4RK5A

Crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound sucrose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
275
structure length
275
Chain Sequence
TGNIGVLVSRVTNPFFAGLFDAIERELHAHGYQVMITQTYDDPEAEERFLKQLKSRELDGVILASVEAPDRVMAVAKAFPGRVVVVNADVQIPGATSLVLPHYQATRDALDYLFNQGHRRFAYVSGGTISGAHHGQSRTQAFLDFMQAHQLLVAQDLLFGQIHTAKEGQAVGKQLASLAPNVRPDAVFTNSDEVAVGVIDSLLAADVKVPDDIAVMGYDDQPFAPFAKIPLTTVHQPVASMAAAATHELLKGLGRQVAQDTQPTLHLSLKIRQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of LacI Transcriptional Regulator Lsei_2103 from Lactobacillus casei, Target EFI-512911
rcsb
source organism Lactobacillus casei atcc 334
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LacI family
total genus 93
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk5A01
1Z18A 1CEYA 4OBBA 3EGCA 1TVMA 4P98A 3O1HB 1P6QA 2FVYA 4YWHA 3CU5A 4N0QA 1J56A 3FDFA 4DADA 5JNUA 2CD7A 5CNMA 1ZAYA 4E7OA 1JYEA 2AYXA 3H5WA 5IC5A 4CBVA 4MS4B 3H5VA 5KI6A 1BVHA 3C3WA 3O74A 1LK0A 4MQEA 3CS3A 3JS5A 1KGSA 2J48A 3CZ5A 4Z4FA 3G1WA 3RVQA 4MR8A 2PUDA 4QICA 3QEMA 1JF8A 5T3YA 2FEWB 5IUJC 4MR7B 1LBIA 3RVNA 3C3KA 5JNRA 3HUUA 1BA2A 1DRJA 1XHEA 2IKSA 2FEPA 3N8IA 3O2QB 4RU1A 3EQZA 1BDHA 2PUCA 4YR7A 3MQ4A 1H9CA 3SQNA 5IX8A 1PUXA 2A9OA 4MR9A 3H6GA 2M1ZA 3K4HA 5JNVA 1VPWA 4HNSA 2LUOA 2FQXA 2VUIB 4MRMA 1JHZA 5IBQA 4Z0NA 3UUGA 4H60A 4EYKA 3IDOA 1FFSA 1DCFA 1QKKA 2M98A 4W5RA 1AB6A 1L5YA 2JB9A 3IPAA 3NNDA 2H3HA 4RXMA 4EGSA 5KWSA 4Z99A 4KNYA 1QNLA 3O2SB 1ISSA 3CG4A 5FWXB 4YP9A 3MYYA 1RNLA 3GBVA 3OO0A 4WXMA 4OATA 4N47A 3SY8A 3SNKA 1DJMA 2VYCA 2RGYA 4NICA 8ABPA 2PUGA 4JB2A 4YRZA 3FFXA 3KTOA 5KC8A 5IEJA 1ZDMA 3OO1A 4G0QA 4G86A 3K9CA 3CHYA 1NTRA 4RK7A 3DZDA 1C4WA 1GLGA 3Q41A 4PE5B 3L49A 4MGEA 1DC7A 1USGA 3IP6A 5EWLB 3QLTA 1ZESA 3GWGA 3QELB 3RVKA 5IULC 2WJWA 3JPWA 4Z4HA 4XFKA 1R8JA 4MPTA 4MQFA 2FKAA 3Q9SA 4Z9BA 4TLLB 1E6MA 3BRSA 3DGFC 4NCAA 3LKBA 2IPMA 3EODA 1QPZA 5FWYB 4WXEA 3RVLA 3QEMB 2IYNA 1EWKA 3BRQA 4KPYA 4ZMRA 2FN8A 4RSMA 2E4UA 4W5NA 2JCGA 3JY6A 3OLVA 1URPA 3OLXA 3QX8A 3QLVC 3KLOA 1P2FA 2ZAYA 2PL1A 1FSPA 5KQLA 2ZWMA 1FFWA 1A0OA 3C6QA 5HKOA 1JX6A 5BRAA 3DBIA 3KLNA 1A04A 4EVRA 3JVDA 3GRCA 4TLMB 4KQCA 3JTEA 2MYNA 3RVOA 2YHBA 1M5UA 2IPLA 3LFTA 1E2BA 3CZCA 3I5AA 1LJUA 2QW1A 2FN9A 3OMXA 2R25B 4HNRA 2FW0A 4RK1A 2HQOA 3RVRA 1XHFA 1Z17A 5EWJA 4WT7A 2V0NA 1E6LA 4LZLA 2MSKA 4OG2A 1VLZA 2GWRA 4YGXB 1U8TA 2E4VA 3I09A 5TQJA 1USIA 2PE5A 5JNSA 2QZJA 3KYJB 4RY9A 1Z13A 5DGCA 1NATA 3D8UA 3IP7A 4RS3A 3RVPA 3H5TA 4DQDA 1JH9A 5TPZA 4LE2A 4XAQA 3OLWA 3F73A 4F3TA 5JS1A 4JOQA 4KK4A 5KQMA 4B09A 1ZGZA 2QSJA 4ETNA 4QPJC 2WB4A 1ZH2A 2H0AA 3KG2A 5FBKA 1JFVA 1YK1A 4LE0A 5E3JA 3H1EA 5TQ2B 3GBPA 1Y1LA 5C5CA 1YS7A 3OQOA 2NZVG 1LBHA 2QR3A 3LUCA 1ZH4A 1JL3A 2R4QA 3H1FA 3F6CA 4G0PA 3O1JC 3EULA 1Z12A 2X7XA 3ILHA 2QVCA 3MMNA 3CTPA 4RK0A 4RKRA 3HV2A 4EY3A 1QMPA 3KKEA 2PL9A 1U0SY 2Q5CA 3MM4A 4RXUA 5CHYA 2L18A 1QQAA 4S05A 4KRFA 2IPNA 1MB0A 2FXIA 3H5LA 2GBPA 3FGZA 4MR8B 2JBAA 2JVIA 3EAFA 4FE4A 3HM9A 1PEYA 4Q7EA 3KCNA 4IMJB 2MYPA 1UDRA 1DBWA 2HJ9A 2RJOA 2FLWA 3B2NA 3Q15C 3TO5A 2GX6A 4MS4A 4QYMA 2ID7A 1EWTA 3N75A 3CKMA 3KS9A 3TD9A 5BRJA 2FMIA 2JVJA 1IIBA 4EYGA 1JYFA 3H6HA 2PKXA 1RZRD 4Q6BA 3UK0A 4W5OA 2WY2D 1JWLA 1Z2DA 2WMYA 4RXTA 4P1ZA 1RPJA 4RKQA 3HVRA 1QP4A 1Z16A 4MQEB 5KC9A 1JDNA 4KFCA 2F8SA 1W9HA 3HDGA 5ED4A 3I42A 4ETMA 4JP1A 3HZHA 4GPAA 1QO0A 5JNTA 4OLBA 4DN6A 2YHAA 1EHCA 3NHZA 3SM9A 4N0PA 4W5TA 3HDVA 1RZRA 5IUKC 2O20A 3F7NA 1TLFA 2E4WA 2WWVD 4RK6A 3MA0A 1YMUA 4LRQA 2VK2A 3M9WA 2MSLA 1L5ZA 3KYIB 3N53A 4G0XA 3H5IA 3C97A 4XASA 4Z4EA 4MS1A 3FFWA 2N9UA 2WJAA 2IPAB 3CRNA 1Z25A 2FSPA 5F64A 5CNIA 4MAAA 1B00A 3A10A 1T34A 1GCAA 2B4AA 1RXIA 2OQRA 3EQ2A 3IP9A 3N6VA 4MS3A 4RZSA 5TQ0A 2NT3A 1F51E 3HK2A 2JK1A 4EUKA 2NUBA 3L6UA 1MB3A 2TMYA 2VUHB 2LBPA 3H1GA 3LUFA 4OLAA 1M2EA 5TE9A 3OM0A 3Q7RA 1TM2A 2LPMA 4ZMSA 4LDZA 1SXHA 3NBMA 1DZ3A 1ZY2A 4RWEA 1WETA 3MIZA 4W5QA 5EWMB 3QLUA 2NT4A 4O1IA 1SXGA 1FFGA 1SD5A 1NXSA 3GYBA 3E3MA 2FMFA 5HM6A 1ZITA 3JPYA 5KQPA 4ZPJA 3KSMA 3NNNA 4IF4A 2HPHA 4JASB 1D5WA 5CNJA 4WWHA 1TJYA 3LUJA 3O2JA 4G0OA 1YMVA 1OXKB 3N0XA 1RXEA 1MAVA 3TMYA 1YK0A 2WRZA 5TQ2A 3LTEA 1F4VA 1M5TA 3NNSA 2JRLA 4XLTA 3MF4A 4EYOA 1DCKA 4F12A 2MYTA 2L17A 5B3JC 1SRRA 3OLZA 3HUTA 1W25A 3QEKA 4OTZA 3CLKA 5DLEA 2FLKA 4PICA 2DRIA 1MIHA 3FMVA 3GT7A 4TMYA 4NCBA 1C0EA 4IRXA 1U2PA 2QV0A 4Q6WA 1MVOA 4MR9B 5BR1A 1JFTA 2FMKA 7ABPA 5IEBA 6ABPA 3ROTA 4ZJPA 1P8AA 3RQIA 4XARA 4H3KB 3BBLA 1I3CA 5EWJB 4ETIA 2B1JA 1ABEA 4LDAA 3BILA 5IUNC 4N03A 2HQBA 3EDCA 4YLEA 3LUHA 2RJNA 5PNTA 4WZZA 4ZYLA 1NXXA 1S8NA 1Z2EA 3RH0A 3E61A 1USKA 1KRXA 5EWLA 2JBAB 3OQNA 1DCMA 4FE7A 2LP4Y 2OENG 1NY5A 4Z4GA 2E4XA 4EVQA 2HSGA 3Q7SA 5TPWA 3H75A 3ILYA 4M88A 3LMKA 4YCSA 4Y9TA 3LUKA 2L19A 1EAYA 3DGEC 3QK7A 3QLVA 4O1HA 5TPWB 1VRVA 2W42A 2IOYA 3IPCA 2KYRA 3LUGA 4KZKA 4KMRA 5BQ3A 1SXIA 4YO7A 1EWVA 1JBEA 3T6KA 1LJLA 3GV0A 2L2QA 1YS6A 1ZN2A 3DLBA 4G0YA 5DCLA 1QQBA 3T38A 1ZVVA 3GL9A 4D6XA 2AYZA 3HCWA 1DG9A 1U04A 2PJUA 3OQMA 3CFYA 2FEKA 2QU7A 3EJWA 3IP5A 4IMIB 3C3MA 6CHYA 3O21A 4H3HB 5JNWA 3N0RA 1PHRA 2NZUG 4IGAA 4MR7A 3T8YA 3UKJA 3LOPA 4MLDA 1D2AA 4KREA 1QO0D 1YTUA 4KQ9A 5FBHA 5KQGA 3ROFA 1HEYA 4MQFB 2PLNA 3S99A 2FQWA 3HS3A 4PEVA 4MYRA 2RDMA 1KRWA 3SAJA 2PUEA 3QLUC 3N0WA 3OLYA 2E4ZA 4G0MA 1EFAA 5DKFA 4JA2A 3KHTA 4TN5A 4F06A 4ML3A 1QP0A 3P9YA 4D74A 1U2QA 1GCGA 5C5EA 1BAPA 5CNKA 3H5OA 5ABPA 1JLKA 4XXHA 1CHNA 1A2OA 4RDCA 5GOTA 4RY0A 4RV5A 2LIVA 3JVIA 4IILA 5FWXA 1YIOA 2E4YA 1K66A 1PNTA 1DC8A 2R48A 2CWDA 1PEAA 3O75A 5D2CA 4E7PA 4FB4A 3NHMA 1NXWA 4Z4CA 3HXMA 3HO1A 3HEBA 1OXBB 2ID9A 3HSYA 3M9XA 1JFSA 4N76A 4MRMB 4NQRA 2A9PA 2MSWA 2JVKA 5TQ0B 4LE1A 4EYQA 1K68A 4G97A 3F6PA 3CG0A 1FQWA 3BREA 5JS2A 2R47A 3M6MD 1YVUA 2PUAA 1ZGGA 3T95A 5I4CA 3TB6A 1NXPA 1E6KA 3D02A 1Z26A 2A9QA 2I6FA 4HYEA 4LX8A 4RK5A 1D4ZA 1BDJA 1DP4A 3LUDA 4KK3A 3TX6A 4JAVC 4NV3A 9ABPA 2P9HA 3R0JA 5GQSA 2FMHA 4L85A 1VKRA 1CYEA 3HJFA 4UHKA 5EWMA 4YS6A 5HQJA 4Z9AA 3A0UA 4G0ZA 3A3KA 2XDYA 2PUBA 1DBQA 3I45A 3RVJA 2BGGA 1BDIA 5T7BA 2QXYA 2PAFA 4QYWA 1PNRA 3Q7TA 5HSGA 2CHFA 3RVSA 4L4UA 3W9SA 2FTKE 4O5AA 2QVGA 4F11A 3LUAA 5TPZD 3RVMA 2MYUA 3URMA 4F8JA 4YV7A 3GA5A 5FWYA 4Z4IA 4UHJA 3SG0A 4MS1B 2FQYA 4JB0A 1P6UA 1NXOA 1Z15A 1ZHHA 2GI4A 2PMCA 3G85A 1DRKA 5B3JA 4PYRA 4HNQA 5DTEA 1NXTA 3QELA 4MLCA 1ISRA 4PZ0A 4WUTA 1ABFA 2A9RA 3FFTA 3A0RB 3O1IC 3DLHA 4S04A 1KMIY 3LKVA 1GUDA 2GKGA 2IDMA 2HQRA 1JDPA 2CHEA 4RY8A 3VNBA 1GUBA 1APBA 1QP7A 4D6YA 1NXVA 3KJXA 3VNAA 3OM1A 4KV7A 4EVSA 4N41A 1D1PA 4GNRA 4RK4A 2F8TA 1TMYA 1D1QA 3OMWA 1AB5A 1DBPA 1M2FA 3CNBA 2P4UA 2PUFA 4KVFA 1XWWA 3QX9A 4MS3B
chains in the Genus database with same CATH superfamily
5DSZA 4FZJA 1WXGA 3F6BX 1CK4A 5KPJA 1GA6A 2CBXA 2KI5A 2X1HA 3IEPA 5EGNA 3OETA 5JXWA 4JUCA 4DADA 2AJTA 5JNUA 2VHYA 2G28A 3FNBA 3PL1A 3JASA 3N3BC 1T5SA 3PHGA 3W05A 1ZRMA 3GAMA 1CJVC 4F9FA 2YJTD 3ESAA 5BR7A 3KT0A 5EG5A 1EE2A 2PXAA 4JENA 4TXJA 5GJVC 1OASA 2HL6A 3E27A 3H5VA 3DTVA 2WM3A 3QXJA 1QF7A 2VPTA 3JS5A 5C8YA 2ZPAA 3H0CA 1EDEA 1FDUA 1IOZA 3FSRA 1DV2A 2HSZA 1LV8A 1D2NA 1O5IA 1JF8A 3JD4A 5TEWA 3S2FA 2YYZA 3BN3A 3ZV3A 4Z54A 1XZDA 3J7AC 1GTZA 3E8MA 3CJRA 5A2QA 3A4TA 1KSHA 1UXJA 1AV7A 1L8LA 1DAGA 1SCJA 1QAMA 4NZNA 4L15A 4X45A 4C3ZA 2FN3A 2GZ1A 2XHEA 4ZOBA 4EB6A 2VP0A 1T5HX 2FE4A 4PPYA 2HIHA 5EPOA 1WX1A 4MRMA 3R4VA 4ZRNA 5HKKA 1FB5A 2ZRNA 3LH5A 1X9HA 3N7TA 4JL6A 4K6FA 1RLUA 1IZ9A 4XYBA 2OZLB 3I64A 1RAGA 4BQSA 3EVFA 3MFYA 4QRDA 5LCXA 5KSOA 3K0CA 3O0TA 3QF7A 5C46F 5JD4A 5KWSA 3CLHA 3Q12A 1ITZA 3OBBA 3S1SA 3Q11A 1SNYA 4NAVA 1AURA 2MJLA 4C88A 2BH2A 2Q8QA 3EHDA 3TVTA 1MZVA 3ZE8A 1PO7A 2OBMA 2PUJA 3EGWA 1RRGA 5BQPA 5K9ZA 2P78A 1VA4A 1C50A 2R2GA 2R5FA 3I0ZA 1DAPA 1R6UA 1QRUA 3AERB 4UFOA 5HIMA 5AJWA 4J8PA 3AI2A 1K6IA 2QGFA 3C4VA 1T0UA 1P77A 1YJQA 3MERA 1DAHA 2BFEB 1FYWA 2AR7A 1VPLA 2ZOSA 4ZA2A 2XSZD 2EZUA 1BX0A 2FZ5A 5G1NA 2CNNA 3KPWA 1WDTA 4RK7A 1OWPA 5DBHX 2XNJA 1VJDA 3DZ8A 4PE5B 1G7TA 1NUTA 1ZOPA 4JZKA 4UOZA 1SVOA 1USGA 4OUDA 4RADA 1ZESA 2J9RA 4CPDA 2OHXA 2GD1O 4ILKA 1P18A 4ZYWA 4H3VA 3SCZA 5AQ1A 1AF7A 1TEHA 1A82A 4NJEB 4EY6A 4IGKA 2KLBA 3LDHA 2CDAA 3UOWA 2DBZA 1OIXA 4BBAA 1E0AA 4M2LA 4DLLA 4M99A 1T4CB 1V45E 3EQ6A 3DHVA 4HP8A 3SSAA 4ZTBA 5JCOA 5K8VA 3U3MA 3KLOA 4IQFA 1J1UA 4KYTA 1NSFA 3BICA 1XXHE 4B3RB 2E89A 2W9XA 1W581 3N8HA 1J22A 2A7XA 1XZCA 3KLNA 1UEIA 1Y7IA 1Z9BA 2OTCA 2O23A 3HN2A 2WWGA 3STWA 1LPOA 5ICCA 3LX5A 4D6PA 1C9JA 3D6AA 1DX6A 3JTEA 4EZBA 3CA8A 1E7YA 2H1WA 2J09A 3DL0A 3P45A 4YXWD 5A5GA 4DB2A 4BVHA 2IPLA 1RJEA 2K2WA 2P3SA 3I5AA 3FTDA 4NG4A 1LDGA 1REQA 5AVRA 2FW1A 1DIBA 1LFAA 2FKNA 2H65A 1I2DA 1O7JA 4WT7A 3FDIA 3V1YA 1ECBA 1AOXA 1YDHA 2JIBA 4B17A 3ICVA 1MQSA 4B80A 3FUTA 2BFFB 3UBMA 3R23A 3NTOA 5KHAA 2C9CA 2PJZA 4G5HA 1GTG1 1J42A 1P1IA 1GSIA 1VP3A 1NUHA 2CB9A 2YL2A 2D3TA 4L9WA 5CG1A 4BRSA 1HETA 1T2VA 4GM0A 4TMWA 3RTCA 3RF6A 2ZYWX 3EUFA 2XODA 4X61A 1V16B 1SJ9A 2ZREA 2WD7A 4PO9A 1QFJA 1BYUA 5FBKA 1QQ5A 4Q24A 3SKYA 4BC0A 2NZVG 4IIGA 1LBHA 5B1DA 1PJ2A 2GD2A 2Q45A 3DONA 4D43A 2MR6A 4P83A 5JC8A 2JFOA 1L4EA 3PNKA 1KP9A 1Z12A 3WGJA 5CB4F 1YB6A 2XCQA 4MCAA 2JLVA 3WOVA 2XIQA 2X15A 4MRSA 1LX6A 5AK4A 3SR0A 1I33A 4CTJA 3BXPA 4KR3A 1E1QD 4IRMA 4PX5A 1AZSC 3T9EA 2FXVA 3ZQ6A 1T6ZA 1MB0A 3UK7A 3QEJA 1ULHA 4RESA 1RHMA 4I2VA 4RVCA 4AKEA 4O2AA 4ZZ0A 1A9XB 1UDRA 3UF0A 3ZZ0A 5KDLA 1Q1QA 5JXJA 4BNWA 1CJUC 2YWDA 4BN5A 3AHCA 1GHTA 4QYMA 4QLAA 4F8EA 1OOEA 1TZKA 2CUNA 3N75A 4I9GA 1Y48E 4BAUA 4GI3A 3OCZA 1DS6A 2W2OA 4QG7A 1OH6A 1O0CA 5HZHA 1ORVA 2NV2B 3HJCA 3EPPA 4OI4A 1E2KA 2D59A 3H6HA 2JPDA 1Y5MA 3OM9A 3S0JA 1FP2A 3B9BA 4EABA 1ZKMA 1UKZA 2G63A 3L0OA 3NIDB 4C05A 2IZ0A 2VXBA 5FB3A 4C6HA 3ZVMA 1Q44A 2O5RA 3UMBA 4BWFB 2A57A 5AW9A 1DQSA 4A8JB 4RGVA 3KAJA 3AX6A 1DEKA 1N0IA 1UZUA 1II9A 2JFUA 3MUEA 3GEDA 4E3ZA 4HB0A 3V42A 3TZBA 1QFSA 2W37A 5BV0A 3GB9A 4BFCA 1ORDA 1O9BA 2EG9A 3PNOA 4KN5A 2YHAA 3FUVA 4HQOA 4Q1CA 1WOYA 3USCS 2X7JA 4W5TA 3D0KA 4L8LA 3A25A 3QBDA 5CM8B 1RXSA 3CEMA 1PFGA 1X3LA 3WLTA 3ZV5A 4GE0A 5E1MA 4RYLA 4O2AB 2CVQA 4OQDA 5JUWA 1L5ZA 5CP8A 4DCJA 3FGNA 2FWMX 4HYTA 3KDAA 4ZVKA 4FMPA 2VBFA 2RKOA 3QHPA 3LC7O 3QVKA 2C94A 5HIIA 4ARIA 1Z25A 5SZKB 3FHJA 3BH6A 3C98A 4O0MA 3SEAA 2IYRA 2PZGA 4JBGA 5F64A 1M2VA 3HVHA 2GCIA 4NEQA 4ZYXA 3C43A 3NHPA 1RXIA 5AM1A 1TT5B 3T99A 2VPPA 2RGCA 2HHLA 4BPBA 4OI0A 2V3CC 4HI0E 2YVUA 2X9NA 3CKLA 1BX1A 3JQFA 4QBGB 4RD2A 4ZQBA 1P2UA 5CYGA 5JRZA 5KYKA 4OMDA 3H87A 2JGNA 1Q7GA 1JIQA 2C0QA 2QP3A 3I2GA 4LHXA 4BVAA 4C6TA 3HKDB 3AUSA 2KSQA 2BPOA 4RH1A 4WJZA 4YREA 2J0SA 4S0XA 2XOEA 3GN2A 3T5TA 2DQYA 3HU1A 3CYFA 5EUBA 1O08A 3D7MA 2FEXA 2ZWPA 2YFQA 4OXIA 5KYVA 3P9SA 3SYLA 3NBMA 4ZO8A 2EXXA 2RGWA 3T06B 3M6XA 3LBHA 2IDKA 2JNWA 3HH8A 3AW8A 3RSSA 1DJLA 2QN9A 3QKIA 3JPYA 3K2QA 3BGDA 3G5LA 4RF5A 2YHIB 4ZPJA 4D8UA 3W1VA 4YXFA 1QJCA 2CVOA 5E38A 1J7JA 3OM8A 1N2XA 5EESA 4C4XA 4BS9A 1GZ3A 1AGXA 2RG1A 2XYPA 5KSZA 5AR1A 4RC9A 3RLIA 5BRNA 3GJ0A 3EOZA 4D4HA 2P6NA 1SCDA 4QUHA 1CIVA 1E0KA 4JI2B 2MWMA 4UZFA 4FMDB 1VKNA 3KFXA 4H1HA 5BW5A 2DHDA 4HPJB 2IW3A 4KIGA 4I4TB 1VYHA 3E1SA 1ZN9A 4W9NC 2WZCA 1SKQA 3KU1A 3FPFA 3W5UA 2VRCA 2Y0DA 3VR1A 2DPLA 5KTMA 1SBCA 1M2WA 1UEJA 4CF3A 3T1HB 3WMRA 3LRTA 4J4TA 5B1YA 1UAGA 4JSYA 2C83A 3B13B 3OLCX 3WLMA 2PA3A 3JAKA 3Q8WA 3LJKA 3PBKA 1M1ZA 5DHAA 4ZJPA 1PN3A 5KHLB 2KPOA 1TUBB 4S12A 3W9UA 5LOVF 2B37A 5FEUA 5JU6A 1L4HA 2ZJ0A 3HN7A 4N03A 4FHCA 3OICA 2R8XA 4TVSA 4G0VA 1C0KA 3AL0C 5CIYA 4NYIR 5BMVA 5JH7F 5IAOA 4GBED 1UEXC 3U6BA 2V54A 4OXYA 2WF9A 2AIRA 2BGWA 3GMIA 4J7XA 2OD7A 1DCMA 3W90A 4EY5A 4OL9A 1BS9A 3SYTA 3FPEA 1Y6GA 5LQUA 1EFDN 1G8MA 2LWIA 1WY5A 3TOVA 1Y3CE 2G7ZA 1Q50A 1HQDA 5CPFA 3V3KA 4LOAA 2HDNB 4JJZA 4FUTA 1VCMA 3ENKA 3M82A 3F5MA 4TYNA 3RFFA 3L8YA 1N6IA 4YQEA 4BNYA 4DNOA 1FUUA 4JI3B 4AS2A 2ZI6A 2G4VA 5F1OA 3VKVA 4MWDA 4X60A 3V2HA 3YASA 1TZ2A 3ZZ1A 5JYCA 1AM4D 1ONPA 1LRKA 4IXWA 3U5ZB 2YBEA 1TZJA 4RA9A 3W5IA 1UK9A 2PZMA 3LPDA 4C14A 3HB4X 1KK0A 1SXIA 3B8HA 3HZRA 3S3TA 2NO9A 1P9RA 5B5SA 3AF2A 4O02B 2QDXA 3L7AA 1VBNA 3NOXA 4R1OA 3CSSA 1IBCA 1N2GA 2RB4A 5FEMA 4OHWA 5FOXA 4RM2A 2Z58A 1JR4A 2QG4A 4Y2XA 3L7LA 5JS7A 5J5VA 4FDVA 1NFFA 3W5JA 2WFZA 3EJWA 1Y1RA 1N5IA 2NZXA 3LFUA 4IMIB 4MUAA 2VJKA 4LV5B 3TG2A 3CRZA 4PSVA 3FJOA 3VI4B 5L4LA 4W9NA 2VYQA 3ADKA 4KQWA 3QE9Y 3D4BA 5L3ZA 4QXQA 1NJ6A 1XVAA 5BW6B 4BNKA 3OSZA 2OVFA 3DEIA 2E3JA 4X7PA 4XA8A 2ZAMA 3VTFA 2O06A 3K1TA 3VOAA 3DMGA 4XIFA 4KQ9A 4FCVA 1BH2A 1D1TA 3REFA 4DQKA 3EY4A 1HEYA 2YIVX 1S2IA 5B53A 4DUYB 5AW3A 3THYA 2N46A 2GSWA 1JQEA 1F2UA 4BV2A 4IZHA 2NUAB 1KRWA 4MUBA 1IE3A 1WVIA 3U1VA 1FYVA 2RGEA 1IM2A 2ODPA 3KZMA 5T41A 1T24A 1GPNA 2C57A 4AY2A 3CIFA 2EFJA 5TMEA 1RJFA 1I6MA 5BPHA 4PG4A 5DYIA 5KOIA 2EGHA 4FT2A 4HATA 4BB6A 3B82A 1TEVA 1BE8A 1WUKS 4V0NA 2EWVA 5CVJA 1JLKA 4K88A 4Q7QA 1ODSA 2B5WA 4EJSC 4XXHA 3UQZA 3ZWNA 4UTNA 1Z6ZA 2A5JA 2UYGA 1LXCA 4BTVA 2QN7A 1QYRA 1LH0A 1UKEA 2J32A 5IN5A 2H57A 3KT3A 4B7CA 5L45A 1YIOA 4ZOCA 3X1JA 1XVIA 3K5WA 2FG7C 1AO3A 1OY1A 1JE0A 1UWLA 2CWDA 4KE8A 1BKYA 2D7JA 1NXWA 2XB2A 2HDOA 3V4LA 1NVTA 4DMKA 4HC4A 3T7TA 1UPFA 4YJ2F 1L7BA 2HF2A 4DR7B 3L7JA 1F3LA 3E7WA 3VVBA 4NOLA 2O8FA 2PZFA 2ONJA 4GZ3A 4LWPA 3FMGA 1AK1A 2AZXA 1JA0A 1XZGA 2AC4A 1E1CA 1OSNA 2VSYA 3QHAA 2FWIA 4GL4A 4M8SA 1FPMA 4MNTA 4PU0A 5E2AA 4J0JA 3REOA 4EW6A 5EN4A 1C81A 3N0TA 5AHWA 2RIRA 3RJZA 1XZKA 2J9XB 3EB9A 4X91A 2A9QA 5EFOA 1NVDA 4BEJA 5B6IA 1ZVKA 4L57A 2Z6AA 3V7FA 1Y3FE 2A0XA 2CEKA 5J1TB 5JCJA 5EMLA 3U3OA 4CCWA 3ZE0B 2W6NA 5CCXA 1NI4B 5GQSA 4AW9A 1QYVA 1O4WA 3JQ7B 1T1IA 4D3ZA 2K87A 4GYYA 4RJ2A 4BNXA 3GU3A 1X1TA 1W29A 3BSSA 4EPYA 2TMKA 3ZDRA 4EENA 5A02A 5JDCA 3OZUA 4Y2SA 2L69A 3DNMA 3L84A 4QNRA 1RRCA 4V39A 5DHQA 4YHHB 3FTCA 3JSAA 3IP8A 1ECCA 2VAWA 1NDHA 2GVZC 4HDCA 4J3FA 4Y1FA 5HF8A 1KKUA 2OUIA 4Q93A 2IEGA 4YFYA 3EVTA 4F11A 1YA6A 4L8YA 4X62B 5DJ5A 2JIZA 4C06A 1P7WA 3GD7A 2GRUA 4NH4A 3ZV6A 5TPZD 1JAHA 1CUBA 2VZ9A 1SIUA 1E4EA 2B78A 3DKRA 5EY5B 2PO5A 2AFHA 3HMKA 4GPTA 2FQQA 2AOVA 4L0CA 2HPVA 1T36B 1UXOA 2YV3A 4IXDA 4UHJA 3RFVA 1ENZA 2O2JA 3ZD8A 5HVNA 2ORIA 3T1NA 3HHEA 4ZQHA 2XGOA 1OFGA 5FADA 3TR5A 1PT9A 2AZMA 4CM9D 2NU6A 2E1RA 1Y8RB 4M0FA 4PN3A 2IXEA 3WIOA 1WDKA 5IJAA 3BIOA 3N3AC 1MJNA 4Z7OB 1FP1D 4FXOA 5JVDA 3DHWC 5JTUA 2ADMA 2JCVA 1G60A 1QH1A 2B8NA 1JKJB 2ZEJA 3FW1A 1P2TA 3HADA 5IW8A 4GD3Q 1EK1A 2BFFA 1V6CA 2FFAA 1LSUA 2ZR8A 3V7WA 3N2GB 4AJ4A 5T6BA 1B26A 3GUVA 4EVSA 2XMSA 1RVV1 1FUKA 3EZ7A 5DTQA 3IS3A 3Q8KA 2VH5R 4ZP1A 3WWEA 1PNVA 4CMJA 3UEOA 5HR5A 3F8WA 1UMBB 2BL4A 1VFPA 2Q7OE 1KDTA 3V9PA 1QIGA 1W36D 3KFLA 1CPYA 2WT9A 5F5LA 4V38A 1QRAA 3QX9A 3NZEA 4OHFA 1ZIXA 2ZQ5A 4YJ2A 2F6RA 1BN7A 2X0NA 3CWZA 2ZBUA 5HK8A 3VM6A 2C0CA 3C3BA 2QRHA 4AJLA 1DKOA 2Y2VA 4BNZA 1KK1A 3U44A 3G0HA 1RI4A 2CXSA 4KFUA 1XMPA 3HCEA 2HMYB 1QHGA 3HU2A 1OWOA 1IZ0A 2XGSA 1CR1A 1XELA 1EZZA 2XNHA 3K20A 1JPJA 3Q0IA 4TGLA 1S01A 3RE1A 4ARUA 2UVPA 3VC3A 1U8UA 1B73A 3CPJB 3GC6A 4RVDA 1LD3A 4QTZA 3T7CA 5JLAA 3NBFA 5C4MA 5JASA 3BL6A 3KZXA 4J03A 4Z4FA 2G1KA 4L16A 5ALYA 1C4OA 1EBUA 2HWUA 4BJ6A 3NDPA 5LQDA 1AKUA 1S2DA 1JILA 2AVNA 1X70A 4XIJA 5DCUA 3X1YA 4G84A 3DMRA 3ZXYA 5BT9A 1GL9B 4HDQB 4FI3C 1VECA 2J0UB 2J5RA 2VLIA 2A0KA 2BAGA 3AHIA 3MWLA 3NCHA 2X8JA 3EXG2 4HDRB 2WWWA 3OC0A 4A8JA 2QY6A 1JHYA 2XUAA 2F2TA 2F00A 3CVUA 2ACKA 2FRDA 2O2EA 2ORED 1ETUA 1RKXA 2A7QA 2UAGA 4TQUS 5FIUA 1FDIA 1XQ1A 4JQSA 3NNDA 1QVAA 2DLNA 1YL7A 4IH1A 2L0XA 3PUIA 3MYYA 4XDYA 3GBVA 1ZD5A 2BMFA 3GFOA 4MJ3A 4AJ9A 1LSJA 2P5UA 1Z7YA 3IESA 4CM8B 5ICGA 5IN4A 5G02A 2G0AA 4QPNA 4FGKA 5DBIA 4RHTA 3FKJA 4TROA 3TUJC 4EGJA 2QSYA 4TYYA 3Q72A 4MW2A 4MW9A 3OJOA 4HRAA 4P7KA 1UBSB 4HH3C 3X43A 1EGMB 3HUDA 2JLXA 3U0VA 3KTOA 3C3DA 3HVIA 1NULA 3STXA 2IQIA 1K8XB 2Y99A 3O03A 3ZKAA 3HXQA 4H7JA 5EMHA 4KQ6A 1KI6A 2ZB2A 4J1NA 5F2KA 2OCPA 3GGJA 3OECA 4ZVUA 4JELA 4MHSA 2AEFA 4ZT3A 3RVKA 5IULC 1EEXB 1U9CA 1TJ3A 1YXMA 4FYXA 1Z4OA 5H9VA 4IDNA 2DCUA 1E5QA 1UZLA 4JJ7A 4KKXB 4N0MA 3BRSA 4YNBA 3B85A 5I7SA 4Z9FA 2OPBA 1M67A 3L01A 3E70C 4TKUB 3ASYA 2FB9A 2E6KA 4LHZA 1PWZA 2CBZA 4P5PA 3TLMA 1Y98A 3EOBI 4ZMRA 2WKSA 1FEZA 4DEYA 1E9CA 3MQFA 4XSVA 1VJTA 1IMOA 2HU5A 4KVAA 3PUZA 1CUZA 2QYTA 2X8BA 3FM9A 3S4YA 4AP6A 2WZDA 1SEPA 4HBGA 3M6LA 1N2CE 4QJ4A 3BTOA 4PGFA 3CEAA 5K3CA 1EGVB 1L1EA 1OBCA 1FSPA 2YOGA 1SAYA 1JX6A 1SBQA 3IAFA 4PLHA 3SEQA 3W6UA 1JR3A 1JHQA 5ITVA 5KJ1A 1YWGO 3M2TA 6REQA 3JVDA 3IQFA 1MGOA 1TYBE 1R0WA 4M8KA 3QPWA 4MV1A 1NUPA 2ZJ2A 3NGMA 3THRA 3QU7A 2DFPA 4QC2A 2WU8A 2ZVDA 1N3LA 3LFTA 3RU7A 3VAZA 4CLRB 5HRAA 3BAFA 4RMHA 5REQA 4MUKA 1PNQA 3ZLUA 5KNDA 1E6LA 5DHPA 4I81A 1QIEA 2O1XA 2ZM6B 3Q3EA 4H1UA 5LB4A 5CA1A 4TMZA 2IV7A 3T7AA 5REQB 5BR4A 4QBFA 5IYZB 1QIDA 3TLEA 3IC5A 1IHPA 4HTAA 1MDFA 4TXLA 1NBAA 5FULA 2OHFA 3RUCA 4W9MC 4DWVA 1OVMA 1T8PA 3LWNA 1R0BA 4I1YA 3KE9A 4E15A 4YCMA 1DWQA 5JS1A 4KK4A 1YR7A 1LRJA 3V8VA 4EA9A 3ZGVA 3BX1A 3FOZA 1Y6QA 1YBAA 4F6RB 5FBVB 5KTRA 5KYUB 4NRDA 1ZH2A 5EJ6A 1HR0B 1N2ZA 3MLEA 3KUDA 3N28A 2I1QA 4NOKA 3ML1A 2DUUA 5D7NA 1RYYA 4WN3A 2VQ3A 1G9SA 4CM6A 2H1HA 3VVCA 4E1BA 1IFXA 3K35A 4QPZA 1ZH4A 4TMVA 2CMDA 1HDGO 3A7EA 3CJQA 1GFWA 3K3PA 1BWRA 2IYOA 2VZLA 2WAOA 1D9ZA 2DUJA 3FIJA 1ZD2P 2JAUA 4HQKA 2JANA 4I1RA 4NE9A 4JI6B 4BFWA 2PL9A 4F4FA 2KS6A 2GKOA 1HSZA 4B3HA 1KI1A 2WWRA 3AR9A 5IM5A 2PWBA 1B6GA 1HA3A 4FDTA 2YV4A 3JX9A 2UUOA 3FYSA 4HS9A 5G41A 1CEEA 4QQRA 3UK1A 1RTKA 1TB4A 4BC1A 3EW9A 2ZYVX 3W34A 2ZBQA 1L7NA 2H5EA 5NULA 1QH8B 1VTKA 4D4JA 1CDOA 3DR5A 3CNQS 1PV2A 2ZYRA 2WYVA 3CKMA 1IBLB 2J45A 1N5MA 5BRJA 1UKCA 2O0HA 2FMIA 4U8GA 1RU3A 3ZTYA 1GQQA 3RYIB 1R6TA 4PIVA 1XZFA 5HKLA 2WFLB 3B1VA 2WI8A 3HB1A 5KU7A 1I5OA 2ZTHA 1VI2A 2R8YA 5TT0A 4B85A 4W5OA 3A3OA 1IUOA 1E1KA 4HB2A 5AXCA 2JLCA 1DWOA 2HPAA 1BROA 3CH7A 2EKDA 4Q66C 4ILEA 1RRMA 2XYHA 4P1ZA 1JAYA 4JZYA 4JLNA 4PRKA 3CINA 4WKNA 3S5JA 5JAMA 2O7QA 3OFKA 4EG0A 4Y8VA 3K0FA 4KJXA 1JDUA 3H2GA 4G1CA 1A5ZA 1R10A 2YZ2A 2VSQA 3GLHE 3VH4A 5EPUA 3UJ6A 3A6EA 5IANA 4L4RA 1FX1A 1P0PA 1KHTA 4JR2A 5L4SA 1WF6A 3UMVA 2W0SA 3B48A 5C31A 2VF4X 1R4MB 5EL0A 2WWVD 1ADJA 4ZVMA 1JIUA 3UHFA 2CYAA 1SUFA 5C1OA 5AW1A 1YMUA 2NWQA 3BD9A 3ZTWA 5F23A 5JECA 4I8XA 4YFVA 3SIWA 4JIGA 2W2KB 4XR9A 4ACBA 2O1WA 4RFVA 4X20A 1H8ED 3OCXA 1XCLA 2Q62A 5A5FA 1Y7LA 4OXRA 3P4UA 4K9OA 3OU2A 4HUQA 4A8JC 2C4UA 3FUXA 2FSPA 1ICIA 4RD6A 5MFZA 5DMXA 4EAAA 5FT9A 1IY0A 2AH5A 2Z5GA 4KU4A 4X41A 3T9AA 3GLFA 2GASA 3EQ2A 3FPSA 4RJTA 3OZDA 2Z43A 4U3JA 3K9QO 4OP1A 2HMTA 3TE7A 5KUTA 3DCNA 2XJ9A 3AOEA 1RJ9B 1JSXA 2NUBA 2YVQA 3DL7A 2AJBA 4TT3D 2ILVA 2BM8A 5DHRA 1RZVA 2Z1DA 3KYCB 4BMNA 1XNRB 3FI9A 4NULA 3W9BA 1PGJA 1MXHA 4FFDA 3UAGA 3MT7A 1BO6A 2LDXA 4WEOA 3VSEA 2O8EA 5TE9A 1EVJA 2V58A 1NPYA 1ZK2A 3P2YA 3ZHVA 4RMJA 2YZ7A 4M98A 2AUTA 3UUEA 4FOTA 1R7RA 3SMVA 2G06A 2C84A 3FKQA 2OBLA 3EFEA 1D4OA 3GNTA 1P44A 4LK3A 4DM4A 1FPQA 1K7FB 1CNFA 2BGMA 5C8VA 1B23P 4R8SA 2ZBEA 4YUYA 4C76A 3O3OB 4W7SA 4HQ6A 3TMYA 5LYJA 4URXR 3GARA 5EA2A 3SHFA 5EUQB 4KYVA 4BB9A 4BO2A 1OB2A 1WSWA 3K32A 1EDZA 1COWA 2IHVA 3IKMB 1A2QA 3L82B 3TRIA 2FUNB 3IEKA 1Q57A 3PFGA 1ECPA 4HD8A 3U4HA 1WJGA 3O90A 4CL3A 2FSGA 3QEKA 2Y1DA 3GZJA 2JDID 5C34B 3PC4A 2EZ8A 1ZI6A 3EEIA 4YR9A 1C2TA 5HMMA 3OQVA 2QQFA 3OURA 3VC2A 1BMFD 4YP5A 4B7UA 3FYUC 4MWSA 2H4JA 4EDFA 1D0SA 1G8JA 1U2PA 4E4RA 1N6RA 4PC7A 3ZWQA 3WHIA 4NC9A 5H16A 6ABPA 1M2VB 4YJGA 4J43A 2PMWB 2HV9A 4OO3A 4ER3A 5MN5A 4R3UC 3BBLA 3KL4A 4GF5A 4N3NA 4NAUA 5I7VA 4LDAA 1XTJA 1SMKA 1FBNA 3GFSA 4FEAA 4Z1MD 2V7BA 3DKVA 1VSUA 3CWCA 2NMVA 3ID6C 2YY7A 3LUBA 4R0NA 5AVWA 5FFMA 4YI5A 4ZYLA 2R1ZA 2OO5C 4QXRA 1M1YA 4K9RA 1SH7A 2J9FB 2X0IA 1W0CA 2BD0A 1OZAA 3H16A 3KZ1E 2AI2A 4YRKA 5IBCA 1M8KA 3HJTA 3TQCA 3OEHA 4EL5A 1EHIA 1DG3A 1R50A 3M33A 2GYUA 5A4FS 2VJAA 3CY6A 1X87A 1YASA 1XGKA 2O50A 2H59A 3GI1A 1RE1A 1T9GR 4OGKA 4UVGA 1V5FA 3V7NA 4B4WA 4YCSA 1K7SN 1DKNA 1U2GA 1VL5A 2GNPA 2I4TA 2RHWA 2YYYA 4N18A 1NR5A 2GCOA 4G1UC 4QQNA 4UEQA 3SU8A 3W8FA 3QK7A 1L1QA 2W48A 3QLVA 4RWZA 1G17A 4KAAA 2AZ4A 1TTPB 2WR8A 4BFTA 3JQBC 2PD3A 4OSEA 3DE0X 3TM5A 2CZCA 2O7NA 4ANFA 4ZGBA 2DR2A 5BQ3A 1DJPA 2V8OA 3HP4A 3VHLB 2R6AA 4AWBA 4F21A 2XLCA 1AK2A 1J9GA 3DE6X 5DFAA 5LPNA 2WPNA 3BE6A 1ZN2A 4DNXA 5LOVB 1DRVA 2XB6A 2JIDA 3AB3A 1ZVVA 4PTZA 5GONA 3JQ6A 2VZ0A 2GYYA 3EXFB 3ODPA 5F21A 2GB4A 2GCPA 3JQ9C 2JGJA 2RAUA 4G5GA 1TAUA 4UNQA 4EGAA 1R18A 4JR0A 1SZCA 3CFYA 2FEKA 1FMJA 4MPPA 1QZTA 4XUCA 3TNYA 2YWBA 1UMDA 2W6MA 2PT7A 1E2QA 4OQQA 3IXLA 2ZLBA 3F5FA 3OWHA 4Y1RA 4YAEA 1N2EA 4CR8A 4CFYA 5DXFA 5TT1A 3HBAA 2Z2JA 4AMZA 3B2QA 4HS4A 2JCBA 1YDGA 2Q6VA 3MUOA 1NM5A 3A3YA 4X1IA 1FNMA 2WUEA 1SQSA 1FTQA 1UDAA 1Z6QA 1WZCA 4PSUA 3MWDA 4OM8A 1CRPA 1U3CA 1G1MA 5KMGB 4OUKX 2C8JA 3HB5X 4E4YA 1KPHA 3N0WA 3OLYA 2YJNA 1LLDA 4GP9A 4XOUA 1EFAA 5DKFA 3BMXA 4EW2A 1DXQA 4G09A 1O89A 4AP5A 5DF1A 1GCGA 1YB1A 2Y1CA 5A7HA 2IIQA 4P92A 4HH0A 3DE4X 1A7JA 2QD5A 5JRJA 3DLHA 2GJ8A 2FCAA 2O0LA 4M36A 4UMVA 1NA5A 3GA7A 5KOYA 3F78A 3QBTA 3HLYA 1H65A 4Q3NA 5A62A 1A8SA 3MCZA 4Q39A 4C7MA 3V6LA 3VPGA 4AWXA 3IERA 2HCBA 4Z4CA 4NKRA 1IL0A 4BL5A 1CS4C 2HLDA 1VDZA 1E1LA 3HEBA 3HJHA 3INNA 1UM8A 1Z47A 3LF1A 2ZIVB 5FJJA 4LRUA 5JH7B 3K70C 3GUCA 2VK8A 1PR2A 2HHHB 2IC5A 3WLQA 1XL1A 4LOJA 1X7ZB 3E35A 3E2PA 2Y1EA 1PR1A 2BIFA 2Q3CA 1QV7A 1XRPA 5EQJB 3WO0A 2H1IA 1GD1O 1LS1A 1GPKA 3CXUA 4O59O 3DT6A 3ZIAA 1NMSA 1THTA 3PWTA 2IU3A 4XYLA 2OO5A 2XVAA 2WSSA 3AUAA 1RZUA 3EDQA 5A9RA 5JPCA 3DM9B 3S7TA 1YOBA 1Q7EA 1BXGA 4FMCB 5KYXA 2OGTA 1CYEA 5F12A 1X77A 1J90A 4I8DA 4W6QA 4Z9AA 4KXMA 2B25A 5ALNA 4PRYA 3B52X 3KUUA 1X7XA 1Y8QB 2XQKA 1FVFA 1C9MA 4EF5A 2IS2A 4PIMA 3IJ5A 3RAPR 5JWHA 1CJKC 4WUVA 3H4VA 1V8BA 3AF6A 2Q0XA 4EKIA 1UPXA 1CY0A 1G2OA 2H18A 2PXHA 4QYWA 3STTA 2BC9A 2FU5C 4WERA 4DKJA 4HOYA 2WHXA 4PZLA 3VKGA 4TSFA 5L6LB 2YYSA 2RGDA 1XWIA 2JI8A 4FSHA 1NQ5A 5FWNA 3PD7A 2V5AA 4GYWA 2W71A 4TTPA 3ZHRA 3KKPA 1QU2A 3DMTA 1KE1A 4E12A 4MS1B 3Q3IA 1TCUA 3BFKA 3ICPA 3NCTA 1ZUWA 3A11A 3IURA 3PQDA 2IZ1A 3G85A 3QW2A 3UUFA 2VJYA 3G2LA 2JIOA 4GPIB 3LP8A 2ZK7A 3IJEB 2J5KA 3I2IA 3IQXA 4JUDX 5DLPA 5BYKA 2CXQA 2OP1A 2H54A 2ZIAA 1UFQA 4OIFA 4PM4A 3RYFB 4HVLA 1IATA 3IIKA 4BV8A 4O8CA 1Q7CA 2IHKA 2HQRA 1NWCA 1VSVA 2D1YA 1GGHA 3RSCA 3D8BA 2HK9A 1RKUA 1NXVA 4DV3B 4Z7NB 3IAAA 3JQDA 4RTJA 4BXOA 1M34B 2G5GX 2XITA 1WVGA 3BT7A 5AVZA 1VDMA 3NS7A 2FR8A 1XNJA 1KJ8A 4ZI7F 1JU3A 2Y1OA 4MQ6A 2GZSA 1ZRHA 2YJ5A 1TK2A 1J0BA 3IIEA 3PC7A 1OFUX 1LQUA 3CNBA 5KCMA 4PG7A 3WJ1A 3WLEA 1RWQA 3B1JA 3FGOA 2EW1A 1N8NA 5JJIA 3OPYI 4RQBA 1CEYA 4OBBA 1J0DA 1OZFA 3LBIA 3MPUA 4OJTA 1UC4B 4CG2A 2HWXA 3GJ4A 1J56A 4HNAA 3ZXXA 5DM0A 4CKWA 1D9XA 1UZMA 4FGWA 2UXBB 4KZPA 1L4GA 2C7BA 2XYQA 3UV3A 4RTPA 3RU2A 2GKSA 1YHYA 1QHHB 1AMNA 1R5JA 5IC5A 2VNJA 1RMTA 3AHGA 4J0QA 3JWIA 3GXBA 3R0XA 4M7PA 3MJTA 5ALXA 5K0EA 1BVHA 3ZLVA 2VUUA 2OV8A 2Q49A 2TYSB 3DJFA 3G1WA 3GQBA 3PXEA 3ZQKA 3SVTA 3B5IA 4PANA 4P6VF 5IUJC 4XW2A 4A2CA 2PYZA 3C3EA 1Z0IA 1UZNA 4OQNA 1H69A 2G9ZA 4IPTA 5GONF 3V8QA 5BOVA 4UOEA 1FXUA 4MYSA 1BE6A 2Q27A 4GUAA 2ZIEA 6Q21A 1HDZA 2FPIB 4BYMA 2X6TA 4MVJG 1COZA 4KGZA 4BZXA 4I8IA 5K0LA 3ZZNA 1EGHA 1JEEA 4UDNA 2GZDA 3HC7A 3OZ7A 2FQXA 1T35A 3R09A 4Q9NA 3VSCA 4Z0HO 1WQ4A 4PSAA 4PNEA 2HMAA 4XGQA 1GL7A 2I33A 1NJ2A 3H13A 2QJWA 4KIWA 2HCJB 4W8GA 4E70A 3JQQA 4H77A 4KR9A 3MGAA 3QTTA 4G5FA 2V9ZA 3WB2A 3WJAA 3ZHUA 2QAIA 2QTTA 3I1YA 3LPCA 3BD7A 5JSUA 2ZZKA 4A8TA 2IHUA 3EUWA 3ACBA 4F8YA 4PLWA 2VYCA 4JVSB 3MW8A 3F7OA 1XAGA 5DT9A 2Z1MA 5BSWA 2OD9A 3AVTA 3T61A 1CRLA 3CN7A 5LQRA 3H0EA 3HLKA 4BASA 1ZDMA 4EZIA 4QUJA 1X38A 1VLVA 4RYDA 1N78A 4RZ2A 3GPLA 2ICAA 2IGBA 4COKA 1Q77A 4IDPA 3IP6A 3BG5A 4B87A 4HRXA 2VPWA 4TXMA 2G88A 3ABIA 2ZUSA 4B83A 1X3SA 3I2KA 1PZNA 3QIAA 3LQKA 3KBOA 1QQTA 4D8VA 2EBFX 3EODA 1PJ3A 4GS5A 2Q8PA 3E5RA 3OKPA 1TIBA 4BRZA 5GZ1A 2XB4A 5IVIA 2Q5HA 3DMYA 4QHYA 2H1CA 3DEHA 4GPZA 3NV9A 2BMJA 3C6MA 5FI3A 4INJA 1GKUB 1OQAA 4I1IA 5FYQA 1U7UA 4DSZA 4GDFA 2C4WA 3GDFA 5IK2A 4FEEA 5I7AA 3K71B 4M1KA 2QD1A 4TV9F 3AW9A 1T1GA 2ERCA 3M81A 2BH9A 1BHO1 4I4CA 5HKOA 4Z3OA 2I9PA 1YO6A 4DQVA 5KYWB 1QGUA 2O2ZA 3ODGA 3PGMA 1OYOA 3C48A 1RCFA 4TL9A 1Z73A 1WMAA 1F8YA 2HC9A 4PYIA 5JMWA 1AN9A 1FC0A 5DU2A 5H59A 1TKAA 1QPGA 2FWPA 4NV0A 2DTEA 4PSKA 4WFQA 5CM9C 4GKKB 1FU7A 4N7MA 3T34A 5IJ0A 4DNQA 1PL7A 4RTNA 1YR8A 3K9NA 4ZO9A 3TRHA 3V2IA 1RM3A 4PNZA 2NW6A 4E5KA 4IHKA 4EHKA 3SC2B 3QPCA 3FVRA 3EN0A 1HXHA 1FSZA 3IMKA 4RS3A 3C15C 3K0HA 4R71A 3OX1A 3HCRA 2FPRA 2AUMA 4OP3A 4WXHA 1ESEA 5I9LA 3D0QA 4JKIA 4QU0A 5BURA 4OQZA 1N7IA 4ZWNA 5INTA 3T7KA 3MWDB 3EQ9A 3VR4D 5K0BA 4PBTA 3V1NA 4C7BA 4PYNA 3DKKA 5KQMA 3TQOA 1DC6A 1H1DA 1VM6A 1I3MA 2QUAA 2WDPA 4B2YA 1J9EA 4LOKA 2I3BA 4KCGA 2QL5A 4B44A 1LC0A 1IM8A 2X9VA 5EC8A 4Z7QB 4AJOA 2OV6A 5FAXA 3TBKA 2XA1A 5EKSA 1BTOA 1Z0UA 3VBCA 3G6WA 3PCRB 4W1SA 4HXEB 4PBSA 5IJZA 3ICWA 2I6UA 1QGOA 3COJA 3L41A 1ZM3A 2FPPB 2KB0A 3FD8A 2J0UA 5CIQA 5LFAA 1I94B 1TFRA 3ILHA 1HDOA 5DGDA 1S2OA 4BFUA 2IS4A 4CKCA 2IOHA 5DB4A 5DLQC 1BU8A 1SUAA 4ZC8A 3ILSA 4H2DA 8ATCA 1MHTA 2L18A 2JFWA 4U2KA 2J3IA 2IYEA 4GC5A 4KX3A 3H5LA 2AFVA 4X7BA 3V1UA 2B5OA 1QJ4A 3T7SA 2GN9A 1GILA 3H86A 4RVSA 5DNDA 3TR6A 4FGSA 5JCOC 4LF6B 3DAYA 5AK3A 3DOFA 1AXEA 3Q2IA 3CEHA 5DNAA 5EJFA 1UMBA 4II3A 2VF7A 2XEDA 4UQPA 1VKZA 2GA9A 2GEKA 2PSEA 4LVNA 4ENRA 4CDGA 2FFHA 2I71A 3I73A 3F49S 3QVGA 4ID3A 4LF4B 3RVDA 2O8CB 4B43A 2XADA 3PHHA 4Z4QA 1XXHA 1ZN8A 3RC3A 2I7XA 4QYIA 2CUZA 3NATA 2GDZA 1IZYA 3R6TA 2BI8A 2VAXA 2OGSA 3UCFA 1VKOA 4MRNA 4CQLB 2C4KA 4LNAA 3SC6A 2E18A 4Y7DA 6GPBA 1I5EA 3IJPA 1CRWG 1RYNA 3KQKA 4ZTZB 2PIAA 3MMZA 3WQSB 5JPDA 1J39A 4UNRA 1SKMA 3KYDA 3HACA 3O8DA 4NX2A 2XI4A 4YAUA 2FWBA 5DX1A 3HDVA 2FF5A 2DJIA 1L9XA 3CZRA 4QOFA 1M6YA 1X42A 2UUPA 3H3JA 5TR9A 4CM4A 3U5TA 1C0PA 5H7XA 1JDTA 2B4YA 2XD4A 1CUCA 3ESZA 2IIPA 3S28A 4DJFC 5BSFA 4LXUA 2Z8ZA 4FDAA 2OHGA 4FDLA 1XZNA 5AWFC 4RKWA 1NQVA 4ZDJA 4P4SB 1ZS9A 2EEZA 2AFHB 3WNVA 4RVNA 5M04A 2YV2A 3PP8A 4TS1A 1U9ZA 5DDIP 1CP3A 3NMUF 4J2HA 3TX2A 1XMOB 1M2OA 1ZUNB 4HTFA 4BRUA 1FDWA 1XROA 3SLKA 2PAAA 2DFKB 3DC7A 4GR4A 4AYWA 1L0BA 2YWGA 4CMEA 4FDUA 4YTEA 1EGAA 1ZVQA 1G98A 3PV0A 3P0RA 1NJGA 4JBIA 3VR4H 1A5BB 2H9AA 4GE3A 4C0QC 4E14A 3ETJA 4FLFA 3JW8A 1PJSA 2BW0A 3B60A 1IJFA 3GEBA 3LUFA 1QTQA 1OUMA 4OAQA 2YQ4A 4INOA 2VRNA 4IIFA 3M83A 3WHLA 3I37X 2WTEA 1MV5A 4HY3A 1UADA 1KKMA 1X13A 1E1YA 3PNBA 5A4JA 1JT9A 1GDTA 2Q5LA 3EDRA 4FZRA 4O1IA 4U1RA 5DTMA 1E4VA 1PBTA 2VTKA 4G2NA 2D2VA 1N34B 4C2TA 1JJFA 5KQPA 3WNDA 4YGYA 3EBOA 3PRHA 1AUOA 5LYYA 1HG1A 5CTJA 1T5BA 2I3AA 4G1EB 2VP3A 2I6SA 4G63A 4UREA 2VRWA 4P82A 4D3DA 4I4TA 5HM8A 3L8HA 1F4VA 1M5TA 2VDJA 4IIUA 3DMPA 1YKGA 2FRDC 4JJ6A 4PFQA 2FPGA 4GVPA 2PGLA 4HEQA 4XLTA 3AUTA 4YACA 2UKDA 3S81A 2IHNA 3TZHA 4FONA 4PPNA 2BSAA 3IUNA 1MJHA 3VPDA 4QKQA 2RGRA 3AF3A 5K0GA 3D4LA 3C1TA 3DDZX 4YCNA 3T9DA 2BSQA 2BLNA 2WKQA 3BXFA 1JPNA 1SVSA 3D0RA 3WL6A 2YMPA 4CGYA 2XYRA 4PC1A 5DHSA 5EI5A 4LY9A 1YOVB 1G0OA 2IP4A 3DEYX 4OK3A 4RV4A 4Y6SA 3CX3A 1E2MA 3HBFA 4KOAA 5JBNA 1NMEA 3CF0A 5K8LA 1WSDA 3T9CA 2O07A 2RBEA 1MA3A 1Z2OX 3HYTA 3BXZA 2HQBA 1VCNA 4FYVA 1ZZGA 2B36A 2WP0A 4IMPA 2NUAA 2FK8A 2V4ZA 3C45A 3F6RA 3SD7A 4R81A 4JU9A 4JOSA 3L6EA 4OIMA 3GRPA 3CUEF 1XO1A 4BLTA 3AY0A 2R6JA 2V7EA 5FPHA 3JWPA 3IBTA 3VNVA 4EHFA 1WV1A 1NY5A 5B7GA 4R6WA 1HLGA 3M4ZA 4PAQA 2VPQA 4IVNA 4W82A 2ON6A 3TL3A 3VQTA 3WGMA 1P8JA 4BVGA 5FTLA 2CXRA 3UA4A 1YQDA 2ZSKA 1GCUA 2VFAA 2ZUDA 1VPTA 4L8VA 3WGVA 1WA5A 3IT0A 2L19A 2NYVA 3NUQA 4EHHA 3VTZA 4D25A 1RIIA 5DVZA 2WYIA 3IUYA 5EJ4A 1XCMA 3TBHA 3NTRA 4LY0A 4H16A 4K81B 4URWR 5LP6F 1VBMA 2VP6A 3G0CA 4FS3A 4WXMA 4AIRA 3UPUA 4KR2A 3TPZA 2V7PA 4YO7A 4ZU1X 2EJCA 5KYYB 1BZYA 2WD8A 5LQCA 3K4PA 3R40A 2A9FA 3DAGA 4WE3A 2XY4A 3H99A 4MV9A 1H4VB 3ES9A 4M6WB 2JFXA 421PA 3R75A 3H9GA 3AJDA 3DV0A 1EX7A 3GJ3A 4F84A 4D9HA 3PVCA 3RSQA 1JEAA 2R7MA 1U0OC 3SFTA 1W2GA 7MDHA 4CKBA 1Y3HA 3LO8A 2ZTMA 3O1LA 2CHQA 3QWAA 4DWOA 3I4FA 4TRMA 4CM7A 1CZRA 4LYAA 3N5CA 3BMQB 4RE5A 4X7RA 4ZKEA 5KNCH 4G89A 1FTNA 1H2ZA 2FW9A 3KHUA 2JH3A 1YZTA 4KW7A 2VYND 3E5NA 3FMPB 3KFVA 5DGIA 1E3EA 5KOHB 1VP9A 1XTZA 2Q2VA 5T64A 2PT9A 2WJPA 3TLCA 4AX4A 4R2WA 1UOPA 1VYVA 5C4GB 4K1LA 4AKSA 4AUNA 1SC9A 1RXYA 1M66A 1TF7A 3DOJA 2VSFA 5LJLA 1N2CB 2HQ1A 4GNKA 2GEBA 3ROFA 4BUCA 1H5NA 1E1NA 4DAOA 2PLNA 1WB6A 1FXSA 5L3SA 5BMVB 2IX9A 3DVRX 1NGSA 5IVKA 2C9BA 3V6MA 3UWOA 1BJTA 2F48A 3CO0S 1YB5A 1CDDA 1YDMA 2Z83A 3VVMA 1YAJA 5MGNA 2GFHA 3D54D 4GICA 4HWOA 4DLUA 2FZWA 2ZXEA 5L51A 4EPRA 4URVR 4O4HA 1AGYA 2REBA 4B0PA 4ZZ3A 1ZU4A 1COWD 1MT0A 1P60A 3CXRA 5JMTA 3F73A 1T25A 2VEDA 3K4QA 5IKPA 3IUQA 3DTYA 2X19A 3Q10A 4CRWB 2JAWA 4GX5A 2E4YA 1IG3A 4L9SA 5ESXA 4BKPA 2DQZA 5D2CA 1D6JA 1UBCA 4N5LA 4WCDA 5FL3A 3HYLA 4Q3OA 1XK6A 2WUVA 3TQHA 3U7EB 4C43A 4YRAA 3ETDA 3T3IA 3AZQA 4N76A 5IVDA 2IS1A 4V0LA 5FQNA 5CT8A 3RD5A 3R3VA 4NBUA 4IX1A 1EX6A 1YSCA 1KP3A 1W1UA 5D87A 1Y3IA 1C3VA 1ZGGA 1UFKA 1RAEA 4L5IA 4GL2A 4C6TB 2OZKA 1NXPA 1RHQA 2W8ZA 2BGNA 4B47A 4RVGA 5FI5A 4BLPA 2H52A 2QE7D 2QLJA 3ZWXA 4BVFA 3SZGA 1TW3A 1PS8A 2ACWA 4GI5A 2I6TA 1IHUA 1N0VC 1Y6ZA 4JH0A 4YRDA 5T67A 4BEVA 3TEJA 4CQJA 4DOMA 1QRSA 1W0JA 2Z30A 4UU1A 1Z6GA 1DOZA 3HJFA 2D74A 3MT0A 5HQJA 3ECAA 2A35A 5BN3B 2ZRQA 3GVCA 5AVOA 5K7SA 5GZ3A 4OX9Y 4UBOA 3K73O 2ZRPA 2G76A 4AJJA 3ORYA 1XEXB 4J0FA 5H83A 3QJ5A 1GFSA 1ZYUA 2YFKA 1ZD8A 2WF8A 3OY7A 4BO7A 5SZHB 2JASA 3E05A 2ADFA 3W78A 2X42A 3L7KA 3QE3A 3QEOA 5EE3A 1YE5A 4MWOA 3RI3A 1XT6A 3MUFA 5MHTA 4EUNA 1Q3KA 1MC8A 3K0AA 2C3OA 2BISA 2GTPA 1F6BA 3EPJA 4BUZA 1C3JA 4JB0A 2FSIA 2EL7A 4NE7A 3ZHZA 4B31A 3FHOA 2FWNA 4KACA 4Z1MA 2R86A 1E1CB 2OQIA 3PPIA 3ZVKA 5J40A 1Q91A 2GPTA 2NQTA 3EBPA 3OIGA 3RREA 4A0FA 1QE0A 3MINA 1ABFA 2C4MA 2PS9A 3LCVB 5E4TA 3KOWA 2WWTA 5JRDS 1JG1A 3PC8C 1AN0A 5K4GA 3DMHA 2GWHA 1OLUA 1NHWA 4Y2UA 2FPXA 4FXPA 1VSTA 4J94A 1AMOA 1TJ5A 4D79A 1CT9A 1D1PA 3EZ6A 2JFGA 4DLBA 4DRXB 1NQWA 1P1CA 1OAKA 3DB1A 1B0ZA 3C3JA 4P4NA 1DBPA 1X1AA 1H0RA 1M2FA 2ORVA 4MP8A 1R3UA 1EM8B 4MA5A 4ALLA 1P6QA 2CXTA 3EIHA 3GVXA 1ZZEA 4YWHA 1JEYB 5J2UA 3NLLA 3AR2A 4J90A 1M73E 4QOJA 1P5RA 3G5AA 1JYEA 4B76A 1J00A 1CDEA 2EBHX 5AKEA 4NNOA 1DPGA 4ZK6A 4KB5A 2GHQA 3NVKI 4EFMA 1XDUA 1CFZA 2SECE 4WINA 3RIGA 5KI6A 4IO1A 2J9FA 4MVJA 1OILA 3CS3A 1WB5A 2IZ7A 3L43A 1J21A 2HA2A 3INGA 3GLIB 2PUDA 2WT8A 4GLLA 4X3OA 4NMXB 3RFXA 5T3YA 1RLTA 3DE1X 1X19A 3IDSA 4Z49A 2XDQB 3QYJA 3RVNA 4EK9A 5A6SA 1QG2A 4UM8B 5KKAA 2LKDA 3ACCA 2JI9A 1Y3DE 1TM1E 4R05A 1MDBA 1RHKA 4KGDA 5F7XA 4DAEA 4F71A 4WBNB 5K05A 2JI4A 3MQ4A 2DERA 4N4AA 1KAOA 2A9OA 1QB7A 5FTJA 2WE8A 3F2IA 1T1JA 3EXHB 4NWIA 2JW5A 1CJBA 1CUVA 2ONYA 1SBZA 3BWCA 4POAA 1VCOA 4EYKA 1DCFA 2JHPA 5DCYA 5CVVA 1JG3A 8OHMA 4LYFA 4KFTA 2Q2NA 1GA4A 2ZZMA 4NDAA 1QNLA 2WAMA 1RM4A 1U2SA 3BDAA 3KKMA 4BAGA 3FF4A 4ISCA 1DAOA 1H4TA 3WGGA 1RBMA 1LDBA 3QA9A 4CL0A 2QTFA 3SY8A 4L4XA 1I4EB 1O94A 1JNYA 4OYLA 2R6GA 3CUUA 8ABPA 2ZT5A 2BZGA 4DSTA 4YRZA 4CEHB 4U00A 4W7HA 4AU1A 2A1TS 3BUSA 2IYYA 3D31A 3QNUA 5KC8A 4LCBA 1KSFX 5IEJA 2OBXA 2POCA 2B6NA 3DBVO 5KNLA 1ZD1A 4YRJA 1VG1A 4C4PA 1G20E 3OA0A 3RG8A 1G8AA 4PY2A 4E94A 3DZDA 3UHPA 1SPBS 2LGJA 3ZHXA 1R5BA 1CY2A 2BHRA 4BX8A 4PAOA 3G6KA 1TD9A 3W2EA 1L1RA 3JPWA 1M7GA 3TTTA 1WV0A 3TTYA 2RKBA 1MAUA 1EJBA 4Q34A 1VIYA 5AK0A 1YZVA 2YRFA 4NS1A 4TLLB 3ITNA 1GNQA 1B6TA 2BFDA 1JQLB 2YNMA 3OCUA 4LC9A 4HEA1 1VPVA 1SN7A 2XXBA 3LLUA 3D3JA 4ZJZA 3IQGX 2AOUA 4UFNA 2O48X 3R24A 3GCXA 3FAKA 4FGZA 3DHYA 3KOZA 4IXTA 1MBZA 4MMZB 1MEEA 2IOQA 3UGQA 1H3EA 3TZ6A 3WX0A 4AJIA 1GQFA 4I55A 1OLSA 2VDQB 2XF2A 4GMGA 4XSGA 3ZHYA 4J0HA 4V2IA 2QAGC 5CT4A 3UYLA 2BGLA 1GWNA 2WSIA 2ZRHA 3N9IA 4Z0TA 4HRVA 3FYHA 3WLJA 5J4VA 3LSTA 4DJEC 4G4GA 1EJ0A 3ASUA 4Q9JA 1QDEA 4CCAA 1QG4A 1GPBA 3L07A 4MYCA 2ZULA 4FOPA 1G8PA 4LY6A 4OH1A 4RD1A 2EG5A 1UWVA 4UASA 5TXGA 4TYWA 4RJKA 4RHUA 4RLHA 4LWZA 5LL6P 2AKYA 3CF4G 4AZ0B 4URYR 1AKYA 3FOFC 2PDAA 1JWBB 2ZPTX 3I92A 4CETA 2VZEA 2MSKA 3LQFA 3IQIX 4E09A 3U7GA 1KXJA 2NIPA 4CEIA 4ARSA 1XDZA 4TXNA 4WKBA 5ALDA 1FTSA 4NH0A 1W88B 2HLPA 1MT3A 1SOAA 4GOXA 5IAJA 3VR0A 1S9HA 3D1JA 2XUGA 4A6EA 1IXYA 1TZBA 3D8UA 1DJQA 4PQFA 4LZWA 4U7TB 3MWYW 2GXAA 1U9IA 4M9CA 4C03A 1JH9A 2R00A 1M6EX 2AFRA 1XUOA 2BEWB 2XTAA 1JB1A 3PGLA 4ZV7A 3TYXA 1SU8A 4A26A 3OLWA 1YFKA 3KQSA 2ILTA 3ADOA 1B8NA 4TL7A 2YJ6A 1C1YA 5AHXA 2A5DA 1QZZA 3LOQA 3HKDA 5BPFA 5K8JB 1AHPA 1P5FA 1R0LA 4Y2QA 3CJTA 1JGTA 2OZLA 3OU7A 2VDPB 1JFVA 5E3JA 3KK0A 4ZANA 3ORFA 2ORYA 3E8SA 2W43A 1YS7A 3LY8A 4U9IS 3TLGA 5B36A 1WZEA 2PV0A 5IBPA 3F67A 1BVYF 1OI7A 2E0IA 2I54A 1OXUA 2QPTA 4G0PA 1S4QA 2PSFA 3AJAA 4PC6A 2WA2A 4B4KA 4KQHA 1JA1A 4O3FA 5B58C 2VHXA 2WWHA 3EDMA 3MM4A 5AVUA 3UGJA 3NWPA 1XCOA 1YFLA 4R1SA 2XCIA 4E2XA 4UQOA 3V97A 1VMIA 4BEBA 2DY0A 3ZX5A 1PL8A 5C80A 4RA6B 3MRXA 1VLMA 2ENWA 4H4EA 4KFSA 3VZBA 2PZEA 3TW0A 4EOGA 1U94A 1WCWA 1JHMA 4C7KA 1NMYA 4OJMX 1RW4A 4QSHA 3ZWVA 2FEOA 1C1XA 2IOFK 3P0JA 2PQ6A 5FV7A 2VTVA 2CE7A 4EJSB 3F4KA 3LP6A 4O4LF 4RY2A 4U63A 4B2IA 3E1GA 4C0SA 3BMNB 1Y4DE 3SHOA 1E2GA 1VE7A 5C8XA 4ED9A 5BWBA 5IM4F 2VT6A 1I3LA 4RABA 4L5BA 2WKWA 4HUJA 3V2GA 2P5YA 1KMHB 3QGMA 1K8RA 1UXIA 2PX4A 4TZ6A 3EG5A 3SXUA 2VTEA 4DZZA 4P32A 4TV8A 2YHSA 1VIMA 4ZVQA 2OL4A 3ESRA 1UBUS 1DAMA 1JDNA 4M53A 1EQUA 4GWLA 4XEUA 3ZWCA 5BWLA 4MYUA 3SBOA 5I45A 3THWA 2WG0A 2Z2YA 4WVFA 2G80A 3C70A 1BWQA 3EMDA 4XQ9A 1QGDA 1MQ9A 2VBIA 3GFGA 2D0DA 1G5HA 1NJFA 1A7KA 1K2WA 4LPKA 1ZIPA 1PSDA 1DNPA 3MRTA 1KEWA 1RYEA 5ALWA 2JGMA 1HTTA 5J59A 3AR3A 1L3IA 1JHPA 1CR6A 3NHAA 1NMZA 4Y9UA 4E46A 2QTAA 2WK1A 2I4MA 2ZJBA 4JOCA 1EU1A 1F9EA 4ASUA 1OC4A 1WHSB 3U2QA 2YR0A 1MO6A 2RI0A 4I6JA 5CJ2A 2NU6B 3PZBA 3HXKA 1SBTA 3RASA 1SB9A 1NMQA 2AOWA 3RAEC 3UHJA 1CY7A 3R0ZA 4RZSA 5TQ0A 4MW5A 4RELA 2J0QA 3IP3A 2JAPA 3ER6A 3ROPA 5A3QA 2O3UA 1T0IA 1U28C 3R5JA 1RZ3A 2ISSD 1E3JA 1N1GA 3K8YA 4M0UA 3RQSA 4GKJB 1U1EA 2BGTA 4ZD6A 3QVXA 4XQ0A 2FMTA 1DWPA 4KIUA 1YBVA 3H1AA 4Q5IA 5BV7A 2AVDA 2AG6A 4H6WA 3VH3A 3OIWA 3OAAA 4UNIA 4D8WA 4LSGA 3AZPA 3ZZTA 2A3RA 1KEPA 1ONSA 4D26A 3PSAA 3Q3JB 1THMA 5JDIC 1BRTA 3QKTA 4J0EA 3KSMA 1JTEA 4LZNA 1XZAA 1CR4A 3WG9A 3TCXB 3AFHA 5ER6A 2QRGA 3W7VA 1FXWA 4CL8A 4EM6A 1GAXA 5CW2A 5CU7A 4B2LA 1ZH6A 3I5XA 2RGGA 1JJBA 4L2IB 1IHOA 2PGDA 1QV9A 5EP1A 4XRGA 4RZIA 4DS3A 3BF7A 4KN8A 3V8PA 3PTAA 2O2GA 2GXUA 1L7EA 1R8YA 1XCBA 5JISA 3AFIA 3QM1A 4GR9A 3QVGB 2JLAA 1PR0A 5ICFA 1GGMA 3GT7A 3HHPA 1L5WA 4LJ6A 3LBFA 1D3AA 2GEUA 4RF4A 3OG9A 1AGRA 4JXJA 4YBRA 2IEIA 1PW7A 3IOCA 3PQEA 2WIDA 4XPZA 1T4CA 1QZ3A 3ETGA 1TMGE 1PJCA 4NOMA 2O8EB 3EA4A 1YBFA 4QXAA 1E2FA 2JFVA 3I39X 3B7PA 3MCWA 4RD0A 1WEKA 2ECOA 1FL9A 4UE6A 5FUYA 3WLSA 3UJ9A 3NM5A 1TYDE 2W2XA 1MEJA 2PKYX 3VR5A 4ALMA 1BXKA 2X4IA 3QYFA 4YAJA 3HXTA 3ZD6A 5FNVB 4CMKA 4OUDB 5DWDA 2ZCJA 2ZYGA 2EP8A 1JR6A 2W6IA 1JR3D 2RK4A 4DIMA 3GUUA 1P7CA 3DAOA 3OTQA 3Q7SA 4HDNB 1D09A 1DOAA 5AHOA 2BTQA 3MTAA 2OMEA 3K8ZA 4NJEA 4MKGA 5CGZA 1OX5A 2PTHA 4F6CA 5TARA 1H2XA 3IMCA 3IUPA 3Q7PA 3DDHA 2I62A 2AUNA 2G4LA 3KEOA 4MUFA 1J0EA 2GT1A 4K6CA 2NO1A 3QVLA 3I3SR 2ZETA 2NUTB 1Y9JA 3E7PA 3SR4A 2HMWA 3KVYA 2PX0A 4IX9A 4F38A 2BN4A 2QM7A 2XJ4A 3KJNA 1ZNQO 4GZMA 1EWVA 2GJ4A 3BWBA 1J25A 5AI0A 4ZDIA 3T9BA 1MGPA 4Q4AB 3G89A 4XIGS 4YP0A 1C4XA 4C3UA 1HH4A 5K0NA 1UBLS 1YS6A 4UULA 4MV3A 1TE2A 4Y6QA 5DCLA 1NOIA 4NBTA 5A2GA 4PG5A 1Q1NA 3E03A 2RJ3A 1HDEA 2Q9AA 4U6QA 4UBLA 1DG9A 2PJUA 2V3VA 3PA8A 4MI9A 3ZU5A 1JHVA 4DBZA 1ULTA 3OQ6A 1XTQA 3JQPA 2WJ3A 3JAWA 1UBEA 2VNHA 4FNGA 4HLNA 5EIFA 5A71A 2XXAA 1G21E 2ZRMA 4HGZA 2QY9A 4JBNA 4C7JA 2W4QA 2V1XA 2VO1A 3VOTA 4MR7A 3T8YA 1W8DA 3JQAD 3ZJTA 3ESDA 3PG5A 1P3Y1 4BZZA 1D2AA 3FCSB 2CK3A 3FCAA 4I1PA 2YOFA 2GD6A 1QO0D 4HNTA 4QDKA 1ZJ4A 1XXHB 1BYIA 4B3CA 2LIPA 1UANA 3NM4A 1L8AA 4K0RA 4KRGA 1VCHA 4H18A 3EFOB 1KZ4A 4ESHA 5IAEA 4JBYA 4X6UA 3SYKA 3K2EA 4JT8A 2XH8A 3NBUA 4BE9A 5HTKA 4KO4S 2WMNB 4U2GA 3DHEA 3A31A 1FFYA 1ENOA 4ARBA 4QOGA 2HX1A 2FF7A 2B1QA 1X2EA 4NTZA 4ZQGA 4FR2A 4CI0B 4UM7A 3T3NA 5DCWA 1P1FA 5D5PA 1B8VA 1CFJA 3FFAA 2NO6A 3FLAA 1YZGA 2GO7A 2JFQA 3PL5A 1ZVJA 4KXQA 4ZOLB 5A9SA 1VJ0A 3GNSA 1E63A 2ZSBA 2E2WA 1HTWA 1P9WA 1VGRA 1C8VB 2JFZA 2POQX 4Q1VA 2BMAA 3ROMA 2A5LA 3ZCPA 4OBXA 1G5QA 3DVSX 1YCHA 4IKPA 2QV7A 3BHIA 4UPDA 2IK8A 2O8DA 1ZJYA 1UPBA 3G49A 3HSYA 3VYSB 3DFIA 1T8TA 3DHNA 1I80A 3BRWA 4F2PA 1KBQA 3HFSA 4WQMA 1E3SA 1K9VF 4ME6A 4EYQA 3QF4B 4XVQA 4C5AA 2E9SA 3UV7A 1IDOA 1UBOS 1T2FA 2GBLA 4IWYA 1V3UA 1G2IA 1CB7A 3HY3A 1H3FA 1I1HA 2D00A 4G4SP 1NVKA 2YMLA 4NFHA 3TFOA 1P4GA 2QW0X 5KWIA 3H42B 4OMUA 3FWHA 1DUIA 4YRIA 3WRXC 1T2UA 4R83A 3AESA 5F2OA 5DN6D 4JLOA 4G5YA 4G8CA 3R3XA 4I4LA 2VA8A 3ZEIA 4AECA 2KQUA 3KVNA 2D8MA 2CBGA 4ERNA 4B3SB 1UFOA 4W6ZA 3L0DA 1R8SA 1NZJA 2B20A 5G53C 4D9NA 5KB3A 3PNQA 3UYKA 1W5FA 2CD9A 5AOAA 1BDIA 1RXUA 1P7VA 1WLSA 3EFOA 3O31A 1BVRA 1G3IA 1XXLA 4IIJF 1XOIA 3H83A 3RODA 2EP7A 5MDHA 1GO2A 1E1QA 2XVXA 3FUWA 4NCXA 4P5EA 4L9RA 4OHMA 3NW9A 1BQ3A 3OBIA 5AKHA 4BQPA 1R3DA 3Q5EA 2XR1A 4WASA 3RVMA 4DLAA 5K8IA 4D7AA 1BGXT 1EHYA 2DPYA 2P4EA 3DC2A 4EHIA 1GQOA 5CVEA 3EBLA 4BWYA 1G21A 3QVUA 5HHTA 2EJUA 2YVAA 1D7OA 4P4GA 1G8YA 1X7HA 3A3NA 2UZ1A 4PN7A 2VNSA 3CE6A 4EECA 2QX9A 3T41A 2A4MA 4FT4A 2UUCB 1C7JA 2QRVB 3KDSE 4HDOB 2QL7A 3CBGA 2QE6A 3ECCA 1L5LA 3WYNA 1UAAA 1TVKB 5FUMA 3LCJA 1U2DC 3SX2A 2BGUA 2ZSIA 2JJQA 4PLFA 1JLLA 5CFPA 4QVIA 2DULA 2JFNA 2WPDD 3ADPA 1Y9ZA 1XF1A 3OQBA 5GAJA 3X2SA 4EPWA 1H3NA 4O2BA 3OM1A 1RYHA 2XWJI 3QFCA 3DVAB 2QTWB 4S0ZA 2NTEA 4HWTA 1LFDB 4XOIA 1TXGA 2JZOA 3IHTA 3WGYA 1ZOIA 2Y0EA 1TMYA 3MLBA 3R44A 5TLSA 4IDEA 1SHTX 3PDIB 5CFNA 2AOTA 4MYTA 4JC0A 1PI3A 3VO9A 2HF9A 3HB7A 3LGAA 3EGCA 3X1WA 1BW9B 1FFEA 3MCVA 1HYQA 4XE5A 3IHLA 4LDPA 5CB8A 2DZDA 4DLVA 4COOA 5KQSA 2DQSA 4WK2B 2CD7A 2YN0A 1JG7A 1IY8A 2DVMA 2ZGVA 2R65A 3P0IA 2WVHA 3FDZA 1N32B 5JJLA 4MS4B 3IV7A 5JR3A 1N75A 3VSBA 4WBXC 1AKEA 3GXOA 2PVSA 1NI3A 2REXB 3W0LB 2RI6A 5AYVA 1BOOA 4EJSA 4QICA 1NZDA 1GRCA 4JDUA 1EM6A 3AB7A 2G72A 4OHOA 1N5JA 3VHXA 1RXWA 3A9CA 3WYBA 2HFKA 2ZB4A 4PWZA 1U8EA 5JXHA 3AR7A 5IX8A 1XRSB 3KXIA 3WRWA 3WLKX 2D0PB 5B6JA 2CNOA 5JAUA 1PFYA 2HJRA 5B7PA 3ZH9B 1QWSA 3CR3C 1S3IA 4H60A 4OV6B 2JJ8A 3GD5A 1Z63A 2E37A 2CFTA 4GZ6A 2IEYA 3RANA 3WRYC 2NVOA 3WZLA 3ELYA 3WV5A 3S2ZA 3X2EA 5A6VA 4DPLA 3OPYB 4Z99A 4LZZA 3AF1A 5ALIA 5IJ0B 4OB8A 3IIJA 3JD0A 4UARA 5KTNA 4PYMA 4OATA 1WNFA 3A6GA 4RETA 4QLBA 1JDBC 3OH8A 3WLRA 4IUDS 4ND3A 2WD7B 4GQBA 2FUG1 2JFYA 5C4IA 1ZSVA 2PQ2A 1ULUA 2OHOA 4U0KA 1X8KA 4LHVA 4GR5A 5FI1B 3BYZA 4HPWA 4M0KA 5AI8A 2D5BA 3D59A 2H5JA 1M2JA 1E5TA 1KC1A 3NI2A 3JVVA 5KO2A 2P7HA 1NTRA 4DUZB 2HV8A 2CCGA 1PCXA 3GHHA 5TX7A 5TS2A 1NNUA 2ZB7A 4KXWA 5E6RA 4D98A 1C1DB 2CXPA 1O58A 3JATA 2FPSA 2VK1A 3GWGA 1E2UA 4HQRA 1YQWA 5EWLB 2RHJA 3S7ZA 4ABYA 3AEYA 4YB8A 2BM0A 3Q9UA 2FKAA 4LW8A 2P1ZA 4F3RA 3K6SA 1PT5A 3QVMA 2Y27A 2P62A 3IMFA 3VR2A 1F4PA 3GROA 4Y7CA 3OTHA 4RS4A 1T91A 4AS3A 2QTNA 5BNFA 1U6KA 4WOBA 4Z53A 4RCZA 2O4CA 2OXIA 9LDTA 3SGLA 5DSXA 3ESQA 1GPDG 3KVRA 2FN8A 1XFAA 3UMFA 4QBHA 3UAVA 4F4DA 1ZH8A 3I83A 4MVJP 4RD3A 4JROA 1T8SA 4J0KA 5G0UA 5DIZA 4R2IA 4LDRA 4AKTA 4ER0A 1ECGA 3HA3A 3FOCA 3F6YA 3U40A 2NSYA 4L6AA 4BKRA 4KH1A 2B98A 3KVVA 4D9MA 4KAXA 4TMXA 1MABA 1TFUA 1ZL2A 4E07A 1TM5E 2Z8XA 3KQMA 1JEYA 3ZQUA 1JBQA 2O8BA 1RQPA 4IJKA 4IS2A 1V7PC 3SSOA 2YHBA 3ZEAA 1XMSA 2NZ2A 2ZI7A 1Q0QA 1TMKA 3DT9A 4XUEA 1QS0A 5HFJA 3R3WA 3EAGA 3V4PB 4BKOA 5JV5A 2PQ0A 4U7WA 1VRWA 4OPMA 4BNFA 4BWVA 5BUCA 1FX0B 1UQUA 4TWIA 2ECKA 5EWJA 3U7QA 6AT1A 1AKMA 3BMQA 2C78A 3KB8A 4GFDA 3U37A 3EGDB 2VTBA 4P84A 3I76A 3R6LA 4RLSA 4CQMA 4EUFA 4CL2A 1I2AA 2UUAB 3I09A 4H7FA 1FLVA 5TQJA 5BQOA 1E3WA 4RY9A 1E92A 5DGCA 1FYDA 3IP7A 3ZD9A 5FNZA 5HKBA 2RHTA 1PTKA 3DF7A 3MINB 2Z3ZA 3DOIA 3HU5A 4AD8A 4KNVA 3VYWA 5JQGA 2HSEA 4KO8A 3EWAA 3OE7A 3HXLA 4JOQA 1DKRA 2B30A 2GAAA 4TTSA 1EXVA 2C29D 4H0FA 4WLEA 4F96A 2P4SA 1K89A 3DTNA 1TKRA 1P0CA 4GOLD 1FTGA 3GBPA 1Z7GA 4IJUA 2Y8EA 4PC3A 2Q21A 5DP2A 3CRVA 2Y2UA 1M74A 3HCDA 1PQWA 1QOZA 3HRIA 1G1AA 2Y4OA 2ZR0A 1GVNB 2OPHA 1DGQA 1NSTA 5I8PA 5CH5A 2A4KA 3F71A 4N48A 1ENPA 4QZVA 3FZEA 2QVCA 4P22A 4EELA 1U5BA 3SQLA 1OWNA 1GN8A 1MA0A 3CV3A 5HBRA 2QWXA 3A1WA 4RVFA 2QORA 3O4RA 5EVCA 1XD8A 2IPNA 1GZ5A 1W49A 1GAWA 1NLZA 3BTUA 1Y6JA 3THSA 4BEWA 1QVWA 1I14A 3LXMA 1HYHA 2D4HA 3HLTA 3I9MA 4YQZA 3W6NA 5HYVA 1Z5ZA 4UEOA 1M3SA 3E1KA 2I6GA 1ID1A 4I3GA 2AMYA 4ZCLA 1S89A 1D6NA 1BHQ1 2I65A 1EFHA 1GZDA 1N3YA 3CN9A 3ZGXA 1H9AA 1ZM9A 1OV6A 4YH1A 1OFUA 1W4CA 2MMGA 1YBHA 3F74A 4BVEA 4D4GA 1Y9DA 1HKHA 2EW2A 2VXCA 3FYCA 4JNCA 2PS3A 2GEVA 4WK6A 3D5EA 1FP4A 2D1RA 5HDBB 3G9TA 1GAJA 2JEOA 3K8QA 3CEJA 1C9NA 4OXXA 4C7OA 1KP2A 1KYTA 1EQ2A 1FTYA 3N74A 1WXHA 1POXA 3N7AA 1VE9A 3PGVA 1U8CB 2H92A 4YJFA 2VVTA 1DELA 2P2NA 3HDGA 3P2KA 3I42A 1G8GA 4Q3DA 2YBDA 2PRIA 4JP1A 1EFLA 2GNOA 1WO8A 4PVDA 5EIBC 4RA9B 1QO7A 2OYSA 3C4JA 1L7MA 4MWGA 2FR1A 5IUKC 1XKLA 3RTBA 3TKAA 4Q47A 1CJMA 1TRKA 2HWYA 1C2YA 4N6NA 4LA4A 5P8WA 4LRQA 1H9BA 3DEFA 4G0XA 4FLEA 4PFJA 1FJHA 2J3QA 1QSGA 5AOVA 3U1BA 3QOYA 4MS1A 1KEEB 4I4NA 4YJDA 1BKDR 1JG6A 3BD6A 5EHQA 3HFJA 3ZE6A 3AEQA 3SP1A 1SU7A 4WI1A 1Z6TA 5HKKD 1OBHA 1BA3A 1NQXA 1ULAA 2B9VA 3N2IA 4UUOA 1CUJA 2A5FA 3NBYC 2OBNA 4G5XA 4JLMA 4LXQA 4NFLA 1F48A 5H80A 3ABQB 2NT3A 3ZWYA 3WGUA 3HZZA 4DIBA 5AVTA 3T0IA 1JR3E 1PQPA 2D5IA 4LHEA 4LQ4A 2NLOA 5AM4A 4EUKA 1ILEA 3SFZA 3R7WB 1MB3A 3AYXB 3OZRA 4GKAA 1JJIA 3RAGA 5FV4A 3AEKB 1TYEB 4OEHA 4OLAA 4GM1A 3WKDA 4EG3A