4RKUE

Crystal structure of plant photosystem i at 3 angstrom resolution
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
63
structure length
63
Chain Sequence
b'PIGPKRGAKVKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
rcsb
molecule tags Photosynthesis
total genus 5
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rkuE00
2ZCFB 2ZPGB 1DJ7B 4Y28E 3VYHB 2ZPHB 4OB0B 3A8HB 2PUKB 2CZ7B 2ZPIB 2CYZB 3HHTB 4XK8E 2PU9B 3A8MB 1QP3A 2CZ0B 1JB0E 1UGRB 2ZPFB 3A8LB 2WSFE 3VYGA 2DXCA 1IREB 2PUOB 1V29B 4KT0E 4ZGDB 3WVDB 3X24B 3QZ5B 3LW5E 3X26B 1UGQB 2PVGB 3WVEB 3A8OB 2DPPB 1AHJB 2CZ6B 1UGPB 4OB2B 1GXIE 1UGSB 1QP2A 4ZGJB 1PSEA 3X25B 2DXBA 3A8GB 4L6V5 2CZ1B 4RKUE 4OB1B 3QXEB 2O01E 4ZGEB 2AHJB 2WSEE 5L8RE 3QYGB 2PVOB 2ZPEB 2D0QB 4FM4B 4OB3B 3X28B 2QDYB 2ZZDA 3QYHB 3X20B 3QZ9B 1PSFA 2DD5A 2ZPBB 2DD4A 2WSCE 2PVDB
chains in the Genus database with same CATH superfamily
3H9NA 2EBPA 3UT1A 4LE9A 2O9VA 1I0CA 1YHQQ 4JRIA 2V1RA 4N4HA 2FO0A 1JO8A 2DIGA 4B6MA 4FYWB 3CCJQ 1QP3A 4BDYA 2E4HA 2BZYA 4FYYB 3JCMc 5KYXA 4F04B 3I56Q 3MP6A 3VS3A 3F70A 2AZVA 4OMOA 2K3XA 2J7IA 5GAMg 2WSFE 4QT7A 4X1VA 4QVCA 4RTTA 2BZXA 1Q95G 2OTLT 1GRIA 3RUXA 3JAME 3GP8A 2DF6A 1Q82C 5I2SA 4AMCA 3OBWA 2PUOB 2DL3A 3CMEQ 3EH1A 4C8QG 3HRSA 2VC8A 1R0CB 5IN1A 1JBMA 5LJ3d 2KBTA 1M3CA 3CMAA 2YUPA 1K73R 4LXCA 3S3NA 1GBRA 2YLCA 3PGGA 3LWHA 2EGEA 1BKBA 3GNFB 3M54A 2EJ9A 5IXFA 1RACB 1VQPQ 1GXIE 1MMAA 4FW1A 1I81A 4E2FB 1OX9A 1M3AA 2EQUA 2FPEA 5GAMe 4PJOG 3RBBB 1Y96B 1YP5A 3UA6A 4DBHA 2QEXQ 5CKFA 4YTLA 1VQNA 4RUGA 3SHWA 3CCLT 3RKXA 2QTXA 1EIFA 2YLBA 2NUTB 1Y57A 4DEXA 2CP0A 4C8QE 1NJIR 2XDBA 4A54A 3OW2P 1SRMA 4M7AG 2A37A 3VS6A 4E7ZA 1G2BA 4JJDA 3J81E 3S3OA 1VQ7Q 2DLPA 4FSSA 3QZ9B 2GQIA 2RA2A 2D8HA 2WSCE 3L2WA 1BI3A 1S72Q 3M0PA 2LJ3A 4J9BA 3MP1A 4EMKA 4PJOE 4EDUA 2ZPGB 1KFZA 1VQ4Q 2CH4A 1RAHB 4IUTA 4O5VA 1M90U 1KC8U 2MMPA 1AVZC 2RPNA 3M0QA 3DLLA 4JZ3A 4ME7A 3V8KA 1N6AA 1EX4A 2H8HA 4BB7A 4M7AE 1W70A 5CKEA 1JJ2A 3OYCA 3M5AA 3BDUA 1VQ5Q 2KMTA 3CXCP 1KK7A 1V29B 3VV0A 4LDWA 4ZGDB 2E6NA 3J7AF 4LDUA 2DL4A 2COWA 1ZUKA 4HKEA 2DBKA 1PRMC 2CZ6B 1NM7A 1VQ6Q 5D7UA 4C8QB 5LJ3j 5FU7B 1PSEA 1NPRA 3WXMB 2DVEA 3N5BB 4M7DF 5KE3A 1GFDA 3I9QA 2QQAA 3QDRB 1MV3A 1UJ0A 4BI4A 3CC2Q 1WIEA 3CMAT 4AFSC 3CC4A 2VXEA 4J83A 3EG9A 1VQ9A 4KGVB 2EAYA 5GAOn 4PJOB 4C8QC 1U06A 2MF2A 3INZA 5FU7C 2LX7A 2CT4A 1Y7XA 4PFZA 4N4GA 4JJBA 5A0GA 4XTYA 4DOVA 2O31A 2XDPA 2KAFA 2RJDA 3ZFJA 3JB9G 1VIEA 1CKAA 1VQNT 3CBMA 4XU0A 2IVWA 3OMGA 3CCVQ 1DJ7B 4M7AB 4Y28E 3VYHB 1JJ2S 4PJOC 3VRZA 2RNAA 3HL8A 2JS2A 2LJ1A 1TU0B 2RF0A 1X75C 4WF2A 2JVVA 5GAN8 5GANd 2OTLQ 1U5SA 2DA9A 2DJZA 1KG1A 3FDRA 1TTHB 1JB0E 2PQWA 3ER0A 4C92G 4JZ4A 2H3JA 1VQ8A 1ZSZA 3SFMA 4OMFB 4M7AC 1O75A 1OV3A 1X6GA 2QK0A 1JU5C 5GAN4 4PFPA 5HK0A 1BIBA 4F7UA 1IHVA 1N27A 1QMCA 4Y92A 3VS5A 4D8KA 3QPHA 3P8DA 2DRMA 2K6DA 4XQ3A 4M78G 4WCIA 2NWMA 4J9GA 1YJNT 1WQ7A 1QWFA 5A0LA 3CCLQ 2O88A 2KDSA 4JRKA 1M1KR 3L42A 4PLLA 5KCHA 5KYUA 4L6V5 4J9FA 3H0FA 2XIDA 2F69A 1OX8A 4QQGA 2XHCA 4HCCA 3NGPA 2DL5A 3JB9H 5L8RE 3QYGB 4XU1A 1IRXA 4M78E 4ZNXA 8ATCB 3V7RA 3GPLA 2JUFA 3KXTA 3HFOA 4RTVA 2MK5A 2QDYB 3CCEA 3M55A 2EIFA 1HJDA 3MP8A 1HD3A 1Z9ZA 2LDMA 4DBQA 4IUPA 1FMKA 3RKWA 1NG2A 3CC4T 2FB7A 1RI9A 3CCSA 1VQ9T 3CEYA 1XJWB 2E12A 1AWWA 1BCMA 2CP3A 2O4XA 2ECZA 2RJCA 3OYNA 2EKOA 4HCZA 2R5AA 4A53A 3OYGA 1UDLA 1UE9A 2R5MA 1I4K1 2OI3A 2BTTA 1K73C 4LUEA 2CGHA 2QAZA 3I35A 5FW9A 5CQYA 5CK9A 3ASKA 2DL8A 2QQ9A 2D0NA 3M0TA 3OSSC 3EG0A 2M0OA 4CC2A 4FT4A 4C92B 4E7HA 4CC7A 4NS5A 5DLOA 4RTZA 4ORZA 1WYXA 4A4EA 2M16A 4O6JA 1MHNA 1TG0A 4J9CA 1VQ8T 3T9NA 3JCMP 2BUDA 3CMAQ 1AZEA 2FYKA 1NJIC 2FL7A 2QGFB 2OX7A 2FEIA 4M78B 1I8FA 1LJOA 1WGSA 1ABQA 4C5HA 4AFZC 4C92C 2DXBA 4N0AA 3MEWA 3G71A 1G83A 5GMKe 1QW1A 5LJ5h 3QXEB 2J6OA 5DY9A 3HKSA 1VQOA 2SRCA 3CMET 3CPFA 2ATCB 3SD4A 1M90R 4II1A 1VQNQ 3PMIA 1LOJA 4FM4B 2J05A 4M78C 1X43A 1EFNA 1YI2A 4ANJA 1FMWA 5IXBA 2HBPA 2LNVA 5GMKl 1PSFA 4HT9A 1PRLC 3C12A 1VQPT 2DD5A 4XTWA 4MDWA 1ZA1B 2MOXA 4J6YA 1SHGA 1YBYA 3MCAB 2KYMA 2HQHA 2EGAA 2QEXT 2MWOA 3JCMd 2PUKB 3KBGA 4TVRA 1H641 2YXYA 2HDAA 5CKBA 2E6ZA 3P8HA 2QA4A 4Z8AA 4Z02A 3CCET 3IQLA 2VVKA 4FCYA 1QKWA 1X6BA 1BYMA 4M77A 3L2QA 2RMOA 2QASA 2KQWA 3BE3A 3LWIA 1KQSA 4JS4A 1E6HA 5CAIA 2K9GA 2PNIA 4PFOA 4LDYA 3CCST 1YIJA 1BI1A 5AT1B 4C8QF 3SB2A 1S72T 3V8JA 5GMKj 2G3RA 5EG2A 1K9MU 1SEMA 1KJWA 2D1XA 2LRQA 1VQ4T 1PCXA 1AOJA 2A3LA 1IZ6A 3OYDA 2RQWA 2PVGB 3OW2S 2FVUA 3QKJA 4C8QD 3JCMe 1KD1C 1LNXA 1YFNA 1SF9A 2EYYA 2PZ1A 2LVMA 3OQ5A 1YJ9A 4FT2A 4PJOF 4C0GA 4WTOB 3VS1A 4ELZC 1BK2A 3SEMA 4D6WA 4M4ZA 2DZ9A 1VQ5T 2RO0A 1LVKA 2CP7A 2JTFA 2MAMA 4UC4A 2GBQA 1UJYA 4M7AF 1YITA 4OB3B 3CC4Q 2OTJA 4HVUA 1VQ9Q 3X20B 4J9IA 3CBPA 2DD4A 1N5ZA 4DQ2A 2EQIA 1N8RU 4M7AD 1M5Q1 3G7ZA 2DILA 3OYHA 1BIAA 2ABLA 2JNGA 4ZN1A 4RTYA 4ZTJA 5HY6A 1LCKA 1ZUYA 5KYXB 3JB9I 4RTUA 1ZUUA 5A2QE 3OS2A 1YI2T 2R58A 2LC4A 2X9HA 1M30A 1RAAB 1D0ZA 3SDZA 3AHUA 3EH2A 7AT1B 1GFCA 3O8VA 3TU4K 3MEAA 1C0MA 2VASA 2MCNA 2ENMA 2RHYA 2QDLA 2EQJA 3E19A 2B8AA 3TSZA 5HCKA 5I21A 4OGEA 2GFUA 2HSEB 5GAMd 1VQ8Q 2ROLA 1M1KC 1HXDA 1W1FA 2GFAA 4HVVA 2KT1A 1MMNA 3CCVT 3OSVA 4ATOA 4N4IA 3R6OA 4E7LA 1M8MA 4IUQA 1UB4A 2FHDA 1LPLA 4JJCA 3M0SA 1Q81R 1I5OB 3LLRA 2RHUA 3HPWA 1Y07A 1AWOA 3EGXA 1Q82U 4C0ZA 1D0YA 1X01A 2QQSA 4FL6A 3LX7A 5CQXA 3PE0A 1M1GA 3SWNC 3UF4A 3EAEA 4IUUA 1D09B 1IB8A 1C1AA 2L2PA 2P0PA 3V8LA 1B3QA 1V1CA 1B34A 4A4FA 4HVWA 1XQHA 4JRQA 1PKSA 2YUOA 3A98A 2XDDA 4J8OA 5EC7A 4J7IA 4RCCA 2X4JA 2SEMA 3SWNA 1H3ZA 2LQ8A 2JM9A 1QWEA 3V7SA 4EMKB 3EGDA 4FSXA 3PIPA 4HXJA 3X28B 5LJ5f 1YJ9T 3OYMA 3NTKA 1CKBA 3TSWA 1WQWA 3EHQA 3JB9F 1JXMA 3C95A 1EZZB 4JLIA 3RNJA 2ZGWA 2LQKA 2HCKA 2CT3A 4FYVB 2JJ9A 4OGCA 4F7UG 3CCEQ 2LMJA 1T0JA 3OYIA 1X6OA 4EMKC 2J6FA 1YITT 2VWFA 3BW1A 4C5EA 3M59A 3CC7A 2LZ6B 1M2VA 2Y4YA 2OTJT 3CCSQ 2NUPB 4BD3A 4AG1C 4C92F 2ZPFB 1K4US 3QDFA 2K7AA 4BE2A 3DB3A 4E7KA 1OEBA 2NUZA 4XU2A 2YUNA 4PL6A 4P5NA 1SPKA 4C92D 2LX9A 3OYKA 2P0QA 2QXFA 2Y4XA 4M78F 2K5FA 4F7UE 2E5KA 5KE2A 4KGZB 5GAOl 2BE7D 3GF5A 2C0TA 1GCQA 4BI3A 4OB2B 1H3HA 5DLQE 3RR6A 3MO8A 3EG3A 2ESWA 2M02A 5GAMj 4M78D 5GANf 1D0XA 1M90C 1PD0A 1SG5A 2DBMA 1VA7A 2NUPA 3EG9B 1RUWA 3VKIA 5KYNA 3C4SA 3CCMA 4ZTFA 2CZ1B 3VS4A 4BE0A 5LL6S 3H0IA 2EYQA 3FIFA 1IXDA 5FRMA 3TCJA 1WX6A 4F16A 2VUBA 5IAYA 2FZGB 4R0KA 4OVAA 4RCBA 1NEBA 4MMLA 4JRPA 1UTIA 2M0YA 5GAOm 4J6XA 2DYIA 4FW2A 3G71Q 1D1AA 1OI1A 6AT1B 2V8IA 1M3BA 1Y71A 1WHHA 1UEBA 5KCOA 1VQOQ 5FU6B 3OS5A 4F17A 2VGNA 1QVFP 3EFSA 2JTMA 3G6EA 1YI2Q 5C0MA 5CVIA 1KD1R 4M7DD 3OS0A 3CCUA 1JEGA 2EFIA 1VYUA 1T3SA 5LJ5g 1X2QA 2KI7A 1ZSZB 1M4ZA 3NMZC 5GAN2 4Q5WA 3FC3A 5KYYA 2YRCA 3ME9A 3CCQA 1N9RA 4HT8A 4E7IA 1K9MR 5FU6C 3JRZA 5I11A 3HRTA 3GIBA 1UGRB 4F7UB 3Q1JA 1MNEA 2YT6A 2K3YA 2FPFA 2DAQA 5GAN7 1V76A 2QA4Q 3L2VA 2DXCA 2LJ0A 2JT4A 1ZSZC 2K79A 1G3TA 2K5LA 4M75A 1KIKA 4JPBW 2M51A 5LJ5e 1O9SA 3PTAA 3LW5E 4JUVA 5KYUB 2DPPB 4Z89A 1YIJQ 1Q7YR 4C5GA 2GQVA 2YSQA 2VKNA 3QJYA 3JCMX 2GF7A 3UPUA 1WHJA 5GAN5 4OMQA 1N8RR 4OB1B 1MMGA 2LQNA 1YJ9Q 5GANg 2I2LA 2YRDA 1VQKA 1MMDA 2EQKA 2XI9A 3AT1B 5GAOp 2XKOC 5J3BA 1WHMA 2ZPEB 4BDZA 2NLUA 2ZAEA 2F2XA 2DEQA 2AKLA 3CBOA 2A7YA 5CKHA 5LJ3h 4VUBA 4BE1A 4J5YA 1TWBA 4M77G 3CCMT 3VUBA 2O4XB 1YITQ 3CQTA 5M9OA 2CREA 2OTJQ 4RTWA 1SRLA 3CCRA 1YNZA 1ZLMA 2RQVA 5A0DA 1W6XA 1UHCA 3FJPA 3VJPA 3VUZA 1KQ2A 1AEYA 3UA7A 2Z0WA 2X4YA 2CP2A 5GAN3 5KH6A 5FLXE 2EKHA 3OYFA 4LD9K 2DX1A 2L3SA 3G6ET 5HKCA 1Q81C 1FWZA 1S1NA 5IH2A 1FXXA 4X9DA 3RKYA 4M77E 1I07A 1BBZA 3CCUT 3PFSA 1PKTA 4DBRA 1G3WA 5CR2A 3OYAA 4KT0E 3X24B 3M56A 5FROA 4KULA 3CCQT 1W2BP 5FRNA 2RI3A 3M58A 1F1BB 1UHFA 5GAOr 1WZOA 1FYNA 4DA4A 2ED0A 1NYFA 4MZTA 3RESA 2DRKA 2DEUA 2P4TA 2HL3A 2RQRA 4PKCC 4ZGJB 1M27C 2HKNA 3REAB 1Q86U 2OAUA 2RK1A 3P8BB 2X3XD 3QWYA 1TUDA 2XD0A 2HD0A 1U8RA 1RABB 2RI5A 3OB9A 2A28A 2A0FB 2CH4W 2O01E 1RI0A 4N0AC 4A4GA 2PTKA 2DYBA 2EYXA 1NJIU 1G8XA 1ZSGA 2JW4A 2CKKA 1VQLQ 3BY7A 5GAN6 5CO7A 5GAOq 1UFFA 2P84A 2XK0A 3RDVA 1NEGA 3OW2A 1BU1A 4IIOA 1AD5A 1M8VA 2PVDB 2ZCFB 1D1BA 1Z9QA 1TUCA 3S3MA 4QQDA 3UWNA 2ZPHB 1K76A 5I22A 1TXQA 1VQKT 1KC8R 3OYEA 2CSIA 1OU8A 3OYLA 2OAWA 1OPKA 2FRYA 5J39A 4JS5A 3OA6A 4J9HA 2RJEA 4M77B 3QIIA 2GTOA 1GCPA 2AIRB 2KT8A 1G3SA 1XNIA 2RB6A 3CPWP 1RLQC 1RAEB 4AFQC 1IGUA 3MEVA 4L59A 2DM1A 3EHRA 2E41A 2DXTA 3CC7Q 2FPDA 4GLKA 3EFRA 4LD6A 2H3EB 1WJQA 1RL2A 4D8DA 4M77C 1B7TA 2GGRA 1AZGB 3RIRA 2VXFA 2BKDN 2E5QA 3X26B 3MHXA 3EG2A 1UGQB 3WVEB 2VB6A 3CXCA 3META 2DL7A 2K2VA 1D1CA 1UGPB 1NZ9A 5GJWB 3NPFA 5L23A 3DKMA 5GMKm 3JCMQ 3UATA 1WJRA 2M1HA 2DXUA 3C0CA 4XTZA 2HMAA 3S6WA 2RHXA 5GANh 2KRSA 4MDXA 1YJWA 4X9CA 1VQMA 2COZA 2L89A 2YDLA 2MIOA 2X35A 1HK9A 2WSEE 3BDLA 2IIMA 3REBB 3JCMJ 3HRUA 3CCMQ 1BI0A 1I1JA 2F2WA 1KQ1A 2F2VA 2D0QB 5ECAA 1NYGA 3FB9A 3EGUA 2QG9B 3PVQA 4J9EA 2DE0X 1E7OA 3H0HA 3PT9A 9ATCB 4ZN3A 4M7DA 2QQRA 1WHGA 1C6VX 1K9MC 4BY6B 3NFCA 3I5SA 2CS7A 2DETA 2DKGA 4PJOD 4LDXA 1UGVA 4F7UF 5IHKA 3A1PA 2JMCA 5LJ3f 2JN0A 1M1FA 2ZPIB 3HHTB 3C94A 4EPCA 3G6EQ 4L5GA 3A8MB 2CZ0B 2DMOA 4BY6C 1UUEA 2IG0A 3THKA 2K4YA 2XICA 3CCUQ 2KNBB 2EYWA 1SSHA 1Y0MA 2Y90A 3G71T 4BUGA 3VRYA 1K8AU 3EFOA 1TS9A 5IT9E 3CCQQ 4A4KA 3CXCS 2L3QA 3HTRA 2COYA 1VQOT 1BB9A 4PJJA 4QW2A 1Q7YC 1H92A 2LT1A 1QLYA 3GLXA 4CRIA 3NTIA 1QCFA 3LGFA 3EGXB 5D6YA 4OMPA 3QHSA 5IHIA 2EJFA 4OMLA 1NPPA 3OYBA 3A8OB 1N8RC 2YHTA 4LNPA 4A63B 2DNUA 1D3BA 4BACA 2LT4A 1B34B 4R56A 1PHTA 4Y91A 3J80E 1AT1B 1AWJA 1M1KU 1OOTA 5D6XA 3CD6A 3A8GB 3SWNB 3LYIA 2QA4T 2EGCA 3EGDB 2V8KA 5GMKh 3RERA 1U3OA 2JS0A 3R6NA 1X2KA 4JJNK 1YCYA 5KYWA 2FG0A 2QQBA 1NLOC 1R77A 4RTXA 2JZ2A 1VYTA 4AFUC 1WLPB 1CSKA 2F1LA 1YIJT 1VQKQ 2KYBA 1PM3A 4RG8A 3QSUA 3L2RA 3GOXA 1VQLA 2RQTA 1WFWA 1WHLA 2WACA 1YJWT 1VQMT 2E1HA 1M2VB 4RMOA 2KEAA 3ZL7C 2CP5A 2QGGA 2RH2A 4M75G 4DOWA 2CYZB 3QBYA 3TREA 2LTOA 1R0BG 1RLPC 2HKQB 3M4GA 4AG2C 2CSQA 2JXBA 4KUDK 3M0RA 3H8ZA 2JTEA 3CCRQ 4LN2A 1ZA2B 2K3BA 4AT1B 3OMCA 5LJ3g 1IO6A 3FRNA 1W2BA 3JB9D 4C0DB 1Q86R 2ROTA 4IUVA 1OQKA 3LH5A 2FRWA 4LDVA 1XOVA 1ABOA 2AK5A 3FEOA 2DFUA 5FWCA 3VS2A 2D8JA 3DB4A 1WDXA 2C0OA 1ACMB 1A0NB 3OYYA 4M75E 1WHKA 2HAXA 2CUDA 4EMHA 5GMKi 1PD1A 3GNGA 2B86A 3TVTA 2K57A 2RI2A 3JCMh 1GCQC 3E9FA 4C0DC 1TUGB 1RADB 5LJ3e 2LNHB 1RAGB 4K11A 2EW3A 2HZYA 2O2OA 2AKKA 2LCCA 2V26A 4V2SA 3OYJA 1Y96A 3M9QA 3PIOA 1NLPC 1MNDA 2HNIA 2RN8A 4XAXB 3VU3C 2EJGA 4E6RA 2J6KA 1KC8C 2NUTA 2KR3A 2RJFA 3QWXX 1QVGP 2GTJA 2XMFA 2G6FX 1ZBXA 1YJNA 1WI7A 2P4RA 1JRIA 1N9SA 2MPXC 3NTHA 4M77F 5CIUA 3CD6T 3TQ7P 5KYYB 2QI2A 3M53A 4GLMA 2KROA 3VS0A 1J3TA 4M77D 1R8OB 1E6GA 4ESRA 1P92A 3CPWA 1W2BS 1PG5B 1OPLA 1WPYA 1YN8A 3G4SA 1BI2A 3RMSA 3BFMA 1KQSP 2RHIA 2LCLA 5I2MA 2DZCA 5LJ5d 4XTUA 2MI6A 2KK4A 1MGQA 2I0NA 4M75B 1VQLT 4MZMA 2MWPA 4X34A 3G1JA 3OY9A 3ZBDA 4IKFA 2NYSA 4E7SA 3JB9J 1OULA 1WNLA 3FLGA 1G5VA 4PJMA 3I55A 3FJ5A 2DVJA 4KBMB 2KGTA 4IURA 4M75C 1M9SA 2KRNA 1H8KA 4OMNA 2KRMA 1ZQ1A 5HK3A 5DM7R 4PJNA 4B9WA 1QP2A 4QVZA 1K0XA 2RK2A 2DTOA 2KXCA 4CC3A 1X69A 4RKUE 2YUQA 4DBFA 4C8QA 3MKDA 2DTHA 3CC7T 4ZGEB 2AHJB 1PNJA 2HEQA 2KVQG 2L8DA 2JOYA 1YCSB 2HQXA 3MPUB 4XU3A 1YJWQ 1QCNA 1VQMQ 1K9AA 3PVLA 2XG8D 3CPWS 1YHQA 2MYSA 5GAMh 4PJOA 1ARKA 3KFVA 2F5KA 1OZ3A 1KHCA 3LH0A 3PMTA 1K8AR 5FWBA 3CCJA 3L2UA 1TOVA 2XU8A 2YWWA 3A8HB 4QVDA 2AZSA 3LGLA 3I56A 4KUIA 3O5ZA 1PC0A 4BI8B 4HCKA 2RQUA 1WXBA 3DLMA 4M7AA 3URGA 1UECA 4KH1B 3JV3A 3CMEA 1K1ZA 3L1AA 3A8LB 4JDSA 2W0ZA 3TEEA 2HBWA 2QTVA 1OU9A 1UG1A 8AT1B 2YRVA 4C92E 1K0SA 5CKDA 5GANe 5LJ5j 1VQPA 1U1SA 3WVDB 3G4ST 3QZ5B 2E70A 2EWNA 3ULRB 2QEXA 2V8JA 2K5IA 1Q81U 3RMQA 3I5RA 1T3LA 2CP6A 3M57A 3HP9A 1Q82R 4GBQA 4PNOA 3QG1A 1RAIB 2KSSA 2A36A 2EVRA 4M7DG 2E64A 1SHFA 3QUIA 2KXDA 1VUBA 1OYXA 1K73U 4KH0B 2JMAA 3I55T 3A5ZB 3JCMf 2DK3A 1QQJA 1VQ7A 1SSFA 4J9DA 1PWTA 1HSQA 3CD6Q 2X3WD 1S72A 4EMGA 4OMMA 4B9XA 4DEYA 1VQ4A 5C6SA 2C0IA 3QYHB 2HQEA 2ZPBB 3EG1A 4J7FA 1U1TA 4CC4B 4NL3A 2FZKB 4M7DE 1TH7A 4XTXA 2L5QA 4OB0B 5GANj 2RD1A 1NE8A 1JXOA 2KY9A 1XTDA 5J26A 4XK8E 1SKUB 2EPDA 2F5TX 2HSPA 4JLGA 3JCMW 2VYTA 1Q86C 1VQ5A 4F14A 1MV0B 1YHQT 3L2ZA 3HFNA 2DERA 2C06A 2E3IA 3VYGA 3D7SB 1NBEB 3CCJT 2AT1B 4QQ6A 1GL5A 2L3RA 3H41A 1JJ2P 1IREB 3I56T 4A4HA 4R55A 4Z88A 2ED1A 1VQ6A 2BZ8A 2QYZA 4E7JA 1FMVA 5D6WA 2BE9B 1WJSA 2X51A 1FX7A 3MEUA 1M2OA 1WA7A 2D6FA 4GY5A 3JCMV 4ELYC 3CC2A 1AHJB 1OZ2A 2VGMA 2X4WA 4IIMA 4C92A 1WXTA 1MUZA 1X27A 1QKXA 1W4SA 3X25B 1KHIA 2BIVA 3VS7A 3CCRT 2HL5C 2P0KA 2E10A 4KGXB 4FIBA 2E3HA 4M78A 2J06A 2K2MA 2GNCA 3MJXA 1QVGA 4M7DB 2DIQA 2EYZA 2X4XA 1I5LA 3U23A 1ZHIA 2RHZA 3CCVA 1VOMA 2R57A 4PK4A 1QCOA 3JCMg 1TSFA 4PLIA 2CDTA 2E65A 2DTIA 1YWOA 2OTLA 1KD1U 4M7DC 1VQ7T 1ZBJA 2LCSA 5GAMf 2A08A 2CZ7B 4M75F 3JSCA 1WXUA 1YJNQ 1QVFA 1T0HA 1B07A 2GCXA 3EFOB 1JQQA 2PU9B 2JM8A 3NHNA 1VIFA 1AWXA 3E9GA 1ZX6A 2KE9A 4M75D 2DO3A 3UDCA 3QO3A 2LQWA 4NL2A 3HSBA 3G4SQ 3GBQA 1VYVA 2FZCB 4RG2A 1IGQA 3OS1A 4FU6A 3JCMb 4PJLA 3H6ZA 1HYOA 3CCLA 4QKUA 1D3BB 3E2UA 2V1QA 4OP0A 2IPOB 5IHNA 4HCBA 4XTVA 5AYFA 4MZPA 5GJVB 2VV5A 2OJ2A 1Q7YU 1UGSB 1KSWA 1QVGS 3I55Q 1BCOA 1GBQA 3V7CA 1QVPA 4CI0C 3M0UA 1IHWA 2D9TA 4C5IA 5KYWB 2CUBA 4MMKA 1VQ6T 3OBYA 3E1SA 4E47A 2LP5A 3ZEHA 1RAFB 1YWPA 2L3PA 4KRTA 1K8AC 3M4YA 2O9SA 4HA8A 2PVOB 4NOYA 3CC2T 2RM4A 3PNWC 1G3YA 4FYXB 4LUDA 1KQSS 5CCAA 2M9UA 1QVFS 4OF1A 2W10A 2DJQA 2ZZDA 4J6WA 3QJ6A 2L0AA 4C0FA 4EIKA 2EQMA 3KUFA
chains in the Genus database with same CATH topology
1YBYA 3MCAB 3UT1A 2QI2A 3M53A 2QEXT 2MWOA 3JCMd 4JRIA 2PUKB 3KBGA 4N4HA 4TVRA 3CCRA 5A0DA 1H641 1R8OB 2DIGA 4M77D 1W2BS 1P92A 3CPWA 3CD6T 5CKBA 2E6ZA 3FJPA 1WPYA 3G4SA 3P8HA 2QA4A 1BI2A 4Z02A 3VJPA 3RMSA 1QP3A 3BFMA 3VUZA 2RHIA 1KQ2A 4BDYA 2LCLA 3CCET 5I2MA 2DZCA 5LJ5d 3JCMc 2X4YA 4XTUA 2MI6A 3MP6A 2KK4A 5KH6A 3F70A 5GAN3 1MGQA 4M75B 5FLXE 1VQLT 2K3XA 3OYFA 4MZMA 1BYMA 5GAMg 2WSFE 4M77A 4LD9K 4QVCA 2MWPA 3G6ET 4X34A 5HKCA 3L2QA 1Q81C 1FWZA 3OY9A 3ZBDA 2KQWA 1FXXA 3LWIA 4X9DA 3RUXA 3JAME 3RKYA 3GP8A 1KQSA 4JS4A 2OTLT 1Q82C 5CAIA 4M77E 5I2SA 3CCST 4LDYA 3CCUT 3PFSA 3JB9J 3OBWA 2PUOB 1YIJA 1BI1A 4C8QG 4C8QF 3HRSA 2VC8A 5IN1A 1G3WA 3SB2A 1JBMA 3V8JA 5LJ3d 1WNLA 2G3RA 5GMKj 4KT0E 3FLGA 3X24B 3OYAA 3CMAA 1G5VA 3M56A 5FROA 4KULA 5EG2A 1K9MU 3I55A 2LRQA 3CCQT 1VQ4T 3S3NA 5FRNA 2RI3A 2A3LA 2YLCA 1IZ6A 3M58A 3PGGA 4KBMB 3OYDA 4IURA 2PVGB 4M75C 3LWHA 2FVUA 1M9SA 3QKJA 3OW2S 1BKBA 3GNFB 3M54A 4C8QD 2EJ9A 5GAOr 1ZQ1A 5HK3A 1GXIE 3JCMe 5DM7R 4DA4A 1KD1C 1LNXA 4B9WA 4MZTA 3RESA 1I81A 1QP2A 4QVZA 2LVMA 2EQUA 2P4TA 3OQ5A 4PKCC 4ZGJB 5GAMe 1YJ9A 4PJOG 4FT2A 4PJOF 4C0GA 1Y96B 1Q86U 2RK2A 2DTOA 2OAUA 2RK1A 3P8BB 5CKFA 4YTLA 1VQNA 4ELZC 2XD0A 4RKUE 2HD0A 1U8RA 5CR2A 4C8QA 3CCLT 4D6WA 2DZ9A 2RI5A 1VQ5T 2DTHA 3OB9A 3CC7T 3RKXA 2QTXA 1EIFA 2YLBA 2RO0A 2O01E 4ZGEB 1RI0A 2AHJB 4N0AC 4C8QE 4A4GA 2KVQG 2JTFA 2MAMA 4UC4A 2L8DA 1NJIU 4A54A 2JOYA 2XDBA 2CKKA 4HT9A 2HQXA 4M7AG 4M7AF 1YITA 4XU3A 3BY7A 5GAN6 5CO7A 4OB3B 5GAOq 2OTJA 2XG8D 3J81E 3S3OA 3CPWS 1YHQA 5GAMh 3X20B 4PJOA 3CBPA 3QZ9B 2F5KA 2XK0A 1OZ3A 2DD4A 2RA2A 3L2WA 2WSCE 4DQ2A 3OW2A 1BI3A 1M8VA 1N8RU 1KHCA 2PVDB 1M5Q1 3LH0A 3G7ZA 3PMTA 4M7AD 4EMKA 3OYHA 3MP1A 3CCJA 2ZCFB 1BIAA 4EDUA 3L2UA 2ZPGB 4PJOE 2JNGA 4ZN1A 3S3MA 4QQDA 3UWNA 2ZPHB 4ZTJA 2XU8A 3A8HB 5HY6A 4QVDA 4IUTA 3LGLA 4J6YA 4O5VA 3JB9I 3I56A 4KUIA 1M90U 1VQKT 3OYEA 1KC8U 3OYLA 5J39A 2MMPA 5A2QE 4JS5A 3OA6A 4BI8B 2RJEA 4M77B 3OS2A 3QIIA 3DLLA 1YI2T 3DLMA 2R58A 2LC4A 4M7AA 4ME7A 3V8KA 3URGA 1N6AA 3SDZA 3AHUA 4BB7A 1G3SA 3O8VA 1XNIA 4C0FA 2RB6A 3MEAA 3CMEA 3TU4K 4M7AE 5CKEA 3L1AA 1JJ2A 3OYCA 3A8LB 3BDUA 3M5AA 2RHYA 3MEVA 4JDSA 4L59A 3TEEA 2E41A 2DXTA 2EQJA 3E19A 2B8AA 4GLKA 2KMTA 2YRVA 3EFRA 4LD6A 4C92E 1WJQA 1RL2A 5I21A 5CKDA 5GANe 4M77C 4OGEA 5LJ5j 2GFUA 5GAMd 1VQPA 1V29B 3VV0A 1HXDA 1M1KC 1U1SA 4LDWA 2GFAA 2E6NA 3WVDB 4ZGDB 3J7AF 3CCVT 3OSVA 4LDUA 4ATOA 4N4IA 3G4ST 3RIRA 3QZ5B 3R6OA 2VXFA 2E70A 2BKDN 2E5QA 2EWNA 4IUQA 3X26B 4E7LA 1UB4A 2FHDA 3MHXA 1UGQB 2QEXA 2V8JA 3WVEB 3LLRA 2K5IA 4HKEA 1Q81U 3RMQA 3CXCA 3META 2RHUA 3HPWA 1Y07A 2CZ6B 2K2VA 1UGPB 3M57A 3HP9A 4PNOA 1Q82U 4C8QB 1NZ9A 1S72T 3DKMA 3QG1A 5FU7B 5GMKm 5LJ3j 3JCMQ 1PSEA 1WJRA 1NPRA 2M1HA 4C0ZA 2KSSA 2DXUA 3WXMB 2QQSA 1X01A 4M7DG 2DVEA 3N5BB 4FL6A 5KE3A 2E64A 3LX7A 5CQXA 4M7DF 3QUIA 1M1GA 4XTZA 3SWNC 2QQAA 3EAEA 3QDRB 4IUUA 3S6WA 4BI4A 1VUBA 2RHXA 5GANh 1OYXA 4MDXA 1YJWA 2P0PA 4X9CA 3V8LA 3CMAT 1B34A 1K73U 1VQMA 4A4FA 3I55T 3A5ZB 2L89A 3CC4A 2VXEA 1XQHA 2DK3A 3JCMf 4JRQA 2X35A 4J83A 1VQ7A 2XDDA 1VQ9A 1HK9A 2EAYA 2WSEE 3BDLA 1SSFA 4J8OA 5GAOn 4PJOB 4J7IA 4RCCA 2X4JA 3HRUA 3SWNA 4C8QC 3JCMJ 2MF2A 1BI0A 1H3ZA 3INZA 1KQ1A 2LQ8A 5FU7C 1S72A 1Y7XA 2D0QB 3FB9A 4EMGA 4N4GA 5A0GA 4XTYA 3V7SA 4EMKB 4DOVA 4FSXA 4B9XA 3PIPA 5LJ5f 3X28B 1VQ4A 1YJ9T 2XDPA 2KAFA 5C6SA 2RJDA 3ZFJA 3OYMA 3NTKA 3PT9A 3QYHB 4ZN3A 4M7DA 2QQRA 1WQWA 3JB9G 1K9MC 3JB9F 2HQEA 2ZPBB 1VIEA 4BY6B 3NFCA 1VQNT 4J7FA 3C95A 1U1TA 4JLIA 3CBMA 4XU0A 2CS7A 2ZGWA 2LQKA 2IVWA 3OMGA 4NL3A 2DKGA 4M7DE 1DJ7B 4M7AB 4Y28E 1TH7A 3VYHB 4LDXA 4PJOD 4XTXA 4OGCA 1JJ2S 4F7UG 2L5QA 4F7UF 4OB0B 4PJOC 3HL8A 5GANj 1X75C 2RD1A 1NE8A 4WF2A 2KY9A 1XTDA 5J26A 5LJ3f 2JN0A 1M1FA 2ZPIB 3HHTB 3OYIA 1X6OA 4XK8E 4EMKC 2JVVA 3C94A 2F5TX 5GAN8 4EPCA 4JLGA 1YITT 3BW1A 4L5GA 5GANd 3JCMW 4C5EA 2VYTA 3M59A 1Q86C 3A8MB 1VQ5A 1KG1A 3CC7A 2CZ0B 2DJZA 3FDRA 2Y4YA 2OTJT 1JB0E 2PQWA 4BY6C 2IG0A 3ER0A 1YHQT 2K4YA 2XICA 4C92G 4BD3A 4C92F 2H3JA 3L2ZA 1VQ8A 2Y90A 3SFMA 2ZPFB 3HFNA 3G71T 4BUGA 4OMFB 4BE2A 2C06A 4M7AC 1K8AU 3VYGA 1O75A 3DB3A 4E7KA 5IT9E 4A4KA 3CXCS 3CCJT 5GAN4 4QQ6A 1VQOT 4XU2A 5HK0A 4QW2A 1BIBA 2L3RA 1Q7YC 4PL6A 2LT1A 4P5NA 1IREB 4F7UA 4C92D 3I56T 1N27A 3GLXA 2LX9A 4CRIA 2P0QA 3NTIA 3OYKA 4A4HA 3LGFA 4R55A 5D6YA 1VQ6A 4E7JA 3QPHA 2QXFA 3P8DA 2Y4XA 4XQ3A 3QHSA 4M78G 2K5FA 4M78F 5D6WA 4F7UE 5KE2A 5GAOl 3GF5A 2EJFA 1WJSA 1FX7A 3MEUA 1NPPA 1YJNT 2D6FA 3OYBA 3A8OB 1N8RC 1WQ7A 4GY5A 3JCMV 4BI3A 4ELYC 1AHJB 1OZ2A 2VGMA 2X4WA 2YHTA 4OB2B 4C92A 3CC2A 5DLQE 3MO8A 1D3BA 4BACA 5GAMj 2LT4A 4M78D 5GANf 1B34B 2KDSA 4JRKA 1M90C 4R56A 4Y91A 3J80E 3L42A 1M1KU 4PLLA 1W4SA 3VKIA 3X25B 1KHIA 2BIVA 5KCHA 3CCRT 3C4SA 5D6XA 3CD6A 3A8GB 4L6V5 3CCMA 3SWNB 4ZTFA 2CZ1B 2XIDA 2F69A 3LYIA 4BE0A 2P0KA 5LL6S 2EYQA 3FIFA 2QA4T 2E10A 5FRMA 4FIBA 3TCJA 2V8KA 4QQGA 4M78A 5GMKh 3RERA 2VUBA 2XHCA 5IAYA 4JJNK 4HCCA 4OVAA 3JB9H 4RCBA 1YCYA 4MMLA 3QYGB 5L8RE 1QVGA 4M7DB 4JRPA 2DIQA 4XU1A 4M78E 5GAOm 2X4XA 1I5LA 4J6XA 2QQBA 3V7RA 3GPLA 1OI1A 2JUFA 1ZHIA 2V8IA 2RHZA 3KXTA 3CCVA 2JZ2A 3HFOA 2QDYB 3CCEA 1Y71A 3M55A 1UEBA 2EIFA 2R57A 5KCOA 3MP8A 2LDMA 5FU6B 3OS5A 1YIJT 2VGNA 4RG8A 3JCMg 3QSUA 3EFSA 3L2RA 4IUPA 4PLIA 2E65A 2DTIA 3GOXA 1VQLA 2JTMA 3G6EA 2WACA 3RKWA 1YJWT 5C0MA 5CVIA 2OTLA 1VQMT 2E1HA 1KD1U 3CC4T 2FB7A 4M7DD 4RMOA 4M7DC 1VQ7T 3CCSA 3OS0A 3CCUA 1VQ9T 2EFIA 5GAMf 2RH2A 3CEYA 4M75G 4M75F 2CZ7B 4DOWA 3JSCA 2E12A 5LJ5g 1QVFA 2CYZB 3QBYA 1M4ZA 3TREA 2LTOA 5GAN2 4Q5WA 2O4XA 3FC3A 2RJCA 2GCXA 3ME9A 3OYNA 1N9RA 3M4GA 3CCQA 4HT8A 4E7IA 2PU9B 2EKOA 4HCZA 1VIFA 2R5AA 4KUDK 5FU6C 4A53A 3OYGA 3JRZA 3H8ZA 3E9GA 3HRTA 3GIBA 1UGRB 2R5MA 4F7UB 3Q1JA 4M75D 3UDCA 1I4K1 2DO3A 2K3YA 1K73C 3QO3A 2DAQA 5GAN7 3OMCA 4NL2A 5LJ3g 3HSBA 2CGHA 3L2VA 2DXCA 3FRNA 5CQYA 1W2BA 5CK9A 3ASKA 4RG2A 2QQ9A 3JB9D 4C0DB 3OS1A 4FU6A 3JCMb 3H6ZA 3OSSC 4IUVA 1G3TA 2M0OA 2K5LA 4FT4A 4M75A 4C92B 3CCLA 4E7HA 4NS5A 4LDVA 1D3BB 1XOVA 4IKFA 5LJ5e 3FEOA 5DLOA 1O9SA 4OP0A 3DB4A 3PTAA 4HCBA 3LW5E 3OYYA 4JUVA 4M75E 4XTVA 4A4EA 5AYFA 2M16A 4O6JA 2HAXA 1MHNA 2DPPB 4MZPA 4EMHA 5GMKi 2VV5A 3GNGA 1VQ8T 3T9NA 3JCMP 1Q7YU 2BUDA 1UGSB 4C5GA 2K57A 2FYKA 1QVGS 1NJIC 2FL7A 2RI2A 3JCMh 2GQVA 4M78B 1I8FA 3E9FA 3QJYA 4C0DC 3JCMX 5LJ3e 1LJOA 1WGSA 4C5HA 2GF7A 4C92C 3UPUA 3V7CA 1QVPA 2DXBA 5A0LA 4CI0C 4N0AA 2D9TA 3MEWA 4C5IA 5GAN5 3G71A 4MMKA 1VQ6T 5GMKe 3OBYA 3E1SA 4E47A 1QW1A 2LCCA 3ZEHA 4V2SA 4OB1B 5LJ5h 3QXEB 5DY9A 3HKSA 3OYJA 1VQOA 1Y96A 5GANg 2I2LA 1VQKA 3M9QA 3CMET 1K8AC 3CPFA 3M4YA 2EQKA 2XI9A 3SD4A 3PIOA 4II1A 5GAOp 4HA8A 2HNIA 2PVOB 4NOYA 3CC2T 2RM4A 1LOJA 1G3YA 2XKOC 3PMIA 3PNWC 4XAXB 2ZPEB 4FM4B 5J3BA 2NLUA 3VU3C 4M78C 5CCAA 4BDZA 1YI2A 1KQSS 2M9UA 2DEQA 2EJGA 3CBOA 1KC8C 1QVFS 4OF1A 2A7YA 2HBPA 2RJFA 2LNVA 2ZZDA 1ZBXA 5CKHA 5LJ3h 4VUBA 4J6WA 1YJNA 3QJ6A 5GMKl 1PSFA 4BE1A 1VQPT 3C12A 4J5YA 2DD5A 1JRIA 1N9SA 3NTHA 4M77G 4M77F 4MDWA 4XTWA 5CIUA 3VUBA 3CCMT 2O4XB 2EQMA 3KUFA 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  2ZPG B;  1DJ7 B;  4Y28 E;  3VYH B;  2ZPH B;  4OB0 B;  3A8H B;  2PUK B;  2CZ7 B;  2ZPI B;  2CYZ B;  3HHT B;  4XK8 E;  2PU9 B;  3A8M B;  1QP3 A;  2CZ0 B;  1JB0 E;  1UGR B;  2ZPF B;  3A8L B;  2WSF E;  3VYG A;  2DXC A;  1IRE B;  2PUO B;  1V29 B;  4KT0 E;  4ZGD B;  3WVD B;  3X24 B;  3QZ5 B;  3LW5 E;  3X26 B;  1UGQ B;  2PVG B;  3WVE B;  3A8O B;  2DPP B;  1AHJ B;  2CZ6 B;  1UGP B;  4OB2 B;  1GXI E;  1UGS B;  1QP2 A;  4ZGJ B;  1PSE A;  3X25 B;  2DXB A;  3A8G B;  4L6V 5;  2CZ1 B;  4RKU E;  4OB1 B;  3QXE B;  2O01 E;  4ZGE B;  2AHJ B;  2WSE E;  5L8R E;  3QYG B;  2PVO B;  2ZPE B;  2D0Q B;  4FM4 B;  4OB3 B;  3X28 B;  2QDY B;  2ZZD A;  3QYH B;  3X20 B;  3QZ9 B;  1PSF A;  2DD5 A;  2ZPB B;  2DD4 A;  2WSC E;  2PVD B; 
#chains in the Genus database with same CATH topology
 3H9N A;  2EBP A;  3UT1 A;  4LE9 A;  2O9V A;  1I0C A;  1YHQ Q;  4JRI A;  2V1R A;  4N4H A;  2FO0 A;  1JO8 A;  2DIG A;  4B6M A;  4FYW B;  3CCJ Q;  1QP3 A;  4BDY A;  2E4H A;  2BZY A;  4FYY B;  3JCM c;  5KYX A;  4F04 B;  3I56 Q;  3MP6 A;  3VS3 A;  3F70 A;  2AZV A;  4OMO A;  2K3X A;  2J7I A;  5GAM g;  2WSF E;  4QT7 A;  4X1V A;  4QVC A;  4RTT A;  2BZX A;  1Q95 G;  2OTL T;  1GRI A;  3RUX A;  3JAM E;  3GP8 A;  2DF6 A;  1Q82 C;  5I2S A;  4AMC A;  3OBW A;  2PUO B;  2DL3 A;  3CME Q;  3EH1 A;  4C8Q G;  3HRS A;  2VC8 A;  1R0C B;  5IN1 A;  1JBM A;  5LJ3 d;  2KBT A;  1M3C A;  3CMA A;  2YUP A;  1K73 R;  4LXC A;  3S3N A;  1GBR A;  2YLC A;  3PGG A;  3LWH A;  2EGE A;  1BKB A;  3GNF B;  3M54 A;  2EJ9 A;  5IXF A;  1RAC B;  1VQP Q;  1GXI E;  1MMA A;  4FW1 A;  1I81 A;  4E2F B;  1OX9 A;  1M3A A;  2EQU A;  2FPE A;  5GAM e;  4PJO G;  3RBB B;  1Y96 B;  1YP5 A;  3UA6 A;  4DBH A;  2QEX Q;  5CKF A;  4YTL A;  1VQN A;  4RUG A;  3SHW A;  3CCL T;  3RKX A;  2QTX A;  1EIF A;  2YLB A;  2NUT B;  1Y57 A;  4DEX A;  2CP0 A;  4C8Q E;  1NJI R;  2XDB A;  4A54 A;  3OW2 P;  1SRM A;  4M7A G;  2A37 A;  3VS6 A;  4E7Z A;  1G2B A;  4JJD A;  3J81 E;  3S3O A;  1VQ7 Q;  2DLP A;  4FSS A;  3QZ9 B;  2GQI A;  2RA2 A;  2D8H A;  2WSC E;  3L2W A;  1BI3 A;  1S72 Q;  3M0P A;  2LJ3 A;  4J9B A;  3MP1 A;  4EMK A;  4PJO E;  4EDU A;  2ZPG B;  1KFZ A;  1VQ4 Q;  2CH4 A;  1RAH B;  4IUT A;  4O5V A;  1M90 U;  1KC8 U;  2MMP A;  1AVZ C;  2RPN A;  3M0Q A;  3DLL A;  4JZ3 A;  4ME7 A;  3V8K A;  1N6A A;  1EX4 A;  2H8H A;  4BB7 A;  4M7A E;  1W70 A;  5CKE A;  1JJ2 A;  3OYC A;  3M5A A;  3BDU A;  1VQ5 Q;  2KMT A;  3CXC P;  1KK7 A;  1V29 B;  3VV0 A;  4LDW A;  4ZGD B;  2E6N A;  3J7A F;  4LDU A;  2DL4 A;  2COW A;  1ZUK A;  4HKE A;  2DBK A;  1PRM C;  2CZ6 B;  1NM7 A;  1VQ6 Q;  5D7U A;  4C8Q B;  5LJ3 j;  5FU7 B;  1PSE A;  1NPR A;  3WXM B;  2DVE A;  3N5B B;  4M7D F;  5KE3 A;  1GFD A;  3I9Q A;  2QQA A;  3QDR B;  1MV3 A;  1UJ0 A;  4BI4 A;  3CC2 Q;  1WIE A;  3CMA T;  4AFS C;  3CC4 A;  2VXE A;  4J83 A;  3EG9 A;  1VQ9 A;  4KGV B;  2EAY A;  5GAO n;  4PJO B;  4C8Q C;  1U06 A;  2MF2 A;  3INZ A;  5FU7 C;  2LX7 A;  2CT4 A;  1Y7X A;  4PFZ A;  4N4G A;  4JJB A;  5A0G A;  4XTY A;  4DOV A;  2O31 A;  2XDP A;  2KAF A;  2RJD A;  3ZFJ A;  3JB9 G;  1VIE A;  1CKA A;  1VQN T;  3CBM A;  4XU0 A;  2IVW A;  3OMG A;  3CCV Q;  1DJ7 B;  4M7A B;  4Y28 E;  3VYH B;  1JJ2 S;  4PJO C;  3VRZ A;  2RNA A;  3HL8 A;  2JS2 A;  2LJ1 A;  1TU0 B;  2RF0 A;  1X75 C;  4WF2 A;  2JVV A;  5GAN 8;  5GAN d;  2OTL Q;  1U5S A;  2DA9 A;  2DJZ A;  1KG1 A;  3FDR A;  1TTH B;  1JB0 E;  2PQW A;  3ER0 A;  4C92 G;  4JZ4 A;  2H3J A;  1VQ8 A;  1ZSZ A;  3SFM A;  4OMF B;  4M7A C;  1O75 A;  1OV3 A;  1X6G A;  2QK0 A;  1JU5 C;  5GAN 4;  4PFP A;  5HK0 A;  1BIB A;  4F7U A;  1IHV A;  1N27 A;  1QMC A;  4Y92 A;  3VS5 A;  4D8K A;  3QPH A;  3P8D A;  2DRM A;  2K6D A;  4XQ3 A;  4M78 G;  4WCI A;  2NWM A;  4J9G A;  1YJN T;  1WQ7 A;  1QWF A;  5A0L A;  3CCL Q;  2O88 A;  2KDS A;  4JRK A;  1M1K R;  3L42 A;  4PLL A;  5KCH A;  5KYU A;  4L6V 5;  4J9F A;  3H0F A;  2XID A;  2F69 A;  1OX8 A;  4QQG A;  2XHC A;  4HCC A;  3NGP A;  2DL5 A;  3JB9 H;  5L8R E;  3QYG B;  4XU1 A;  1IRX A;  4M78 E;  4ZNX A;  8ATC B;  3V7R A;  3GPL A;  2JUF A;  3KXT A;  3HFO A;  4RTV A;  2MK5 A;  2QDY B;  3CCE A;  3M55 A;  2EIF A;  1HJD A;  3MP8 A;  1HD3 A;  1Z9Z A;  2LDM A;  4DBQ A;  4IUP A;  1FMK A;  3RKW A;  1NG2 A;  3CC4 T;  2FB7 A;  1RI9 A;  3CCS A;  1VQ9 T;  3CEY A;  1XJW B;  2E12 A;  1AWW A;  1BCM A;  2CP3 A;  2O4X A;  2ECZ A;  2RJC A;  3OYN A;  2EKO A;  4HCZ A;  2R5A A;  4A53 A;  3OYG A;  1UDL A;  1UE9 A;  2R5M A;  1I4K 1;  2OI3 A;  2BTT A;  1K73 C;  4LUE A;  2CGH A;  2QAZ A;  3I35 A;  5FW9 A;  5CQY A;  5CK9 A;  3ASK A;  2DL8 A;  2QQ9 A;  2D0N A;  3M0T A;  3OSS C;  3EG0 A;  2M0O A;  4CC2 A;  4FT4 A;  4C92 B;  4E7H A;  4CC7 A;  4NS5 A;  5DLO A;  4RTZ A;  4ORZ A;  1WYX A;  4A4E A;  2M16 A;  4O6J A;  1MHN A;  1TG0 A;  4J9C A;  1VQ8 T;  3T9N A;  3JCM P;  2BUD A;  3CMA Q;  1AZE A;  2FYK A;  1NJI C;  2FL7 A;  2QGF B;  2OX7 A;  2FEI A;  4M78 B;  1I8F A;  1LJO A;  1WGS A;  1ABQ A;  4C5H A;  4AFZ C;  4C92 C;  2DXB A;  4N0A A;  3MEW A;  3G71 A;  1G83 A;  5GMK e;  1QW1 A;  5LJ5 h;  3QXE B;  2J6O A;  5DY9 A;  3HKS A;  1VQO A;  2SRC A;  3CME T;  3CPF A;  2ATC B;  3SD4 A;  1M90 R;  4II1 A;  1VQN Q;  3PMI A;  1LOJ A;  4FM4 B;  2J05 A;  4M78 C;  1X43 A;  1EFN A;  1YI2 A;  4ANJ A;  1FMW A;  5IXB A;  2HBP A;  2LNV A;  5GMK l;  1PSF A;  4HT9 A;  1PRL C;  3C12 A;  1VQP T;  2DD5 A;  4XTW A;  4MDW A;  1ZA1 B;  2MOX A;  4J6Y A;  1SHG A;  1YBY A;  3MCA B;  2KYM A;  2HQH A;  2EGA A;  2QEX T;  2MWO A;  3JCM d;  2PUK B;  3KBG A;  4TVR A;  1H64 1;  2YXY A;  2HDA A;  5CKB A;  2E6Z A;  3P8H A;  2QA4 A;  4Z8A A;  4Z02 A;  3CCE T;  3IQL A;  2VVK A;  4FCY A;  1QKW A;  1X6B A;  1BYM A;  4M77 A;  3L2Q A;  2RMO A;  2QAS A;  2KQW A;  3BE3 A;  3LWI A;  1KQS A;  4JS4 A;  1E6H A;  5CAI A;  2K9G A;  2PNI A;  4PFO A;  4LDY A;  3CCS T;  1YIJ A;  1BI1 A;  5AT1 B;  4C8Q F;  3SB2 A;  1S72 T;  3V8J A;  5GMK j;  2G3R A;  5EG2 A;  1K9M U;  1SEM A;  1KJW A;  2D1X A;  2LRQ A;  1VQ4 T;  1PCX A;  1AOJ A;  2A3L A;  1IZ6 A;  3OYD A;  2RQW A;  2PVG B;  3OW2 S;  2FVU A;  3QKJ A;  4C8Q D;  3JCM e;  1KD1 C;  1LNX A;  1YFN A;  1SF9 A;  2EYY A;  2PZ1 A;  2LVM A;  3OQ5 A;  1YJ9 A;  4FT2 A;  4PJO F;  4C0G A;  4WTO B;  3VS1 A;  4ELZ C;  1BK2 A;  3SEM A;  4D6W A;  4M4Z A;  2DZ9 A;  1VQ5 T;  2RO0 A;  1LVK A;  2CP7 A;  2JTF A;  2MAM A;  4UC4 A;  2GBQ A;  1UJY A;  4M7A F;  1YIT A;  4OB3 B;  3CC4 Q;  2OTJ A;  4HVU A;  1VQ9 Q;  3X20 B;  4J9I A;  3CBP A;  2DD4 A;  1N5Z A;  4DQ2 A;  2EQI A;  1N8R U;  4M7A D;  1M5Q 1;  3G7Z A;  2DIL A;  3OYH A;  1BIA A;  2ABL A;  2JNG A;  4ZN1 A;  4RTY A;  4ZTJ A;  5HY6 A;  1LCK A;  1ZUY A;  5KYX B;  3JB9 I;  4RTU A;  1ZUU A;  5A2Q E;  3OS2 A;  1YI2 T;  2R58 A;  2LC4 A;  2X9H A;  1M30 A;  1RAA B;  1D0Z A;  3SDZ A;  3AHU A;  3EH2 A;  7AT1 B;  1GFC A;  3O8V A;  3TU4 K;  3MEA A;  1C0M A;  2VAS A;  2MCN A;  2ENM A;  2RHY A;  2QDL A;  2EQJ A;  3E19 A;  2B8A A;  3TSZ A;  5HCK A;  5I21 A;  4OGE A;  2GFU A;  2HSE B;  5GAM d;  1VQ8 Q;  2ROL A;  1M1K C;  1HXD A;  1W1F A;  2GFA A;  4HVV A;  2KT1 A;  1MMN A;  3CCV T;  3OSV A;  4ATO A;  4N4I A;  3R6O A;  4E7L A;  1M8M A;  4IUQ A;  1UB4 A;  2FHD A;  1LPL A;  4JJC A;  3M0S A;  1Q81 R;  1I5O B;  3LLR A;  2RHU A;  3HPW A;  1Y07 A;  1AWO A;  3EGX A;  1Q82 U;  4C0Z A;  1D0Y A;  1X01 A;  2QQS A;  4FL6 A;  3LX7 A;  5CQX A;  3PE0 A;  1M1G A;  3SWN C;  3UF4 A;  3EAE A;  4IUU A;  1D09 B;  1IB8 A;  1C1A A;  2L2P A;  2P0P A;  3V8L A;  1B3Q A;  1V1C A;  1B34 A;  4A4F A;  4HVW A;  1XQH A;  4JRQ A;  1PKS A;  2YUO A;  3A98 A;  2XDD A;  4J8O A;  5EC7 A;  4J7I A;  4RCC A;  2X4J A;  2SEM A;  3SWN A;  1H3Z A;  2LQ8 A;  2JM9 A;  1QWE A;  3V7S A;  4EMK B;  3EGD A;  4FSX A;  3PIP A;  4HXJ A;  3X28 B;  5LJ5 f;  1YJ9 T;  3OYM A;  3NTK A;  1CKB A;  3TSW A;  1WQW A;  3EHQ A;  3JB9 F;  1JXM A;  3C95 A;  1EZZ B;  4JLI A;  3RNJ A;  2ZGW A;  2LQK A;  2HCK A;  2CT3 A;  4FYV B;  2JJ9 A;  4OGC A;  4F7U G;  3CCE Q;  2LMJ A;  1T0J A;  3OYI A;  1X6O A;  4EMK C;  2J6F A;  1YIT T;  2VWF A;  3BW1 A;  4C5E A;  3M59 A;  3CC7 A;  2LZ6 B;  1M2V A;  2Y4Y A;  2OTJ T;  3CCS Q;  2NUP B;  4BD3 A;  4AG1 C;  4C92 F;  2ZPF B;  1K4U S;  3QDF A;  2K7A A;  4BE2 A;  3DB3 A;  4E7K A;  1OEB A;  2NUZ A;  4XU2 A;  2YUN A;  4PL6 A;  4P5N A;  1SPK A;  4C92 D;  2LX9 A;  3OYK A;  2P0Q A;  2QXF A;  2Y4X A;  4M78 F;  2K5F A;  4F7U E;  2E5K A;  5KE2 A;  4KGZ B;  5GAO l;  2BE7 D;  3GF5 A;  2C0T A;  1GCQ A;  4BI3 A;  4OB2 B;  1H3H A;  5DLQ E;  3RR6 A;  3MO8 A;  3EG3 A;  2ESW A;  2M02 A;  5GAM j;  4M78 D;  5GAN f;  1D0X A;  1M90 C;  1PD0 A;  1SG5 A;  2DBM A;  1VA7 A;  2NUP A;  3EG9 B;  1RUW A;  3VKI A;  5KYN A;  3C4S A;  3CCM A;  4ZTF A;  2CZ1 B;  3VS4 A;  4BE0 A;  5LL6 S;  3H0I A;  2EYQ A;  3FIF A;  1IXD A;  5FRM A;  3TCJ A;  1WX6 A;  4F16 A;  2VUB A;  5IAY A;  2FZG B;  4R0K A;  4OVA A;  4RCB A;  1NEB A;  4MML A;  4JRP A;  1UTI A;  2M0Y A;  5GAO m;  4J6X A;  2DYI A;  4FW2 A;  3G71 Q;  1D1A A;  1OI1 A;  6AT1 B;  2V8I A;  1M3B A;  1Y71 A;  1WHH A;  1UEB A;  5KCO A;  1VQO Q;  5FU6 B;  3OS5 A;  4F17 A;  2VGN A;  1QVF P;  3EFS A;  2JTM A;  3G6E A;  1YI2 Q;  5C0M A;  5CVI A;  1KD1 R;  4M7D D;  3OS0 A;  3CCU A;  1JEG A;  2EFI A;  1VYU A;  1T3S A;  5LJ5 g;  1X2Q A;  2KI7 A;  1ZSZ B;  1M4Z A;  3NMZ C;  5GAN 2;  4Q5W A;  3FC3 A;  5KYY A;  2YRC A;  3ME9 A;  3CCQ A;  1N9R A;  4HT8 A;  4E7I A;  1K9M R;  5FU6 C;  3JRZ A;  5I11 A;  3HRT A;  3GIB A;  1UGR B;  4F7U B;  3Q1J A;  1MNE A;  2YT6 A;  2K3Y A;  2FPF A;  2DAQ A;  5GAN 7;  1V76 A;  2QA4 Q;  3L2V A;  2DXC A;  2LJ0 A;  2JT4 A;  1ZSZ C;  2K79 A;  1G3T A;  2K5L A;  4M75 A;  1KIK A;  4JPB W;  2M51 A;  5LJ5 e;  1O9S A;  3PTA A;  3LW5 E;  4JUV A;  5KYU B;  2DPP B;  4Z89 A;  1YIJ Q;  1Q7Y R;  4C5G A;  2GQV A;  2YSQ A;  2VKN A;  3QJY A;  3JCM X;  2GF7 A;  3UPU A;  1WHJ A;  5GAN 5;  4OMQ A;  1N8R R;  4OB1 B;  1MMG A;  2LQN A;  1YJ9 Q;  5GAN g;  2I2L A;  2YRD A;  1VQK A;  1MMD A;  2EQK A;  2XI9 A;  3AT1 B;  5GAO p;  2XKO C;  5J3B A;  1WHM A;  2ZPE B;  4BDZ A;  2NLU A;  2ZAE A;  2F2X A;  2DEQ A;  2AKL A;  3CBO A;  2A7Y A;  5CKH A;  5LJ3 h;  4VUB A;  4BE1 A;  4J5Y A;  1TWB A;  4M77 G;  3CCM T;  3VUB A;  2O4X B;  1YIT Q;  3CQT A;  5M9O A;  2CRE A;  2OTJ Q;  4RTW A;  1SRL A;  3CCR A;  1YNZ A;  1ZLM A;  2RQV A;  5A0D A;  1W6X A;  1UHC A;  3FJP A;  3VJP A;  3VUZ A;  1KQ2 A;  1AEY A;  3UA7 A;  2Z0W A;  2X4Y A;  2CP2 A;  5GAN 3;  5KH6 A;  5FLX E;  2EKH A;  3OYF A;  4LD9 K;  2DX1 A;  2L3S A;  3G6E T;  5HKC A;  1Q81 C;  1FWZ A;  1S1N A;  5IH2 A;  1FXX A;  4X9D A;  3RKY A;  4M77 E;  1I07 A;  1BBZ A;  3CCU T;  3PFS A;  1PKT A;  4DBR A;  1G3W A;  5CR2 A;  3OYA A;  4KT0 E;  3X24 B;  3M56 A;  5FRO A;  4KUL A;  3CCQ T;  1W2B P;  5FRN A;  2RI3 A;  3M58 A;  1F1B B;  1UHF A;  5GAO r;  1WZO A;  1FYN A;  4DA4 A;  2ED0 A;  1NYF A;  4MZT A;  3RES A;  2DRK A;  2DEU A;  2P4T A;  2HL3 A;  2RQR A;  4PKC C;  4ZGJ B;  1M27 C;  2HKN A;  3REA B;  1Q86 U;  2OAU A;  2RK1 A;  3P8B B;  2X3X D;  3QWY A;  1TUD A;  2XD0 A;  2HD0 A;  1U8R A;  1RAB B;  2RI5 A;  3OB9 A;  2A28 A;  2A0F B;  2CH4 W;  2O01 E;  1RI0 A;  4N0A C;  4A4G A;  2PTK A;  2DYB A;  2EYX A;  1NJI U;  1G8X A;  1ZSG A;  2JW4 A;  2CKK A;  1VQL Q;  3BY7 A;  5GAN 6;  5CO7 A;  5GAO q;  1UFF A;  2P84 A;  2XK0 A;  3RDV A;  1NEG A;  3OW2 A;  1BU1 A;  4IIO A;  1AD5 A;  1M8V A;  2PVD B;  2ZCF B;  1D1B A;  1Z9Q A;  1TUC A;  3S3M A;  4QQD A;  3UWN A;  2ZPH B;  1K76 A;  5I22 A;  1TXQ A;  1VQK T;  1KC8 R;  3OYE A;  2CSI A;  1OU8 A;  3OYL A;  2OAW A;  1OPK A;  2FRY A;  5J39 A;  4JS5 A;  3OA6 A;  4J9H A;  2RJE A;  4M77 B;  3QII A;  2GTO A;  1GCP A;  2AIR B;  2KT8 A;  1G3S A;  1XNI A;  2RB6 A;  3CPW P;  1RLQ C;  1RAE B;  4AFQ C;  1IGU A;  3MEV A;  4L59 A;  2DM1 A;  3EHR A;  2E41 A;  2DXT A;  3CC7 Q;  2FPD A;  4GLK A;  3EFR A;  4LD6 A;  2H3E B;  1WJQ A;  1RL2 A;  4D8D A;  4M77 C;  1B7T A;  2GGR A;  1AZG B;  3RIR A;  2VXF A;  2BKD N;  2E5Q A;  3X26 B;  3MHX A;  3EG2 A;  1UGQ B;  3WVE B;  2VB6 A;  3CXC A;  3MET A;  2DL7 A;  2K2V A;  1D1C A;  1UGP B;  1NZ9 A;  5GJW B;  3NPF A;  5L23 A;  3DKM A;  5GMK m;  3JCM Q;  3UAT A;  1WJR A;  2M1H A;  2DXU A;  3C0C A;  4XTZ A;  2HMA A;  3S6W A;  2RHX A;  5GAN h;  2KRS A;  4MDX A;  1YJW A;  4X9C A;  1VQM A;  2COZ A;  2L89 A;  2YDL A;  2MIO A;  2X35 A;  1HK9 A;  2WSE E;  3BDL A;  2IIM A;  3REB B;  3JCM J;  3HRU A;  3CCM Q;  1BI0 A;  1I1J A;  2F2W A;  1KQ1 A;  2F2V A;  2D0Q B;  5ECA A;  1NYG A;  3FB9 A;  3EGU A;  2QG9 B;  3PVQ A;  4J9E A;  2DE0 X;  1E7O A;  3H0H A;  3PT9 A;  9ATC B;  4ZN3 A;  4M7D A;  2QQR A;  1WHG A;  1C6V X;  1K9M C;  4BY6 B;  3NFC A;  3I5S A;  2CS7 A;  2DET A;  2DKG A;  4PJO D;  4LDX A;  1UGV A;  4F7U F;  5IHK A;  3A1P A;  2JMC A;  5LJ3 f;  2JN0 A;  1M1F A;  2ZPI B;  3HHT B;  3C94 A;  4EPC A;  3G6E Q;  4L5G A;  3A8M B;  2CZ0 B;  2DMO A;  4BY6 C;  1UUE A;  2IG0 A;  3THK A;  2K4Y A;  2XIC A;  3CCU Q;  2KNB B;  2EYW A;  1SSH A;  1Y0M A;  2Y90 A;  3G71 T;  4BUG A;  3VRY A;  1K8A U;  3EFO A;  1TS9 A;  5IT9 E;  3CCQ Q;  4A4K A;  3CXC S;  2L3Q A;  3HTR A;  2COY A;  1VQO T;  1BB9 A;  4PJJ A;  4QW2 A;  1Q7Y C;  1H92 A;  2LT1 A;  1QLY A;  3GLX A;  4CRI A;  3NTI A;  1QCF A;  3LGF A;  3EGX B;  5D6Y A;  4OMP A;  3QHS A;  5IHI A;  2EJF A;  4OML A;  1NPP A;  3OYB A;  3A8O B;  1N8R C;  2YHT A;  4LNP A;  4A63 B;  2DNU A;  1D3B A;  4BAC A;  2LT4 A;  1B34 B;  4R56 A;  1PHT A;  4Y91 A;  3J80 E;  1AT1 B;  1AWJ A;  1M1K U;  1OOT A;  5D6X A;  3CD6 A;  3A8G B;  3SWN B;  3LYI A;  2QA4 T;  2EGC A;  3EGD B;  2V8K A;  5GMK h;  3RER A;  1U3O A;  2JS0 A;  3R6N A;  1X2K A;  4JJN K;  1YCY A;  5KYW A;  2FG0 A;  2QQB A;  1NLO C;  1R77 A;  4RTX A;  2JZ2 A;  1VYT A;  4AFU C;  1WLP B;  1CSK A;  2F1L A;  1YIJ T;  1VQK Q;  2KYB A;  1PM3 A;  4RG8 A;  3QSU A;  3L2R A;  3GOX A;  1VQL A;  2RQT A;  1WFW A;  1WHL A;  2WAC A;  1YJW T;  1VQM T;  2E1H A;  1M2V B;  4RMO A;  2KEA A;  3ZL7 C;  2CP5 A;  2QGG A;  2RH2 A;  4M75 G;  4DOW A;  2CYZ B;  3QBY A;  3TRE A;  2LTO A;  1R0B G;  1RLP C;  2HKQ B;  3M4G A;  4AG2 C;  2CSQ A;  2JXB A;  4KUD K;  3M0R A;  3H8Z A;  2JTE A;  3CCR Q;  4LN2 A;  1ZA2 B;  2K3B A;  4AT1 B;  3OMC A;  5LJ3 g;  1IO6 A;  3FRN A;  1W2B A;  3JB9 D;  4C0D B;  1Q86 R;  2ROT A;  4IUV A;  1OQK A;  3LH5 A;  2FRW A;  4LDV A;  1XOV A;  1ABO A;  2AK5 A;  3FEO A;  2DFU A;  5FWC A;  3VS2 A;  2D8J A;  3DB4 A;  1WDX A;  2C0O A;  1ACM B;  1A0N B;  3OYY A;  4M75 E;  1WHK A;  2HAX A;  2CUD A;  4EMH A;  5GMK i;  1PD1 A;  3GNG A;  2B86 A;  3TVT A;  2K57 A;  2RI2 A;  3JCM h;  1GCQ C;  3E9F A;  4C0D C;  1TUG B;  1RAD B;  5LJ3 e;  2LNH B;  1RAG B;  4K11 A;  2EW3 A;  2HZY A;  2O2O A;  2AKK A;  2LCC A;  2V26 A;  4V2S A;  3OYJ A;  1Y96 A;  3M9Q A;  3PIO A;  1NLP C;  1MND A;  2HNI A;  2RN8 A;  4XAX B;  3VU3 C;  2EJG A;  4E6R A;  2J6K A;  1KC8 C;  2NUT A;  2KR3 A;  2RJF A;  3QWX X;  1QVG P;  2GTJ A;  2XMF A;  2G6F X;  1ZBX A;  1YJN A;  1WI7 A;  2P4R A;  1JRI A;  1N9S A;  2MPX C;  3NTH A;  4M77 F;  5CIU A;  3CD6 T;  3TQ7 P;  5KYY B;  2QI2 A;  3M53 A;  4GLM A;  2KRO A;  3VS0 A;  1J3T A;  4M77 D;  1R8O B;  1E6G A;  4ESR A;  1P92 A;  3CPW A;  1W2B S;  1PG5 B;  1OPL A;  1WPY A;  1YN8 A;  3G4S A;  1BI2 A;  3RMS A;  3BFM A;  1KQS P;  2RHI A;  2LCL A;  5I2M A;  2DZC A;  5LJ5 d;  4XTU A;  2MI6 A;  2KK4 A;  1MGQ A;  2I0N A;  4M75 B;  1VQL T;  4MZM A;  2MWP A;  4X34 A;  3G1J A;  3OY9 A;  3ZBD A;  4IKF A;  2NYS A;  4E7S A;  3JB9 J;  1OUL A;  1WNL A;  3FLG A;  1G5V A;  4PJM A;  3I55 A;  3FJ5 A;  2DVJ A;  4KBM B;  2KGT A;  4IUR A;  4M75 C;  1M9S A;  2KRN A;  1H8K A;  4OMN A;  2KRM A;  1ZQ1 A;  5HK3 A;  5DM7 R;  4PJN A;  4B9W A;  1QP2 A;  4QVZ A;  1K0X A;  2RK2 A;  2DTO A;  2KXC A;  4CC3 A;  1X69 A;  4RKU E;  2YUQ A;  4DBF A;  4C8Q A;  3MKD A;  2DTH A;  3CC7 T;  4ZGE B;  2AHJ B;  1PNJ A;  2HEQ A;  2KVQ G;  2L8D A;  2JOY A;  1YCS B;  2HQX A;  3MPU B;  4XU3 A;  1YJW Q;  1QCN A;  1VQM Q;  1K9A A;  3PVL A;  2XG8 D;  3CPW S;  1YHQ A;  2MYS A;  5GAM h;  4PJO A;  1ARK A;  3KFV A;  2F5K A;  1OZ3 A;  1KHC A;  3LH0 A;  3PMT A;  1K8A R;  5FWB A;  3CCJ A;  3L2U A;  1TOV A;  2XU8 A;  2YWW A;  3A8H B;  4QVD A;  2AZS A;  3LGL A;  3I56 A;  4KUI A;  3O5Z A;  1PC0 A;  4BI8 B;  4HCK A;  2RQU A;  1WXB A;  3DLM A;  4M7A A;  3URG A;  1UEC A;  4KH1 B;  3JV3 A;  3CME A;  1K1Z A;  3L1A A;  3A8L B;  4JDS A;  2W0Z A;  3TEE A;  2HBW A;  2QTV A;  1OU9 A;  1UG1 A;  8AT1 B;  2YRV A;  4C92 E;  1K0S A;  5CKD A;  5GAN e;  5LJ5 j;  1VQP A;  1U1S A;  3WVD B;  3G4S T;  3QZ5 B;  2E70 A;  2EWN A;  3ULR B;  2QEX A;  2V8J A;  2K5I A;  1Q81 U;  3RMQ A;  3I5R A;  1T3L A;  2CP6 A;  3M57 A;  3HP9 A;  1Q82 R;  4GBQ A;  4PNO A;  3QG1 A;  1RAI B;  2KSS A;  2A36 A;  2EVR A;  4M7D G;  2E64 A;  1SHF A;  3QUI A;  2KXD A;  1VUB A;  1OYX A;  1K73 U;  4KH0 B;  2JMA A;  3I55 T;  3A5Z B;  3JCM f;  2DK3 A;  1QQJ A;  1VQ7 A;  1SSF A;  4J9D A;  1PWT A;  1HSQ A;  3CD6 Q;  2X3W D;  1S72 A;  4EMG A;  4OMM A;  4B9X A;  4DEY A;  1VQ4 A;  5C6S A;  2C0I A;  3QYH B;  2HQE A;  2ZPB B;  3EG1 A;  4J7F A;  1U1T A;  4CC4 B;  4NL3 A;  2FZK B;  4M7D E;  1TH7 A;  4XTX A;  2L5Q A;  4OB0 B;  5GAN j;  2RD1 A;  1NE8 A;  1JXO A;  2KY9 A;  1XTD A;  5J26 A;  4XK8 E;  1SKU B;  2EPD A;  2F5T X;  2HSP A;  4JLG A;  3JCM W;  2VYT A;  1Q86 C;  1VQ5 A;  4F14 A;  1MV0 B;  1YHQ T;  3L2Z A;  3HFN A;  2DER A;  2C06 A;  2E3I A;  3VYG A;  3D7S B;  1NBE B;  3CCJ T;  2AT1 B;  4QQ6 A;  1GL5 A;  2L3R A;  3H41 A;  1JJ2 P;  1IRE B;  3I56 T;  4A4H A;  4R55 A;  4Z88 A;  2ED1 A;  1VQ6 A;  2BZ8 A;  2QYZ A;  4E7J A;  1FMV A;  5D6W A;  2BE9 B;  1WJS A;  2X51 A;  1FX7 A;  3MEU A;  1M2O A;  1WA7 A;  2D6F A;  4GY5 A;  3JCM V;  4ELY C;  3CC2 A;  1AHJ B;  1OZ2 A;  2VGM A;  2X4W A;  4IIM A;  4C92 A;  1WXT A;  1MUZ A;  1X27 A;  1QKX A;  1W4S A;  3X25 B;  1KHI A;  2BIV A;  3VS7 A;  3CCR T;  2HL5 C;  2P0K A;  2E10 A;  4KGX B;  4FIB A;  2E3H A;  4M78 A;  2J06 A;  2K2M A;  2GNC A;  3MJX A;  1QVG A;  4M7D B;  2DIQ A;  2EYZ A;  2X4X A;  1I5L A;  3U23 A;  1ZHI A;  2RHZ A;  3CCV A;  1VOM A;  2R57 A;  4PK4 A;  1QCO A;  3JCM g;  1TSF A;  4PLI A;  2CDT A;  2E65 A;  2DTI A;  1YWO A;  2OTL A;  1KD1 U;  4M7D C;  1VQ7 T;  1ZBJ A;  2LCS A;  5GAM f;  2A08 A;  2CZ7 B;  4M75 F;  3JSC A;  1WXU A;  1YJN Q;  1QVF A;  1T0H A;  1B07 A;  2GCX A;  3EFO B;  1JQQ A;  2PU9 B;  2JM8 A;  3NHN A;  1VIF A;  1AWX A;  3E9G A;  1ZX6 A;  2KE9 A;  4M75 D;  2DO3 A;  3UDC A;  3QO3 A;  2LQW A;  4NL2 A;  3HSB A;  3G4S Q;  3GBQ A;  1VYV A;  2FZC B;  4RG2 A;  1IGQ A;  3OS1 A;  4FU6 A;  3JCM b;  4PJL A;  3H6Z A;  1HYO A;  3CCL A;  4QKU A;  1D3B B;  3E2U A;  2V1Q A;  4OP0 A;  2IPO B;  5IHN A;  4HCB A;  4XTV A;  5AYF A;  4MZP A;  5GJV B;  2VV5 A;  2OJ2 A;  1Q7Y U;  1UGS B;  1KSW A;  1QVG S;  3I55 Q;  1BCO A;  1GBQ A;  3V7C A;  1QVP A;  4CI0 C;  3M0U A;  1IHW A;  2D9T A;  4C5I A;  5KYW B;  2CUB A;  4MMK A;  1VQ6 T;  3OBY A;  3E1S A;  4E47 A;  2LP5 A;  3ZEH A;  1RAF B;  1YWP A;  2L3P A;  4KRT A;  1K8A C;  3M4Y A;  2O9S A;  4HA8 A;  2PVO B;  4NOY A;  3CC2 T;  2RM4 A;  3PNW C;  1G3Y A;  4FYX B;  4LUD A;  1KQS S;  5CCA A;  2M9U A;  1QVF S;  4OF1 A;  2W10 A;  2DJQ A;  2ZZD A;  4J6W A;  3QJ6 A;  2L0A A;  4C0F A;  4EIK A;  2EQM A;  3KUF A; 
#chains in the Genus database with same CATH homology
 1YBY A;  3MCA B;  3UT1 A;  2QI2 A;  3M53 A;  2QEX T;  2MWO A;  3JCM d;  4JRI A;  2PUK B;  3KBG A;  4N4H A;  4TVR A;  3CCR A;  5A0D A;  1H64 1;  1R8O B;  2DIG A;  4M77 D;  1W2B S;  1P92 A;  3CPW A;  3CD6 T;  5CKB A;  2E6Z A;  3FJP A;  1WPY A;  3G4S A;  3P8H A;  2QA4 A;  1BI2 A;  4Z02 A;  3VJP A;  3RMS A;  1QP3 A;  3BFM A;  3VUZ A;  2RHI A;  1KQ2 A;  4BDY A;  2LCL A;  3CCE T;  5I2M A;  2DZC A;  5LJ5 d;  3JCM c;  2X4Y A;  4XTU A;  2MI6 A;  3MP6 A;  2KK4 A;  5KH6 A;  3F70 A;  5GAN 3;  1MGQ A;  4M75 B;  5FLX E;  1VQL T;  2K3X A;  3OYF A;  4MZM A;  1BYM A;  5GAM g;  2WSF E;  4M77 A;  4LD9 K;  4QVC A;  2MWP A;  3G6E T;  4X34 A;  5HKC A;  3L2Q A;  1Q81 C;  1FWZ A;  3OY9 A;  3ZBD A;  2KQW A;  1FXX A;  3LWI A;  4X9D A;  3RUX A;  3JAM E;  3RKY A;  3GP8 A;  1KQS A;  4JS4 A;  2OTL T;  1Q82 C;  5CAI A;  4M77 E;  5I2S A;  3CCS T;  4LDY A;  3CCU T;  3PFS A;  3JB9 J;  3OBW A;  2PUO B;  1YIJ A;  1BI1 A;  4C8Q G;  4C8Q F;  3HRS A;  2VC8 A;  5IN1 A;  1G3W A;  3SB2 A;  1JBM A;  3V8J A;  5LJ3 d;  1WNL A;  2G3R A;  5GMK j;  4KT0 E;  3FLG A;  3X24 B;  3OYA A;  3CMA A;  1G5V A;  3M56 A;  5FRO A;  4KUL A;  5EG2 A;  1K9M U;  3I55 A;  2LRQ A;  3CCQ T;  1VQ4 T;  3S3N A;  5FRN A;  2RI3 A;  2A3L A;  2YLC A;  1IZ6 A;  3M58 A;  3PGG A;  4KBM B;  3OYD A;  4IUR A;  2PVG B;  4M75 C;  3LWH A;  2FVU A;  1M9S A;  3QKJ A;  3OW2 S;  1BKB A;  3GNF B;  3M54 A;  4C8Q D;  2EJ9 A;  5GAO r;  1ZQ1 A;  5HK3 A;  1GXI E;  3JCM e;  5DM7 R;  4DA4 A;  1KD1 C;  1LNX A;  4B9W A;  4MZT A;  3RES A;  1I81 A;  1QP2 A;  4QVZ A;  2LVM A;  2EQU A;  2P4T A;  3OQ5 A;  4PKC C;  4ZGJ B;  5GAM e;  1YJ9 A;  4PJO G;  4FT2 A;  4PJO F;  4C0G A;  1Y96 B;  1Q86 U;  2RK2 A;  2DTO A;  2OAU A;  2RK1 A;  3P8B B;  5CKF A;  4YTL A;  1VQN A;  4ELZ C;  2XD0 A;  4RKU E;  2HD0 A;  1U8R A;  5CR2 A;  4C8Q A;  3CCL T;  4D6W A;  2DZ9 A;  2RI5 A;  1VQ5 T;  2DTH A;  3OB9 A;  3CC7 T;  3RKX A;  2QTX A;  1EIF A;  2YLB A;  2RO0 A;  2O01 E;  4ZGE B;  1RI0 A;  2AHJ B;  4N0A C;  4C8Q E;  4A4G A;  2KVQ G;  2JTF A;  2MAM A;  4UC4 A;  2L8D A;  1NJI U;  4A54 A;  2JOY A;  2XDB A;  2CKK A;  4HT9 A;  2HQX A;  4M7A G;  4M7A F;  1YIT A;  4XU3 A;  3BY7 A;  5GAN 6;  5CO7 A;  4OB3 B;  5GAO q;  2OTJ A;  2XG8 D;  3J81 E;  3S3O A;  3CPW S;  1YHQ A;  5GAM h;  3X20 B;  4PJO A;  3CBP A;  3QZ9 B;  2F5K A;  2XK0 A;  1OZ3 A;  2DD4 A;  2RA2 A;  3L2W A;  2WSC E;  4DQ2 A;  3OW2 A;  1BI3 A;  1M8V A;  1N8R U;  1KHC A;  2PVD B;  1M5Q 1;  3LH0 A;  3G7Z A;  3PMT A;  4M7A D;  4EMK A;  3OYH A;  3MP1 A;  3CCJ A;  2ZCF B;  1BIA A;  4EDU A;  3L2U A;  2ZPG B;  4PJO E;  2JNG A;  4ZN1 A;  3S3M A;  4QQD A;  3UWN A;  2ZPH B;  4ZTJ A;  2XU8 A;  3A8H B;  5HY6 A;  4QVD A;  4IUT A;  3LGL A;  4J6Y A;  4O5V A;  3JB9 I;  3I56 A;  4KUI A;  1M90 U;  1VQK T;  3OYE A;  1KC8 U;  3OYL A;  5J39 A;  2MMP A;  5A2Q E;  4JS5 A;  3OA6 A;  4BI8 B;  2RJE A;  4M77 B;  3OS2 A;  3QII A;  3DLL A;  1YI2 T;  3DLM A;  2R58 A;  2LC4 A;  4M7A A;  4ME7 A;  3V8K A;  3URG A;  1N6A A;  3SDZ A;  3AHU A;  4BB7 A;  1G3S A;  3O8V A;  1XNI A;  4C0F A;  2RB6 A;  3MEA A;  3CME A;  3TU4 K;  4M7A E;  5CKE A;  3L1A A;  1JJ2 A;  3OYC A;  3A8L B;  3BDU A;  3M5A A;  2RHY A;  3MEV A;  4JDS A;  4L59 A;  3TEE A;  2E41 A;  2DXT A;  2EQJ A;  3E19 A;  2B8A A;  4GLK A;  2KMT A;  2YRV A;  3EFR A;  4LD6 A;  4C92 E;  1WJQ A;  1RL2 A;  5I21 A;  5CKD A;  5GAN e;  4M77 C;  4OGE A;  5LJ5 j;  2GFU A;  5GAM d;  1VQP A;  1V29 B;  3VV0 A;  1HXD A;  1M1K C;  1U1S A;  4LDW A;  2GFA A;  2E6N A;  3WVD B;  4ZGD B;  3J7A F;  3CCV T;  3OSV A;  4LDU A;  4ATO A;  4N4I A;  3G4S T;  3RIR A;  3QZ5 B;  3R6O A;  2VXF A;  2E70 A;  2BKD N;  2E5Q A;  2EWN A;  4IUQ A;  3X26 B;  4E7L A;  1UB4 A;  2FHD A;  3MHX A;  1UGQ B;  2QEX A;  2V8J A;  3WVE B;  3LLR A;  2K5I A;  4HKE A;  1Q81 U;  3RMQ A;  3CXC A;  3MET A;  2RHU A;  3HPW A;  1Y07 A;  2CZ6 B;  2K2V A;  1UGP B;  3M57 A;  3HP9 A;  4PNO A;  1Q82 U;  4C8Q B;  1NZ9 A;  1S72 T;  3DKM A;  3QG1 A;  5FU7 B;  5GMK m;  5LJ3 j;  3JCM Q;  1PSE A;  1WJR A;  1NPR A;  2M1H A;  4C0Z A;  2KSS A;  2DXU A;  3WXM B;  2QQS A;  1X01 A;  4M7D G;  2DVE A;  3N5B B;  4FL6 A;  5KE3 A;  2E64 A;  3LX7 A;  5CQX A;  4M7D F;  3QUI A;  1M1G A;  4XTZ A;  3SWN C;  2QQA A;  3EAE A;  3QDR B;  4IUU A;  3S6W A;  4BI4 A;  1VUB A;  2RHX A;  5GAN h;  1OYX A;  4MDX A;  1YJW A;  2P0P A;  4X9C A;  3V8L A;  3CMA T;  1B34 A;  1K73 U;  1VQM A;  4A4F A;  3I55 T;  3A5Z B;  2L89 A;  3CC4 A;  2VXE A;  1XQH A;  2DK3 A;  3JCM f;  4JRQ A;  2X35 A;  4J83 A;  1VQ7 A;  2XDD A;  1VQ9 A;  1HK9 A;  2EAY A;  2WSE E;  3BDL A;  1SSF A;  4J8O A;  5GAO n;  4PJO B;  4J7I A;  4RCC A;  2X4J A;  3HRU A;  3SWN A;  4C8Q C;  3JCM J;  2MF2 A;  1BI0 A;  1H3Z A;  3INZ A;  1KQ1 A;  2LQ8 A;  5FU7 C;  1S72 A;  1Y7X A;  2D0Q B;  3FB9 A;  4EMG A;  4N4G A;  5A0G A;  4XTY A;  3V7S A;  4EMK B;  4DOV A;  4FSX A;  4B9X A;  3PIP A;  5LJ5 f;  3X28 B;  1VQ4 A;  1YJ9 T;  2XDP A;  2KAF A;  5C6S A;  2RJD A;  3ZFJ A;  3OYM A;  3NTK A;  3PT9 A;  3QYH B;  4ZN3 A;  4M7D A;  2QQR A;  1WQW A;  3JB9 G;  1K9M C;  3JB9 F;  2HQE A;  2ZPB B;  1VIE A;  4BY6 B;  3NFC A;  1VQN T;  4J7F A;  3C95 A;  1U1T A;  4JLI A;  3CBM A;  4XU0 A;  2CS7 A;  2ZGW A;  2LQK A;  2IVW A;  3OMG A;  4NL3 A;  2DKG A;  4M7D E;  1DJ7 B;  4M7A B;  4Y28 E;  1TH7 A;  3VYH B;  4LDX A;  4PJO D;  4XTX A;  4OGC A;  1JJ2 S;  4F7U G;  2L5Q A;  4F7U F;  4OB0 B;  4PJO C;  3HL8 A;  5GAN j;  1X75 C;  2RD1 A;  1NE8 A;  4WF2 A;  2KY9 A;  1XTD A;  5J26 A;  5LJ3 f;  2JN0 A;  1M1F A;  2ZPI B;  3HHT B;  3OYI A;  1X6O A;  4XK8 E;  4EMK C;  2JVV A;  3C94 A;  2F5T X;  5GAN 8;  4EPC A;  4JLG A;  1YIT T;  3BW1 A;  4L5G A;  5GAN d;  3JCM W;  4C5E A;  2VYT A;  3M59 A;  1Q86 C;  3A8M B;  1VQ5 A;  1KG1 A;  3CC7 A;  2CZ0 B;  2DJZ A;  3FDR A;  2Y4Y A;  2OTJ T;  1JB0 E;  2PQW A;  4BY6 C;  2IG0 A;  3ER0 A;  1YHQ T;  2K4Y A;  2XIC A;  4C92 G;  4BD3 A;  4C92 F;  2H3J A;  3L2Z A;  1VQ8 A;  2Y90 A;  3SFM A;  2ZPF B;  3HFN A;  3G71 T;  4BUG A;  4OMF B;  4BE2 A;  2C06 A;  4M7A C;  1K8A U;  3VYG A;  1O75 A;  3DB3 A;  4E7K A;  5IT9 E;  4A4K A;  3CXC S;  3CCJ T;  5GAN 4;  4QQ6 A;  1VQO T;  4XU2 A;  5HK0 A;  4QW2 A;  1BIB A;  2L3R A;  1Q7Y C;  4PL6 A;  2LT1 A;  4P5N A;  1IRE B;  4F7U A;  4C92 D;  3I56 T;  1N27 A;  3GLX A;  2LX9 A;  4CRI A;  2P0Q A;  3NTI A;  3OYK A;  4A4H A;  3LGF A;  4R55 A;  5D6Y A;  1VQ6 A;  4E7J A;  3QPH A;  2QXF A;  3P8D A;  2Y4X A;  4XQ3 A;  3QHS A;  4M78 G;  2K5F A;  4M78 F;  5D6W A;  4F7U E;  5KE2 A;  5GAO l;  3GF5 A;  2EJF A;  1WJS A;  1FX7 A;  3MEU A;  1NPP A;  1YJN T;  2D6F A;  3OYB A;  3A8O B;  1N8R C;  1WQ7 A;  4GY5 A;  3JCM V;  4BI3 A;  4ELY C;  1AHJ B;  1OZ2 A;  2VGM A;  2X4W A;  2YHT A;  4OB2 B;  4C92 A;  3CC2 A;  5DLQ E;  3MO8 A;  1D3B A;  4BAC A;  5GAM j;  2LT4 A;  4M78 D;  5GAN f;  1B34 B;  2KDS A;  4JRK A;  1M90 C;  4R56 A;  4Y91 A;  3J80 E;  3L42 A;  1M1K U;  4PLL A;  1W4S A;  3VKI A;  3X25 B;  1KHI A;  2BIV A;  5KCH A;  3CCR T;  3C4S A;  5D6X A;  3CD6 A;  3A8G B;  4L6V 5;  3CCM A;  3SWN B;  4ZTF A;  2CZ1 B;  2XID A;  2F69 A;  3LYI A;  4BE0 A;  2P0K A;  5LL6 S;  2EYQ A;  3FIF A;  2QA4 T;  2E10 A;  5FRM A;  4FIB A;  3TCJ A;  2V8K A;  4QQG A;  4M78 A;  5GMK h;  3RER A;  2VUB A;  2XHC A;  5IAY A;  4JJN K;  4HCC A;  4OVA A;  3JB9 H;  4RCB A;  1YCY A;  4MML A;  3QYG B;  5L8R E;  1QVG A;  4M7D B;  4JRP A;  2DIQ A;  4XU1 A;  4M78 E;  5GAO m;  2X4X A;  1I5L A;  4J6X A;  2QQB A;  3V7R A;  3GPL A;  1OI1 A;  2JUF A;  1ZHI A;  2V8I A;  2RHZ A;  3KXT A;  3CCV A;  2JZ2 A;  3HFO A;  2QDY B;  3CCE A;  1Y71 A;  3M55 A;  1UEB A;  2EIF A;  2R57 A;  5KCO A;  3MP8 A;  2LDM A;  5FU6 B;  3OS5 A;  1YIJ T;  2VGN A;  4RG8 A;  3JCM g;  3QSU A;  3EFS A;  3L2R A;  4IUP A;  4PLI A;  2E65 A;  2DTI A;  3GOX A;  1VQL A;  2JTM A;  3G6E A;  2WAC A;  3RKW A;  1YJW T;  5C0M A;  5CVI A;  2OTL A;  1VQM T;  2E1H A;  1KD1 U;  3CC4 T;  2FB7 A;  4M7D D;  4RMO A;  4M7D C;  1VQ7 T;  3CCS A;  3OS0 A;  3CCU A;  1VQ9 T;  2EFI A;  5GAM f;  2RH2 A;  3CEY A;  4M75 G;  4M75 F;  2CZ7 B;  4DOW A;  3JSC A;  2E12 A;  5LJ5 g;  1QVF A;  2CYZ B;  3QBY A;  1M4Z A;  3TRE A;  2LTO A;  5GAN 2;  4Q5W A;  2O4X A;  3FC3 A;  2RJC A;  2GCX A;  3ME9 A;  3OYN A;  1N9R A;  3M4G A;  3CCQ A;  4HT8 A;  4E7I A;  2PU9 B;  2EKO A;  4HCZ A;  1VIF A;  2R5A A;  4KUD K;  5FU6 C;  4A53 A;  3OYG A;  3JRZ A;  3H8Z A;  3E9G A;  3HRT A;  3GIB A;  1UGR B;  2R5M A;  4F7U B;  3Q1J A;  4M75 D;  3UDC A;  1I4K 1;  2DO3 A;  2K3Y A;  1K73 C;  3QO3 A;  2DAQ A;  5GAN 7;  3OMC A;  4NL2 A;  5LJ3 g;  3HSB A;  2CGH A;  3L2V A;  2DXC A;  3FRN A;  5CQY A;  1W2B A;  5CK9 A;  3ASK A;  4RG2 A;  2QQ9 A;  3JB9 D;  4C0D B;  3OS1 A;  4FU6 A;  3JCM b;  3H6Z A;  3OSS C;  4IUV A;  1G3T A;  2M0O A;  2K5L A;  4FT4 A;  4M75 A;  4C92 B;  3CCL A;  4E7H A;  4NS5 A;  4LDV A;  1D3B B;  1XOV A;  4IKF A;  5LJ5 e;  3FEO A;  5DLO A;  1O9S A;  4OP0 A;  3DB4 A;  3PTA A;  4HCB A;  3LW5 E;  3OYY A;  4JUV A;  4M75 E;  4XTV A;  4A4E A;  5AYF A;  2M16 A;  4O6J A;  2HAX A;  1MHN A;  2DPP B;  4MZP A;  4EMH A;  5GMK i;  2VV5 A;  3GNG A;  1VQ8 T;  3T9N A;  3JCM P;  1Q7Y U;  2BUD A;  1UGS B;  4C5G A;  2K57 A;  2FYK A;  1QVG S;  1NJI C;  2FL7 A;  2RI2 A;  3JCM h;  2GQV A;  4M78 B;  1I8F A;  3E9F A;  3QJY A;  4C0D C;  3JCM X;  5LJ3 e;  1LJO A;  1WGS A;  4C5H A;  2GF7 A;  4C92 C;  3UPU A;  3V7C A;  1QVP A;  2DXB A;  5A0L A;  4CI0 C;  4N0A A;  2D9T A;  3MEW A;  4C5I A;  5GAN 5;  3G71 A;  4MMK A;  1VQ6 T;  5GMK e;  3OBY A;  3E1S A;  4E47 A;  1QW1 A;  2LCC A;  3ZEH A;  4V2S A;  4OB1 B;  5LJ5 h;  3QXE B;  5DY9 A;  3HKS A;  3OYJ A;  1VQO A;  1Y96 A;  5GAN g;  2I2L A;  1VQK A;  3M9Q A;  3CME T;  1K8A C;  3CPF A;  3M4Y A;  2EQK A;  2XI9 A;  3SD4 A;  3PIO A;  4II1 A;  5GAO p;  4HA8 A;  2HNI A;  2PVO B;  4NOY A;  3CC2 T;  2RM4 A;  1LOJ A;  1G3Y A;  2XKO C;  3PMI A;  3PNW C;  4XAX B;  2ZPE B;  4FM4 B;  5J3B A;  2NLU A;  3VU3 C;  4M78 C;  5CCA A;  4BDZ A;  1YI2 A;  1KQS S;  2M9U A;  2DEQ A;  2EJG A;  3CBO A;  1KC8 C;  1QVF S;  4OF1 A;  2A7Y A;  2HBP A;  2RJF A;  2LNV A;  2ZZD A;  1ZBX A;  5CKH A;  5LJ3 h;  4VUB A;  4J6W A;  1YJN A;  3QJ6 A;  5GMK l;  1PSF A;  4BE1 A;  1VQP T;  3C12 A;  4J5Y A;  2DD5 A;  1JRI A;  1N9S A;  3NTH A;  4M77 G;  4M77 F;  4MDW A;  4XTW A;  5CIU A;  3VUB A;  3CCM T;  2O4X B;  2EQM A;  3KUF A;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...