4RKUC

Crystal structure of plant photosystem i at 3 angstrom resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
b'SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
rcsb
molecule tags Photosynthesis
total genus 10
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2014-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rkuC00
1CLFA 1HFEL 3MM9A 3OR2B 1Y5IB 3MMCB 1F5BA 1B0VA 2FJAB 3MM8A 3IR5B 2C3PA 2V4JA 3MM6B 5E7OB 1Y5NB 1WTFA 4L6V3 1FERA 2C3YA 1FXDA 1ROFA 1K0TA 2V2KA 2V4JB 1C4AA 3EUNA 1B0PA 5L8RC 1FEHA 2ZVSA 2FDNA 3PNIA 1DURA 1BC6A 2PDAA 3MMAB 1GT8A 1F2GA 2WAQD 2C42A 1SIWB 1FRMA 2VKRA 1H7XA 1IQZA 3OR2A 1BWEA 1FRXA 2UZAA 4OMFG 2FJEB 3MMCA 1FCAA 1SJ1A 3EGWB 3MM6A 2FJDB 1DFDA 5FD1A 1F5CA 3IR7B 1Q16B 1KEKA 5BYRA 4XDCA 1R27B 3LW5C 4Y28C 3C8YA 3MMBB 2VPYB 3MMAA 1FRLA 4CI0B 3MM5B 4XK8C 2WSCC 1Y4ZB 2VPXB 2Y0SD 1C4CA 2C3UA 1B0TA 1H7WA 4DHVA 3MM7B 4KT0C 1H98A 1AXQA 1IR0A 3IR6B 1XERA 5BYSA 3HKZD 1D3WA 1KQFB 1FRHA 6FDRA 1FRKA 2WSEC 2WB1D 2FD2A 1SIZA 3MMBA 2IVFB 1BQXA 1GAOA 1GTHA 2XSJB 4OV1A 2C3MA 1JNZB 3MM5A 1GTEA 3GYXB 4AYBD 1FDNA 7FD1A 4ID8A 1FD2A 6FD1A 1FDBA 1PC5A 3MM7A 1VJWA 3OR1B 1G3OA 5BYQA 2VPWB 2WSFC 2GMJA 1A6LA 1BD6A 1FRIA 2O01C 1JB0C 1DAXA 1FRJA 2VPZB 3MM9B 1G6BA 1FTCA 2PMZD 4XDDA 7FDRA 3MM8B 2XSJA 1FDDA 1PC4A 2GMHA 1FF2A 1FXRA 1JNRB 5CHCB 4YDDB 2C3OA 2FJBB 1KQGB 2FGOA 1RGVA 1Y5LB 3OR1A 2Z8QA 1H0HB 3EXYA 2PA8D 4RKUC 1BLUA 1FDAA 5CH7B
chains in the Genus database with same CATH superfamily
4OJ3A 3Q86A 2XQCA 2H5EA 4WXWA 2IAJA 1NHVA 5AT1B 3IA0A 5F8GA 1JJHA 3BS9A 2QZ8A 3ZZZA 2F63A 2YNIB 2AMCB 4M5NA 4RW4B 3F73A 1N32J 2W2MP 2ZZNA 2ASJA 2PMWA 3KOAA 3P45B 3MPYA 2Q43A 2RU9A 2IA6A 3AJ2A 2AJ4A 2UV8G 4YB7A 1C1CB 4RBUA 2W2QP 2B5JB 2CZ9A 3P4UB 4O4RA 2WCXA 2XY6A 1FNXH 3SDEB 2N4CA 3TVZA 4H4MB 4TU8A 5AE3A 3BN4A 3IM8A 1KVIA 4I69A 2WONB 2ZWOA 1REVB 5DG9A 1PGZA 3HP6A 1RT5A 1JLBB 4DV4F 3UI3A 2A3JA 3HCXA 4KR0B 3KJNB 4X4UA 3VAFA 2QGFB 1CS4A 1CBKA 2E5IA 3Q8YA 2W25A 2YX1A 4Q5VA 1ULRA 1FWKA 4H4KA 4WFZA 2ZH8A 2NYHA 2P6TA 5L1JA 1CQNA 5EGYA 3PX6A 2ZJRQ 1Q0NA 4X66J 4CNYA 4OZ1A 2WSCC 3M6VA 3TNVA 3WIUA 4P72A 1YKWA 3IXQA 3A3OB 4WYLA 3LGHA 3CD5A 1UP1A 4MKBA 2BXJA 2W7OA 3QO9B 3EXCX 3HF5A 3D68A 2RH3A 3H42A 2YVSA 1OIAA 2V68A 2BJ3A 1HWLA 1NDKA 4LVNP 2XG8A 1SJ4P 2H5IB 2Z30B 3VCDA 1SL1A 2FVSA 2BZ2A 3OFEA 3DM2A 4LJMA 1RKJA 2I2YA 2JZ5A 4L6V3 1FKOA 4F25A 4DR6J 3OSPA 4D3HA 4ZPCA 3HSDA 4KGZB 2R42A 3W5XA 2VBYA 4DEZA 2HYIB 3K2YA 3V81B 4WU2A 2XYGB 4RX6A 1JLQA 3DLGB 2CDRB 4ZPDA 1ZZNA 3QIPB 1MROB 2MHNA 2DKOB 4XPEA 5G0RA 2V6AA 2DH7A 1FWPA 2C2MB 1NSAA 2ZH9A 2A10A 2H54B 5CYQB 5HN0A 1HIYA 4TXSA 2QT7A 5IM0B 3HHLB 4DN9A 2XYPB 5J2MA 3UPFA 4ED4A 4OX8A 4ZMMA 1DAXA 1G6BA 3J7YU 4DX6A 2LU2A 4LMZA 4TLRA 3MPWA 2HHPA 3R9LA 2GZOA 1WG1A 4EBEA 4I2PA 3RBZA 4RW6B 3MMCB 3MM6B 3LAKA 5DG8A 2DGTA 1VBZA 3G8TA 5J2QB 3TOQA 4IG0B 3PHTA 2EWHA 2ZBIA 3CMES 4J9VA 2FZKB 3FQKA 3ILLA 3C66A 3NBPB 2C2OB 3TZYA 2H51B 4ERDA 3K58A 1FJEB 4FNIA 4Y2MA 1SXLA 5DDRC 5KFEA 2J6TA 2B51A 5B7WA 2YWKA 5DDOC 2JFDA 3BEGB 2QC3A 4F3QA 3KMSA 3A1YG 1S1TB 3C3LA 3I96A 4WIQA 2EG2A 4FXDA 3UDLA 4IUFA 2XWXA 2G0CA 1C1BA 3AODA 1N48A 5M2PA 1X0FA 1LK7A 4DQQA 4B9VA 2XNQA 2QG9B 1B70B 3KXDA 1JXLA 4U7UD 4D3GA 1FFSB 3L7UA 5D3GA 3CC2S 3VVTA 4ES2A 3M9MB 1FVQA 5GMKa 2OPPA 4OQJA 1IJFB 4CLKA 5E2QA 1HFEL 3HT0A 2X3GA 3LP2B 4UUXA 5DJBA 5THWA 3KJQB 1VRTA 3RB3A 1IJEB 5HBMB 4ZJQA 1CULB 2D3O1 1B3TA 4O4GB 4ZVOB 4LSNB 1S4EA 3OVAA 2KHCA 4W90B 4LRBA 1PCAA 4B9TA 4LF4F 4JYAJ 4IFYB 2VG5A 4MK7A 5C25B 2F4FA 4B3TJ 1UZDA 3RRKA 3CW2C 3J80Y 1J2VA 5AJ3J 2V9WA 1TFWA 1X5OA 3W61A 1F9FA 2IM0A 1RWXB 5DO2A 4ICLB 2CPFA 3W2VB 3K57A 2B4UA 1M5PC 4GVBB 3W9HA 2OPRB 2VB6A 4C11B 3KK3B 3GG1A 1F3FA 1JLEA 1NLKL 4FZVA 2RF2A 4B3RJ 2R8KA 2DR8A 1NPPA 4KJIA 4X62F 3SBMA 1FHTA 2JX2A 1K47A 3MD1A 1JJ4A 1LW2A 1SH2A 4BS2A 4RNNA 4EU0A 2YNFB 3EDQB 3OL7A 3BQ2A 2K8GA 4RR5A 1WTBA 1IWGA 4NI2A 4F2SA 4AXIA 1WUUA 2HS0A 4QR0A 3OVSA 2B4VA 1I94J 5FD1A 1ZAVA 3BR8A 5KFQA 3ZZOA 3FRZA 1Z2LA 5T7LB 4CI0B 4HDHA 2BX6A 2P2CB 3F41A 4CP5A 1RHUB 4IRCA 2CQ2A 3AD8C 2KM8B 3CCQS 1GTEA 5LSRA 4M5GA 2V8DA 1XC9A 3FSIA 2VPZB 3ZTRA 3PJ9A 1ZM3A 3ENWA 2D69A 2XSJA 3R1HA 1I5OB 3J81U 2VONA 3OFGA 1QAXA 3QRPA 1V6HA 1C0TA 1DBDA 2HK2A 2DRBA 2AYEA 4JB8B 2RQMA 2ZDOA 4N8NA 3PW0A 2O5DA 2R4FA 1WJ9A 3BB5A 2QV6A 2FJDB 4CO3A 3R97A 2YH0A 1TR0A 2HIYA 2MMYA 5HVHA 1P1LA 1NK7A 4BHQA 4ZN3A 4RWWA 2VBWA 1LW0A 5CD4A 1HL6A 1WDTA 2CJBA 3ZFVA 2RJZA 4QCLA 3C14A 1LWCA 1ZBTA 3BPDA 1JXVA 3PIPQ 1NBEB 3TA0A 2D41A 1TAUA 3FGVA 4HT7A 1DTTB 1J5OA 3HHNB 4KRWA 1L3TA 2AGOA 1F0XA 3MM7A 5LMNF 1LXJA 4OZLA 3HHDA 2NZCA 3C6TA 4ZVSB 5HO4A 3OXLA 1OJ4A 3QIDA 4ZIVA 1O6XA 3A12A 5LXYA 3KUGA 2ATCB 1PC4A 1RAOA 3ZXWA 2GVDB 3NRBA 3JSBA 2E1AA 2GJFA 3JQMA 1R0AB 3CGIA 3CCZA 1QE1B 3TJ9A 1HNXJ 4EMDA 1UW9A 2YWEA 3V4IA 3CJSA 4HKQA 3DI6B 4B17A 1OYDA 1L5UA 3N28A 4C8KA 5IQ6A 4F4YA 3M1VB 2BJEA 1N36F 3JSYA 2QL9B 3AQOA 3MM5B 4ES1A 2XM3A 2YNIA 4ED7A 2L48A 3IFEA 2DB1A 4DL4A 4DQRA 1K0VA 5EDWA 2RU3A 1KHVA 1GAOA 1VQ7S 1JNZB 3KTQA 1YBAA 5HP1B 4QWAA 1P8GA 1YWXA 2LECA 4ECTA 3D1OA 3CMAS 3MEGB 4CLUA 1C1CA 4FKYA 4P73A 1CPZA 5D6GA 4YN3B 4KV8B 1WC4A 4QYZK 1RYSA 3SXLA 3SDEA 2WW8A 2ASDA 1UKUA 2VG6B 4H4MA 4H54A 1VC6A 4DUTA 2F9DA 4F4XA 1UFKA 1VOMA 1IBKJ 4DU7A 1FERA 1A0OB 3PHEA 4L3KA 1JLBA 2BW7A 1RCXB 4C8OA 2AIRB 1V3SA 1IWAA 5KFHA 2LEAA 5KFYA 3ILOA 3GIJA 2P9EA 1DFDA 2MKJA 3RJMB 1Z4UA 4XDCA 3AFGA 3EMTA 2FZCB 5B0DA 4ILRA 1AFIA 3DRRB 2W01A 3OTEA 4JV1A 3NGUA 3IGNA 2JJ4D 3I0SB 2M70A 3BZQA 3TZZA 4HTJA 4UQTA 5DGBA 3H5SA 3HZGA 4M1KA 5KFLA 1T3NA 5GAGI 2CQIA 4WIIA 4F0HA 2OEKA 1S0MA 1KLNA 2DGVA 1S9EB 5B0EA 1N5YB 4ZVQB 3D6MB 2HNDA 2OTLS 3K8WA 2B9WA 5IOLA 1FTCA 4V19J 1RWKB 3GQCA 3QO9A 2JLEA 3UN2A 3WQPA 2ZC4A 4DV4J 2G2OA 2XB2D 1GX5A 4K59A 5B0FA 4DU8A 4BC9A 5DGAA 2ZNYA 1GH8A 3I56S 1VIXA 1GMWA 5J2NB 5L9NA 4CLSA 4Y2CA 4QR2A 1S72S 2BQUA 3NP5A 2RQCA 2RD5C 4X4SA 2A6OA 3V6DB 4KPYA 2VF3A 1RT7B 2LVWA 3PYEA 4RNOA 2XHWA 4LVOP 3MECB 4UTGA 4CCHA 1MMLA 1C4CA 1PAEX 4CYUB 4R25A 5H1SV 3V81A 5KFAA 3UE2A 2J7UA 1I6JA 3DLGA 3QIPA 1MROA 4QU7A 2R8JA 1VK3A 2RUSA 3W8GA 1UPPA 1XNRF 4V1Ak 3M6WA 2CPHA 2LA6A 2RHQB 3A13A 4IQMA 5ETRA 2UUAJ 5CYQA 4TN2A 3QAUA 3KNGA 1HMVB 2ZBQA 2BRLA 4PXCA 1F5AA 3OW2R 2JEGA 3RYLA 1SB6A 4IO1A 2LXFA 2JC0A 2YNHB 5LJ3Y 5HMXA 5KG2A 2GAGC 4K5SA 1QSLA 3PO5A 3AB2B 3T5LA 1YJWS 2AD9A 1X4GA 4O3PA 2VKRA 1H7XA 4RW6A 3K17A 5GAHI 3MMCA 5IC6B 2XMJA 3U1NA 2OEJA 3MM6A 4NLWA 2N82B 5EWFA 2HAFA 3BSNA 4I68A 3JXOA 5J2QA 2LEBA 2EFQA 4YR3A 2NXEA 5KFTA 3NBPA 4FYXB 1WELA 1ZTWA 3Q2TC 1SJ3P 5F8MA 1U25A 1D9DA 4YB6A 1DTQB 4ECQA 3MFHA 3KLHB 1RACB 3GLJA 1G3OA 2AZ1A 1S1TA 5M2UA 3I6PA 4ANCA 4HYKA 2MKSA 2C2KB 4CLPA 1U1PA 1Q95G 7FDRA 3PZPA 1XMQF 4OI2A 1FXRA 1JNRB 3QZ8A 1J5EF 1EZZB 2QMUB 5KT6A 1QY7A 2CQHA 3LP0B 3ZTOA 3M8YA 4DI6A 2QA1A 3R27A 2QSWA 1Q82T 3PNIA 4HLBA 1HNZF 2P5VA 3BN7A 4K8RA 4DV1F 3LP2A 2R2SA 4KPCA 3MR7A 2OUGA 1BQMA 5HBMA 3LP1B 3ZZUA 4O4GA 1R27B 4LSNA 2DGXA 4LBPA 1Q1KA 2F8MA 1UJ6A 5KOXA 2E5JA 4OJ1A 2EG1A 3E3XA 2CZ4A 4IFYA 1MNEA 2EC0A 1VRQC 2FHMA 4RJVA 4ECXA 5C25A 2AGQA 3CIMA 1GXLA 4DR7F 1MMNA 3MWBA 1U1RA 3TQ1A 1NK6A 4LF9F 2IM3A 1CJTB 5L9XA 2YQ0A 4U8YA 5FLXU 3KDOA 2RQKA 1AYEA 5CHCB 3TX0A 2F8EX 3KHRA 8RUCA 2YH1A 5KFGA 2OPRA 1SC4B 1WOOA 4PAAA 3T6BA 1F2HA 3D28A 3GFXA 3D6HB 4TY8B 4LF4J 4UOHA 1OQ3A 2COLA 3ZZPA 2GQQA 1YRUA 2YNFA 4ZVTB 3RW6A 4EO6A 2KFYA 4AL6A 2CPYA 3DNCA 1OY9A 4O3QA 2B8QA 4QYRA 2P9CA 4DG1B 4C0HA 5T7LA 3W60A 2KRRA 4A8WA 2I1RA 2L9WA 1X4CA 1JXEA 3EDRB 2ZITA 3FKBA 4F26A 1D9FA 2VL1A 1T7PA 2LEPA 4J9KA 3EPGA 1FWLA 3MR3A 3CVKA 4WJBA 2NPIA 2IPOB 3BH6B 3M32B 2FGOA 3DLBA 2NZ4A 3GIIA 4PXDA 2QJ3A 4N56A 1TKDA 3GFHA 2CQ0A 1R8HA 3PW5A 1YGYA 3J81j 4X62J 1X5SA 3BGFA 3UWTA 2ASLA 4ZOSA 3BKTA 4RU2A 4USVA 2HZCA 1F2GA 4B3OB 2ZHOA 1FKPB 2UUTA 4A8OA 4YOEA 4CM0A 3OXGA 4NYOA 4ECVA 2RRAA 3QLHB 4B9NA 1FESA 2UU9F 4MK9A 4OJHA 3KJVB 1E6VA 3NEKA 4PWUA 4NLDA 5I42B 1X9SA 3ILIA 1WEZA 1H38A 2QSFA 4MKAA 4I7FB 3BYPA 4C2MA 3FEXB 5FJ4A 1I3OB 2CAJA 4FF4A 4QJVA 5SUHA 2P9GA 2FJVA 3EVWA 5HMWA 2KJWA 3DGPB 2JRSA 1FRJA 2EFNA 1M5OC 4EEYA 3UDVA 2ROGA 1SQFA 2W4DA 4K4SA 3JTNA 1N5TA 2NCKL 3HK2A 5BR8F 5KFFA 1GFWB 4QR1A 3M30A 4N76A 1RJJA 1RTHA 3LGMA 2AX1A 3RAMA 4RW8B 1NCLA 3GE9A 1Q5YA 1HQEB 2A6MA 2GVDA 4J9MA 3DDKA 1S10A 3NL0A 1FNOA 2MLZA 3MUMP 1R0AA 3QJPA 4NASA 3A4TA 3MR5A 5CXTA 3A8KA 3IAS9 1QE1A 1V5VA 3CCLS 4AD6A 3U1MA 4DN0A 5L1IA 5KAKA 1U1MA 1FK9B 3R5CA 5DZ7A 4Q43A 1HBUB 4OLOA 3DI6A 3GCXP 5J1PA 4OL8A 5KG7A 2FPHX 1XJWB 2JNJA 2DR5A 2F5GA 4PKDB 3M1VA 2MZSA 4TU7A 1S97A 3MM5A 2ZVIA 3LA0A 4A8XA 5LMNJ 3AJDA 2V2VA 2DJWA 1U1KA 5DDPC 2M5YA 1S79A 2ZNZA 2FLPA 4DL5A 1TTHB 1PJ6A 2OMOA 1WHWA 5IQQA 2HFUA 3I4PA 3PKYA 3OUYA 2VOOA 5HP1A 3RAQA 2DNGA 2JH3A 3TUJC 3H4BA 2D7SA 3MEGA 1HHTP 2B56A 4CTAB 1WC5A 2DK2A 1JLGB 1OSDA 4KV8A 4QIFA 4Z7YA 5K20B 2BRKA 3BO2A 4F4KA 2NXJA 1U45A 2PEBA 3KG1A 3Q22A 2VG6A 1DURA 3DU5A 3W1YC 3KNAA 4ZP6A 3WBZA 4FN5A 2ASYA 3PR4A 3PYGA 3FSXA 2RS8A 1FO1A 2PMHA 1N36J 3OLBA 2XLJA 4S0MA 5IFMA 4ZHRB 5L1KA 1RT6A 2YKOA 3BQ1A 1VC0A 4QIEA 3N0VA 4F02A 4C97A 1XERA 1NB2A 3HXMA 3FUYA 1RE1B 1HI0P 4WE1B 3QSIA 4A8MP 3DRRA 4DV6F 2D1CA 5LSOA 4DUZF 5L39A 3I0SA 6FD1A 2OTJS 3MURP 1S9GB 5HK4A 4KHPF 2QIFA 4AXJA 1YIJS 3CB4A 2HVDA 1CC7A 3GJQB 3EX7B 4ZCIA 4UOCA 2QLXA 3D7SB 3HHLC 1S9EA 1N5YA 2JDJA 3B78A 4YR2A 1M1KT 2RVJA 1Y5IB 4ED2A 4DR5J 3CJ5A 5KFWA 4LT6A 5U47A 1B64A 1TKTB 1M5KC 2AV5A 3AY0A 5J2NA 3W9IA 2ZE2B 3GTYX 4EGLA 4GKJF 3I0RB 3E01A 3V6DA 3BDPA 1TL1B 4H4OB 1HQ2A 1BGXT 4C3MA 3KG0A 5BJRA 2Z4PA 1TKXB 3MECA 3AD9C 3CO9A 1S0VA 4M63A 2ZH7A 1H6KX 1A7GE 1XEZA 4OX6A 3RZAA 2CPIA 4LF5F 1S1VB 4NRUA 3T9ZA 1KWMA 1SCJB 2H5JB 4JV2A 4NPOA 4LRDA 4RBTA 4DUYF 1V9OA 2E5HA 1W26A 2J9DE 1W2IA 2IVYA 4JI4F 2RQ4A 2YNHA 3UDEA 1S7IA 4U95A 3HJVA 4M5JA 2AJ0A 4J37A 4YY3F 3HJFA 2HPUA 4WYWA 4OYXA 5AE1A 1T8EA 4B9SA 5E3AA 1XWLA 1M0SA 3TEHB 4K4VA 2BE9B 1S76D 2LDIA 4A47A 1Y11A 3FVYA 1S1UB 1VRUB 3D3CJ 2E7XA 5KFXA 1FJGF 2WB1D 5F8NA 2Q3PA 1QSYA 4DV0F 5D0GA 4UZBA 3H0PA 4P7TA 3JS9A 3D9BA 3VAMA 2XO6A 3NNCA 2KYXA 2BA9A 1S6UA 3MM9B 2JVRA 3OVBA 1HBOA 4WP8A 1EARA 3BKFA 2F4VF 2CPZA 1DTQA 3LANA 1UWBB 1OY8A 3VALA 1NRKA 1VQ6S 2NSBA 3M6XA 5K8PA 1ZYQA 3K7RA 5CYJA 4N8OA 2E44A 1UETA 3T5HA 3ET6B 3B4MA 1VK8A 4KAIA 3ZTPA 1X5PA 4FKXA 3LP0A 2UZAA 3RRGA 3CJTA 4EK2A 4PWDB 1B4SA 4G1QB 2VBXA 2PT0A 4OZ2A 4WZQA 2GIRA 3EZOA 1U2RA 2AHOB 4M5DA 1GQEA 1T94A 3RAXA 5HJYA 3LQVA 4DFMA 5JUMA 5KG5A 3LP1A 3ZNJ1 1RHJB 3R5DA 1RT1B 5B09A 3UN5A 1YZ6A 4RNFA 2G13A 3KJFB 1VQNS 2HQCA 3SSRA 5BYQA 2VPWB 1WKLA 4J9LA 3U1LA 3UR0A 4R0JA 3D2WA 2XS2A 4LR8A 2KM8C 4F3OA 4CQ1A 1KQGB 9ATCB 2PI5A 3SCLE 4A48A 1JKHB 1JLAA 1WHXA 4QWCA 2XI2A 2XULA 2OI2A 1WKJA 3NMAA 2GV1A 4DBQA 4O3SA 3CPWR 1NKBA 4K2JA 1HNZJ 3PFOA 3FQLA 2FHJA 4K50A 3CNQP 1X4HA 2ZEJA 3RR8A 4NLPA 4K4XA 3VAJA 3DU6A 3B54A 1NHKL 2X51A 2J0XA 4I1TA 1RHMB 2EBEA 1KTQA 1GMVA 4DR3J 2EK6A 4M5LA 3VZIA 4TY8A 3THPA 1XK8A 3I9V9 3U27A 4Q8EA 4HHJA 2KZMA 5A6PA 4DR7J 4ZITA 4X2BA 4W4MA 5B0CA 4G6VB 5KG1A 4LF9J 3IS9B 1HNVB 1S6OA 3V6JA 3SCIE 3T5JA 2G9OA 4MFBB 3DXBA 1DZ5A 1WSVA 3PG9A 2U1AA 3CDAA 4G65A 2H1YA 5I3PA 3QGIA 3OT9A 2DNQA 2Y1IA 3IMQJ 4OJGA 3M32A 1S6QB 1FT8A 3B8HA 2HSEB 3H2VE 1XR5A 2ERRA 4ZS6A 1RSCA 2GHWA 5HLFB 1R0BG 2NLWA 1R31A 2MXYA 3ICLA 2BANA 3N5FA 3QT5A 1KD1T 3EM1A 4NA3A 2JC1A 4B3OA 4KH0B 2R2TA 1FKPA 4MIWA 3PRBA 4EWTA 4CLWA 4P2SA 2XS5A 4R5PA 4ZPVR 4KIAA 2D3ZA 5E3CA 3P6YC 3DMJB 2ROEA 3U02A 4PEOA 3VV2B 2CNNB 3KJVA 5I42A 4YFUA 3LPYA 4FS2A 4IH5A 5A76A 4I7FA 3MOJB 5A8RB 2HGMA 3L7OA 4QW9A 2NUUG 4LQ3A 4ED0A 2HFNA 2Y1LB 3OHBA 4NXMF 1N54B 2BJ7A 1HARA 2MEWA 3DGPA 1D09B 3IGVA 1SI9A 2LQ8A 4IKAA 1Y5NB 2DIVA 4FPIA 3R5GA 2X1GA 4DR1J 3T1YF 4TVAB 3I9ZA 2FVCA 2GQ2A 1N6QA 1TELA 3VGSA 4RW8A 1VGYA 1RTDB 2XC9A 2MZTA 2QLJB 4I2QB 1HQEA 1HD0A 4WKYA 2UU9J 3T6JA 5HANA 2FJWA 2G4BA 1VBKA 5LMUF 1QLNA 2L3MA 3CD7A 4NCAA 1RHQB 1FA0A 3TAMB 4ATNA 1SPBP 2ZH6A 2M7SA 1UZHA 4UY85 1ZH5A 4DFKA 1WC3A 1G7CB 2DO4A 3THTA 1FK9A 3SQGA 3R8YA 3W5YA 1HBUA 5IXUA 4M5IA 3GPAA 2KXFA 4R8UA 3QMQA 4DSJA 3HSGA 1HBMB 2Y8YA 1U24A 1C2PA 5DETA 5BR8J 3AA8A 3IBFB 4DL3A 4DLGA 1IKWB 1H3DA 4ED8A 3KHGA 2E7WA 2MQQA 1XMOF 2V4JA 3DOLB 1VYAA 3GSDA 3MPVA 2KYZA 2CDQA 4CTAA 1JLGA 3QGGA 3I32A 2Q66A 2I5JA 4I56A 4IQXA 1NAQA 2LKZA 1KLMB 4WTOB 2J7KA 3HHKA 3KK1B 3JAMY 3X3UA 1Q81T 1H98A 5RUBA 1S99A 2A1BA 3ENQA 5A8WB 3NS5A 1Y00A 2KG1A 4LF8F 2FVRA 4EFAC 2E66A 3PRDA 3EGZA 4OYPA 1HI8A 1MWQA 4ZHRA 1SH0A 3OLAA 2ZH4A 2OHDA 3NGSA 2J0QD 4A8QA 2V34A 1QJHA 5KFJA 2DNMA 4WE1A 4JI3J 4CT9A 3GU0A 3H40A 5SZTA 4GO7X 3RB4A 2Y1RI 2ADCA 3C46A 1VDHA 5CH7B 1CG2A 5E3QA 3G82B 2I0XA 3G9CA 5HQ8A 4JI2F 1JQGA 2KDOA 1GXUA 5AE2A 1YJ9S 3I5CA 1X4AA 3C15B 4OHVA 2AT1B 3CE8A 4N77A 2XY7A 1AA1B 4UF4A 2MKCA 2JWNA 3I5BA 1VLYA 2VJUA 4EO8A 3I55S 2OP5A 1TKTA 2YKQA 2KVIA 1HBNB 3T41A 2ZE2A 4OX9F 3IWNC 4QU6A 2KZZA 3IO1A 2A0FB 5DLFA 1BQXA 3N5BA 4DV6J 4DUZJ 3I0RA 1NUEA 1MLAA 2DRDA 3MAAB 1CJVA 2XZTB 4KHPJ 3UO0A 4ZP8A 4HACA 4H4OA 1HWUA 3DOKA 5DS7A 4DV7F 4NMLA 1S1XB 4UQGA 3D0GE 1TKXA 3QSYB 3D6TB 2CJXB 1I1GA 4DDFA 2MLYA 3DLKA 2PA8D 3HSJA 2C2EA 4U7UK 1OPIA 4RW9B 2BBEA 5HATA 4DR4F 4HHHA 2KKHA 1W25A 2BKPA 2WW4A 4QWBA 2KN4A 1HHSA 3N6LA 1LOUA 1TU0B 3M2RA 3VGVA 2HWTA 3S1TA 1HNWJ 2VV5A 2QE5A 5DQIA 1PBAA 4K4ZA 4NL5A 3LALA 2HFOA 4HI1A 4DV2F 2HKEA 1RWMB 3SSQA 1H7WA 2L9NA 5JXSA 4O0IA 4OZ5A 3W62A 2ROPA 4FXVA 4J9SA 4CO2A 3CDWA 5EX3A 3T5KA 4P2XA 1AT1B 4ZVHA 1VRUA 2XYHB 1PO6A 3LWLA 2Q79A 4LF5J 2KU7A 4J9NA 3AJ1A 3MGJA 1NU4A 3MM9A 5ETNA 4JI5F 2CG8A 2UXDF 4DUYJ 1F5BA 4OYWA 2DNHA 2V2KA 3J7Z5 1YQHA 1U0HB 1UWBA 4I6AA 1RP5A 2VFVA 4JI4J 2ALZA 4ANDA 4KGMA 5KFUA 4YY3J 3ELHA 2OMLA 4RL1A 5IZHA 3VQSA 2VU5A 3ET6A 3G8SA 1SJQA 4FF1A 2ZFHA 2HK3A 4NX9A 2XY5A 3AD7C 4Q0BB 5ETTA 1YTYA 4ZVFA 3F44A 4G1QA 5KFPA 1PG5B 1KQFB 1FJGJ 1SL2A 2BE7D 2GIQA 3R7NB 4DV0J 3T1HJ 2K7JA 2QN6B 3T1AA 4NMXA 2HS4A 3HDSA 3K5PA 3KUHA 1FXLA 2FC8A 3QZ7A 3FNNA 2F4VJ 3SV4A 4P7VA 4C3KA 1R8PA 2DNOA 2DT9A 2E5GA 2AZ3A 3NCRA 4JI6F 3LPEA 2XS7A 2Y1JA 2DEIA 2DCLA 4PPDA 4Y34A 3ILJA 2AYMA 2MSSA 1TFYA 1JKHA 1D8ZA 1UVJA 1HI1A 1UW4A 2ZM6J 4LR9A 5EX0A 3MCOA 2BJ8A 5J2PB 4ILLA 3CCRS 5CZXA 4QQBA 3J7A1 4GC6A 3N79A 3MMBB 2B43A 1F9EB 3DC2A 3HM9A 4MIAA 3KLIB 4NA1A 2XWYA 2FD2A 4CO5A 1UTAA 2BJDA 5B0AA 1SL0A 1YSJA 2LFVA 3OR1B 1RLCL 3R2CJ 3LUYA 1W2BR 1NHUA 3FFIB 4FDFA 3FCHA 1OQ6A 4ELUA 1N8RT 2RE1A 2X1FA 1T0TV 3IS9A 1HNVA 2N4DA 2R8GA 2GS8A 2GVZB 2LYVA 5J1NA 1FE4A 1FX2A 5AXKA 4MFBA 2EVZA 3KHLA 3UVJB 1BWVA 3UD5A 2KG0A 4NYZA 3AT1B 2HIQA 1NM2A 4DPOA 3MFIA 1YJVA 3FBFA 4ZK7M 1UVLA 4HVZA 2C2DA 1M5VC 5F8JA 1NZAA 4FF3A 5KT5A 1S6QA 1SUQB 5DQGA 5BYRA 4FVMA 2F65A 4L73A 1QUVA 4NYPA 4UZCA 2JEFA 2RKIB 1R8BA 2UUBF 4DMZA 4ZIWA 4OYZA 4N41A 1IM6A 1ZM4A 3OTCA 3VR1A 1S6PA 5LSLA 3TJAA 4J9PA 5K8MA 1V5IB 2R3VA 3M05A 1VFJA 1HWIA 7FD1A 1DJ0A 4URSA 4ID5B 1LFWA 2UXBF 2ZH2A 3DMJA 5D8HB 4U7CA 1DRZA 4QPXA 1SKSA 2XTJP 2G0IA 3F0NA 2Z8QA 5A8RA 4ECUA 1RWOB 4DQSA 1KTVA 2H9ZA 2YKAA 1YG0A 3EZUA 4USTA 4IDKA 3PM9A 5CQGA 4P9SA 1SQGA 3KYLA 4F2RA 3A3NB 2KFZA 1N34F 1SQEA 2HVZA 4PUOB 4F36A 2B9EA 1XTZA 3ZTQA 5GADU 3WZ0A 1VQKS 1DLOB 4RNMA 3DRSA 4DPTA 1SKUB 3TR5A 4XK8C 5F3TA 3QPIA 5KT7A 1RTDA 1SJFA 4I2QA 4DSLA 1TZ0A 2F7VA 1D3WA 4Y65A 2HLTA 4I6YA 2GQCA 2A2DA 4AQYF 3TAMA 1Q53A 1IBCB 2V5HG 2NXCA 2ABYA 5HJXA 1CC8A 2O01C 2HVIA 2VC0A 1JJCB 5HI7A 3TO8A 1WG4A 2RUGA 4NXMJ 2HQFA 1X0PA 4PQAA 1F9HA 4PXEA 4P10A 2HHXA 2YX7A 2AKWB 3POTA 2IJNA 2DTJA 4FYDA 1N33J 1FX4A 4NXNF 2KTQA 3KG4A 1WF1A 2CNKB 2G2YA 4ZPBA 2H65B 2FY8A 2BQ3A 2CRLA 1IKWA 1JLFB 2WB4A 2UUWA 3S6EA 2J0SD 2XLIA 1U8WA 2IC3B 3NY0A 1P27B 3DOLA 2IYGA 3M8RA 2W9CB 3LW5C 3EE3A 3B4DA 4MH8A 1B0TA 2IM2A 2QYGA 2DYAA 4DV5F 3ZZRA 1KLMA 3QJJA 3KK2B 4I4BA 2VJVA 3SCKE 3QWUA 3KK1A 4JOUA 4E2FB 2GC8A 4DSFA 3I82A 2JHEA 1QAIA 5A8WA 2EPIA 4DFJA 4DJBA 4CLLA 2MKHA 2GW8A 4NLUA 4RZRA 1HLWA 3UW1A 3Q8VA 1QTMA 4RBVA 1N0VC 2KL8A 3UR3C 2P8IA 2CNOB 4C8LA 2E1PA 4X65F 2OO4A 5KT4A 5DM7Q 4QOTA 1KOOA 5KFDA 2IMWP 2CG4A 2RRBA 5IT0A 1EQ0A 4ZPAA 1NZ8A 3U7JA 3G82A 1O0PA 3MAHA 2AQ4A 1CJUB 2EFVA 4EBCA 2UVVA 2XMWA 1Q16B 4NZ7A 3P96A 3C15A 4CZCA 4RNHA 4NLGA 3HKWA 3GJRB 1ZAWA 1ACMB 4C8MA 3K0JA 2BJ1A 2KT2A 3O8WA 2Z2MA 1MN9A 5GVQA 1HR0J 2FIUA 2EFPA 2FTRA 2ZBCA 1RBOB 2PN6A 3CTRA 3OPKA 1QUPA 1HBNA 2HNYB 3AXKA 4C4WA 5GAEI 2YKNB 3MR6A 1NEEA 1SV5A 3QWPA 4BDPA 2HBRB 3GMGA 3BQ0A 3NGDA 5GMEA 2ZOFA 5ETSA 3VVUA 1N56A 3MAAA 4RUBA 1GX6A 4MJKA 5AXLA 3TRGA 3TUZC 4XAKA 2ILYA 3DYAA 1S1XA 3OTOF 1KONA 1RHKB 5KFCA 2FVQA 4KSEB 1R0CB 4LSLB 3JYTA 1TKZB 3PJXA 3C16A 3ADAC 3W7BA 4OHYA 5KG0A 4J9OA 4RW9A 2QLWA 4ITSA 4X4VA 4IRDA 4GMKA 2DNKA 2AW0A 4WU3A 1RCOB 2DCUB 3JQKA 5CD4H 4OZ3A 4JUZA 1Z2ZA 3QT8A 4DR6F 1KRPA 2ZD1B 4G1PA 5FDLB 3BR9A 4OX9J 2E1CA 2AU0A 4DWIA 3KFWX 4CH1A 4LFAF 1WEXA 4OYAA 3B6BA 2QRRA 4Y0FA 1X9WA 1MWYA 1NK0A 1YRXA 3G6VA 5F0UA 1UEKA 5HQLA 1S49A 1S0OA 2ZC3A 1RWPB 3TEGA 3UNGC 4J90A 2PE8A 1CVJA 3JB9k 2KB2A 2KHDA 1LNQA 3DCAA 5KFIA 1UVIA 3MXHP 2PD1A 4HT5A 2HGNA 2C22A 3TP2A 4B3SF 2DY9A 3KUEA 5KFZA 3KLFB 4DR4J 3VTIA 2C3YA 2PSZA 2XNRA 2FHOB 4CH7A 4CDIA 1FKOB 5MAOA 1V3ZA 2OSQA 1MW7A 1T3OA 2K1RA 2WAQD 1FRXA 1BXNA 1PSDA 1TL5A 2K06A 3D0HE 2RDIA 1YK9A 2AEMA 2GMLA 1KFSA 1U0HA 4DV2J 1NB7A 1LFPA 4MYUA 1O5JA 1NPRA 6AT1B 5KT3A 2YPZA 1WKKA 5HSPA 2W9BA 1FRKA 3AH6A 4M5MA 3T9NA 1PILA 3HD1A 2DIUA 1SJRA 1E6YB 1X7VA 4WFNQ 3GZ7A 3HSZA 1EX8A 1PYSB 1L3UA 5IWAF 4PPZA 1ITPA 1JWWA 4WFYA 3CCWA 4ELTA 3ZNUA 3L95X 2IRYA 4N47A 3TA2A 1XQIA 3SV3A 3C19A 4JI5J 2Z0GA 2UXDJ 4IFVB 3KHHA 2C3PA 1VMBA 2B7CB 4TU9A 1D1UA 2MPUA 5D78A 4I0WA 4Y2IA 2VG7B 1N52B 1PBUA 1QM9A 2O67A 2XMKA 3PXGa 5H9FJ 2HBQB 1R89A 2PGCA 2G0JA 3PO4A 3RG6A 3P8BB 5E5NA 1HW9A 1NJXA 3IR7B 1WI6A 3UNYA 5LL6d 3PX4A 3TVKA 2I6WA 1RLDA 1GXTA 5J2PA 3MDFA 2VIHA 3V6HA 2NS1B 1KBRA 2WOMB 4FXWA 2L41A 1FEEA 2AEFA 3MMBA 4JYAF 3EJMA 1HA1A 2M0GB 3K5OA 5LM7E 4OZNA 1RWUA 1PC5A 2VFSA 1U1NA 4B3TF 1C1BB 2DY1A 3CDBA 2HURA 3IC1A 3KLIA 5D4OA 2E7VA 4IR9A 5AJ3F 4YHHJ 1RAEB 2R7OA 4G3IA 5D3GB 1VLOA 2V4RA 4LBIA 4LRFA 2L9DA 3VZHA 1URNA 1TK5A 3OR1A 1Q5VA 1RAFB 4USWA 2CQCA 2RT3A 2CADA 3FFIA 1UVKA 1R6VA 2VODA 2XI3A 3EZ5A 3WDOA 2QMXA 5F8LA 4OYIA 4C0OC 4WKRA 1FXDA 1UA0A 3MEDB 1C4AA 3EUNA 1D8YA 3CJ0A 1RT2B 2YNGB 2ZVSA 2GVZA 1DQ8A 1NNDA 2UUCJ 3DN9A 2E29A 2MZQA 3DOMB 1YJNS 1U1LA 3UVJA 4RW4A 2R2RA 3GG0A 4PG7A 2AF6A 2SXLA 4FBTA 2ZKTA 2AX0A 2HW3A 4U96A 2VA2A 4C8NA 4ZVPB 4M95A 4Q2MA 3UCUP 2VG5B 1Y4ZB 2ZOGA 2VPXB 3TI0A 2G1DA 1JJ2R 4IG3B 3I5AA 1S59A 3R5BA 1SUQA 1IBMF 3OFFA 3GIRA 3OTDA 2B5JA 3BH7B 2OFGX 4F67A 1IM4A 3TUPA 1NSPA 3BV8A 1F3VA 2WONA 3PTWA 1REVA 3W8PA 3DHWC 3CSKA 4ID5A 2W2OP 2CFXA 1FI4A 2DHGA 2MZJA 1BLUA 1NK9A 4C6AA 3MCNA 4IRKA 2IDEA 1F6TA 3EVMA 1T9UA 3L4BC 5HL7Q 4QZVB 1FD8A 2VC1A 5H9EK 2Z2YB 2MQ8A 4P75A 1Q79A 4NI2B 4OI4A 2XGQA 1W7WA 4PWWA 3QGHA 3AB4B 5K8OA 3QJLA 2VPYB 2ALYB 4OFZA 3NS7B 4PUOA 4AL7A 2Q1LA 2HHWA 2J8SA 1DLOA 1ZM2A 1EIYB 1F1BB 3SEOA 1EAYC 3L7PA 4CT8A 1GTHA 3N01A 3H5UA 3E8OA 1XNQF 4USMA 3O6QA 2AGPA 2CJKA 2UXBJ 2B4PA 1IR1A 3QATA 2RILA 3R1LA 3IRXB 1GNKA 1KKHA 1SC3B 5ETLA 2ZKUA 2V67A 4ZKAA 3BM7A 1U02A 4FYYB 2VQFF 1HNIB 3JTOA 2DEJA 1NJYA 3IR5B 3MOZA 2DR6A 2J0WA 5L38A 3FCVA 2FZGB 2EBGA 1N34J 2J8AA 4WK1A 3AQPA 2C2NA 4NLVA 3EGWB 3C6UB 4JBCA 2M2BA 2MJNA 3FZBA 1JLFA 5D0EA 2CJ9A 3ISND 2IC3A 3G6ES 4KT0C 2E9TA 3HFZB 2POKA 3A8IA 2QO3A 4JI1F 1HHQA 2LXUA 1RK8A 2HGLA 2W9CA 5IM0A 3H8YA 4RW7B 1OWXA 1X31C 5CYMB 2RRNA 2YY3A 4AQYJ 3HHLA 1A9NB 5T41A 1EQMA 5CCLA 3OFHA 1VQYA 3KDNA 4FYVB 2MJUA 3MTKA 3C6TB 3QAEA 3CCTA 3GCWP 1N0UA 2F9JA 3J81Y 3UD3P 3I87A 2X1AA 4C0BA 2BV3A 2IYIA 2YX4A 1QSSA 4OZ0A 2XMAA 1N5QA 4NXNJ 3DLEB 3QFHA 3EPIA 3RU0A 4IOBA 4IG0A 3HLUA 3PEJA 3M2VB 8AT1B 3DDNA 2FJEB 2ZZTA 4DF4A 4EYIB 1IBKF 1KHWA 3W65A 4MAKA 3OV7A 1G2EA 1WOSA 2HQGA 4X4NA 2Z56B 1CJUA 5C42B 4DV5J 3R5AA 3J80U 3WC2A 4DZDA 5CCMA 3GYNA 3W63A 2MSTA 1WSRA 2QTWA 1RA7A 2IJFA 5CABA 1IR2A 2GMJA 4KKOB 1OYEA 2OFHX 3CCES 1CJKB 2QA4G 3TJ8A 2GMHA 1ZA1B 3OL9A 5LOQA 3PFEA 2FJBB 3RBDA 1BUXA 4WFXA 2HNYA 4BWMA 4A46A 4HDGA 4C8ZA 2YKNA 2EFGA 5KFKA 1ICEB 4X65J 3P3DA 1CULA 4F0MA 2YWHA 3K89A 3W66A 1RZMA 1M1HA 4O23A 1RWVB 4YP3A 1SVDA 4TY9A 1I51B 4LSLA 1TKZA 3SQOP 4RO0A 4F4ZA 1NDLA 2C2RA 1VQ9S 5I4MA 1FVSA 2MGZB 1FRLA 3O2IA 3CC7S 3MUTP 2C3UA 3DFEA 1U8SA 4ZCMA 2V8GA 5KFVA 1WHYA 3GB0A 4X4OA 4X4TA 2EXUA 3NWGA 1IKVB 3MZIA 3DRYA 4ICLA 2FLLA 4EUVA 3TQEA 2ZD1A 5FDLA 3W2VA 1RAJA 4USUA 1MN7A 3PDNA 4GVBA 1O8BA 2CQPA 4C11A 3LOUA 2IHR1 3KK3A 4DS5A 4C3LA 2HNDB 3MM8B 2UVRA 2VBZA 2W2NP 4OYOA 2VDHA 4M5HA 4OI3A 3VAHA 2QA4S 1NDPA 2D3OR 2ACYA 2Z2LA 1KVKA 3OTOJ 3OHAA 2ZJQQ 1RBLA 5IS2A 3GFYA 2DPIA 2UUAF 1Y3JA 5D0HA 1YVFA 3VHQA 3MMAB 4PYDA 5E3PA 4ECRA 3VGTA 2L08A 4OMFG 3KLFA 2RMLA 2HFSA 4FYWB 3LO3A 3Q8RB 3RBXA 3PACA 1NJZA 1BHNA 1CQMA 4A8SA 4FVCA 4GRSA 5L46A 4OHZA 4USJC 2RDJA 2WSEC 4LFAJ 4X4RA 2DD8S 2ZH1A 1OMSA 1UWAA 4AYBD 3GILA 1DQ9A 2XCAA 4BCAA 3ITHB 3M7VA 4PG8A 1Q8KA 2DNRA 4CRJA 2IBOA 4EI2A 4LF6F 1FDDA 3FMWA 2B4OA 4CLYA 1WDDA 2KO1A 3DGVA 3EXYA 1E6YA 2BVZA 2BR0A 4B3SJ 3UFCX 3HHEA 2DNPA 4QWEA 2MTLA 3GYGA 2ZDPA 5CZVA 2R8HA 4P52A 4NLXA 2HBZB 5DZ6A 1B0PA 2X7IA 2W4CA 4M8LA 2PDAA 4MMOA 4IFVA 1N5SA 4YUDA 3R2DJ 1FCAA 4AL5A 2V50A 4HL9A 1WI8A 4L75A 4B3MF 2VG7A 3CIZA 2HMIB 2F40A 2DHAA 2MZ1A 1FTRA 4LREA 2WVEA 4TKTA 1AROP 8ATCB 2NR0A 2H48B 1DTTA 2WHOA 3NAHA 1K9MT 5M2RA 3OL6A 4KGKA 3PV8A 1TL3B 4L3NA 3GIKA 1VBXA 3G6XA 4K5RA 4DSIA 3FZ2A 3R7SB 2NREA 4JV0A 4DV3F 1IN0A 2EK1A 4ZDNA 1QD1A 4AFFA 3AAWB 1OO0B 1UJ5A 2WOMA 5IWAJ 3EVOA 4XO0A 2D3UA 5F8IA 5C5JA 4R0EA 2H4WB 3GWCA 2YWFA 2V2ZA 1RAGB 5KFSA 2BM0A 4NE9C 1BMQB 3DKDA 2BE2B 3FEYB 1L3VA 4NLRA 1T11A 3Q8SB 2LA4A 1LKZA 3E51A 4IOAQ 4E98A 2CQ3A 1IBLF 4K7QA 3TYTA 4L72B 1AW0A 3MEDA 3M8QB 3PW2A 1BQMB 1RT2A 4Q2LA 2YNGA 5AXMA 1RT4B 2ZUGA 2R7SA 3UN3A 2Y0SD 1UMJA 3DOMA 2R7TA 3CD0A 2VFRA 2GJ2A 2PIIA 4WZMA 4EZ9A 1KSPA 2VASA 1HD1A 3GJSB 2KRBA 2AYBA 1RTIB 4X4QA 3PVXA 5KT2A 2ILZA 4V19X 1D0EA 4IG3A 2R7UA 2DH8A 2PMZD 2BQRA 2C3OA 1UVMA 2OELA 1TQLA 2YPYA 2OD4A 4DX5A 3Q23A 1AFJA 3BKUA 5E0OA 4FNHA 5GADI 1GEHA 5KOWA 3W64A 4JV5F 4DF8A 4DL7A 1KVJA 2JEIA 2C42A 3WC0A 4WCEQ 3D67A 2AP6A 4DCOB 1YDLA 4PCQA 3TAQA 4XPCA 2YKPA 1H2UX 3HT3A 2PA3A 2IA0A 4EBDA 4OYMA 3EICA 3MUVP 1S1WB 1TK8A 3CEDA 4K4TA 1RT3B 3PKMA 2MDAA 1K8AT 1IBMJ 3HKZD 2FLNA 1YRTA 1T9VA 5AXNA 1RYRA 2QLFB 3DXSX 1QAJA 4ZCKA 4KB7A 3AXMA 4HHUA 2J6UA 3HO1A 5FLXY 1Q4RA 2VHGA 2WVDA 1M90T 1TVRB 3V6KA 2J76E 4HH1A 3BBCA 5K5MA 4CO4A 2V4QA 3EWGA 3SYZA 3NCQA 2FHJD 1RQ0A 4NLOA 2V69A 2C2ZB 3IRXA 4OYBA 4CLZA 1T02A 1VS3A 1AZSB 1S4FA 5H9FK 2MLXA 4DR2F 2EW9A 4ED5A 5KTQA 1QDUB 1KDNA 1HNIA 4N7TA 5K14B 1TMMA 1FE0A 3D1QA 1RT7A 2QFIA 3C8YA 2H3EB 4CYUA 3GSIA 1E6VB 1U1QA 1ZZFA 1OY6A 1YBTA 4O3RA 1RUSA 4DL2A 3C6UA 3BGRB 2M88A 4I67A 1X4DA 2DO0A 3BDEA 3W2WB 2C3MA 4HEA9 2IBKA 1XNQJ 1X8DA 4K4UA 4DPYA 3MEEB 4B9UA 1HMVA 2MKYA 5KFBA 5GAEU 4Q7AA 1T9TA 2XMTA 4A4JA 2F1FA 4AUKA 2CJYB 3OQ2A 4RW7A 5CYMA 4B9LA 4KFBB 2W8KA 2BYCA 2XEXA 4KHRA 5IT4A 3CCUS 2FHKA 4PQUB 1NO8A 3M30B 2CUYA 2VQFJ 3CUNA 1RTHB 5EWGA 3BBFA 2LQ5A 4O44B 4FS1A 2CPDA 2P6SA 5D15A 3M9NB 4WXOA 4LIRA 2HFVA 1SKRA 3DLEA 2DR9A 1U48A 1NH8A 3WX8A 2HAIA 1XNRJ 4IH7A 3GIMA 2W24A 5JMNA 3M2VA 2KH9A 3ENVA 3M6UA 1Q8IA 1VCTA 2JLGA 3N9UC 3RGIA 3KLVA 3L09A 2HHQA 4DPUA 4JI1J 3Q24A 3MPDA 4H4KC 1UL3A 2J9EA 4YR0A 1K1QA 2QL5B 1OS5A 3KLHA 2HHHF 4LUBA 3KLGB 4BBYA 5C42A 4Q8FA 1Q8BA 3RB6A 2OJ3A 3CJKB 4YB5A 1T9WA 2W8LA 1U26A 3IG1B 4NZ6A 3OUYB 2R9LA 5CAAA 4A8YA 2EFOA 4KKOA 4DX8H 7AT1B 3GV7B 1CJKA 1B99A 2YBVA 4Z37A 1PJ5A 1WOPA 2KT3A 3GR0A 3JSMB 1U1OA 2CZVC 1JX4A 1S77D 4OI0A 4K2XA 5L8RC 4O3NA 1S12A 1PIEA 2AWZA 2PFDA 5IV3A 2HRYA 4URQU 1IQZA 3FEZA 2E9RX 3H5YA 1YI2S 2VKZG 2VDIA 3GV8B 1KOHA 3SFGA 4DR5F 4PR6A 4N5SA 2B9XA 2W7AA 2GGPB 2WVBA 3H5XA 5BXIA 3OJUA 3CT9A 2HZVA 4M94A 1RT6B 3O1LA 2HS3A 1FRHA 1XMQJ 1Z1ZA 4LF1A 2MGZA 1J5EJ 1RA6A 2WTFA 5HQMA 2DNYA 4JI7F 2ZBRA 1TL7B 1CJTA 4MIBA 5D0RA 5F3ZA 1XN9A 3TANA 4BC7A 2Q6CA 4F7VA 2VZ9A 1IKVA 3CD6S 3PX0A 2KVQE 3G96A 1HW8A 3N4WA 2VA3A 4W98A 1LEOA 4ZN1A 2DVIA 1KN6A 4DV1J 2UV8A 3W3SA 1WC6A 2RIJA 3MM8A 4BLGA 5E7OB 4NRTA 4P2FA 4U67Q 2CVIA 2RNEA 4IR1A 2GO8A 3BREA 3MF5A 4ELVA 3TZXA 4QPTA 4K4WA 1KFDA 3D3BJ 1X60A 2YTCA 3N6NA 4LIWA 3MMAA 1KC8T 3HZEA 1U2FA 4F0KA 4JP8A 2B6AB 4X64F 4ECWA 1AXQA 4PG5A 3E01B 3X1LB 2KJVA 1YX2A 4DG1A 6FDRA 1Y0HA 3MMJA 2M8HA 4B02A 2OSRA 2XMMA 5LXRA 4TNOA 4ZCLA 1ZETA 3TX8A 4OHWA 1YLXA 4KY3A 4HI2A 4BWJA 4C7QA 2DHHA 3ITHA 3H59A 1M5HA 4ZP9A 2CJQA 3W5ZA 3ETOA 1VHIA 3PW4A 5HROB 2FDNA 4CO0A 2ZOMA 3SCJE 2BEFA 1HWKA 2ZUAA 3QLHA 3T3FA 3BSAA 2J6SA 2PC6A 2ZHAA 4Q45A 2HQIA 1LK5A 1AUDA 4KYZA 2W7PA 2AJ2A 3MEKA 4MK8A 5LJ5Y 2WVCA 2EI5A 5A2QY 1TK0A 3GONA 5KG6A 1HPZB 5E33A 3OD2A 2HMIA 2DNLA 4CH0S 3ISZA 4PXBA 3GYXB 4OLPA 1FD2A 1UA1A 3PIOQ 3CCSS 3NKYA 1NDCA 5EUHA 2IM1A 4WF9Q 4U8VA 1T05B 2DISA 3CJ8A 2DBBA 2DGQA 1TL3A 2QL7B 3HVRA 4LF6J 4XDDA 2MQPA 2OPSB 1HBOB 3BJYA 1VQ4S 2Z57B 5DRKA 4F04B 3CMQA 2FGCA 2R7WA 2APOA 4MTPA 3I31A 3D66A 1AUSL 4UT4A 3HULA 2GO9A 3TA1A 2VFTA 1B0VA 4WWSA 3H4DA 2HLUA 4YQWA 1C0UB 4W92B 3ZC4A 2HRUA 4NCBA 1GT8A 1NKEA 2D9PA 2PEHA 2BE2A 3CCVS 1M5SA 4DX7A 2V0NA 2LMIA 4RUCA 1EHWA 4B3MJ 1TUVA 3IWLA 5B0GA 2V8PA 1TL4A 1APSA 3KKFA 1HKAA 2EKNA 3M8PB 3VQTA 1RAAB 4M5DB 1RBAA 3K5NA 2B7BB 4Y00A 1N88A 1QVFR 3M8QA 2CIMA 2V8VA 3BO4A 1RT4A 4J5OA 4TYBA 4A8FA 2XZDB 4DZ6A 3O3LA 4DV3J 4PABA 2A18A 1ZM9A 1XMBA 3RTVA 3CJ2A 2HRTA 4DR3F 1VQ8S 1J27A 1IKYB 3OL8A 3PW7A 1RTIA 4EYHB 4MKVA 1S57A 3DHXA 3ENAA 3HX9A 4TYAA 3D0IE 4ZVGA 2G2ZA 1JIHA 1ZPWX 1JLAB 1RU1A 5DDQC 2Y8WA 4QW8A 3PRVA 2OKQA 4ZVRB 3HFKA 3K5MA 3HPOA 2DXEA 3VGUA 2R7XA 2DR7A 2DNNA 3MAQA 1NSQA 2W4PA 2N7CA 3A8JA 2PI4A 1IBLJ 2UP1A 4Y2AA 2BOAA 3R7BB 2DPJA 3D6FB 5ETPA 1PYTA 2XBPA 2OLWA 4CIOA 1JMTA 3CWJA 3MHYA 1P9QC 5A0YB 2CQGA 2B9YA 1VQOS 1RTJB 4Y28C 2K3KA 5A6WA 4WBFA 4AE5A 5HVFA 3H2UB 2FLOA 3Q8PB 4LF2A 5BYSA 3M8ZA 4Z2XA 5E41A 2EKYA 3DRPB 4PZVA 1WACA 3Q8UA 1RWWB 3NOCA 1S1WA 2CPEA 1S9GA 3N6MA 1FDNA 1RT3A 5I3UB 2XLKA 1NPKA 2N3LA 2LCWA 1TUWA 3ZZYA 5F9LA 2MQLA 1RISA 4YMEA 3CXCR 1K1SA 3VF0B 2KT5A 1Q78A 1U09A 4PG6A 1SH3A 1VISA 1YHQS 1RKIA 3GV5B 1TVRA 3BYRA 4DPXA 1SC1B 4B08A 1ZAXA 5L1LA 4JV5J 1BQNB 5A8KB 1DQAA 4ED1A 1QVGR 1T9XA 4L76A 4QBUA 3V2UC 1H72C 1BE4A 4DFPA 4ECZA 2NSCA 4C8YA 2DNZA 1AZSA 2BANB 1NXIA 1EETB 4DR1F 5ETKA 4XIUA 3QT7A 3VAGA 1X5TA 2B0GA 2AYGA 2JVOA 2OD6A 5K14A 1TL1A 1MU2B 4R5PB 2RB7A 3FBBA 5K8NA 2MQMA 2XMUA 1RI7A 2F8HA 4LQ9A 4OV6A 3BBBA 2G1HA 2WRMA 2GX8A 1X9MA 3K8VA 3BGRA 3D5MA 4PG4A 1WG5A 4E8UA 4JI8F 1S1VA 3O5TB 3W2WA 2GNKA 4OZJA 1RWNB 1RGVA 5HMYA 3NLCA 1NH7A 3MEEA 1YJ7A 1EKRA 2QEXS 1T03B 4RWXA 5F0WA 2X1BA 4KFBA 3KWMA 4GKJJ 3F56A 4ES3A 2FUG9 1IUJA 2MKKA 1Q8LA 4DR2J 4PQUA 2YXLA 4NZ0A 4I64A 3QRRA 4U9RA 3DRXA 2DRAA 1N6QB 3NOGA 3TW0A 5ADZA 3LWMA 1T95A 2MYFA 3TZWA 4AT1B 4O44A 4XTTA 1QTNB 4WFAQ 3QRQA 3O44A 2HEKA 3HVAA 1H2VZ 4NLQA 5KFNA 2DGUA 4KE5A 5CA5A 3TWZA 2WVFA 4K0KF 2BOPA 2HG4A 4USHA 2MY7A 1S1UA 3G4SS 3IRWP 5JVHQ 3HVTB 4KGXB 3FDSA 2RAQA 2UXCF 2FJXA 2OPQB 1NK4A 1LWEB 3SQGB 3W9JA 3V4MA 2M9KA 3EYZA 1TAQA 1LWXA 4ED6A 3SIPB 4R8UB 3L3CA 2MQNA 3AA9A 1Y9OA 3KLGA 1VBYA 1WNEA 2JFKA 4GKKF 2BW2A 3CJRA 2FY1A 3C2PA 4KQZA 3CJKA 3OR2B 5H9EJ 2XSFA 3G6YA 4LBHA 3OTBA 3Q2SC 3NNAA 3IG1A 2BDPA 4JI3F 1ROFA 2QYCA 4PRFA 4IYQA 2V4JB 4ENOA 3TVYA 2KI2A 3G2XA 5ETQA 1BWEA 4PWDA 2QA2A 4KGVB 2W1BA 3V5RA 3GFZA 2KFNA 2CQBA 2WK4A 3JSMA 2I5JB 1Q7LB 3DLHA 2V63A 2ACMA 1P6TA 4UOGA 2MY8A 5DQHA 3IN5A 3NWRA 4C9DA 3CDUA 1K73T 4USKA 4NA2A 2LDYA 3PR5B 3OJSA 1RT1A 1P1TA 4JI0F 1YITS 2DH9A 2LQJA 2HHHJ 1S9FA 2F3JA 2DGOA 2GGPA 3QT6A 1XR7A 2ZZMA 2YQ1A 4G1IA 3OSNA 2AEJA 1N4LA 1MMDA 2YWGA 3A3PB 4KO0B 2BUNA 5G4DA 5GMDA 4IH6A 2ZH5A 4Q44A 2VFUA 5D4LA 4YDDB 1TL7A 4P71A 3PCOB 1S0NA 1ZOTA 4QIVA 1GK8A 2C28A 1UFWA 4LFCF 3E2EA 1S7HA 3RW7A 2V8HA 2B8PA 1R7IA 2NXNA 1NSKL 1AB8A 2D74B 9RUBA 1UEUA 2FYXA 2XZWA 4HR2A 1XIQA 3MCMA 1REGX 1U0SA 5JJBA 3PEHA 2Y3YA 3OXFA 3UDCA 3H98A 4NEYA 2DITA 1HNWF 3THVA 3ZZTA 1U6ZA 1SBRA 1VIOA 4JI7J 3RRHA 1VJQA 1HQUB 4NLTA 3NAIA 2B6AA 3BPSP 2YKMB 4J7CA 1CJVB 3IAM9 3DDIA 3ZO7A 4CNZA 3K59A 5A2QU 3J7YI 4HACB 3S7RA 3DOKB 2GHPA 1EJ7L 3M8WA 2IRUA 4OI1A 2E9ZA 2DHXA 1B7YB 2X3DA 2BMBA 3DLKB 2LQ9A 4ED3A 3NCPA 3DLLQ 3M2UB 4RUAA 2R7QA 3BSOA 2M3DA 4LRAA 1D9AA 3KLEB 2EC2A 4CLFA 1P9YA 3QYYA 1EKSA 4C98A 5HLFA 4F4WA 1FRMA 4UY8T 2M4MA 2W2PP 2GCFA 1RTZA 3T19A 2XO7A 3M2RB 5HROA 2K7KA 3QQCD 2LLZA 1VHFA 2JLFA 4P2MA 4KC5A 4X64J 3GR1A 3FK4A 3HD2A 3IR6B 4LFBF 4KBIA 3BO3A 1OPZA 1WC1A 4WTYA 1PYOB 1SIZA 3R3TA 4OX7A 4DL0C 1TV6B 5HVGA 1ELOA 2UVWA 1HPZA 4TLQA 3P5BP 2VQEF 1A6LA 1JLCB 4O3OA 1IKXB 3S8SA 2HQDA 5C24B 2W9AA 4DCPB 4I6WA 3T1HF 4WP9A 3RR7A 3CDEA 1T05A 3WX4A 1EB0A 4ZP7A 2HNZB 2OPSA 1Y10A 1WF2A 3AOAA 4L74A 4U6PA 1LWFB 1Q86T 3NXZA 4J9QA 4LR7A 1EP4B 2CXEA 4MKYA 2DGSA 2I8EA 4ZJOA 4IO9Q 4F8RA 3D54A 2JOQA 3G71S 1C0UA 5T14A 2JL9A 4A8KA 3G87A 1U7LA 4WP3A 2E5LF 3JAMU 3M4XA 1R8AA 3PYFA 4YB1P 2BACA 4OI6A 2ZM6F 1NKCA 5DM6Q 4TQRA 1NMEB 3AOCA 4OV1A 1R43A 4LF7F 2OAUA 3M8PA 1FDBA 2BKNA 2CWKA 5KFRA 4ZPTR 1WHVA 1UJ4A 3HVWA 1HBMA 5EN1A 2D9OA 3BF4A 1JB0C 5KFMA 2PFFB 1HYSB 3T1YJ 1SKWA 2AJQA 3ISNC 4UW2A 2IMOA 1IKYA 1UPMB 4OHXA 3K5LA 3D4JA 3FBCA 4NLYA 5IT9Y 2I38A 3CJ4A 4DQIA 2BABA 5LMUJ 3VWSA 2NUHA 5IV4A 1RB0A 4DQPA 1R3NA 1FKAF 5KG3A 4HTIA 4FP9A 3R6GB 2IRXA 3IBWA 2FB0A 1N32F 4YS2A 1UVNA 4K4YA 1Q7YT 2BM1A 2ZWPA 1PAUB 4J9RA 1NJIT 5EWEA 3H7HB 1SC6A 4ECSA 1WF0A 3AHPA 3QNWB 5A0YA 4ANEA 4DSKA 2OEMA 4NCGB 1RTJA 2IVFB 3RB0A 2IDLA 3D1HA 4Y6IA 1KQSR 5J1EB 3CJQA 3M9OB 5I3QA 2VOPA 5C2CA 1XMOJ 1RU2A 3DRPA 3JTPA 1KNZA 1VQSA 2DXFA 3LF0A 2IAJB 1RABB 1Y5LB 2NYIA 4X84A 5I3UA 3WIVA 1CLFA 2CKWA 2HFZA 3OBIA 1H74A 1WTFA 1K0TA 2GA7A 2MZRA 2VUGA 3CJ3A 3CO0P 4Y2KA 5D4NA 3BGOP 5EHHA 4LF8J 1BQNA 5A8KA 1UAWA 1NK5A 4MYTA 2DGWA 4ALZA 4KH1B 3AOBA 1FJCA 2XGPA 1FFWB 4X66F 1URRA 4DL6A 2CWXA 2QMWA 1IR0A 3LAMA 2CPXA 3TUIC 4RU9A 1FFGB 1S6PB 2CNLB 1EETA 1YJTA 5ETOA 1RT5B 4X4PA 4Y3CA 1MU2A 3RBEA 2WSFC 2GIFA 4JI2J 3J7ZT 3FSYA 3Q0AA 1M1GA 1KS2A 3HFVA 5D77A 2ADBA 2YQ3A 1RAIB 1CS4B 1L3KA 3UCZP 2NQPA 3SFUA 2M8DB 2O66A 2IY5B 1CEZA 3MPUB 4ZVEA 1R8CA 3LGNA 4IDKB 2M52A 1FEHA 3SZ2A 5D4PA 1OSCA 1T03A 1RHRB 4ZLPA 3TARA 5IC4B 1SJ1A 3VAKA 1N33F 4O0NA 4UOFA 3H90A 2MQOA 3NS6A 2O3DA 3DRSB 3IP0A 2GFFA 2FC9A 2WZ1A 4DV7J 1VR6A 1LV5A 2HHSA 3DLJA 1QAYA 3FMBA 2BKOA 3L9ZA 5JVGQ 2BJ9A 4WPAA 3UQSA 1B7FA 4ID8A 1K44A 4ZLNA 4ECYA 2FQQB 3ONQA 2Q6BA 2U2FA 4B9MA 2LXIA 3LH2S 5KFOA 3HVTA 4JI8J 1WEYA 5ITHA 2QLBB 2OPQA 3DM2B 2HHVA 4GC7A 4M5KA 4DPWA 2MB0B 1LWEA 3ETMA 4P74A 5GAGU 5MLCV 1KR4A 4E0DA 1H0HB 1DHMA 2CYYA 2C1EB 1VI7A 4FF2A 2Y0BB 3FJ2A 4RKUC 2J9CA 1UFLA 2K2PA 2HQ3A 4MT1A 3POTB 5KG4A 4QWDA 1IVZA 3J7AN 1JLQB 3NGKA 4HH0A 4DSEA 5FIIA 2HWIA 3LTOA 2CJAA 1SIWB 3ZZ0A 3OR2A 5G0RB 1DARA 1O51A 2R2UA 4ETXA 1PJ7A 1HWJA 4UUWA 3CCJS 3M8SA 2R7RA 1KEKA 1U4BA 3MR2A 2MHEA 2CA9A 2NPFA 1X4FA 1U47A 4Q0BA 2OGUA 4K0KJ 2R7VA 1FNMA 4ZPWR 1GMWD 4GO5X 5B08A 3CCMS 1V3RA 5C7PA 3HMJG 5J2MB 3NG8A 2UXCJ 4NWBA 2ATLA 3Q83A 1NJWA 4URGA 1YBUA 1ZS6A 3NMRA 2DXDA 2XMVA 2NXUA 4I2PB 1IQTA 3QFWA 4F50A 1HR0F 2KXHA 3G86A 4KTQA 3GJTB 4GKKJ 4YDXA 1T9YA 4FBUA 2HWHA 3G8QA 1RAHB 2FVPA 4KO0A 1YJRA 2PO4A 5F41A 3QBCA 2IVMA 4NOHA 1WC0A 1N5VA 4IOCQ 3BSCA 1X4EA 3GP9A 3EGVA 3PY8A 1Y3KA 2N7YA 1XBWA 3MD3A 3JSRA 2O1PA 1H73A 3I4HX 3HHLD 4OIXA 1G4CA 4WFBQ 1VQPS 4DHVA 5F8HA 2E1RA 3P49B 5F9NA 1XR6A 3US5A 5GAHU 2CVEA 2QFJA 4EZ6A 4JI0J 3R5JB 3EGNA 4ILMA 2HZAA 4C48A 2OPPB 4J9UE 4JI6J 3IM9A 3S01A 4QIWD 2WBMA 1MSWD 1KP6A 3FC9A 2VICA 3P5TL 1SV5B 3WHIA 2IFXA 1VRTB 1HQUA 2HVEA 4DOZA 3PJWA 3B82A 2LP4A 2YKMA 1ZA2B 3IWXA 2ZH3A 2EEYA 2B3TB 1FDAA 3RUBL 4B3RF 3DYAB 4LFCJ 2VD3A 1LXNA 2H4YB 2CQ4A 1VQLS 3MCSA 3JYTB 3MTJA 4ER8A 3C16B 1VC5A 1TUGB 1PKUA 2V9KA 3M2UA 4ZVUB 1MWZA 4RLEA 3H2LA 1I94F 1UEVA 2RHSB 1WD6A 4ZLLA 3KLEA 4ZLJA 1IXKA 1U6FA 2RKIA 3A8EA 2E1MC 1MG7A 3NGTA 1RXOB 2ZHBA 1VQMS 1DY3A 1WWHA 3H25A 5E3RA 2Z2ZA 4RUHA 3FCWA 4WK3A 1VJWA 4CWBA 1KQKA 1JLEB 2JEJA 1JK9B 2Z58B 2RF2B 5DLGA 3QGPA 1TP7A 2QX0A 2GHVC 4DLEA 3Q8QB 2GJIA 1FF2A 1TV6A 5DG7A 2OH2A 3NNHA 2KXNB 1FJ7A 2JSXA 4QYZJ 1LW2B 2J7WA 5ETMA 1RADB 2IJRA 5ETVA 1JLCA 1IKXA 3KMQA 2K3IA 3CC4S 3UD4P 2HBYB 1U6BA 1VQ5S 5C24A 1R6YA 3FBEA 3H20A 3R6LB 4FPRA 3CULA 3FRYA 2UUBJ 5K9FA 1Y7PA 1NK8A 1F60B 2K1RB 2AJFE 2RS2A 2HNZA 2V2QA 4TQSA 2RSQA 3JQJA 4ETZA 1F5CA 2ZBPA 5IT9U 1RDRA 3CF5Q 1LWFA 5C2GA 1ZPVA 1EP4A 4RPFA 1H2TZ 5HMZA 4P6QA 4GVLA 2ZJPQ 4Z7CA 4LFBJ 4LRCA 4DS4A 1U49A 3Q89A 4ZJLA 2LQBA 2J9DA 3NGRA 3VAIA 2W9BB 2XSJB 2J5AA 5HAOA 1TMJA 2VH7A 1YZ7A 2UVUA 4CLTA 1YJUA 2AJ1A 2RDDA 2LU1A 2I9SA 1WORA 4USIA 4DCJB 2VQEJ 2CQ1A 2DHSA 1L3SA 1C0TB 4PYAA 1X4BA 4F4AA 2R8IA 2N3OA 3ZTSA 4DXLA 3ULHA 2HVHA 1UCNA 4CO1A 5LT5A 2GAHC 3PYDA 4NEZA 3BGLA 2IIHA 1HYSA 2V94A 2FJAB 4ZA1A 4YHHF 4CM2A 1HNXF 3TAPA 2YWWA 1BC6A 3IBCB 1S5ZA 5B0BA 1LW0B 3SMZA 4LSZB 3C14B 1LWCB 3SI8A 4KHMA 3BGUA 4QIGA 1J5OB 2E5LJ 4NLSA 1GMUA 2UUCF 3MM7B 2WBRA 2CQDA 3KK2A 2HHTA 2OIHA 4F3MA 2A2CA 4YEAA 1S48A 1CSJA 1LQ9A 4LF7J 3HI9A 4J91A 1BY9A 3MI7X 2HHUA 2CPJA 3UCGA 2XCPA 2XHCA 1BD6A 1FRIA 2MKIA 4NCGA 3SSSA 1G1XA 2Y9HA 1U2CA 1ZTTA 5J1EA 3V4IB
chains in the Genus database with same CATH topology
4OJ3A 3B78A 4YR2A 1M1KT 2RVJA 1Y5IB 2GO9A 3TA1A 2VFTA 1B0VA 5KFZA 3KLFB 2H5EA 4ED2A 3H4DA 2HLUA 3VTIA 2C3YA 2PSZA 2XNRA 2FHOB 4WXWA 3CJ5A 4CH7A 2IAJA 4YQWA 1NHVA 5KFWA 1C0UB 1FKOB 5MAOA 4LT6A 1V3ZA 2OSQA 4W92B 1MW7A 1T3OA 3IA0A 5U47A 3ZC4A 5F8GA 1B64A 2HRUA 4NCBA 1JJHA 1GT8A 2K1RA 2WAQD 2D9PA 1NKEA 1TKTB 3BS9A 2PEHA 1FRXA 1M5KC 2QZ8A 3ZZZA 1TL5A 1PSDA 2AV5A 2BE2A 2YNIB 3CCVS 1M5SA 3AY0A 3D0HE 5J2NA 2RDIA 2V0NA 2LMIA 2GMLA 4RUCA 2ZE2B 4RW4B 3F73A 1KFSA 1TUVA 3IWLA 2ZZNA 5B0GA 2ASJA 4EGLA 4GKJF 1TL4A 1APSA 3KKFA 3KOAA 1NB7A 1LFPA 3M8PB 3I0RB 4MYUA 3VQTA 1O5JA 3E01A 3MPYA 2Q43A 4M5DB 2RU9A 3K5NA 2IA6A 5KT3A 3AJ2A 2B7BB 4Y00A 3V6DA 1N88A 3BDPA 1TL1B 4H4OB 2AJ4A 2UV8G 1QVFR 3M8QA 4YB7A 2CIMA 2V8VA 3BO4A 1BGXT 4C3MA 2W9BA 3KG0A 1FRKA 5BJRA 1C1CB 1RT4A 2Z4PA 1TKXB 3AH6A 4J5OA 4TYBA 4A8FA 3T9NA 3MECA 1PILA 4RBUA 2DIUA 1SJRA 2B5JB 3CO9A 3O3LA 4O4RA 2WCXA 2XY6A 1FNXH 2A18A 3SDEB 1S0VA 2N4CA 1E6YB 1ZM9A 1XMBA 3RTVA 3CJ2A 4M63A 2ZH7A 1VQ8S 4DR3F 3TVZA 4H4MB 4TU8A 1H6KX 1X7VA 5AE3A 1A7GE 4WFNQ 1XEZA 3BN4A 3GZ7A 1IKYB 1KVIA 4I69A 2WONB 4OX6A 3OL8A 1REVB 5DG9A 3PW7A 1RTIA 1L3UA 3RZAA 5IWAF 4EYHB 4PPZA 2CPIA 4LF5F 1S1VB 4NRUA 1PGZA 1JWWA 4WFYA 3DHXA 3T9ZA 3CCWA 3HP6A 4TYAA 1RT5A 3HX9A 4ELTA 1JLBB 3D0IE 3L95X 4ZVGA 2IRYA 4DV4F 4N47A 4JV2A 4NPOA 3UI3A 2A3JA 3TA2A 3SV3A 1JIHA 1ZPWX 4KR0B 1JLAB 2Z0GA 5DDQC 4IFVB 4RBTA 4QW8A 4DUYF 3KHHA 2C3PA 1VMBA 2B7CB 4TU9A 1V9OA 2OKQA 1D1UA 2MPUA 5D78A 4X4UA 3HFKA 4I0WA 4Y2IA 3K5MA 2E5HA 3HPOA 2VG7B 3VAFA 2R7XA 2DR7A 2J9DE 1W2IA 2DNNA 2IVYA 3MAQA 1N52B 4JI4F 1QM9A 2E5IA 2RQ4A 2O67A 2XMKA 2W25A 2W4PA 2YNHA 3PXGa 5H9FJ 2N7CA 2PI4A 2YX1A 4Q5VA 2UP1A 1R89A 2PGCA 4Y2AA 2AJ0A 4J37A 2DPJA 4YY3F 1ULRA 3PO4A 3HJFA 2HPUA 2XBPA 2OLWA 5E5NA 4H4KA 4WYWA 1HW9A 4WFZA 1JMTA 4CIOA 1NJXA 2ZH8A 3CWJA 2P6TA 3IR7B 3MHYA 1P9QC 5A0YB 5AE1A 5L1JA 1T8EA 4B9SA 1CQNA 1WI6A 5EGYA 2CQGA 3PX6A 5E3AA 2B9YA 5LL6d 2ZJRQ 1VQOS 1RTJB 1XWLA 4Y28C 3PX4A 1M0SA 2K3KA 5A6WA 3TVKA 4K4VA 4CNYA 4AE5A 4OZ1A 3H2UB 2WSCC 3M6VA 3TNVA 1S76D 1GXTA 2FLOA 2LDIA 3Q8PB 4A47A 5J2PA 3MDFA 3IXQA 3FVYA 1S1UB 1VRUB 5BYSA 2E7XA 4Z2XA 5E41A 2EKYA 3V6HA 2NS1B 3DRPB 5KFXA 4WYLA 1FJGF 2WOMB 4FXWA 3CD5A 2L41A 1FEEA 1UP1A 2WB1D 5F8NA 4MKBA 3MMBA 4JYAF 2Q3PA 1WACA 2BXJA 1HA1A 2M0GB 2W7OA 1QSYA 3K5OA 1S1WA 4DV0F 2CPEA 4OZNA 3QO9B 1S9GA 1RWUA 3N6MA 1FDNA 3EXCX 4P7TA 3HF5A 1PC5A 2VFSA 1U1NA 1RT3A 3VAMA 4B3TF 1C1BB 3NNCA 2KYXA 2BA9A 3CDBA 1S6UA 5I3UB 2RH3A 3IC1A 3KLIA 5D4OA 2XLKA 4IR9A 2N3LA 2LCWA 2YVSA 1OIAA 3MM9B 2JVRA 3OVBA 1HWLA 5AJ3F 1HBOA 4LVNP 3ZZYA 5F9LA 2XG8A 2MQLA 2R7OA 1SJ4P 4G3IA 2F4VF 5D3GB 2CPZA 1DTQA 2V4RA 1RISA 4YMEA 3VCDA 2L9DA 1SL1A 3LANA 3VZHA 2FVSA 1URNA 1TK5A 3CXCR 1K1SA 3OR1A 2BZ2A 3VF0B 1UWBB 2KT5A 1Q78A 1U09A 2CQCA 4PG6A 3VALA 2RT3A 1NRKA 1SH3A 2NSBA 3FFIA 1UVKA 3OFEA 1RKIA 3GV5B 1YHQS 3M6XA 1TVRA 2VODA 5K8PA 2XI3A 3DM2A 3EZ5A 1ZYQA 3K7RA 3WDOA 5CYJA 4LJMA 1RKJA 2I2YA 4N8OA 4B08A 1ZAXA 2E44A 2QMXA 5F8LA 5L1LA 1UETA 4C0OC 2JZ5A 4L6V3 1FKOA 3T5HA 4WKRA 1FXDA 1UA0A 3MEDB 1BQNB 3B4MA 1VK8A 5A8KB 4F25A 1C4AA 3EUNA 4KAIA 1D8YA 1DQAA 3CJ0A 1RT2B 3OSPA 2YNGB 4D3HA 1X5PA 4ED1A 2ZVSA 4ZPCA 1DQ8A 1NNDA 1QVGR 3DN9A 2E29A 2MZQA 2VBYA 3LP0A 4DEZA 2UZAA 4QBUA 2HYIB 3V2UC 3K2YA 1YJNS 3RRGA 1U1LA 4RW4A 4WU2A 3V81B 4DFPA 4PWDB 2R2RA 4ECZA 3GG0A 4PG7A 2NSCA 4C8YA 2AF6A 4RX6A 4G1QB 2SXLA 4FBTA 1JLQA 2VBXA 2ZKTA 2DNZA 2AX0A 2PT0A 3DLGB 2HW3A 4ZPDA 1ZZNA 2BANB 3QIPB 2VA2A 4WZQA 2GIRA 1MROB 4C8NA 1EETB 4DR1F 4M95A 4Q2MA 1U2RA 4XIUA 3UCUP 2VG5B 2MHNA 1Y4ZB 2ZOGA 4M5DA 2VPXB 4XPEA 1GQEA 1T94A 1X5TA 2B0GA 5G0RA 3VAGA 2JVOA 2OD6A 5K14A 2DH7A 3TI0A 2AYGA 2G1DA 3LQVA 1TL1A 4DFMA 1JJ2R 1MU2B 5JUMA 4IG3B 3I5AA 3R5BA 5KG5A 1SUQA 4R5PB 1IBMF 2RB7A 3LP1A 3OFFA 2ZH9A 3R5DA 5K8NA 2A10A 2MQMA 3OTDA 1RT1B 2XMUA 5CYQB 5HN0A 1RI7A 2B5JA 4TXSA 5B09A 2OFGX 4RNFA 2QT7A 5IM0B 4F67A 2F8HA 4LQ9A 1IM4A 2G13A 1VQNS 2WRMA 2GX8A 3HHLB 3SSRA 4DN9A 1X9MA 3K8VA 5BYQA 2VPWB 3BGRA 3D5MA 4PG4A 4J9LA 3U1LA 2WONA 5J2MA 1REVA 1WG5A 3UPFA 4E8UA 4OX8A 4JI8F 4ZMMA 1DAXA 1S1VA 3O5TB 1G6BA 3UR0A 4R0JA 3D2WA 3J7YU 3DHWC 2XS2A 3W2WA 2KM8C 2LU2A 3CSKA 2GNKA 4OZJA 4F3OA 4CQ1A 4LMZA 1KQGB 1RGVA 5HMYA 4TLRA 4ID5A 2PI5A 3SCLE 3MPWA 3NLCA 4A48A 2HHPA 1JKHB 1NH7A 1JLAA 2CFXA 2DHGA 2MZJA 1WHXA 1BLUA 3MEEA 4QWCA 2XI2A 1WG1A 4EBEA 2QEXS 4I2PA 1T03B 2XULA 1NK9A 4RW6B 3NMAA 4RWXA 2GV1A 3MMCB 4IRKA 5F0WA 2X1BA 4DBQA 3MM6B 3LAKA 4KFBA 4O3SA 3KWMA 3CPWR 5DG8A 1NKBA 2DGTA 1VBZA 3F56A 4ES3A 2FUG9 3G8TA 1IUJA 2MKKA 5J2QB 1Q8LA 4PQUA 3PFOA 5HL7Q 4NZ0A 4QZVB 1FD8A 3FQLA 4I64A 3TOQA 4IG0B 2FHJA 4U9RA 3DRXA 2DRAA 2VC1A 4K50A 2EWHA 1N6QB 5ADZA 3TW0A 2ZBIA 1T95A 2MYFA 3LWMA 3CMES 4O44A 1X4HA 3FQKA 1Q79A 4OI4A 2XGQA 3C66A 3NBPB 4WFAQ 3RR8A 4NLPA 3QGHA 4ERDA 3K58A 3AB4B 5K8OA 4K4XA 4FNIA 4Y2MA 1FJEB 3O44A 1SXLA 5DDRC 5KFEA 3VAJA 3HVAA 1H2VZ 3QJLA 3DU6A 2J6TA 2VPYB 2B51A 4NLQA 5KFNA 4OFZA 2DGUA 2X51A 4KE5A 2J0XA 5B7WA 5CA5A 4I1TA 2YWKA 2BOPA 2HG4A 4K0KF 2EBEA 5DDOC 1KTQA 2JFDA 2MY7A 3BEGB 1S1UA 2EK6A 4USHA 4PUOA 4F3QA 3VZIA 3KMSA 3G4SS 4AL7A 2Q1LA 3A1YG 2HHWA 4TY8A 3THPA 3IRWP 5JVHQ 3HVTB 1DLOA 1S1TB 1XK8A 1ZM2A 3C3LA 3I96A 3I9V9 3FDSA 2UXCF 3SEOA 2OPQB 2FJXA 3U27A 2EG2A 4FXDA 3L7PA 4CT8A 1NK4A 1GTHA 4Q8EA 3N01A 3UDLA 4IUFA 2XWXA 4HHJA 2G0CA 2KZMA 1LWEB 5A6PA 3H5UA 3SQGB 1C1BA 3E8OA 4X2BA 1N48A 1XNQF 5B0CA 4G6VB 5KG1A 3O6QA 5M2PA 2AGPA 3V4MA 2CJKA 3IS9B 1HNVB 1S6OA 2M9KA 1X0FA 3EYZA 1TAQA 1LK7A 4DQQA 4B9VA 2XNQA 3V6JA 3SCIE 1JXLA 4ED6A 3T5JA 2G9OA 4MFBB 4D3GA 4R8UB 2B4PA 3DXBA 1DZ5A 2RILA 5D3GA 3CC2S 3L3CA 3R1LA 3IRXB 2MQNA 4ES2A 3M9MB 1GNKA 3AA9A 1Y9OA 3KLGA 1FVQA 2U1AA 5GMKa 1VBYA 2OPPA 4OQJA 1WNEA 2JFKA 4GKKF 3CDAA 2BW2A 1IJFB 5E2QA 2ZKUA 3C2PA 2FY1A 4KQZA 4ZKAA 5I3PA 3QGIA 3BM7A 3CJKA 1HFEL 2VQFF 3OR2B 2X3GA 1HNIB 5H9EJ 2XSFA 3G6YA 3OTBA 3Q2SC 3LP2B 3JTOA 1NJYA 2DNQA 3IR5B 4UUXA 5DJBA 3NNAA 3IG1A 2Y1IA 2BDPA 4OJGA 5THWA 4JI3F 1ROFA 2QYCA 1S6QB 1VRTA 3M32A 3MOZA 4IYQA 1FT8A 3RB3A 4PRFA 1IJEB 2V4JB 3B8HA 5HBMB 3H2VE 1XR5A 2J0WA 3TVYA 4O4GB 2KI2A 5L38A 4LSNB 2ERRA 4ZS6A 2EBGA 2GHWA 2J8AA 1BWEA 4PWDA 3OVAA 5HLFB 2QA2A 4WK1A 2KHCA 2NLWA 1R31A 3AQPA 3V5RA 4W90B 3GFZA 2MXYA 4NLVA 2KFNA 2CQBA 3EGWB 2WK4A 3C6UB 3JSMA 3ICLA 2BANA 2I5JB 4JBCA 4B9TA 3N5FA 1Q7LB 3DLHA 4LF4F 4IFYB 2M2BA 2MJNA 1KD1T 1P6TA 4NA3A 3FZBA 2MY8A 2VG5A 5DQHA 1JLFA 2JC1A 4MK7A 3IN5A 4C9DA 3CDUA 2CJ9A 5C25B 4B3OA 1K73T 3ISND 2R2TA 1FKPA 4MIWA 4NA2A 3PRBA 4EWTA 3RRKA 2IC3A 4P2SA 2LDYA 3G6ES 3J80Y 4R5PA 2XS5A 4KT0C 1J2VA 3PR5B 2E9TA 4ZPVR 2POKA 4KIAA 2D3ZA 5E3CA 3OJSA 2QO3A 4JI1F 3P6YC 1RT1A 3DMJB 2V9WA 2LXUA 1P1TA 2ROEA 3U02A 1TFWA 1X5OA 1RK8A 1F9FA 2IM0A 4JI0F 2HGLA 3KJVA 2W9CA 5IM0A 3H8YA 1YITS 2DH9A 2LQJA 1S9FA 2F3JA 5I42A 4RW7B 1OWXA 2DGOA 2GGPA 2RRNA 3LPYA 2YY3A 5CYMB 4YFUA 3HHLA 1XR7A 2ZZMA 1A9NB 4FS2A 5DO2A 4ICLB 4G1IA 4IH5A 5T41A 3OSNA 5CCLA 2CPFA 1N4LA 3W2VB 3K57A 4I7FA 3OFHA 3MOJB 1MMDA 5A8RB 2HGMA 3L7OA 2B4UA 1VQYA 2YWGA 1M5PC 4KO0B 2OPRB 2VB6A 4QW9A 2BUNA 5G4DA 2NUUG 2MJUA 4C11B 2HFNA 3MTKA 4ED0A 4LQ3A 3C6TB 3QAEA 3CCTA 4IH6A 3KK3B 2ZH5A 3OHBA 1N0UA 2F9JA 3J81Y 4Q44A 2VFUA 3UD3P 3GG1A 4NXMF 5D4LA 4YDDB 1N54B 3I87A 2X1AA 1HARA 4C0BA 2BV3A 1S0NA 1JLEA 3DGPA 1ZOTA 2IYIA 2YX4A 3IGVA 4QIVA 1SI9A 4FZVA 2RF2A 1QSSA 4OZ0A 2R8KA 2DR8A 1N5QA 2C28A 4KJIA 4IKAA 1UFWA 4X62F 3DLEB 1FHTA 4LFCF 2JX2A 1Y5NB 2DIVA 3E2EA 3MD1A 3EPIA 3RU0A 2X1GA 1JJ4A 3T1YF 1S7HA 3I9ZA 4IOBA 4B9NA 1LW2A 1SH2A 4BS2A 2FVCA 4IG0A 3RW7A 4RNNA 3HLUA 2V8HA 3PEJA 3M2VB 2GQ2A 4EU0A 2YNFB 1N6QA 3DDNA 3OL7A 3BQ2A 2K8GA 1WTBA 1R7IA 4RW8A 4F2SA 2FJEB 1VGYA 1RTDB 4AXIA 2XC9A 2D74B 2MZTA 4DF4A 2HS0A 4QR0A 3OVSA