4RK5A

Crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound sucrose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
275
structure length
275
Chain Sequence
TGNIGVLVSRVTNPFFAGLFDAIERELHAHGYQVMITQTYDDPEAEERFLKQLKSRELDGVILASVEAPDRVMAVAKAFPGRVVVVNADVQIPGATSLVLPHYQATRDALDYLFNQGHRRFAYVSGGTISGAHHGQSRTQAFLDFMQAHQLLVAQDLLFGQIHTAKEGQAVGKQLASLAPNVRPDAVFTNSDEVAVGVIDSLLAADVKVPDDIAVMGYDDQPFAPFAKIPLTTVHQPVASMAAAATHELLKGLGRQVAQDTQPTLHLSLKIRQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of LacI Transcriptional Regulator Lsei_2103 from Lactobacillus casei, Target EFI-512911
rcsb
source organism Lactobacillus casei atcc 334
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LacI family
total genus 93
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk5A01
3JY6A 5HQJA 4ML3A 3CU5A 4RDCA 2R47A 2VUIB 1ISRA 2FQWA 2JBAB 1KMIY 3DGFC 1KRWA 3LUJA 2IOYA 1QPZA 5EWMB 1MB3A 1KGSA 2HJ9A 1Z16A 2QVGA 2J48A 4Z4IA 1ISSA 1L5YA 4RY0A 5DKFA 5BRJA 4QPJC 2FMKA 4O1IA 3I45A 3UK0A 3OLVA 4PICA 5KC8A 3OLYA 2PUAA 2YHBA 2E4VA 3O21A 2R48A 3RH0A 3B2NA 4RKRA 4YP9A 1LBHA 1BAPA 3OMWA 3MIZA 5TQ2B 3JPWA 1JFTA 1RPJA 3D02A 4GNRA 5JS2A 4E7PA 3KHTA 3EODA 5EWLB 4IMIB 1DRJA 2Q5CA 3IPCA 2X7XA 1U04A 2P4UA 4M88A 4RWEA 2IPNA 2QZJA 4EVSA 1NY5A 3H5OA 3GWGA 5ED4A 1NXTA 5FWYB 4N03A 1ZGZA 1M5TA 3BBLA 2F8TA 3LUAA 5F64A 1NXOA 2HPHA 3FGZA 2H3HA 1U2QA 3HEBA 5CNJA 1YTUA 5TQ0A 1W25A 5KI6A 2VYCA 1FFWA 3LOPA 4RSMA 3NHZA 6CHYA 4N0QA 2MYPA 5JNTA 3M9XA 4NCAA 2LPMA 1JX6A 2HSGA 2QR3A 2FLWA 3D8UA 3E61A 3GV0A 3N53A 1ZAYA 3G85A 4IMJB 5IEBA 3KJXA 1EWVA 1JLKA 2JVIA 4Z4FA 4W5OA 2FLKA 3EQ2A 3Q41A 4EVRA 1JYFA 4N0PA 4W5RA 2WY2D 1D1PA 2JRLA 2P9HA 2JVJA 3GBVA 3ILHA 2JVKA 2ZWMA 4B09A 3E3MA 3HK2A 2MYUA 1E6MA 1DBQA 3Q7SA 3TX6A 1Z2EA 5CNIA 4RK7A 1PNRA 4RS3A 2F8SA 4ETMA 4YWHA 4KK3A 5EWLA 3OLXA 3FFWA 4N47A 1JL3A 2L19A 3DZDA 5IUKC 2MSKA 3JS5A 3DBIA 2FKAA 1QNLA 1URPA 4JOQA 1ZESA 3KYJB 4ZMSA 5KWSA 2E4WA 4NICA 4EYGA 3H1EA 2NT4A 2L18A 1P8AA 1NXVA 3OLZA 4RXMA 3IP9A 1E6KA 3SY8A 5TQ0B 4EYQA 1TVMA 3LTEA 3N8IA 2FQXA 2ID9A 2IKSA 4FE4A 5KQMA 3NNNA 1SRRA 3O75A 1UDRA 5IC5A 2WJWA 3MYYA 4O1HA 1E6LA 1GCAA 1DP4A 2GI4A 2AYZA 4KQ9A 3RVJA 4S04A 3R0JA 2PAFA 1S8NA 3QLUA 4H3HB 2E4UA 2IPMA 5DGCA 4YCSA 5ABPA 3CG4A 5T3YA 1PUXA 1C0EA 3HM9A 1DCMA 4Z4EA 4MQEA 1F4VA 1I3CA 2PMCA 4RY8A 1YK0A 1PEYA 3KTOA 3O1JC 1FFGA 3RVOA 5IUJC 1M5UA 1SXHA 1USGA 3FMVA 3QLUC 1DBWA 4O5AA 5PNTA 2A9OA 3O1HB 2RDMA 3LFTA 4MYRA 3JVDA 4OLBA 3RVRA 1TJYA 1E2BA 3FDFA 2FMIA 2E4YA 1DCFA 4LZLA 1KRXA 4D6YA 1EHCA 3Q7RA 3EULA 4OG2A 4MLCA 3C6QA 1RXIA 2LIVA 4MR8B 1RZRA 2WJAA 3C3MA 3QK7A 3RVKA 4CBVA 4G86A 5TQJA 4G0OA 2QVCA 2PLNA 3HSYA 1BVHA 2CWDA 3GRCA 3KSMA 2NZUG 1YS6A 4S05A 3K4HA 5IBQA 4KREA 3GT7A 3CLKA 1BA2A 4LE2A 3N0XA 4QYMA 5D2CA 3VNAA 5B3JC 2A9PA 5FWYA 1JWLA 5EWJA 3A3KA 5JNWA 4TN5A 4PE5B 1D2AA 2HQOA 2LBPA 3CNBA 3C97A 1LJLA 1U0SY 3OM1A 2I6FA 3BRSA 3IPAA 3MM4A 4KVFA 7ABPA 3H5WA 2LUOA 1Z13A 4PEVA 1YK1A 1QQBA 3RVSA 1NATA 2NUBA 4MGEA 1DRKA 4Z9AA 5DLEA 2RJOA 1QP0A 4EUKA 1ZY2A 4MR9A 3MA0A 5C5CA 1RNLA 4NV3A 4JP1A 3BILA 2FEKA 1NTRA 1RXEA 2MSLA 3BREA 3HCWA 4F8JA 1JH9A 4JB2A 1GUBA 1A2OA 3EJWA 3JTEA 3LKBA 5EWMA 5KC9A 3F7NA 3QLVC 4IF4A 1YMVA 1IIBA 2R4QA 4GPAA 4EVQA 3VNBA 4LE1A 4PZ0A 3H5LA 2W42A 1RZRD 5E3JA 1JBEA 2FVYA 3QX8A 4YR7A 4W5TA 4G0MA 1EFAA 3OQOA 1K66A 5BR1A 3HZHA 2KYRA 1FSPA 3EQZA 2FEPA 3LUGA 4W5NA 1ZN2A 2QSJA 2PL1A 1MB0A 2FTKE 1VRVA 5FBHA 2RGYA 5EWJB 5FWXB 3F73A 2FMHA 1A04A 1C4WA 3TMYA 4EY3A 1P6UA 2FXIA 4Q7EA 1JFVA 2L2QA 3H5IA 3TO5A 2VK2A 3DLHA 3Q7TA 4HNSA 4E7OA 3H5TA 3LKVA 3CS3A 4F3TA 4WZZA 4P1ZA 3ILYA 4Q6BA 4N76A 2E4XA 4P98A 4F11A 3RVMA 3NBMA 4W5QA 4RXTA 1DC7A 5FWXA 1PNTA 2OENG 2V0NA 5TPZD 4KPYA 3I09A 1P2FA 3H6HA 5DCLA 2QW1A 2CHFA 1TMYA 4MRMA 1YVUA 3DGEC 1MVOA 4HNRA 3H1FA 3H75A 4MS3A 5TE9A 2FEWB 2GKGA 4EYOA 2PE5A 3OO1A 4XFKA 4DQDA 3G1WA 3CZ5A 1SD5A 3KKEA 4MQEB 2JB9A 1VPWA 2HQRA 1NXPA 4TLMB 3CG0A 1XHFA 3DLBA 3A0UA 1D1QA 4RK4A 2QV0A 1U2PA 3HS3A 1HEYA 3BRQA 3KYIB 3OM0A 4IRXA 3SG0A 1P6QA 3RVPA 4KNYA 3LUFA 4KQCA 1DC8A 3FFTA 2PUBA 4F12A 1JDPA 3UKJA 3LUKA 2H0AA 4MR8A 4D6XA 1OXKB 1Z26A 5CHYA 3H1GA 4ZJPA 5HKOA 1ABFA 4KK4A 2PUFA 4LE0A 4OBBA 5TQ2A 5JNSA 1EWKA 3KS9A 1BDHA 1OXBB 4MLDA 2MYNA 3I5AA 4XARA 1Z17A 4NQRA 3LUCA 4H60A 1NXWA 3O2QB 1JFSA 5TPZA 2PUDA 1USKA 2BGGA 1APBA 1LBIA 2M1ZA 2FW0A 4YO7A 1ZH2A 1ZHHA 2WMYA 3FFXA 1JDNA 1JHZA 1PEAA 2CHEA 1CEYA 4NCBA 2JBAA 3L49A 6ABPA 3JPYA 3ROTA 3LMKA 1PHRA 4Z99A 4DN6A 2E4ZA 1A0OA 4WXEA 4YGXB 2B1JA 2HQBA 3O2SB 3QX9A 4JAVC 3ROFA 4Z0NA 2A9QA 2MSWA 4MS4B 3T8YA 1J56A 4PYRA 4XAQA 3CKMA 1SXIA 1MIHA 2IYNA 2IPLA 3IDOA 3NNDA 1FFSA 1NXSA 1BDIA 1Z12A 3NNSA 4TMYA 5TPWB 2PUCA 3CZCA 2FN8A 3HDGA 1QP7A 1H9CA 3T6KA 3HVRA 2IDMA 2RJNA 2PJUA 4YLEA 1W9HA 3L6UA 5JNVA 1ZH4A 4DADA 3GYBA 4IILA 4LDZA 4RKQA 2O20A 1AB6A 4L4UA 5JS1A 1CYEA 1D5WA 3C3WA 1DG9A 1MAVA 4Y9TA 3T95A 1GLGA 3N6VA 4ZPJA 1QO0D 3CTPA 3IP7A 3RVQA 3TD9A 4OLAA 5IX8A 3HJFA 1B00A 3C3KA 3OO0A 4QYWA 4LDAA 4LRQA 2WB4A 4TLLB 1Z18A 2M98A 1VLZA 8ABPA 1CHNA 3GL9A 3HUTA 3MF4A 1Z25A 4Z9BA 2CD7A 3MMNA 4G0QA 4MS3B 3OQMA 1U8TA 3HXMA 3GBPA 1GCGA 4RK1A 4XXHA 1QP4A 5GQSA 1ZDMA 3NHMA 4KZKA 4OATA 3RQIA 5JNRA 4YS6A 3QELA 5KQGA 1F51E 3N75A 4WUTA 4Q6WA 3SQNA 2PUEA 2IPAB 3Q9SA 2WRZA 1DZ3A 2PL9A 4JB0A 4YRZA 4ETIA 5JNUA 2NZVG 4HYEA 1LK0A 1TM2A 4MS1A 5HM6A 1QKKA 1D4ZA 5KQPA 1GUDA 1SXGA 1QQAA 1FQWA 1DBPA 1Z2DA 3A10A 4Z4GA 3HO1A 2LP4Y 2PKXA 3EGCA 3A0RB 3EAFA 1AB5A 1QO0A 4IGAA 2AYXA 4XASA 4G0XA 1R8JA 3LUDA 3SM9A 3W9SA 4YV7A 1ZVVA 4KV7A 3O74A 3EDCA 4WT7A 1ABEA 3JVIA 3P9YA 4LX8A 4HNQA 4JA2A 4EYKA 4RV5A 4OTZA 3URMA 3HV2A 3QEMB 3HDVA 2N9UA 5FBKA 1YIOA 3KLOA 3QEKA 2JK1A 3O2JA 3KLNA 4D74A 1ZGGA 2FSPA 4RK5A 3H5VA 2PUGA 2NT3A 4MR7B 2ID7A 3I42A 3QLTA 4L85A 1DJMA 1Z15A 2FQYA 1WETA 4ZYLA 1L5ZA 2GBPA 4FE7A 4G0ZA 4Z4HA 5KQLA 1YMUA 1YS7A 2QXYA 3CRNA 3IP5A 1T34A 3QELB 4H3KB 3F6CA 2VUHB 3QEMA 2B4AA 3T38A 9ABPA 5BRAA 2FN9A 5I4CA 4MR9B 1USIA 1NXXA 3S99A 3GA5A 3OQNA 1EAYA 4MS4A 4G0YA 4JASB 4MAAA 4EGSA 1QMPA 1XWWA 4Z4CA 4MPTA 3MQ4A 1ZITA 5TPWA 2YHAA 5T7BA 1M2EA 1VKRA 4ETNA 2DRIA 5BQ3A 4UHJA 4UHKA 4RK6A 3UUGA 3N0RA 3M9WA 1XHEA 2FMFA 4N41A 3CFYA 4MS1B 1BDJA 4MR7A 3KCNA 1M2FA 2TMYA 4KFCA 4WWHA 3SAJA 4RU1A 3RVNA 4MQFA 3O1IC 1Y1LA 5IUNC 1EWTA 3QLVA 2XDYA 1LJUA 2GWRA 4RZSA 4G97A 3RVLA 1JYEA 3N0WA 5CNKA 2GX6A 3HUUA 1DCKA 3KG2A 4XLTA 5C5EA 2MYTA 2ZAYA 3CHYA 5B3JA 1TLFA 4F06A 5IULC 3OLWA 2WWVD 4KMRA 4RK0A 5IEJA 3F6PA 3M6MD 3H6GA 4ZMRA 4KRFA 1K68A 2A9RA 2JCGA 2OQRA 3Q15C 3LUHA 4G0PA 4WXMA 5GOTA 4MRMB 4RY9A 2R25B 4QICA 3TB6A 2L17A 3IP6A 4RXUA 5CNMA 4FB4A 3OMXA 3SNKA 5HSGA 4MQFB 1JF8A 5DTEA 2QU7A 3K9CA
chains in the Genus database with same CATH superfamily
1HTWA 1QO7A 1Z33A 2ABWA 3TVTA 1CJSA 3IQWA 1HNWB 2WZDA 3ZLVA 4JGBA 5F78A 2CBGA 1F2TA 1K6XA 5LQSA 5JU6A 1G64A 1SK8A 1U7ZA 1KJ8A 2J3EA 5FTMA 4NU8X 1NXQA 5JCOA 4DLKA 3C1OA 4PPFA 2QVGA 3Q0IA 2P3SA 3CZAA 3REQB 5BRJA 4XD7A 3H99A 1JHYA 3H4VA 3OLVA 4KGVA 5DNDA 3L1JA 1FLVA 2BF7A 4BNUA 2WT4A 3O21A 1QBGA 4O29A 1QRAA 2V7XA 3G2OA 3H65A 1K6JA 2KM1A 2VOEA 3C16C 4FFBB 4L4ZA 4MJ7A 4WFQA 4YP9A 1EVIA 3T3NA 3THOA 2I91A 3LGSA 4DZTA 1UZLA 4N5LA 3JV7A 4AZ0A 2RCYA 4E5UA 1BU5A 1VE3A 3DV9A 3JPWA 3ER9A 3GF4A 1XAJA 3EHDA 1AMOA 1HYHA 1D6JA 2QZJA 1Z8FA 1U3CA 3PFGA 3WJAA 3DOOA 2Q6IA 3FSEA 3AOGA 4B5LA 1J09A 2GESA 4AY5A 1E0AA 1QYIA 4Z9YA 4K40A 1KIAA 3OWOA 2FOLA 2O8BB 2CLEB 2HPHA 4G6ZA 2H3HA 1B76A 3LDUA 1T25A 1E9VA 3KBOA 3L7AA 2VNJA 3EDOA 4HNGA 2H85A 3EZ6A 4KDCA 5LD2C 3KXKA 4I1OA 4V02A 3LOQA 2Y1EA 4OOFA 1JX6A 1C30B 2QR3A 1G8YA 3A70A 1F9EA 3KM0A 1LCIA 3TW0A 3QYAA 3UJ7A 3J80A 1QR6A 2WKWA 4C3UA 3U3OA 4LX0A 2XMQA 1IB6A 4K9DA 4OJYA 4ZI3A 2G3YA 1CZLA 1UIRA 4QXOA 1BFUA 4XDHA 4EVRA 2EKZA 2OFOA 5EIXA 1LBTA 1OV6A 3FNRA 2WHPB 3NU1A 3PIIA 3ELUA 3VYWA 4JLWA 5TGTA 3GBVA 3ND8A 5CGQB 3NC0C 3HK2A 1Z3CA 3E3MA 2QW8A 4KB5A 4OREX 1RKBA 3B8HA 3FUXA 3UA4A 3VH3A 1A9OA 1NUHA 4FFPA 1UMBB 2BEWB 2YC2C 5TQVA 3TTSA 4HZGA 2IZZA 1YH3A 2CVOA 3IHWA 4KK3A 3KQPA 3M2TA 1F48A 2XI4A 3BJMA 2J45A 4MDYA 1Q84A 1KAQA 1RACA 2IOFA 1VI6A 3EDQA 3PHIA 2ODAA 3PT9A 4IIBA 4LV6A 4MPDA 3TQRA 3ZJVA 4YXWA 5GAJA 4J90A 3IT2A 4FUQA 2RGXA 2H4ZA 5K2MA 4YYZA 2PWAA 4I6GA 1MPTA 1IHPA 3RI3A 1F3LA 3S2FA 4MWOA 1HWYA 4NC9A 1XPOA 4F1WA 2ZCVA 3IP9A 2PXHA 4HQNA 2G88A 2VHTA 3GG2A 3SOPA 1DTWA 1OBFO 2EARA 1I4LD 2ID9A 4JJ8A 2A59A 3GCZA 2JJ1A 4U9UA 3RUEA 2IZ5A 1FTWA 1HDGO 1T2UA 2PKCA 5JEDA 4FI3C 5JBQA 4MV6A 2REQB 3E84A 3FPBA 4QGSA 3DZCA 2DU8A 2SCUB 4KFUA 4BLOA 4TV9A 2I34A 3W8RA 1WKCA 3F67A 1WHTA 1N2HA 2OMEA 4ACBA 2UV8A 3AX6A 4DSAA 3I5YA 3H05A 4MCHA 4EG7A 4X61A 3ECAA 4FIDA 4FMBB 1YK0A 4QU0A 2ZJ6A 2RB5A 2PLRA 4FT2A 4JLDA 3U7FB 4WZAB 5DU2A 4TQ9A 3T12A 3FTCA 4UCXA 3CLRD 3P9XA 2P62A 1ZI8A 3WGLA 3OQIB 1JAZA 2BFBA 3FDFA 3IDFA 3WMGA 3GZNA 4YIHA 1E3SA 1HE8B 1JPJA 3D1VA 2YVQA 3RK1A 4LZLA 3PQ5A 3LW7A 4MP3A 3GCXA 1JEJA 4N65A 5DWVA 1GQSA 4QE3A 1W5AA 4KJZA 1CUHA 1Y3HA 3TLGA 1TIKA 5FOSA 1NWCA 4CTKA 2JZNA 1SRQA 5BUQA 3GLRA 1ENOA 1N8NA 5GY7A 3MFQA 5E1MA 2DT5A 2X23A 4TSRA 5BWNA 1G2IA 1O96B 5D2CA 2YWXA 1AKYA 3UUEA 1H5QA 4RGQA 5C0OE 4TWJA 2W98A 4B4KA 1R12A 3WAKA 4J76A 3VI4B 3UPTA 3UK2A 2Q1TA 1DJNA 1Z5GA 4GLJA 4G4JA 4ZXFA 5C51B 2PZGA 3H2KA 3WGZA 2RGWA 1MVLA 2BHNA 2XA2A 5A4IS 1HURA 1QQBA 3I9LA 3OU2A 5KWIA 3PGA1 4MVJF 5BXQC 1JQLB 4MGEA 1OCEA 4MUBA 4Q21A 4CM8B 2I4NA 3Q7EA 2ZWIA 4UCFA 1T2DA 1V25A 4PVDA 1PAUA 3MA0A 4G5XA 2FPWA 1SGWA 1VPEA 2PGDA 1SVWA 3NWBA 4QOIA 2W71A 2YXLA 2Q45A 4ZD6A 4ILKA 4DMHA 4LCBA 1K5HA 3DCNA 1MHTA 4WLNA 3KLBA 3ZHXA 1E4EA 1DHRA 1N1GA 2JFYA 5KC9A 1G6Q1 3R7AA 5DM1A 1C9DB 2CFOA 2IDKA 3N1UA 4HDMA 2RAUA 3G0OA 4Y2HA 5M04A 3LYAA 3BWMA 4FOTA 4Q48A 2EFYA 2OECA 3HI6A 1IK6A 1LXCA 1TAUA 4JVSB 3AV0B 2L82A 5HVNA 1PYDA 1ULSA 5SY4A 1ZM4A 4ZFNA 2B99A 4EDFA 4DB4A 1ZVQA 3NYRA 1NONA 2C9YA 2CY0A 4HWPA 4BGDA 5I4IA 1QU3A 3GN2A 3JQAB 3PWSA 5KHLB 1SQ5A 3STTA 1A27A 5JEEA 1XA0A 1VRVA 4OBEA 4RD6A 3H2GA 4C0XA 2RGYA 3NGXA 3IALA 5FWXB 4NE2A 1WNFA 3IQHX 1G4AE 1L5FA 4QSMA 4MZDA 2PWPA 3GQVA 1Y9ZA 5HWSA 2JFBA 1PUJA 3WK6A 3DTVA 1R5OA 4DG8A 5B3AA 3MCTA 4G5FA 1AC5A 3M6LA 1DWOA 2XKAA 2H1FA 4E7OA 4IFIA 3BAFA 3HM2A 4DMFA 4JP8A 3PHJA 4WZZA 3QEBZ 2AG1A 4P98A 2ODBA 3NBMA 4KG7A 1A7AA 1SWWA 2XF2A 4EA9A 2WB2A 3ESRA 1OH8A 3GX1A 1Z08A 1PNTA 3HHEA 4NDAA 5HKKD 4KPYA 3FPGA 2GK4A 1QYVA 2VL7A 4X97A 4ZVUA 1TMYA 3L4KA 1ZCJA 3K6KA 3ONWA 1RQ2A 4Y7DA 2QD3A 4BX0A 3EXHC 4JUCA 4G84A 4AJPA 3WDSA 3RADC 4G8CA 5JTTA 3DOEA 3FPHA 3L07A 3B1WA 3F7OA 4XFKA 1W35A 2IGBA 1ZIYA 2YWBA 3HEAA 4R1NA 2HB6A 2XA1A 2IIBA 5DYWA 3TQCA 3WJ1A 1G9SA 4EMBA 4JLUA 4CF5A 1JIUA 1RZUA 2ONYA 3GLHE 3TJZA 4QNMA 3LC2O 4U00A 1J8DA 1HZZC 3CGGA 4LRXA 3CW2A 3EQ8A 4WZBB 5B2ZA 3SEQA 4HDSB 5B3KA 2X0KA 3T7DA 4FQ8A 4KBYA 3H13A 4V1CI 3WLFA 5CX4A 2IKQA 3M6AA 4AXBA 3IE2A 2Q5QA 2Y1CA 3MC1A 3FGOA 4V0SA 3SXPA 2CYAA 3C7TA 1ZD1A 3FFTA 2I03A 3OT4A 3VMMA 3UG6A 2VRCA 3AHHA 3CVOA 1FTYA 3FMGA 1HDCA 3INTA 3K1JA 3H1GA 4KYUA 2GN2A 3B51X 2H17A 4C6TA 1M8JA 3UVEA 3F6EX 4KR2A 4OQFA 1RHKA 2AXEA 1Z17A 1J33A 4OFXA 4E2FA 1IQUA 2QBYB 5EIBD 3A1FA 5A3QA 1N57A 1NXWA 1IY0A 2QK4A 4H60A 5JAQA 4LC9A 1Y8QB 2IYLD 1E79A 1WL8A 3QVTA 4H1HA 4UBLA 4RTPA 5AR1A 1LBIA 2GZSA 3JQAA 5CYFA 5K8TA 2VZEA 4GUAA 3CLRC 1F2UB 3E7PA 3FUCA 1HE3A 4IPTA 4L5AA 4MWBA 3SJBA 1KZ6A 4O4IF 2FJ0A 2DQKA 2QLNA 1Y6ZA 4HB3A 1U7XA 2D7JA 2GK7A 1A95A 1PEAA 4P3NA 1U94A 5CVVA 5BQ5A 2D74A 3X1JA 5A1TA 2QL9A 3L8HA 2VDWA 5FTWA 1ZOOA 1QU2A 3NANA 1ITZA 4RJKA 3SYTA 4DN6A 1E2FA 2YVUA 4EGQA 4IJVA 4R0VA 2PX6A 1Y33E 2X9NA 2YZGA 2ZUBA 2GWHA 2OR3A 3FOBA 1RQ7A 4DMMA 4RM2A 1PSWA 1ZP6A 2OHGA 4HVAA 2GAJA 3CE6A 4IDEA 4KWCA 5I7FA 3A06A 1S1MA 1MIHA 1GEGA 2G9ZA 4MUMA 4UMVA 3KKOA 3NNSA 4ALIA 4PYIA 3OHMA 2TYSB 3UMYA 1YACA 1N6KA 2V7PA 2YRXA 3EXHB 1M7BA 1UXJA 1BCSA 3VA7A 3GLHA 3TQTA 1DIBA 1Y5MA 1Q0PA 1QRRA 5AKKA 2OXIA 5B36A 5HFJA 4YLEA 3DUFB 1YS4A 1XMXA 1DKOA 2SNIE 2ZIGA 3UWOA 3R3WA 2XMDA 4AROA 3HB9A 3ETGA 5CT6A 5DTIA 4QDTA 3BEDA 5ALLA 1SCJA 3TRIA 4OQDA 2CE7A 2ILTA 3KIPA 3NETA 1K3UB 1HZZA 3I0MA 1H0SA 4P31A 5F9HA 1NQOA 2FGKA 4J0DA 1WB9A 1C9EA 1NAHA 2C3PA 3A58B 3PNYA 4OXRA 4OL0A 4QYWA 1Z6ZA 1GV0A 2PRIA 3PICA 3OT1B 4JYCA 5CH3A 2OPHA 3WGJA 2IX9A 4ACAA 4EQ6A 4U2CA 1T1EA 2GEJA 3Q3IA 3QV2A 5FPPA 4MRSA 3GJTA 2XKBA 2YDXA 2WWXA 4G1EB 5LZ5A 2AN5A 3LQQA 4HDCA 2D59A 5MGNA 8MHTA 1LLDA 1ZDMA 2NSJA 1VPDA 4B3SB 4DV3B 4CCWA 4Q4CA 3HYTA 2BFFA 3EGDB 3C5HA 3SQMA 5CXSA 1TF5A 2YMLA 1NJ5A 4DCNA 1JUDA 1QZ3A 1S2IA 4N1AA 1QK5A 1PTJA 2Q2VA 3MYRA 1XDGA 3AL3A 4ESOA 5P21A 1QK4A 3T3PB 4INZA 2XOKD 4ITRC 3RFTA 2IP1A 3FKQA 5CLHA 1D4ZA 3NHFA 4MW7A 3BWBA 4REOA 1MBZA 2WVJA 3FJ1A 2H7VA 3ZE0B 1VIDA 2W6CX 2CD9A 4MWZA 5E2AA 4J8PA 3A10A 1PR3A 2EG5A 4H7KA 2P6NA 4GW3A 3GLIE 5JD3A 1PJZA 4C06A 1XMPA 3FYCA 3UWMA 3KZ1E 2FEXA 2FCRA 4MW1A 1R2QA 4TRMA 3GT3A 5IN5A 2VPPA 3HO6A 4FP9A 4K9KA 9LDBA 1AQNA 4I1SA 5HBGA 4LYYA 3UMMA 4ARCA 2QMEA 1T3LA 1U1EA 2NAPA 3QEMB 4I1VA 3ZHYA 3S2ZA 4LFAB 4ND4A 4YNBA 2NSLA 3K0FA 1KAOA 3KLNA 1KO4A 4MWTA 2IHTA 5JYCA 4M1YA 4FGUA 4RJJA 1BU8A 1DU4A 1S3FA 4ZO4A 1O9GA 1SBZA 1BX3A 3QLTA 4N82A 5LDGA 3BQ9A 2H9IA 1PFYA 5TSDA 2DCUA 3I39X 4DJEC 5ERXA 4RLQA 3JWPA 3JW8A 3WKCA 4LFCB 2YASA 4NENB 4WEQA 3U1BA 3B6JA 3MW8A 4HQKA 3HCRA 4KNVA 4XEUA 1X42A 2ZVJA 3DMRA 4CIXA 9ABPA 5IHPA 4JEHA 4D44A 4W1SA 5CDFE 1KY2A 2CL5A 1W85A 1BE6A 4E2XA 5AYVA 3C7CB 4Q7JB 3UV6A 3HLKA 5CVDA 5YASA 1GL7A 2O5CA 1IUKA 4IWNA 4BE4A 1ANKA 4KXUA 3AHGA 1VPTA 1SVOA 1P1CA 3CQ9A 4YCBA 1JKFA 1PWHA 2AYYA 3PUWA 2DFNA 1ZOPA 4ODIA 5KIAA 3ZJ5A 1GFZA 1YBMA 4XGQA 4WLVA 2HLHA 4PX2A 5L3SB 1KY4A 2Q7OE 1Q91A 3R75A 4RW0A 4C0BA 1NKSA 3HJHA 2FK8A 4G01B 5CB6A 3OE7A 3KQVA 4P38A 2V5VA 3OESA 2B5OA 4GBGA 2CNBA 4EJ6A 1DXHA 1T5BA 1X87A 2XBLA 2C8LA 3FB4A 4OLHA 4TKVB 1MFZA 3ANSA 4QLAA 1MO2A 1T1JA 3JQAD 3HRKA 4ERNA 3UT6A 3CZ4A 4EMSA 2WWVD 2OBXA 1JHMA 2R1TA 4KZPA 3ISTA 4RK0A 3ZX4A 2OG1A 2EJVA 3AQ4A 4C0QC 4DNFA 4UBNA 4OHXA 1ECGA 2JLAA 4NZYA 4BGVA 2Q28A 3HKCB 3VPHA 1EVLA 2ZJAA 3MBKA 1P0FA 3E1SA 1S01A 5FTLA 2XOXA 2HSEA 3B52X 2VPWA 3FA2A 3IP6A 1TU3A 2DPXA 3LFUA 4J2OA 1JF8A 2GXSA 3NBAA 4RPIA 1PEKE 3OHPA 3CWZA 3PCTA 4RE6A 1JDBC 2ZBRA 4CKWA 4UHHA 2JKZA 2KWIA 2Q6OA 4ML3A 3V5NA 1XK7A 3AY6A 2VUIB 4ITVA 4KQXA 3PLNA 5KYVA 1ISRA 3O8QB 4KDRA 2B4TO 2DFDA 2J9FA 5ALZA 1XEWX 3CN9A 2D1RA 3K72B 4Q82A 4YMWA 1AS3A 2HJHA 1TM4E 5H68A 4CM7A 4MKFA 1FP2A 2ARKA 3FG9A 3C43A 3OQPA 5CGZA 5BW8A 1CDZA 4AN4A 5DT9A 4CM6A 4TZ0A 1DL5A 1F60A 4FOOA 2PL3A 3L6OO 3WI7A 2Q1XA 4B3CA 3EZYA 4J7UA 5CFNA 2IHVA 5AP9A 4B7CA 1RAEA 3ESBA 3BSFA 2G06A 2Y3IA 4PO8A 1KPHA 5JFTA 1SXJD 5IDYA 1DXYA 4LGVA 4BB9A 1IBCA 2IBMA 2MMCA 5LP1A 4CPDA 1DRJA 1CD5A 2P4UA 5JY1A 1W5SA 3MWEB 3KKLA 4U7GA 2PD4A 5TMBA 2V6GA 5ITSA 3AVYA 2QG4A 1NXTA 3I9V6 2QZPA 4O33A 4HGRA 4YAJA 1G7TA 1OWLA 1RYYA 2NQTA 4HAZA 4ZQFA 1P4AA 3UMFA 3WGIA 1LBEA 2XB8A 1T4MA 4RFVA 5FX2A 2BFMA 2GASA 1UC9A 2ZJ0A 3NGMA 2P5TB 2GLTA 2JEOA 3N2ZB 3NHZA 2CKDA 1R9JA 2X41A 5LXTA 3QKIA 4QXQA 1TFRA 2Z09A 5AVKA 3BRWA 4FYYA 4GICA 3DR5A 2V7TA 4X93A 3TSAA 4CKCB 3GRZA 1FFYA 4Z5XA 4CT0A 3KTAA 3KSRA 4YX9A 1E5VA 5A04A 3I6BA 4OHMA 3V00A 2XKJE 4KR3A 4HD8A 4UAJA 5JRDS 5KJCA 1U2DC 1EE2A 5D1NA 5FUYA 4MVWA 1N9GA 3VYUB 1QQTA 4XEHA 3PK0A 4XYBA 2H5LA 3TYXA 2VHQA 1FS5A 3UAZA 3WV5A 3MGKA 2XUZA 1OFIA 2IYUA 2G4CA 3GJXC 1YB4A 3PC4A 3ZBQA 1DBQA 3Q7SA 3TX6A 2C82A 4RY2A 4EZEA 7ADHA 5KJFA 4RK7A 3WIEA 1J06A 4Q3AA 1E3EA 2RHWA 1VE7A 2OXCA 4PWZA 3TI7A 4CF3A 1TUEA 2XUKA 4ISCA 2YWDA 1ZHOA 3UW1A 4FYKA 4ZMSA 2P2GA 1ZG3A 1OWNA 4B8WA 4EYGA 3EA4A 1N33B 4JX8A 4CJXA 2JLUA 3CR8A 4PYLA 2P2YA 2PRSA 4I9FA 1UQTA 3M70A 4TLDA 4F5DA 5AVWA 3I0ZA 4K6MA 1E6KA 4GXNA 3RJTA 4JR0A 2JASA 3N8IA 4KMMA 5CHEA 4B4VA 3VI3B 3RNOA 3TN7A 5IJ0A 4JOCA 1Q7EA 1UDRA 1U8UA 4AO8A 3TRHA 5H3LA 3GN1A 4KTTE 4Q37A 3ZEIA 3DPIA 5JR3A 2GI4A 2CJXA 3Q3HA 4UNNA 3JWGA 4WI1A 3MJHA 4MQ5A 4BKPA 4HEQA 5EZYA 3R7LA 5EKDA 3C1TA 1VIYA 1DCMA 3CVWA 1L5SA 1I3CA 2JHGA 4RY8A 3OX3A 3CUUA 4TKZA 4TTJA 1JHPA 3QUCA 3RVOA 3TLGB 3JR3A 3OJLA 2R6DA 3C6MA 1UWCA 5CLGA 5CUQA 4P34A 3QLUC 2I1VB 1QHSA 1DBWA 5GONF 2HU8A 3NCHA 3U7QA 5LQDA 4NNPA 1I6MA 4DA9A 4F85A 1GZ5A 2D2FA 5C4GB 1RYHA 1KMHA 4NS1A 3L8ZA 2ZIXB 3SDBA 1E2BA 4C1NA 3FCUB 1EGMB 3TBHA 2VR1A 2OV4A 4XDGA 5TXGA 1CUAA 2EJTA 4YJFB 4OG2A 1H1TA 1C7JA 2JH8A 4TRRA 1I33A 5HZHA 4G86A 4G0OA 4MOWA 5E3IA 2B30A 2PLNA 1DXQA 1GDDA 4GAEA 4BNKA 4UM5A 1NW6A 4NZOA 5NULA 2AFIE 1GPMA 3H6KA 5B4TA 1X7WB 2PZEA 3U6BA 4NK4A 1WHTB 1CRQA 3N0XA 2QEQA 2G09A 1RAAA 2ZVPX 4UBJA 5JNWA 2R68A 3N8HA 2ZGVA 2DJIA 1E5QA 4A8JB 2DQSA 2ZT7A 4FFDA 2Z9CA 5J1SB 1Q77A 1Z0JA 4FOPA 2NU8B 4IIHA 2ZAGA 2A84A 3AJRA 3EF3A 4NCXA 4II3A 5THXA 4ZHQF 4AY2A 5JRJA 4EPVA 4LOHA 1NUPA 4O2AA 3RVSA 2HJSA 2OAEA 4JXJA 4BMYA 5B57C 2OV6A 1KXZA 2VYQA 3A4TA 5KQSA 2YWHA 1DG1G 5DLEA 3U44B 2ZIUB 2DLDA 2WVAA 2Z2JA 3IEUA 3OQ1A 5D7BA 4MUIA 4TWZA 1YUNA 3V7YA 3ZV7A 1Z7WA 4TT3A 4CKZA 1OI3A 3FBTA 4L27A 1UXKA 2E5FA 1NP7A 1UC4B 4YJGB 3T1HB 1EWQA 2R8ZA 2ZJYA 2ZR0A 2ZUWA 5FPTA 4BZWA 4WK6A 1A2OA 1EX9A 4LV8B 5TS2A 1XT6A 3JVVA 4U3JB 1FRNA 5BN5A 4N18A 3ZJUA 4KQFA 1AK2A 1XK6A 2ZRIA 4Q1AA 3R5JA 3SMVA 1P2TA 4IX9A 1JKJA 1DX6A 1MF7A 4FW8A 4KXWA 5DSZA 1OW3B 3PRHA 4NMWA 1OUMA 3UT5B 4G0MA 1KIFA 4CKYA 1K66A 1PNOA 3WHPA 5JUWA 5DW0A 3OMLA 2JHPA 3PS9A 2Q2NA 4FEEA 4JNKA 2VP5A 3ETLA 2JGIA 1E2MA 5A71A 3ZHZA 1MCZA 4YCJA 5AT1A 1I6WA 2O48X 2PL1A 3CVYA 5TLSA 2GCNA 4F3NA 2QQFA 4MV8A 1RM3A 3THWB 1BGWA 1D7AA 3M5PA 5DLQC 1QB8A 1P91A 2EX1A 1NVGA 3MWKA 4GFDA 3L79A 3S2SA 2CZQA 2VK1A 4FS3A 3EVCA 3REGA 2QD4A 3BAZA 5DLYA 2X2FA 3E3LA 4D6XA 5CEJA 3NWPA 2R2AA 4JZKA 2XE7A 1TJ3A 4NOKA 4TV8F 4LXYA 2FPKA 2X77A 3TOZA 3FAKA 4BMDA 2QENA 4YMSA 4NLLA 2GVZC 3I2YX 5J2TF 1OR8A 2BV3A 4CTOA 3NORA 5L6MB 1AVTA 4UE3S 3L1IA 1ZM2A 4M0PA 4QECA 4MVJP 1WMBA 4YJ2B 5BORA 1PP4A 3DEZA 3MJTA 2GFHA 4RXTA 1U4OA 3AVOA 3GRUA 2E18A 2GPWA 1CIPA 4OD0A 4QL3A 3R3VA 5K8LA 1YL5A 4LN1A 4M7OA 2BKEA 2FSVC 2FRVA 1KZHA 5JPCA 4LRYA 1MRNA 1NR1A 1CETA 1FMFA 4NJMB 5B7GA 1WHSA 3ZOKA 2F1HA 2BR5A 2DULA 2HCRA 4REQA 3TDMA 3T9FA 1RKUA 4I3GA 2YJTD 4TLMB 2VLIA 2I7XA 3S28A 5FWDA 1ZVJA 3A1WA 3CBGA 3SX0A 1H9AA 2PS9A 1P33A 1U2PA 3VV3A 1U0FA 4E4YA 1E89A 4UU7A 3SEZA 1DLJA 4C88A 4PANA 1OI4A 2G1PA 4QUHA 4UM9D 2ZTVA 3FIJA 3GRRA 4KNYA 4KO8A 5B53A 4NCHA 2ZRAA 4F12A 1KI8A 3ZHQA 2YVAA 1QRSA 5LC1A 4C6SA 1LSJA 2CFCA 3L4SO 4C78A 5B7PA 2PUFA 1VP9A 1GILA 2ZRJA 3FZEA 1QRUA 1NBOA 2P9JA 2SKEA 5LYJB 2REBA 4NS4A 4R69A 5KSPA 3DJFA 4H0FA 5FLKA 2G71A 1WBBA 1OF1A 2BL4A 1QFJA 2C7VA 2V9CA 2ZSIA 4JODA 4LXTA 2VZ8A 4UDNA 3CRQA 2ZFUA 3OT5A 5EXTA 4GPBA 3NASA 5H4GA 1FUEA 2OMKA 4OBWA 2I5PO 3RWBA 5EJ4A 4LPKA 4GZ6A 1QGAA 3WGOA 4GYWA 2FK7A 5ENZA 3CCFA 4BFSA 4UXJA 5FBVB 1J42A 3KVRA 4OB8A 1Y1PA 4AX8A 1VJRA 1TF7A 1GTJ1 1N2SA 4AF7A 2DBRA 3LMKA 3IUBA 4JR1A 1C0PA 3ABZA 3FB1A 2XDWA 2XRMA 3FNGA 4RQBA 4X6UA 5ELMA 2QTGA 1BMDA 1NW5A 2BGRA 3C41J 2BGIA 1AKVA 1TO1E 4I1IA 4XA8A 3HNOA 5C4MA 2Q8NA 1T0BA 1VKNA 2TS1A 4PXSA 5J2UB 2HR1A 2YQZA 1G5HA 1NLMA 4CXMA 2F59A 2AJBA 3IDAA 1WY5A 3ZWXA 3IDOA 3NHLA 3IUJA 4HAVA 5HKLA 4L02A 2D4AA 4UM9B 5JASA 1BDIA 1HX7A 3KCQA 2FN8A 2MHCA 3H2IA 3VTAA 2PKYX 3FRHA 1ICEA 4WFIA 1LLQA 4YN3A 3X0DA 4BVGA 4XWOA 2VIIA 4KR6A 4HUQB 5TIIA 1OH5A 2FFRA 5FRDA 3WB1A 3WFIA 2TRSB 4CG2A 1H2HA 2WUFA 4HMQA 4OQXA 3R5SA 1WDWB 5L40A 3JYNA 2AMJA 4L72A 4G07A 1DFIA 2FW8A 4RVHA 4PG8A 1A1SA 4M22A 3RRFA 3P1JA 3PFWO 4G89A 5CT4A 4BV8A 3GEDA 3TD9A 1XZAA 2Q3EA 2SHKA 3RQSA 3WK8A 1J2EA 3UGKA 1EFDN 4YFYA 3DOFA 1ZOLA 3TLAA 2I65A 4Q9IA 2D1QA 1YI1A 3BB4A 4B9EA 4ZVTA 2YMMA 1T10A 1WABA 3ISVA 3VJRA 4RX1A 1E1YA 3NEAA 4H08A 3MAGA 2WD9A 1B74A 1G5QA 4EFDA 3FJYA 2QRZA 2BTQA 2XUFA 4RK1A 3TLKA 2FPRA 2QTLA 3LW8A 4HLNA 4XVRA 1P31A 3MUEA 1P5ZB 5JRZA 2VAWA 4J1NA 4HG2A 2H2IA 3RQIA 4K05A 2DPGA 1F51E 3AWIA 3FNQA 4KQHA 5A9SA 2O2CA 1SCAA 4JUDX 2K87A 4O63O 1HNXB 1DAPA 3T35A 4D7AA 1AMUA 2PL9A 5BOSA 3K2EA 3HV0A 4RPKA 1B8OA 4HYEA 3PQ4A 2L0XA 5K7SA 1JFLA 3DFMA 1T8SA 4JX9A 1AV6A 1NC1A 3C6YA 2GZ1A 3KELA 1PU2A 4GU5A 3BH6A 1ORIA 3T61A 4UHEA 1JBKA 4A91A 2AXNA 4D96A 2G5PA 1DBPA 1L3CA 4QLOA 3H7AA 2YIVX 2PYIA 4TKMA 4A6DA 3I05A 1YR8A 1GXSA 4UTPA 1UDBA 4EO9A 4PX3A 3OPQA 2Q9BA 5JZBA 3F46A 4MHOA 4UOQA 3GWZA 2FHPA 1HETA 4I5EA 1JG4A 5H1YA 4E88A 5CG1A 3L7KA 3AVVA 3HDTA 3TM5A 1QDUA 3Q8LA 1AZSC 2VTBB 3D0KA 1XELA 2OUKA 3TAXA 3X1KA 5ALVA 4OTZA 2GKOA 3LHKA 4YUYA 1RSZA 4RTQA 5EIHA 1Z35A 1BCRA 1M0TA 4U9IS 3ABRB 3AM1A 2D5LA 1YR9A 3G5UA 5G0VA 2RD2A 1LA2A 1KDYA 4MDEA 4H9GA 3HXTA 4MYTA 2AXQA 1QCZA 1SUPA 5ELXA 1Z0SA 3K0CA 3CIFA 4CEJB 2VDPB 1KJWA 1SEVA 3FCAA 2FQYA 3COYA 1YBHA 3HDJA 4UVGA 3VR6A 4ZKDA 4G0ZA 1I7SB 2OHOA 3DNPA 4ICIA 4N3NA 3VZSA 3PUVA 3ZWOA 2DX7A 3QELB 5E6RA 3TNJA 2PXAA 4IJUA 1K3FA 4Q1FA 1RS0A 2O3TA 5EUMA 2IW1A 1USIA 2IEDA 3EA0A 2XGMA 3HJAA 4GX0A 4YCAA 4BDSA 5CB0A 3P9KA 1NLFA 5DISB 2GPYA 3T4UA 1Q92A 4ZGGA 5MN5A 4R7ZA 4LS3A 4X62B 2GCOA 2B1IA 3G2NA 3FF1A 3LWDA 3MQ4A 5E0OA 5FDFA 3H2BA 2EIXA 3NV9A 4RMIA 3RU9A 1GAJA 2DRIA 1IY9A 1EG7A 1LQTA 1Z4QA 2NXNA 4FPXA 2VTVA 4P2BA 5LJIA 2AZXA 3QWFA 4GUDA 1NC3A 5I9LA 1L4MA 1I7DA 3WRXA 1OY1A 4D5GA 5BSVA 3G5LA 3M6VA 1HEIA 1M2FA 1O96A 1V8OA 4FKMA 4JBYA 3A28A 4BFTA 1RPZA 2UUCB 2R9VA 3S55A 4RBNA 1ZFNA 2NSYA 1QM5A 3HFRA 3PEYA 2BONA 3FGPA 1W1IA 3L9XA 4BNJA 3STYA 1QTIA 3I8OA 4CL8A 1E0KA 1SBNE 3HUFA 3PFNA 2HWUA 3G1UA 1I2AA 4F06A 5B3JA 1BS9A 1TLFA 2EZ4A 4DLVA 5GTDA 4LOIA 4NJMA 3D7MA 4YT2A 2YJ5A 1Q2XA 1KFBB 2PZMA 1VSUA 3BMQB 2YN0A 4KQ1A 3CH5A 3GQBA 3U6KA 1RI1A 4ENUA 4CG3A 1N2GA 3IEPA 5ALPA 4ZCLA 4GZLA 4FB4A 3JZDA 1LVUA 3VVCA 3GT0A 4B7UA 3SHVA 1E2HA 1MNQA 3EMVA 4YRSA 4CIBA 1KIMA 3PKIA 3PXUA 1NN5A 4M8SA 5K3BA 3D6JA 3U7EB 1IHOA 1PL8A 2NMVA 3WQBA 4TYWA 4HI0E 1RLOA 5JHGB 1A4XA 1V5FA 3IUYA 4NY1A 1YQGA 2HAEA 4N0DA 3ZXSA 1Z37A 3U19A 5ITVA 5A03A 1E99A 3INYA 1N2EA 2PX8A 3T5GA 2BW0A 3N2IA 1PZGA 5I9MA 1RI5A 2RHRA 3V8QA 3I37X 1SQFA 4X9XA 4KP7A 3JARB 2W2QA 2ZANA 3L93A 5KWVA 4CR8A 3D6NB 1RYNA 4DCVA 3WVNA 5IFKA 3FLEA 4UVIA 1WBDA 3BQNB 5FI3A 1WTCA 2C0CA 2X9GA 3IKLA 4I50F 4IYRA 4MAMA 2CLHB 3HA2A 4NWIA 2D5IA 3NR2A 5THKA 3VC1A 3ADBA 1M2WA 2QYHA 5H9VA 1KKUA 1YGPA 3BWDD 4J1TA 5REQA 3SQWA 2OLKA 4LRSB 4NOJA 4E7PA 4JSTA 4JYMA 3L5OA 5EWLB 5JXGA 3E9ZA 4D4GA 1TQ4A 1WULS 4R81A 1G3RA 2QN6A 3GJSA 3GPDG 4D3SA 2CK3D 3CVUA 1NY5A 4D43A 5FWYB 4C0SA 2RHLA 2FZ5A 1GCUA 2H00A 4L51A 4GLOA 4M0KA 1M5TA 1ODTC 1ZU5A 5AM5A 3O8RA 4LMPA 1U3WA 1UIMA 3ECSA 5TRTA 4YYEA 4B74A 2B1RA 5L7TA 4HBZA 2PR7A 2A0KA 2HMAA 1U98A 2EV9A 2NUAA 3G59A 3IVRA 2ZRBA 3DKPA 4E32A 4TKLA 5JNTA 3N9IA 1TK9A 3EFOB 3UMVA 4O0MA 4DQKA 1EINA 1GTMA 2LPMA 3A04A 3KWFA 3R09A 1EPUA 5FR2A 2ZXUA 1UDXA 4JEIA 2EKBA 4WGFA 1LS6A 1PZNA 1Q19A 4DAOA 4N5IX 2G1JA 4BATA 4F04A 4A3SA 2JVIA 4H1TA 1YU9A 1EP2B 1VJCA 3D59A 1KYIA 2GB4A 1GD1O 2XGGA 3HB1A 3Q12A 4IJQA 4LSWA 4TTQA 5ARCA 3RWMB 3V4FA 1TM1E 3X2SA 4N0PA 1GKUB 3VR5D 1CRWG 1Y8RB 1INLA 5K0NA 3I9V1 5TVGA 2QYOA 2DR3A 3KQWA 2A4MA 2P30A 5AJUA 2RHJA 3AFGA 1GFSA 1W75A 4MB0A 2XWBF 1I1OA 2YV5A 4MWCA 4PZAA 2BZGA 4CLRB 4DMGA 1F8GA 2OZLB 5B2EA 2LTAA 4B3HA 2HXGA 1GAQA 2YCLA 3G8CA 3ZWAA 5ER6A 1U90A 2QN9A 3U4QA 1V37A 2A3RA 3QVSA 2QN8A 3V7NA 2D4HA 2R84A 1ZJJA 2FKAA 4PG6A 4ZRMA 1JU4A 3BRCA 3OEYA 3JWIA 1AKMA 2Z1NA 2AOXA 4BYGA 5ICEA 1S2MA 5LMUB 4K2HA 2C7QA 4YASA 1YZVA 5CVEA 2YNMA 1DINA 3FH0A 1N0WA 2VT7A 1II9A 4FVTA 1EZ1A 2RH8A 3HKCA 1EESA 4DQUA 2Y1LA 3DO5A 4HLUA 1JTFA 1F4PA 4XGIA 4ENTA 3TPFA 5EJ2A 3JRXA 1N4DA 4FFOA 2GKSA 4UHBA 3ICOA 2IKSA 2QIPA 3AKEA 3BSWA 2VF5X 5DLPA 5HUQA 2X19A 3AYZB 3FUVA 3A4YA 4X1KA 4EY4A 5DK6A 1K7SN 1QF6A 3TGWA 4WOJA 5HK9A 2IPMA 5JZSA 1UJ5A 5ABPA 4PQGA 4W99A 4QYIB 1WPQA 4Q5IA 2WYWA 3AGPA 3DHWC 3LC1O 4MJ3A 3LM8A 2VDJA 3KXLA 1XVUA 1OX6A 1LLUA 4LSZA 1C7QA 4NBUA 3SSNA 1ZCAA 4L2IB 5HTOA 2JF0A 2A9OA 1XC7A 4BQNA 2CK3A 1Q7BA 2NNWB 4W1RA 3MWFA 3JVDA 2IYSA 1I3MA 2OAQ1 2NO6A 3DZ8A 2UVPB 5C81A 2PPVA 4RSRA 2QE7D 2ZT8A 1H4TA 2PFGA 2CSUA 3TTUA 2ZWVA 4D97A 1YQ9A 1YT5A 1TEVA 5ADHA 1XYYA 1EAMA 3L02A 4KV9A 2P4QA 3KKKA 4QULA 3QK7A 4H27A 3GEGA 5IH3A 2PTHA 1K4YA 2B0JA 1XDSA 1SBYA 2ONZA 3A37A 3E2IA 4C89A 4ZCTA 1Q1BA 1QX4A 1O97D 1NFRA 1MRZA 3MT9A 4X94A 3UPUA 3A1TA 3B2EA 3TOSA 2Q21A 3ZVNA 1EXDA 4BN0A 1JWLA 2JIQA 1DTWB 1WUTA 4W63A 1G59A 3A3KA 4HXEB 4NEHB 4PE5B 4TN5A 3V80A 3C7KA 1U0LA 2WWGA 3CNBA 3RIGA 5LR6A 4XB6B 4KL8S 3G0BA 1A5AB 5AXDA 3GRVA 3F3SA 1OLUB 4A0SA 1IG3A 1FDTA 2X2PA 3PDHA 5FO0A 3ZGNA 2OOSA 4HZUB 3MCUA 3BE5A 1HYQA 1KI6B 5B1HA 3ZU4A 2CMFA 2ZYSA 4AMVA 5EFZA 3BL5A 3QXJA 3R24A 2YX1A 4KKVA 1F8FA 1UP4A 4UHFA 4CM9A 3ETDA 4FYIA 4YY3B 1LNSA 1H6BA 4B7XA 3E05A 4GR4A 3ZLBA 3AUXA 2VYNA 3QVGB 3Q2KA 1AY0A 3L6EA 3QLVC 4P4LA 3PXBA 4DNPA 3VTFA 2R4QA 3DEJA 3HJRA 5JJIA 1NNEA 3VNBA 1OU0A 3GR6A 4XCXA 4NCNA 3H5LA 3G0HA 3OF2A 4ZOQI 4ZAVA 5ITZB 4TSFD 1JBEA 2XMPA 3B6KA 2AGVA 3OIGA 1G20E 4PAMA 1UFKA 2VT2A 2PUVA 3W3ZB 4HDRA 2ATVA 1W5BA 2I4RA 2I1WA 3EVGA 3ZY5A 3OQ6A 3PEFA 3VR6H 2J5KA 4Q4JB 1OAAA 5EEGA 2JDID 2W48A 2XXJA 1U0JA 1L5NA 2C7OA 2JCBA 3QFFA 2J0QA 3SJUA 4UU8A 1AGRA 1PJTA 3AI3A 1T4GA 1PR0A 4DBLC 2HBQA 4ENRA 2C61A 2Z4TA 1ZC3A 1LRLA 1P6UA 4UFPA 2NU7B 3U4CA 3TLMA 1ZINA 2NN3C 3CISA 3PDUA 4X65B 1ISMA 2NU9B 4ATNA 4RGBA 5LP6A 1OROA 4MCJA 2X0FA 1SD1A 2F64A 3AI7A 3CSSA 2ZWPA 3CS3A 3P0IA 1H22A 2QNRA 4J1QA 4C14A 1U3UA 3ZD6A 2EZ9A 3SX4A 2DERA 2J5QA 4ZCPA 3BN3A 4F11A 5FNZA 3OQHA 3MWDA 1D2RA 1PZHA 2GAOA 1H2RS 1I0LA 3IC5A 3KOOA 3W4IA 5FI5A 1CJMA 1HRKA 2FQQA 3OZDA 1JHUA 2HHLA 3VBCA 3NYQA 2QW1A 2I2AA 1XVAA 3M2PA 4AMBA 5EQTA 2FZCA 1BMQA 2DR2A 4HRVA 2NX2A 1DDIA 4H18A 1N0VC 5A7HA 1M2VA 3IO5A 4YRLA 1XI2A 4JT2A 1IVNA 1HQCA 2JI7A 2P1DA 4QU8A 5COBA 5AJYA 3REQA 5KSOA 5GINE 1U1CA 2DM6A 2GHTA 1NXPA 1ZGJA 1BQ4A 1Y48E 2HMSA 1U5BB 4V0LA 1J0BA 3GH3A 1ZAKA 3SC3A 4YONB 5IMBA 2C7GA 3DLBA 1MJHA 4RCYA 1PV1A 2GAIA 3B1VA 1LV8A 4YT5A 4WKNA 2J09A 2AOVA 2Z5LA 3CLTC 1A8QA 1SUEA 3EUAA 5EMLA 1UJBA 2VDNB 1QH1B 2FZ4A 1VLQA 4C0WA 3LV8A 5IJWA 2CNWA 3G2IA 2HQ1A 1H66A 4CHGA 4ZJZA 1U6KA 3QJYA 1ZK4A 1GPDG 1TVKB 3IQGX 4QAJA 2EKPA 4GOOD 4G1BA 1EXVA 1MOZA 4FGKA 5T41A 5BWLA 2P9CA 3RJMA 5AO9A 1CS0A 3JSXA 1IZ0A 2I3BA 4N7JA 4RH0A 5JNSA 3K1YA 1P19A 3WFZA 5CB4A 2JFOA 3NQ41 4B76A 4V0NA 2FP4B 4ZK2A 2A0YA 1WW2A 3RC8A 1NUAA 1CFZA 5KWEA 2UZ1A 2DBZA 5KNDH 1JFSA 2OYSA 1KA9H 1M6YA 1UPAA 1ZIOA 3RUIA 1V2GA 1ADGA 2BOVA 3JYQA 1GYPA 1GU1A 3GXOA 2O2JA 3HJCA 3OIDA 4IFBA 2CXHA 4O4LA 5JWHA 3L4EA 2XD4A 3TXAA 2VQ6A 5KX5F 1E3WB 3PL1A 4G5QA 1N5JA 1VRCA 1SIWA 1ZRNA 5MFPA 3V55A 2CHEA 1QAOA 5H82A 2NU6A 3QOFA 2ZYAA 3K09C 2C2KA 3KP1A 1PD1A 2ZI5A 2P91A 1G8MA 1EFCA 1D6SA 3L49A 4TZKA 3F71A 5AHRA 4CRWB 5AVVA 1R3UA 4FFMA 4UE2A 2D2IA 4HUQA 5C8YF 1QONA 2H5JA 1JHXA 5AKLA 5AVOA 2BI8A 4OYLA 4LKRA 2WG2A 4Y1RB 1M2HA 1TXGA 3Q4GA 3Q2IA 1OX4B 3SDZA 4ZZ3A 1FX1A 1OPXA 3CCBA 4Z0NA 5HM6A 5K3EA 1CCWA 3GJ0A 2JHCA 4OUKX 4PYRA 5AVJA 3ABQB 4WCFA 1EFLA 1EUQA 4JI5B 1GDHA 3FWZA 3BUSA 3VYSB 3QNMA 5IBCA 3H04A 2FEMA 4MDHA 3ACBA 3HDGA 4IIDA 2AOTB 4FFSA 2B82A 2OV2A 9LDTA 3L6DA 2V7BA 2XYGA 3C3BA 1D3AA 3DBHB 3L0CA 1V8ZA 2ZBDA 3L2OB 1Y7LA 2HCTA 1LDNA 1TEHA 2YMPA 3L9WA 3LZDA 2UAGA 3QX7A 2O20A 4FCTA 4FI3F 4IILA 5EP3A 3SDSA 3B9BA 4L9SA 4WJLA 1KI7A 2YOHA 2W6ZA 4RKWA 1UP6A 1BKYA 1XCLA 1F1BA 4YDHB 4CMKA 4EHHA 5KTNA 5B1IA 5CVCA 4L8GA 1AKEA 5IAAA 1REQB 3PR3A 2A5LA 3HJFA 1B00A 1R0WA 1N5RA 5HEKA 2QF7A 2OESA 3LK7A 3SKVA 2J7PA 2WOOA 2LCIA 4EJ2A 5JJKA 5KYYA 5G0TA 3U9TA 2HA7A 1UP7A 4EG1A 4DDUA 3HUTA 4PTZA 5FCDA 4BU0A 2AF3C 2PJDA 1R0RE 2IHNA 4M7RA 2P8SA 1R8XA 4PAOA 4WTOA 2CCKA 3ITKA 1EX6A 4IIFA 3URKA 1NBMA 1XQ6A 4L76A 1GA6A 3MS7A 1PJRA 4PCAA 4F71A 1ID8A 1SOMA 3IE1A 1X1CA 2VHZA 3E22A 3SC6A 5JNRA 1NVEA 5EP1A 3QIVA 4AKTA 4WBNB 4EDHA 3ZHUA 4WJZA 4OJQA 4N3CA 2XWJI 1DZ3A 5ALUA 5SV2A 2ZE6A 1GSHA 3K1ZA 3BYZA 4JT9A 3VC7A 4AJLA 5BUZA 1WXEA 1BD4A 4ONEA 5JH7F 1HO3A 2X4GA 2XWPA 1PGNA 3CF4A 4JITA 4N8DA 3U26A 4CTNA 5KQPA 5EJGA 3SSAA 5KKAA 4RLFA 2XMZA 3FKSA 3NV7A 4KQJA 4Q03A 5JH7B 3HSSA 3P0RA 2CJWB 4U63A 3ZHBA 3S68A 3ZS8A 3FX2A 3OWXA 4LVCA 5EJ5A 3PC6A 4RNCA 4ARSA 4YV7A 3F7MA 3P7MA 4G0XA 4ND7A 4ZV4A 1BA3A 1H8HD 4GPIB 2HU7A 4TTSA 3K0KA 3NBXX 3MCAA 2XXBA 4JFRA 1R27A 1J07A 3PWTA 1FBTA 1ZISA 4PS1A 5LP6C 5E6RB 2Y1OA 5LXTF 1JXOA 1GKIA 2INGX 2QORA 2XTZA 4CQLA 2XKKA 4WCFC 1IFXA 1R5NA 3TLEA 5ICSA 4DUZB 2PSEA 4MUEA 4R2KA 3TFOA 4X92A 2ONCA 3ZV4A 5CA1F 5FI0B 4FKBA 1RTTA 1H6AA 2BGMA 2B7BA 2GD2A 2Q5EA 2W6PA 2XGSA 3OU6A 4L85A 5ALKA 3UM9A 1Z5UA 3DBHA 5KAPA 1NVDA 1H69A 4IP0A 3CN7A 3OTWA 2BEJA 5EY5B 3V4ZA 1OOEA 4Z4HA 2C5EA 2EP7A 4LCJA 2J4CA 4BNNA 4CIDA 2WC1A 1RMYA 3LPNA 4ZU6X 1C8BA 3FXAA 3T3EA 3HXQA 2X15A 4S24A 4LHVA 5FEUA 3TFQA 1J8YF 5DASA 4K5QA 3ON5A 2FMUA 4PHFA 3ZUPA 3COSA 4M83A 2J67A 3KJQA 1B0ZA 1CQWA 4RHCA 1VLLA 2JAWA 1TJ4A 1V26A 2VF2A 3V4VB 4IVNA 3NHBA 1RDFA 4Z4CA 3NGLA 2GTPA 3VKHA 5GJCA 3N7UA 1C8LA 1FCJA 1TTQB 3AK4A 5AVSA 1M2EA 2AK3A 3SQLA 4DR3B 4DC9A 3TNDA 3D3NA 2I4LA 1Q21A 4AQDA 1Z0DA 4KWHA 1DKLA 2NYRA 2B8EA 2IIPA 4V3CA 1TQDA 3ZV6A 1OXMA 4EW6A 3D5EA 1OI2A 3E4DA 1ADBA 5CLQA 4YP5A 1BXGB 1ZXLA 1Z8NA 2QTMA 5A9SB 2ZZKA 4K86A 2D1TA 2I2XB 4GSLA 4IAOA 2XB4A 1PZMA 1BN6A 2KW5A 3KYCA 4RM3A 4I2VA 5IARA 4BX9A 4CN8A 1TO6A 3K9QO 4L74A 2P9QA 3HMKA 3IJEB 2OKGA 5L95A 3SVLA 4U2EA 4GVPA 1TM7E 3MRVA 1DQRA 4RE5A 1YKGA 2HRZA 4FEGA 2ZB8A 1E2EA 4FXOA 1D1SA 4ZOBA 4ZK6A 2ZQ5A 3FOAA 3K0BA 3WLLA 2IYVA 1IJBA 2Y1KA 3P5SA 4DWOA 4LHXA 1IXYA 1L5KA 1YB1A 2W37A 1G9XA 2IOFK 4K28A 4DKJA 3KOUA 3ZHVA 5G1NA 3AW9A 4ZHSA 3UIEA 3HN2A 1E2QA 3KUCA 4EHAA 2NV0A 3NDIA 3Q7PA 3CKKA 4DJAA 4X1OA 5LLSA 1I9GA 4JI6B 1IM5A 5MDHA 1K27A 3EIEA 1NY6A 2ZRCA 4MCIA 3RD5A 3RHFA 3AIKA 1N6RA 4F6LA 1HBJA 1NW8A 3MB8A 4LNHA 4ZVQA 1BROA 3CLSD 4FMDF 4G25A 1GZHB 1G18A 3ITDA 3CA8A 5F1KA 1MB3A 2QGFA 3HDYA 2H4JA 1J39A 4JROA 1D6NA 1F4LA 3DHEA 4CM3A 4DMKA 3G2QA 3OE7D 1K8RA 1N0UA 1XE3A 4M76B 1YZUA 2JZCA 4IBOA 5H81A 3TKAA 2AFIA 4WUVA 1CUCA 2QYTA 3KUXA 4A0QA 1VBKA 1RR6A 3ZQKA 4LOLA 2TMKA 1Y6FA 4UC0A 1E18A 1NMXA 3JX9A 3N2GB 2WF7A 1TCUA 3CRMA 1NUUA 3NYWA 4PN7A 3QU7A 3G9QA 5GM2A 3WLEA 1XRJA 1KC1A 4PGFA 1HORA 2CNOA 3E1KA 4KEAA 1SOUA 4TM7A 1NJSA 4M88A 3SKXA 1X6VA 5K8VA 4WPGA 3AB8A 4HNAA 3MJRA 2H06A 1QORA 2J9GA 1XEFA 2MTBA 2YINC 4R8KA 1F5SA 5BYKA 1NMEA 3DE1X 3HLYA 5L3RA 4Q3CA 5JVDB 2HFJA 3VAAA 5KI6A 1U7WA 1RAIA 4Q7LA 3KQNA 4K2AA 1QX3A 1V1RA 3WICA 2OV3A 4RSMA 2R5NA 2XCUA 3BZBA 2XNKA 1VLHA 2RHMA 3EBLA 3NIWA 2MYPA 3IT0A 4XYEA 4ZOAA 2ORIA 1UKEA 2IWRA 4E4RA 2QX7A 1Z6GA 3VX3A 1XLTC 3WQRA 1K5PA 1EI9A 2V59A 4JL5A 3IOBA 3G7UA 4KSCA 4Y9SA 2AR7A 5EP2A 2FX5A 2WR8A 2C57A 3ZX5A 1FFAA 1FTNA 1Z0ZA 1WOMA 1XRRA 4PYNA 3ZDBA 3Q41A 3W6ZA 4B3TB 3R7BA 5F3DA 1RCUA 4Y98A 5F2NA 3CJRA 2IY9A 3ZYZA 1RRCA 3ENNA 1H94A 1OAOC 3CZ9A 1ZWKA 3F2VA 1OE0A 1GTSA 4GM1A 3DL7A 1YZKA 2ZG6A 3G6KA 4UD6A 1BW9B 5EUQB 1Q0TA 3F49S 2FDRA 4X6YA 3R6TA 1Q0ZA 4LAFA 4Z54A 3SMQA 4CLDA 4OHYA 5AXCA 3VYTB 3W9YA 5M29A 1XMVA 3QEJA 4N40A 5EE5B 3UJDA 1LI7A 1QNLA 3DFUA 3T7AA 3G68A 3PE4A 3W90A 4BQIA 5LQAA 1MN6A 1R66A 3AYXB 1M8PA 2WEKA 1SH7A 4RXMA 2GXAA 4OBXA 4HWTA 1CJBA 1VL8A 4ON9A 2C3UA 4R2LA 3Q8KA 2GO7A 2QM7A 4NR0A 3O9VA 1FYXA 1GQFA 1L6RA 5K9ZA 1CNEA 3LG2A 3LHDA 4J1TC 3VXKA 3WLOA 2X1LA 2OVFA 3PXAA 2WJWA 4O1HA 4QVIA 3NHKA 3UBTA 5EXXA 1FP1D 4J94A 1DTSA 4YP0A 4R1LA 3Q1LA 2H07A 3TTYA 4M60A 3FAZA 5T3YA 3QX3A 3BG5A 4RVGA 4MPPA 3WJ7A 3HE3A 3HM9A 2R7LA 3N0TA 1TJNA 5A7GA 3RC3A 3RU7A 5A5GA 5I5EA 2PBLA 1T5IA 1PEYA 3DTVD 2CB9A 4TVKA 5T3UA 4A0RA 1R64A 2BC9A 1OXSC 2NZXA 1LV7A 2DT8A 3FDXA 4FZJA 4F1KA 3FMVA 1NYTA 2QTVB 5DCWA 3T3DA 2XNDD 2OZKA 3B3FA 3EMBA 3KOMA 4PPNA 4II7A 4UAVA 5LOVA 2ATIA 3MBIA 1OIVA 2KJQA 3EB9A 4JUFA 2I22A 3RVRA 2YWRA 4DT1A 3AZQA 1KS9A 2EWMA 2WSYB 3EIHA 4O2BB 1NVFA 3VNQA 5LOVB 2Z1DA 4HAXA 4KOAA 3DYIA 3ZWKA 3QITA 5CD1A 2Z6AA 3F7TA 1L7AA 2RI1A 3C6QA 1M3SA 1YASA 1Z88A 4UHDA 3VNVA 1UKZA 1EK5A 1XXHB 7YASA 4X1KB 2HF9A 1GQRA 2VATA 1T6BY 5EQFA 4F4DA 3HKBB 5K0EA 2O19A 3PQCA 1XTTA 4WOKA 1TL7C 3K4HA 3MTQA 4KREA 1NKVA 3AR4A 4BMZA 2GXQA 4X1IB 3EZ9A 4DQVA 1Y5RA 2O8DB 1YUBA 4GD3Q 1RRVA 2DUMA 1D2AA 2WTBA 1W1WA 1X38A 1UM8A 1VG0B 2BMAA 2Y2UA 3C45A 3DOIA 1KH3A 1GNSA 3PFCA 4RIGA 4RH1A 2I6FA 3I6IA 1EGVB 3H5WA 4BX8A 3IIIA 4PEVA 3H2HA 4C20A 2JW5A 4PVCA 2B4QA 2YYSA 3JQGA 3ZEAA 4P3KA 5CDHA 2JI9A 3IE0A 1QG0A 2AV6A 3IQEA 1ISIA 3QFRA 5HIAA 1Y3DE 4FSHA 1R0XA 1QHHA 4MI1A 3SHOA 4XIFA 5IWAB 1TM5E 1NTRA 4ALJA 3PVZA 3EJWA 3GBSA 1RZVA 4QYIA 4EK9A 2DCMA 1UKBA 1ZIDA 3SIRA 1UAAA 1I14A 1KMQA 3EE6A 3AHIA 3W4KA 3AR6A 4LE1A 5J4VA 1Z3IX 3QE0A 3ULKA 5JDCC 4Q1DA 1Y63A 3G9ZA 2QRJA 1TAQA 3NAGA 4UNRA 3ZWWA 1U5CA 2BBSA 1XAGA 2QQGA 2QAGA 2X5XA 3JQ6A 3MB5A 3VKVA 1HLFA 3GPIA 4LEIA 2H6EA 2QU8A 3ENZA 1JBQA 3VTKA 4GLFA 3F6YA 4HB2A 1J6UA 3M6FA 4PO3X 3IB3A 2LVBA 5JAOA 4LFBB 3MINB 3RTGA 2RGGA 3K2QA 2XVXA 5HE8A 2A9JA 3DWEX 5EKUA 2VQ3A 1VIAA 4FDTA 1KH2A 5AVTA 5JLJA 1CQJA 4PG7A 2JH9A 2WM2A 4NBNA 4TYMA 2H1OA 1COZA 1YE5A 3ADPA 3LQFA 4OM7A 2ZYIA 3TO5A 2ZT6A 5DGXA 1ZM7A 4GH5A 1CB7A 4G5OA 1Y3AA 3BWYA 5AKXA 2C7RA 3DONA 4PPYA 2VF4X 3QFSA 4F3TA 3R9IA 1GR0A 4EY7A 3KZXA 2AFVA 1TTPB 2Q2OA 3AHJA 5C80A 2CJYA 1JGTA 2PGXA 1L7RA 4H7HA 4LIPD 1ZPDA 4M9QA 5LBTA 2W70A 1XU4A 5D6OA 4RYLA 1XFDA 1KDOA 4KFTA 4NONA 5K3DA 4DLSA 2F3UA 1OZGA 2QG9A 3UNXA 5M2QA 1S8OA 3PGJA 1HPLA 2XSZD 2ZRPA 4BO1A 3PG5A 3U5TA 4W9MC 2ZBFA 1Z73A 2HO5A 2ODQA 1BKSB 1XPJA 3H75A 4GX2A 3LYHA 3SZ3A 4MLPA 2C4KA 2ZT5A 4AWAA 4B31A 2WSIA 4FZVA 4IOJA 2HW8A 1JPVA 3EXFB 2X8AA 3GUZA 3F3YA 4RJIA 4YRKA 4O0LA 2NUAB 2Z95A 5TMPA 4WRRA 3CXRA 1HE2A 4F7WA 2NUTA 2PO5A 4AUNA 4BBJA 3SC2A 1N75A 1TRHA 2GRAA 2QP3A 1S5PA 5CCBA 1ILWA 1NLZA 3WZ2A 3JALB 2GZRA 4O4JB 4AKEA 3IQZA 1WP9A 1RHJA 2CJFA 1YDMA 2ODPA 2B92A 2ZP1A 1KPIA 1JALA 3DYVA 4MUKA 1SQ6A 4R9RA 3IMCA 4MJLA 3RC1A 3H4IA 5TQ2A 4DNQA 2I87A 3WGKA 4J2HA 1C3OA 3OEEA 2EATA 1T0PA 5AK4A 4ID3A 1C3LA 4I46A 4QDUA 1LPPA 4RJLA 5C37A 2QD1A 4DQXA 4PS0A 2EFGA 1M6VB 3H1AA 1FNCA 4CGYA 1GHTA 1Q0QA 4BO7A 5DF1A 1OLOA 5LU9A 4WNCA 5CA1B 2P7HA 1E2GA 3CMCO 3P27A 4D79A 2R3SA 4Q34A 3SBXA 5AJXA 4U6NA 4YA6A 5CVUA 3T1VA 2H1CA 1T43A 4KO4S 1ODJA 2QM3A 2GPNA 3AILA 1FRQA 1HZJA 3ONEA 2HRDA 3EZ2A 2E4ZA 1YIAA 1J1IA 1RLUA 1SOWA 2GXUA 5FA5A 3B3QA 4BMCA 4CR6A 1T9CA 2O8EB 1WB6A 1R6AA 2C2MA 1S3IA 1FRZA 3BJZA 1GPKA 5FHQA 4DXDA 3EIOA 4QPPA 3B8EA 3T8YA 4F60A 5A6SA 3N6XA 2X2OA 1SVSA 2JK0A 5I6DA 3G82C 1C3EA 1EX7A 2YV3A 3GJ5A 2B7CA 1OBOA 3QPUA 4TMYA 1LF0A 3H11A 3QKTA 1IWPB 1E9FA 3KXIA 5HJ7A 3UAWA 2AC7A 5KBYA 3W9UA 4LYFA 2F3RA 3L1UA 2Z9DA 1YOBA 1IMOA 1O87A 2Z8YA 3M4NA 4EB0A 5JI3E 4YTEA 5J2TA 4MYCA 1AQLA 2J9FB 1NU8A 2QZ9A 2VZ0A 1PNQA 2H2HA 3JQFC 2FF7A 4I9HA 3GEBA 3ILXA 4OL9A 4WFJA 5LA6A 3ZKAA 2WNHA 3GVIA 3WIOA 1FNNA 1MA0A 1KOJA 3NAZA 3PRKE 4PRLA 1PFWA 2R96A 3ED1A 3N39C 2CUZA 3COPA 2V7VA 3A14A 4PG5A 4AIIA 1PS0A 5CFRA 5L53A 4YRAA 1EWRA 1RLIA 1FS6A 3Q8WA 5CB4F 1B93A 3MXOA 1H42A 4LPSA 4TZ6A 3EMKA 2B4RO 1RQNA 4AYTA 2Q4BA 3V48A 2V7EA 1PDVA 1RPAA 4O4HF 1FUUA 4ISBA 1A5BB 1OZHA 5JBNA 1UBLS 3KO8A 4DCUA 1JQ3A 4TV8A 3ZNPA 2C7BA 2ESRA 1GGNA 1UL1X 3D7LA 3DXYA 1WNTA 3ND9A 2BHSA 1HDZA 4C4AA 4PIPA 3VOAA 5B64A 2AMFA 5AI0A 5ER9A 3CRW1 1RAFA 3QYFA 1GZVA 4KACA 2PLAA 4H4DA 3CO0S 3GEPA 5KQGA 5J9FA 2R00A 4ZT2A 4K6OA 1CY0A 3CBQA 3BD6A 4UXHA 4WCDA 1AQUA 1NV9A 3CJTA 3RG2A 4Z51A 4ETIA 5FO1A 4HNAB 1TGVA 2QVZX 5A5FA 4BOYA 2VTEA 3V9AA 3B2QA 1GUDA 4CIYA 3PDIA 4ZANA 4FDLA 5EC8A 721PA 1AO3A 3S1AB 2ZATA 2BM1A 4S1TA 4DGSA 2JI8A 2HGSA 4KLZA 5JADA 1OMOA 1Z34A 4G56A 3VKUA 3EGCA 3PNLA 3USCS 5K6TA 1YS2X 4TZTA 1GZUA 4LC1A 3E22B 4TYPA 1IHYA 4G5YA 4BZQA 3OBIA 4EPYA 3OUUA 1QIGA 1WZCA 3DAOA 1UJ6A 4EYKA 2GBGA 2VH1A 4BQSA 2O0HA 4ZVRA 3C3PA 1Z2OX 1IVYA 4FLMA 4B80A 1WKBA 3RGWS 2XX3A 4ENVA 4FNAA 4RK5A 5KOHB 1U0RA 2HRQA 4FINA 2ID7A 3P2IA 2GD6A 3KRTA 4NSNA 3VJKA 4YR9A 1R9NA 2EG9A 3AV3A 2J33A 1I3NA 2RFLA 1XJWA 1REQA 3IRUA 1BWPA 4QWWA 4LJSA 2J3MA 1NJ8A 3LVQE 1CS4C 1EGAA 4JWKA 4DLXA 1YMUA 5IXSA 4DLWA 1MQSA 2WSMA 3K9WA 4P86A 3S1LA 2VUHB 3UHOA 3HCEA 1DG3A 1YB2A 4XSHA 1HTBA 3PGVA 1E3IA 1KAMA 2CFSA 1QLWA 4L8WB 3EFEA 2H51A 3BMOA 1J00A 3EXFA 3NUZA 1YZQA 3GA5A 4JQCA 3HVUA 1IOWA 4C7XA 1NHWA 3B48A 4FBGA 4EGFA 2J5BA 4JENA 2HM7A 2P9YA 5TGZA 4C2UA 2WDPA 3B7PA 1Z68A 5AKGA 2OV8A 1JRLA 4ETNA 1ZN7A 3CPHA 1WF6A 4RZ3A 4RFSB 3UMSA 5BQ3A 1DARA 1NM5C 4UHKA 3JSAA 1Z7YA 1P0QA 2X4IA 3JYPA 4XVHA 2ORED 3WL8A 1V9LA 4XB2A 5DM0A 4CKBA 2P9BA 5JPIA 4EY6A 3FRIA 4DMCA 4JR2A 4EKGA 2NP6A 1R8YA 4XM2A 1RHRA 5AW9A 2I6TA 3K30A 4RKEA 2XF8A 2GWRA 4Q9KA 2Y1XA 4Y9RA 3FPEA 1QHGA 1XA4A 1ZQ1A 1AKWA 2PSDA 1PDOA 4RTSA 4EJSA 1K08A 3OX2A 3KG2A 1PVOA 3HR7A 4MIKA 1JDSA 2Q29A 2V7QA 3JCZA 1H6CA 1P1BA 3MTAA 3P9SA 4YQYA 4CLXA 4WV3A 1HDEA 3GNLA 3QYJA 3WB9A 5LYJA 4JT8A 4ER6A 5DPMA 1XD2A 1JSLA 4ZV9A 1H93A 2OCKA 2YHUA 2CJWA 5DWDA 2JFPA 1WSAA 1JLLB 2A9RA 2HDHA 2PY6A 1ZCBA 3Q15C 3EMDA 4J7XA 4Q4HB 4G1FA 4IZ6A 4V0KA 5I7EA 1LLCA 1GVNB 2Z2XA 1WXXA 4KXFB 1S4QA 2JRCA 1TMKA 4J0CA 2NXJA 3IEKA 3DD1A 4E5KA 1A88A 3QW2A 1GG8A 2WIGA 4DG5A 1YJBA 4WY5A 2X76A 4EKNB 3RROA 3PL5A 3B53X 3IT1A 1QTRA 1X3LA 1CS0B 1XEWY 1TO2E 4LDRA 1SR8A 3U31A 1NTOA 2DH6A 1R4AA 4YCMA 5DI3A 2ONKA 4YCCA 1GL6A 4X7BA 3ZDYB 5U9CA 1DBRA 2P79A 3OJCA 4JC0A 2D8MA 2F3QA 2JI4A 1P0CA 1KMIY 4I50B 4UNIA 4Y6PA 5A4DA 3JQ9C 1KGSA 2I4TA 1T13A 4WNIA 3T7IA 3QBDA 1OSNA 3EPLA 1ZXXA 2O3SA 1VJ1A 2OO3A 4P5DA 2JFZA 4G37A 3JQ9A 4YJHA 3LXRA 3G6WA 1G8JA 4RTNA 3FOZA 4CMGA 4QTZA 3UYKA 2P35A 3C7DB 1V8BA 1CR2A 1RI4A 3EZ7A 3JQPA 1KQ3A 2O14A 1PBNA 3TW6A 3NHJA 3IEVA 4HPJB 3LZCA 3W34A 1CUSA 3JQGB 1BAPA 1W48A 4EIWA 4IIYA 2CVFA 3MIZA 2QW0X 2F1KA 3VBEA 4FM9A 1KYQA 4RVUA 4AF6A 2C96A 3FVRA 3LVBA 2V98A 2MINA 2CFRA 2X3UA 1C9KA 2QRVA 3ZQ6A 2D8AA 3MGCA 4GC9A 1JHQA 1MJNA 3O93A 4P3XA 3BBLA 2GSWA 4FQ5A 3QH4A 5LZ4A 4IIJF 5E8RA 1NPYA 1O08A 4OHWA 3WYDA 1CYDA 3LY5A 3ZXYA 4BBAA 3KKMA 4IHJB 3WSWA 3U80A 5FWNA 4DXHA 1JR3D 1V5IA 2X86A 5JARA 5K5EA 1X14A 2AFIB 1UK6A 2N42A 1S2LA 4A16A 4YJDA 2VKTA 3PYMA 1ZH8A 2FLWA 1NGSA 3KR1A 1W88A 1RBYA 2ISQA 1P1FA 1R18A 2RHTA 3GV0A 3OCZA 3VR3D 4AI6A 4GXRA 2G4VA 3RAPR 5IDQA 1NA5A 1WA5A 3KB6A 3Q6IA 2EJBA 5B58T 1JKJB 2P9GA 1I4OA 4D99A 4R05A 1M83A 5HYVA 4QOGA 5TNXA 3ICQB 4US1R 2GHIA 2JLBA 4NHEA 2FSSA 3H2JA 4QOEA 3ZXIA 4ZI7A 3WP1B 3T7CA 4Y6OA 1RM5A 1Z0AA 3NALA 3QFHA 4LY3A 4DM3A 4FZ5A 2BR3A 3BF7A 2IS4A 3PJEA 3AEKA 3CLSC 4RD3A 1PNRA 2VDVE 3GZ4A 2DPHA 4QELA 3IAFA 4YWHA 2AEMA 4QJBA 1JSRA 1DEXA 1UZMA 2QE7A 4EVIA 2C42A 3ZWPA 4E5YA 2ZUEA 5DGHA 2OHVA 4CL2A 1CY8A 5LQCA 2IBSA 1VL6A 4PG4A 3KQYA 2D5AA 2NT4A 3FLBA 3NVAA 4YJ3B 3W2FA 3IOCA 4IQ0A 2OBMA 3CUEF 3SY8A 1HR0B 1JTEA 3CB4A 4MQUA 1FBNA 2IF2A 1EH5A 3F97A 2HL6A 2GDJA 4IDDA 4A82A 3OFNA 3D8SA 1JXMA 3ZGOA 5EE9A 4LGCA 4PHTA 3DMYA 5AH0A 5AIBA 5IANA 3UB4A 1A4UA 4F3CA 2AYZA 2E49A 3BIJA 3RDPA 3RSGA 4UATA 5HRCA 1T5LA 2FX3A 5BNIA 2V7GA 1NYLA 1QLHA 2M6SA 2VHYA 4Y1FA 1FUYB 1LC3A 2D54A 4FMDB 4YT8A 2Y05A 3VSBA 4DEYA 3ADDA 3KYDB 1FFGA 3ETHA 3O1JC 5T57A 3T7KA 3TQHA 3LLUA 4BJ6A 3R7WA 1M1ZA 3F1LA 5DV9A 5KZMB 1SXHA 3PF8A 1P8JA 1TZBA 3MS4A 4K3VA 4ZVNA 3LFTA 3WNZA 2ANBA 3EEOA 5AVUA 2JFFA 4IIXA 2Z8XA 1VGQA 1POWA 2VHVA 4FDVA 2QUJA 1N78A 3DL0A 1X80B 1EGQA 3FTNA 4ZT7A 3WNBA 4QT0A 1RXIA 1RZRA 1CV2A 1KYZA 2GNOA 3OIUA 4NHOA 3RVKA 1EM8B 2YNMD 1XPRA 5C1IA 2RG7A 1EDDA 1EE1A 1VIVA 3MCWA 4N39A 4QREA 3FD8A 4U2DA 3U3XA 1Y9EA 4PLPA 2KMLA 5B3JC 3EH1A 4LE2A 4D2IA 1KI4A 1C3JA 2GVNA 4UMEA 2C2XA 2PKQP 4QUIA 2ES4A 3TB4A 4X0EA 4EQZA 2E5WA 2YFYA 5A02A 3ZDFA 3W5CA 1FMJA 3OM1A 3BICA 1U0SY 4OOEA 3AF5A 1K3TA 4PQYA 2XE6A 4X45A 4DIMA 1QKIA 3I04A 4B81A 1QFZA 2EL7A 2QRKA 2VQFB 4OGLA 2JHFA 1RJEA 3PFFA 1MD9A 4IF6A 3WMWA 4ZJUA 1QP0A 2JPDA 3HUDA 5HG0A 3PYLA 2JHAA 2NQ8A 5K45A 3GCGA 4P82A 2NZYA 3K71B 4O1MA 2OFXA 5E4TA 4Z0TA 4DS3A 2O8DA 1TPZA 1XOIA 3WWCA 5CYGA 1U6IA 3TGPA 1A77A 3CUSA 1JDUA 1NE2A 3HVIA 4MULA 3THSA 2I6SA 5FAXA 5IM4F 4V38A 1O6CA 1RVDA 2BR4A 2CLDX 2VLBA 3A4MA 3F7NA 3IVMA 3NT4A 4M0MA 3WKDA 2PA3A 2QLBA 2IUYA 2FWMX 1K6IA 3E9NA 4HDNA 2P6RA 4BASA 2QNBA 3C4QA 3ENWA 2IS1A 3ELYA 1X9GA 1UH5A 2V97A 3AF0A 3A27A 3BB1A 3SEFA 1WDMA 2ZM5A 1EFAA 3HZHA 2XW6A 3S27A 4E51A 5LLTA 1TKCA 5HP4A 3BERA 2I2CA 1FJXA 5FPQA 4AZSA 3G8BA 3UB2A 2W11A 2ZVQX 3IDZA 3S2EA 5J2TB 2H1WA 5DBEX 1PQ4A 2WIJA 1HXHA 4K9QA 2OWDA 1TKRA 2RHBA 1KHTA 4RAQA 3NIFB 5SYAA 5JDIA 2R65A 4URXR 3DFFA 4EF4A 5C34B 1PZXA 2GJ8A 5HMLA 1C80A 3RUFA 3SQOA 1UOPA 4MVCA 3ROXA 1ZKMA 2QZZA 3H19A 1XZIA 3ZGLA 1DIOB 3EIFA 5A3JA 2FWBA 3OZCA 2BH2A 2QZSA 3O83A 3ZBUA 1X8XA 3E03A 5EINA 5HJ5A 5LMNB 1NF2A 5CLFA 3ILYA 2YJGA 3PJDA 4LA4A 4DUGD 1P1HA 2XLBA 3BK1A 1QS0A 5K0TA 1KEVA 2BI7A 3P45A 1ZCZA 3CNNA 3X1YA 4QFBA 4B3XA 1E2PA 3RU2A 4AURA 2NVOA 2V6BA 2UVPA 3DBLB 4FSDA 1P9RA 2O57A 5ECDA 2C00A 2X1VA 4TKUA 5DJ5A 5TX7A 3WNDA 4YRBA 2H4WA 1Z6AA 4OXKA 2GEFA 4X85A 1ZUNB 4LY9A 1E98A 4ZDIA 1SBIA 4ZPXA 5EEHA 3T99A 1D4FA 4MS3A 4GOND 4RACA 3WA7A 2XUOA 3I23A 1JSXA 2V03A 3R76A 4NCJA 2J6IA 1OFHA 1EHYA 1UADA 3C74A 4QBKA 2JGEA 1ZR4A 1SHJA 2YQ4A 5IVHA 2CXSA 1AGNA 1XKTA 5ILQA 2BGKA 3PQ3A 4CF6A 4TLAA 5K4AA 1D6MA 4MUHA 1ZK0A 4WL0A 3LSTA 5HFAA 4F9FA 5HHTA 4X3PA 1OLSB 3EWIA 3SX2A 1CRLA 1XBTA 1EFUA 3ZNOA 3OM0A 1FFCA 1XMSA 3AM3A 2VJPA 4FC6A 4TVOA 4XZ3A 4F4FA 1PJQA 1H23A 4XPIA 3STUA 1ZNQO 3DVLA 1J9ZA 3B3GA 1JDPA 4PO9A 4W1PA 1ADYA 1NVXQ 4MTCA 1OXKB 1KO8A 4RIIA 4TT8A 4E33A 5LMCA 1W36B 2WJYA 2JGFA 3DE2X 4GKAA 5BXYA 1AHIA 1RRFA 2HFKA 1OKKD 2PIDA 5D87A 4NKRA 2Y0EA 4OH7A 3OZTA 2HU5A 3IV6A 4OA5A 3ZCXA 1ICIA 3COJA 3LUCA 2A0FA 1E4VA 4I9UA 3RREA 4ARAA 2UYCA 1BIFA 4A8JA 2PUDA 4JQYA