4RKUE

Crystal structure of plant photosystem i at 3 angstrom resolution
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
63
structure length
63
Chain Sequence
PIGPKRGAKVKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
rcsb
molecule tags Photosynthesis
total genus 5
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rkuE00
3VYHB 3A8GB 4OB2B 3QYGB 4RKUE 2ZPFB 4Y28E 2ZCFB 2O01E 1DJ7B 2DD4A 2PVGB 2ZPEB 2DD5A 2D0QB 4OB0B 4FM4B 3A8OB 3X28B 1QP2A 2PVDB 2CZ1B 1V29B 5L8RE 3WVDB 2WSCE 3X20B 3LW5E 2QDYB 3A8LB 2ZPBB 2DXBA 3A8HB 3QZ9B 1UGQB 1QP3A 4ZGDB 2PU9B 3QXEB 3QYHB 3VYGA 2DPPB 1PSEA 3A8MB 2PUKB 1AHJB 3X25B 2AHJB 2ZPHB 3X24B 2CYZB 1GXIE 4XK8E 1PSFA 2ZPGB 2CZ0B 1IREB 2WSFE 4ZGJB 2CZ6B 2DXCA 3QZ5B 1JB0E 4ZGEB 4KT0E 2CZ7B 3HHTB 2ZPIB 4OB3B 2ZZDA 4OB1B 2PUOB 2PVOB 2WSEE 1UGSB 1UGRB 3X26B 3WVEB 4L6V5 1UGPB
chains in the Genus database with same CATH superfamily
1G2BA 2LNVA 1K73R 4XTUA 3E9FA 5IHKA 2MWOA 4A54A 1OX9A 2LX9A 2CP3A 4PL6A 2AT1B 1SEMA 2PTKA 1IGUA 4LDVA 1OI1A 2LQKA 2K7AA 3OB9A 4F7UF 4RTXA 3EGDB 1PC0A 3REBB 2HQXA 2COZA 5DY9A 3CMAT 5HCKA 2QQBA 2MCNA 2VWFA 3ZEHA 3NHNA 1OEBA 1YBYA 1WFWA 4OP0A 3FB9A 2D6FA 3JAME 2YRVA 3UA7A 1BYMA 2DX1A 1OU9A 5GJVB 4ZGDB 5IXFA 4P5NA 1KJWA 4M75F 1D0XA 2GNCA 2DAQA 4RTTA 2KYBA 2JM9A 2L3QA 5GANf 3SEMA 5LJ5e 1Y57A 4J9DA 1QVFP 2AHJB 4M78B 1KHCA 3CCEA 1RAHB 3HL8A 5FU6C 1QVFA 1TOVA 1SSHA 2KXDA 2M1HA 3G1JA 1WJRA 1G3WA 2EQIA 1SRLA 2C06A 1VQ5Q 4LDWA 2DXCA 2F69A 1ZSZA 2HAXA 1YJNT 3H6ZA 4OMFB 2JMCA 3KXTA 1YHQA 4KT0E 2QEXA 5CKEA 3CBOA 4IURA 3CMEA 4FYXB 3CC4Q 1WHMA 3FLGA 2CKKA 1D0YA 1NJIC 1YI2A 4HVVA 1HJDA 4C5IA 2BZ8A 4PJOA 2F5KA 4PJOE 1RAAB 4J8OA 4XAXB 2OTJA 4C5GA 2CP2A 3ER0A 3C12A 2EVRA 1OZ3A 4WTOB 2V8KA 5I2MA 3SWNA 4Y28E 1Q82U 3CD6T 2F5TX 2EQJA 5FU7B 2D1XA 5J39A 2L89A 1TWBA 1VYUA 5D6XA 3EH2A 4JRQA 1AWXA 3M5AA 1SSFA 3X28B 4AMCA 3JCMb 2FZCB 1SKUB 3WVDB 3VS6A 1KD1C 1EZZB 4J9BA 4N0AC 3EG9B 2W0ZA 2DYIA 2OTLQ 2JN0A 2JS2A 4HKEA 1QQJA 2MI6A 1WQ7A 2EJ9A 1M90R 4M77F 1NG2A 4M78D 6AT1B 2DTHA 2E1HA 2DNUA 1LOJA 4MMKA 2O9SA 2KRMA 2JTMA 1PD0A 2EYQA 1X6BA 4E47A 4LUDA 3QDRB 3PT9A 2O4XB 3JCMh 4M7DA 4Z02A 4R55A 3MP6A 4M7DE 4EMHA 3BFMA 2RJCA 5HK3A 3M53A 1IREB 3VUZA 2P4TA 1LVKA 4IUUA 3DKMA 3MHXA 1ACMB 3G6EQ 1VQ9Q 1YWPA 3PIPA 2FZGB 5GAOm 4HCBA 3GNFB 5GAN8 4J5YA 4LD6A 2CGHA 3JCMe 3QJYA 4XQ3A 4PLLA 2QA4Q 3VYHB 4A63B 1PRMC 2NUTA 3M0SA 3JV3A 2DIQA 5CR2A 5KYWA 1ZSZC 4FYVB 3OYFA 1M1GA 4GBQA 2MIOA 4VUBA 5IAYA 2NUPB 3JB9G 2VV5A 4PJOC 1O9SA 3I9QA 2KXCA 4BY6C 1EIFA 1ZLMA 4GY5A 2E3HA 3JB9H 2RQRA 5LJ3g 1B07A 1VQ6T 1G8XA 2RI3A 3VS7A 5CKBA 1RLPC 1MNEA 3E2UA 2PZ1A 1KQSP 4ELZC 1VQ8T 3SWNC 1YJWA 1WHJA 4C0DC 3CMAQ 1KQSA 3V8KA 4JS5A 3CCJA 3CC2T 2KMTA 1K0SA 3UDCA 4KGVB 1E7OA 1TG0A 2F2XA 3CCSQ 2KDSA 2E3IA 4LD9K 4ANJA 2HSEB 1AZEA 1QVPA 2RHZA 5KE3A 4C5HA 2RQVA 1PD1A 5EG2A 1WHLA 2QXFA 5LJ3h 2CYZB 1GXIE 2Y90A 2LCSA 1WJSA 2L3RA 1D3BA 2DTIA 2WSFE 5A0GA 3PTAA 2EFIA 5LJ3d 3OYNA 3KBGA 3NTIA 2JTEA 1UGVA 2OI3A 1MMDA 1K0XA 2PUOB 1VOMA 3OA6A 4LDXA 5D7UA 2QQRA 3CCVT 4F17A 3OYLA 3GOXA 3I35A 7AT1B 3JSCA 4M7DC 2K79A 2L3SA 4M75A 3QDFA 2EWNA 4M75E 4D8DA 3CMET 1M2OA 2KBTA 1T0JA 1TUGB 1U1TA 5HKCA 2QG9B 3FRNA 2FZKB 4FT4A 2O01E 2KYMA 4RG8A 2DD4A 5KYUA 3UATA 2PVGB 1UHFA 2DRMA 2LCLA 2COYA 4QVZA 2JT4A 3RKYA 1WGSA 3URGA 2YUNA 3CD6Q 2RF0A 1PHTA 4E6RA 4PFZA 2QI2A 2SEMA 1YP5A 4JJBA 5A2QE 1VQ4A 3X20B 1G3SA 2DETA 4DQ2A 2J6FA 2O31A 2FRYA 3A1PA 4JRIA 2DL8A 2B8AA 3L2ZA 3I56A 2EYYA 2EPDA 1BKBA 1UGQB 2L3PA 2KAFA 4R0KA 1VA7A 1YCSB 3QYHB 4DEYA 3MEUA 5GAOn 3I55Q 3MEVA 2FL7A 5GAN7 4JZ4A 1AWOA 1BK2A 3ZL7C 5IT9E 1MMGA 2ZPGB 4PJOF 2W10A 2K2MA 2P0KA 1M9SA 1VQOA 3N5BB 3PGGA 1I0CA 2ZPIB 3R6OA 2C0OA 2ZZDA 3A5ZB 2G3RA 2PVOB 3MJXA 1N9SA 3I5SA 5GAMf 2IG0A 1VQ7T 1M1FA 1U1SA 4RTUA 2FVUA 2MOXA 4AFSC 1RAGB 4AT1B 3UA6A 3CCLT 4O6JA 3BDLA 1ARKA 2GFUA 1NBEB 1D09B 3OW2P 1U5SA 3OW2A 4PK4A 4ZTFA 2D9TA 5FRNA 1K4US 5IN1A 4WCIA 3JCMX 1Z9ZA 3T9NA 4OMNA 2FHDA 2P0PA 3S6WA 1VQMA 3QPHA 1RLQC 3RESA 1KC8U 5GAOl 5IH2A 1RAEB 4M75C 3TQ7P 4XU3A 3CXCS 2RJDA 2HBWA 1BBZA 4M7AC 3CCMA 1Q81C 1QVGS 2Y4YA 1RI0A 1SHGA 3BDUA 3LH0A 1JBMA 2OTLT 4MZTA 3QBYA 1JJ2A 2DPPB 2QQSA 1XQHA 4X1VA 3H8ZA 2PUKB 2KNBB 1HSQA 3M54A 2DIGA 4OMLA 2JNGA 4LN2A 5A0LA 1BB9A 5KYXA 1FXXA 1MMNA 1WIEA 4IKFA 1TSFA 4QQ6A 2CP7A 5GAOq 1I4K1 4KUIA 2LQ8A 1VQPA 4C92G 1U8RA 3GIBA 3PNWC 3H41A 1S1NA 5LL6S 2EW3A 1BIAA 3BE3A 5GANe 1FWZA 1G83A 2HEQA 2LP5A 4JDSA 4A4FA 4M77D 4DBQA 1M3CA 3QUIA 4HT8A 3G6ET 2YDLA 1VQ9T 5FLXE 4DEXA 4FCYA 1KC8R 2K4YA 1PCXA 1W1FA 4DOVA 2R5AA 2KEAA 2MMPA 4JLIA 2QA4T 1FMKA 4C8QB 1DJ7B 2DXTA 1JJ2S 3M0RA 3MEWA 1YHQQ 2X4YA 3OYIA 1N8RC 3CMEQ 2CP5A 3NPFA 1ZA1B 2DTOA 3P8BB 1UHCA 4IIMA 2DYBA 1BI0A 4BACA 1YI2Q 2ABLA 4C0FA 3SB2A 4FT2A 3VU3C 4KUDK 1SHFA 2OTJQ 2LJ3A 4N4GA 2O2OA 4JUVA 3G71A 1ZA2B 4C0ZA 4RUGA 3F70A 5I22A 3OYHA 2QTVA 3OS1A 2AZVA 1D1CA 1ZBXA 3L2RA 1I81A 1RL2A 2DERA 4C8QG 1M8MA 3CC7A 4E7ZA 1Q86U 2FEIA 1JXOA 3R6NA 2ROTA 3CCST 2XG8D 5LJ5h 3EGDA 4TVRA 1AZGB 3HP9A 2A28A 1M1KR 1SRMA 4L5GA 3VS1A 3OYYA 1QWFA 1TUDA 4XTWA 5LJ5d 2A3LA 4Y92A 2GTOA 2M02A 4XTXA 2RQUA 5D6WA 2VUBA 2M0OA 2V1RA 3LLRA 4PJNA 3DB3A 1G3YA 4M7AF 3M59A 5DM7R 3EG3A 4DBFA 2DK3A 4DA4A 3ZBDA 2CH4W 2LC4A 4OGCA 1IGQA 3EFOB 2KY9A 3HRTA 2HL3A 2LZ6B 1VQOT 4FSXA 2RQTA 4C8QD 4N4HA 5GMKi 4AG1C 1QW1A 3QG1A 4OB2B 3QYGB 2QAZA 4BI8B 3REAB 1VQ7Q 3V8LA 1ZSZB 2NLUA 4NL2A 3CCLQ 1PKSA 2GQIA 3UPUA 1KQ1A 3M0TA 5KCOA 2XHCA 4BDZA 1Q86R 2PVDB 4K11A 2K3YA 1I07A 1OX8A 1K8AU 3Q1JA 1WQWA 4M78G 2A7YA 2I2LA 4PJOB 2YUOA 2CS7A 1YJ9A 3CCQA 5L23A 1K73C 3CCUT 1OULA 1PM3A 2FB7A 1WA7A 1HK9A 2DBKA 2XICA 3JCMP 1N6AA 1Y96B 3PE0A 3SWNB 1G5VA 1NEBA 4FU6A 4KULA 5ECAA 1X6GA 3GNGA 3OYKA 2X4WA 4M4ZA 3CPWP 1XOVA 1QVFS 1SG5A 2RD1A 3CPWA 1Q7YU 1D1BA 3JCMg 2Y4XA 1BCOA 1IB8A 3FC3A 2D0NA 1XNIA 1AWJA 3JRZA 1AVZC 1QKWA 3I55T 1UB4A 5LJ5j 1M1KC 2LCCA 3V7RA 2YUQA 2BKDN 5CKFA 1YJWQ 3EHQA 3CCJQ 4J9FA 3TREA 1C1AA 4RTWA 3CCRA 3OYCA 4XTYA 3NTKA 3L2VA 2LJ1A 2OAUA 2V1QA 3H0IA 4Z89A 1VQLA 4A53A 4FW1A 2DZ9A 1K8AR 2O4XA 4J83A 1FYNA 3JCMd 4M7DB 2QTXA 3OSVA 2DL5A 1Q82R 3SHWA 3PVQA 3M4YA 4GLMA 3OS2A 1VQ5A 3QWXX 4BI4A 1YWOA 4MZPA 3OYGA 3FIFA 2IPOB 2ZPEB 4MDXA 4B6MA 1VQKA 3OMCA 4X9CA 4PJOD 4KGZB 4OB0B 4CI0C 3GLXA 1YNZA 2JZ2A 2MF2A 2JOYA 1K1ZA 2K6DA 3CC4A 3M58A 1Q7YR 2EYXA 3V7CA 4JPBW 1K9MU 3EH1A 1X2KA 4PFPA 1K76A 3HPWA 1NYFA 2DJQA 1NEGA 1M8VA 1E6HA 1LJOA 3SD4A 2E5QA 2NUTB 2V26A 2KT1A 4J6WA 3NTHA 5D6YA 4XTVA 3SFMA 1CKBA 5KYWB 1ZBJA 2CH4A 4YTLA 2RHIA 5J26A 2ATCB 1WPYA 4LDUA 1WXTA 2V8IA 1O75A 2EQMA 2NUPA 4PJJA 3H0FA 4D8KA 1M5Q1 1TU0B 3OYBA 1QCFA 1NYGA 2MPXC 1TTHB 4LNPA 4J6YA 1GCQC 1M27C 2AKKA 3MPUB 2BE7D 2QGFB 4A4EA 1M90C 3I56Q 2KE9A 3HRUA 2FRWA 2H3JA 4ZGEB 4EDUA 5IHNA 5FU7C 2CZ7B 3HHTB 2BTTA 2BIVA 4HCKA 2PNIA 2J7IA 2E5KA 5GAMh 4M7DD 2AK5A 2WSEE 2XI9A 2ESWA 1UGSB 5GAN6 4IUTA 1X27A 2DO3A 1JU5C 3QIIA 3X26B 1M30A 1QCOA 2RQWA 1RI9A 4E7SA 4F7UB 4AFQC 1N9RA 2HQEA 2FPFA 1D3BB 3CCET 1YFNA 1Q81U 2CSQA 1YITA 1ABOA 3PVLA 2K5LA 3M4GA 4Z8AA 1IHVA 2LX7A 1VQOQ 5GAMe 2LNHB 2GFAA 1CSKA 2AKLA 4X9DA 1H641 2D8JA 2X3XD 5FROA 4KH1B 1YHQT 1V29B 1YCYA 2QEXT 4FYWB 4M7AA 1KQSS 4M7AE 3OYAA 5GAN5 3MO8A 2FO0A 1W2BP 4M75B 1YI2T 1W2BA 4QVDA 4XU2A 5CO7A 3LWHA 2DBMA 4F7UG 3QZ9B 1T3SA 2OTJT 5KYYB 2HL5C 2PU9B 2LTOA 4XU1A 4QKUA 1X43A 1YJ9T 3CCQT 5FW9A 3CCUQ 2E6NA 4DOWA 4HT9A 2F2WA 1YIJA 2KRNA 4LDYA 4FSSA 1WLPB 1QWEA 2X4XA 5KE2A 3FJ5A 3TVTA 2OAWA 2VYTA 4XK8E 1Z9QA 1PSFA 5GMKm 2DRKA 1OOTA 2SRCA 3CCMQ 3DLLA 3QZ5B 2JVVA 4MMLA 3H0HA 1UUEA 2YRDA 5CQYA 4EMKA 1UJYA 2VGMA 1X01A 2DXUA 2BUDA 2DEQA 3INZA 2RK2A 1LCKA 3M0UA 2MWPA 3A98A 2ED0A 2DVEA 3VKIA 4RTYA 1FMVA 3QHSA 1MMAA 5GAMj 3HSBA 5A0DA 2CT3A 4O5VA 1MV3A 4MDWA 3C4SA 5HY6A 2DLPA 2Z0WA 1VQPQ 1QCNA 3TSZA 2QASA 4XTZA 1NZ9A 1GFCA 1PWTA 8AT1B 1WHHA 3VV0A 2DMOA 1BU1A 4M75D 5C6SA 4QQDA 2P84A 2DKGA 1OPKA 1GBQA 4M77B 1M2VB 3ULRB 2JMAA 1YJNA 4MZMA 2LQWA 3TSWA 3KUFA 2MK5A 3LH5A 5M9OA 2YHTA 1V1CA 1AEYA 1J3TA 4J9IA 5LJ3f 2YRCA 4RTVA 1D1AA 2J6KA 3E19A 2K9GA 1XJWB 1QP3A 2KQWA 2DL7A 1PKTA 3PMTA 1WI7A 1ABQA 1ZQ1A 1M3BA 3VJPA 2K5IA 5AT1B 3OYDA 3G4SA 2EKHA 4ZN1A 1AT1B 1BI1A 3VS3A 3X25B 2R5MA 1OU8A 4RCCA 2L0AA 4M77G 3O5ZA 3S3NA 4HXJA 3E1SA 1S72A 4C92A 4ZGJB 3G71Q 3RERA 4C92E 1B34A 3THKA 2J6OA 5FRMA 1JQQA 2FPDA 1P92A 1KHIA 5GANh 2X3WD 3M0PA 2J05A 1YJWT 1NJIU 3CCJT 4Y91A 5GANd 2ECZA 4ATOA 4CRIA 4E7LA 1UGRB 1KSWA 5FU6B 4KGXB 3CQTA 4NL3A 5CAIA 2X35A 3BY7A 3EHRA 2VC8A 2DL4A 3DLMA 3JB9F 1I8FA 3OW2S 2VXEA 1FMWA 2DF6A 1K73U 2ZPFB 4A4HA 5I2SA 3RBBB 4L59A 3OY9A 2XMFA 2ZCFB 1KQ2A 2LRQA 4EMKC 4IUPA 2JM8A 1BI3A 4OVAA 3JCMW 5GAN3 1ZUUA 2GGRA 1VQNA 2IVWA 3QKJA 4FM4B 4BB7A 3AT1B 3LGFA 2P4RA 3CCEQ 2F1LA 2ED1A 1OPLA 1KD1U 1GL5A 2QGGA 3EGXB 3GF5A 2DA9A 2EGEA 4HVUA 1F1BB 2RJFA 2CUBA 2XU8A 1IO6A 4RG2A 4KBMB 2QEXQ 2KVQG 3DB4A 5FWCA 2MAMA 3UWNA 1TUCA 4ELYC 5LJ5g 1EX4A 1K9AA 1PSEA 4QT7A 2LT1A 1NJIR 1JEGA 2EJGA 2VKNA 5CCAA 4X34A 2C0IA 1TS9A 1E6GA 1N5ZA 3RKXA 1WYXA 1MUZA 1OZ2A 1Y0MA 3OSSC 4E7KA 1YJ9Q 2A36A 3CCQQ 2B86A 3L2UA 3OS5A 1B7TA 2O9VA 5FWBA 4BE2A 1VQ4T 1W4SA 3JCMQ 4ZNXA 4AFUC 3I56T 1OYXA 4DBRA 1VQ6A 2JW4A 2FPEA 5GANj 4JLGA 3H9NA 2EJFA 2VGNA 1VQ8A 1I1JA 1KD1R 3OMGA 3CC2A 3VUBA 2E70A 1VYVA 2RO0A 4C92C 4J7IA 3M9QA 3ASKA 3OBWA 1UDLA 1MV0B 2COWA 3GBQA 2LDMA 5GMKl 1TXQA 4PJLA 3TEEA 3CCRQ 3C95A 1T3LA 3TU4K 1B3QA 2E65A 2RHYA 5CQXA 3VRYA 1NM7A 4LE9A 5CVIA 3J80E 4M78A 4BE1A 1VQLQ 1N27A 2HBPA 4M78E 4NS5A 2GCXA 5I11A 3FDRA 3EFOA 2WSCE 1X69A 1KK7A 1KC8C 4QQGA 1Y7XA 2QDYB 3FEOA 2RA2A 3A8LB 3GP8A 1WJQA 1KIKA 4KH0B 8ATCB 4F04B 4KRTA 1M90U 3CCVA 2E4HA 2CSIA 1UG1A 3QXEB 5KH6A 2ZAEA 1VQKQ 1C0MA 2GQVA 4JJNK 2ENMA 2M51A 4A4GA 2AIRB 4BY6B 2G6FX 3HKSA 3AHUA 5GAN2 3PIOA 3MP1A 4J9EA 2OJ2A 1GCQA 1Q95G 1H3HA 2RMOA 2CZ0B 2QK0A 2RHXA 4C0DB 1VQMT 3QSUA 3G4ST 2EQUA 2E12A 2K57A 1M4ZA 4WF2A 3MKDA 2RI2A 1Y96A 2RK1A 3CCMT 4C8QC 1WXBA 3HTRA 1YN8A 4OB1B 1VYTA 2GTJA 3E9GA 2QDLA 3UF4A 4HCZA 4C5EA 4Q5WA 1S72T 3SDZA 4D6WA 4J6XA 2NUZA 2EAYA 4A4KA 4PJOG 2DM1A 3OQ5A 3EG9A 4L6V5 2RB6A 1RABB 4PKCC 2YUPA 1HD3A 1IZ6A 1G3TA 4E2FB 4JJCA 1VIFA 2QYZA 5DLOA 1W70A 1NE8A 2KT8A 2CT4A 1I5OB 5J3BA 5GJWB 3QO3A 2J06A 4CC7A 1VQPT 1UTIA 3LGLA 2XDBA 1QP2A 1TH7A 2O88A 3QJ6A 2L8DA 4AFZC 3P8HA 4DBHA 2CP0A 1R0CB 4E7HA 5LJ5f 2R58A 4CC4B 2RNAA 1VQNT 2DXBA 1C6VX 3A8HB 4FYYB 3EAEA 1YITQ 3CPWS 3QWYA 3M56A 1BCMA 1WXUA 3M0QA 1VQ7A 2XIDA 4IUVA 1I5LA 2P0QA 2CREA 4C92F 2DJZA 1ZX6A 2GF7A 4BD3A 1WDXA 3CCLA 4EPCA 4PFOA 1Q86C 4FIBA 4M78C 4RMOA 3BW1A 3EFSA 5CKHA 2KR3A 4B9WA 3JB9I 2DL3A 1OV3A 1NPRA 3RKWA 4II1A 1AWWA 4M7DG 3S3MA 2E41A 4GLKA 5KYNA 4OMQA 1PRLC 4ME7A 4BDYA 4NOYA 1WHGA 2YXYA 3PMIA 5GAMg 2LVMA 5AYFA 3G71T 2RJEA 1U3OA 3L2QA 1PG5B 1GBRA 4Z88A 1M3AA 5C0MA 4JRPA 2X4JA 2YWWA 2RI5A 4OMOA 2I0NA 1YIJQ 1GCPA 3RNJA 1KG1A 1VQ4Q 1H3ZA 2X9HA 3EG0A 3CC7T 2OTLA 5GMKh 5CIUA 4OMMA 3KFVA 3PFSA 3OYJA 1NLPC 1BI2A 4QW2A 4RKUE 4ESRA 4V2SA 2HD0A 5I21A 2M9UA 1IXDA 3ZFJA 4CC3A 2DD5A 1NPPA 2JUFA 1H8KA 2L2PA 3JCMV 3L1AA 1K9MR 3C94A 5GAMd 1IRXA 5L8RE 4UC4A 3L42A 4C8QF 2R57A 5GMKe 3V8JA 2WACA 1K8AC 2E64A 1RACB 4EIKA 2XK0A 4J9CA 3JCMJ 4LUEA 4J9GA 1MHNA 1Q82C 2HKQB 4BI3A 2EKOA 2NWMA 4F7UA 4F7UE 2HSPA 4QVCA 2K3XA 1RADB 2YSQA 3G6EA 1ZUYA 3GPLA 3JB9D 1VQ9A 1U06A 1VUBA 4HA8A 1OQKA 3VS0A 5HK0A 2FYKA 2E10A 3VS2A 2A0FB 3OS0A 1UEBA 1Q7YC 3HFOA 3RR6A 3J81E 2HNIA 2HZYA 2K2VA 3L2WA 2K3BA 2ZPHB 1UECA 3EG1A 2QA4A 5LJ3e 4M7AB 1WZOA 1YJNQ 3FJPA 3JCMf 5EC7A 4ORZA 3C0CA 4ZTJA 4FW2A 4ZN3A 1JB0E 1SF9A 4PNOA 5KYUB 5KCHA 3O8VA 2K5FA 3NGPA 1XTDA 3MP8A 2EBPA 1GFDA 5KYYA 4RTZA 1LPLA 2CDTA 4LXCA 1VQMQ 3CPFA 1X75C 4JRKA 3G4SQ 1A0NB 3MEAA 1W6XA 4E7JA 3IQLA 3MCAB 2RN8A 3WVEB 4RCBA 1UGPB 2BZXA 4M75G 2M16A 4M78F 2NYSA 3EFRA 1Q81R 2DZCA 1RUWA 2BE9B 4M7AG 2DE0X 3CMAA 1S72Q 1IHWA 4PJMA 3M57A 1X2QA 1QLYA 1LNXA 2LQNA 4R56A 5GMKj 3JB9J 1RAFB 3CCSA 3RUXA 1N8RU 4EMKB 4OF1A 3CEYA 4HCCA 2KRSA 2JTFA 1H92A 3A8OB 4CC2A 4J7FA 2OX7A 3TCJA 2VVKA 3CCRT 3CBMA 3LWIA 1W2BS 4B9XA 4PLIA 1K9MC 3LW5E 1X6OA 1VQLT 3J7AF 1MNDA 2EIFA 1WHKA 2ZPBB 4F14A 3CXCP 1GRIA 2A08A 3OBYA 3CXCA 9ATCB 4OGEA 2KSSA 4N4IA 3RMSA 2H3EB 2VXFA 1WNLA 1QVGP 3EG2A 2DEUA 3VYGA 1QVGA 5LJ3j 3G7ZA 1SPKA 1EFNA 2HMAA 1KFZA 3A8MB 4M7AD 3CBPA 1VQ5T 1VQNQ 2XKOC 3EGUA 3NMZC 2EGAA 5GAOp 3U23A 1VQKT 4OMPA 1HYOA 1R8OB 4M77A 2H8HA 4IIOA 4IUQA 3RMQA 4M77E 2KK4A 1M2VA 2ROLA 3M55A 3CC4T 2V8JA 2KROA 2VASA 1UE9A 5GANg 4EMGA 2JXBA 2EYWA 2EYZA 2BZYA 4F16A 2YLCA 2QQ9A 4OB3B 3JCMc 1N8RR 2RH2A 4J9HA 2DILA 3D7SB 2JJ9A 3LYIA 1JRIA 2X51A 3LX7A 1NLOC 3CD6A 3CCUA 2PQWA 1ZUKA 2LT4A 5IXBA 1WX6A 2ZGWA 2LMJA 4BE0A 1VIEA 2E6ZA 2YLBA 2CUDA 2QQAA 3RIRA 3A8GB 4JJDA 2DFUA 5GAOr 2RHUA 2JS0A 3OYEA 3V7SA 4C92B 1B34B 3UT1A 3CC7Q 1AD5A 2RM4A 4M7DF 2D0QB 5CK9A 2MYSA 1JJ2P 1PNJA 3I55A 1R77A 1VQ6Q 1ZHIA 2CZ1B 5KYXB 2XDDA 2CP6A 1VQ8Q 2XD0A 3ME9A 3CC2Q 2HQHA 2KI7A 2HCKA 2L5QA 2HDAA 4XU0A 2C0TA 3VS4A 1FX7A 2LJ0A 4JZ3A 2FG0A 1BIBA 2F2VA 3S3OA 3I5RA 2M0YA 2RPNA 1QKXA 5CKDA 1T0HA 1RAIB 2AZSA 5DLQE 4HVWA 3VS5A 4C0GA 4E7IA 1YITT 1AHJB 2D8HA 4AG2C 1R0BG 1Y07A 4BUGA 2XDPA 4FL6A 3OYMA 3NFCA 1CKAA 1ZSGA 1D0ZA 2A37A 1QMCA 1JXMA 3X24B 3META 2EGCA 3HRSA 1M1KU 2EQKA 3EGXA 3RDVA 1UJ0A 2CZ6B 3VRZA 2HKNA 4C8QA 1JO8A 4C8QE 1Y71A 5GAN4 3CCVQ 3WXMB 5IHIA 1HXDA 2IIMA 1MGQA 3HFNA 2YT6A 4JS4A 2KGTA 1V76A 2DVJA 3P8DA 4C92D 4M77C 1AOJA 2GBQA 2VB6A 4N0AA 1UFFA 1YIJT
chains in the Genus database with same CATH topology
4F7UB 2LNVA 1N9RA 4PKCC 4XTUA 3E9FA 1IZ6A 1G3TA 2HQEA 2MWOA 4A54A 1VIFA 2LX9A 2GFUA 4PL6A 1D3BB 5DLOA 3CCET 1Q81U 4LDVA 1YITA 1OI1A 1NE8A 2K5LA 3M4GA 2LQKA 3OW2A 5J3BA 3QO3A 3OB9A 5GAMe 4ZTFA 2D9TA 5FRNA 5IN1A 4F7UF 2GFAA 1VQPT 4X9DA 3JCMX 1H641 3T9NA 5FROA 2HQXA 2FHDA 2P0PA 3LGLA 5DY9A 1QP2A 3S6WA 1TH7A 2QQBA 1YHQT 1V29B 3CMAT 1YCYA 1VQMA 2QEXT 3QJ6A 3QPHA 2L8DA 3P8HA 3RESA 1KC8U 5GAOl 3ZEHA 4M7AA 1KQSS 4M75C 3CXCS 4XU3A 3OYAA 4E7HA 4M7AE 5GAN5 2RJDA 3MO8A 1YBYA 4M75B 5LJ5f 1YI2T 2R58A 4OP0A 4M7AC 3CCMA 1W2BA 3FB9A 1Q81C 4QVDA 2D6FA 1QVGS 4XU2A 3JAME 1VQNT 5CO7A 3LWHA 2DXBA 4F7UG 3A8HB 2Y4YA 1RI0A 3BDUA 3LH0A 3QZ9B 3EAEA 2YRVA 1JBMA 2OTJT 1BYMA 3CPWS 2OTLT 3M56A 4ZGDB 2PU9B 2LTOA 2XIDA 4XU1A 4IUVA 4MZTA 1I5LA 4P5NA 2P0QA 1VQ7A 3QBYA 1JJ2A 2DPPB 2QQSA 4C92F 2DJZA 4M75F 1YJ9T 1XQHA 3CCQT 3H8ZA 2GF7A 4BD3A 2E6NA 2PUKB 3CCLA 4EPCA 2DAQA 4DOWA 4HT9A 1YIJA 4LDYA 3M54A 5GANf 1Q86C 2DIGA 4FIBA 4M78C 4RMOA 2JNGA 5LJ5e 3BW1A 3EFSA 5CKHA 5A0LA 2AHJB 2X4XA 4M78B 5KE2A 1KHCA 3CCEA 3HL8A 1QVFA 5FU6C 4B9WA 3JB9I 1FXXA 2M1HA 1NPRA 2VYTA 4XK8E 4II1A 3RKWA 4M7DG 1WJRA 4IKFA 1G3WA 3S3MA 1PSFA 2E41A 2C06A 4QQ6A 5GMKm 4GLKA 5GAOq 1I4K1 4LDWA 4KUIA 2LQ8A 3DLLA 1VQPA 4C92G 2DXCA 2F69A 3QZ5B 1U8RA 3PNWC 3GIBA 2JVVA 4ME7A 4MMLA 2HAXA 4BDYA 1YJNT 5CQYA 3H6ZA 4NOYA 5LL6S 4OMFB 1BIAA 3PMIA 4EMKA 3KXTA 4KT0E 1YHQA 5GANe 2VGMA 5GAMg 1FWZA 5CKEA 2LVMA 3CBOA 5AYFA 4IURA 3G71T 2QEXA 2RJEA 3CMEA 1X01A 3L2QA 2DXUA 2BUDA 2CKKA 3FLGA 4JDSA 4A4FA 4M77D 5C0MA 4JRPA 2X4JA 3QUIA 2DEQA 4HT8A 1NJIC 2RI5A 3INZA 2RK2A 3G6ET 1YI2A 1VQ9T 5FLXE 4C5IA 1KG1A 2MWPA 4PJOA 2F5KA 4PJOE 2DVEA 3VKIA 1H3ZA 4J8OA 4XAXB 3QHSA 3CC7T 2OTJA 2K4YA 5GAMj 3HSBA 2OTLA 5A0DA 4C5GA 4O5VA 5GMKh 3ER0A 5CIUA 4DOVA 3C12A 3PFSA 3OYJA 2R5AA 1OZ3A 2MMPA 1BI2A 4QW2A 4RKUE 4MDWA 2V8KA 5I2MA 3C4SA 3SWNA 5HY6A 2XDBA 4Y28E 1Q82U 3CD6T 4JLIA 2F5TX 2EQJA 5FU7B 2QA4T 4V2SA 5J39A 2HD0A 5I21A 2L89A 4C8QB 2M9UA 1DJ7B 2DXTA 3ZFJA 1JJ2S 3MEWA 2DD5A 5D6XA 1NPPA 4XTZA 2X4YA 1NZ9A 2JUFA 3OYIA 1N8RC 3VV0A 4JRQA 2DTOA 3M5AA 3JCMV 1SSFA 3L1AA 3P8BB 4M75D 3C94A 5C6SA 3X28B 4QQDA 5GAMd 2DKGA 1BI0A 4BACA 3JCMb 4M77B 5L8RE 4UC4A 3L42A 3WVDB 4C8QF 2R57A 5GMKe 4C0FA 3V8JA 3SB2A 1KD1C 2WACA 1K8AC 4FT2A 3VU3C 4KUDK 2E64A 4N0AC 1YJNA 2XK0A 3JCMJ 4MZMA 4N4GA 2JN0A 4HKEA 4JUVA 1MHNA 3G71A 1Q82C 3KUFA 2EKOA 4BI3A 4C0ZA 4F7UA 5M9OA 2YHTA 3F70A 2MI6A 4F7UE 1WQ7A 2EJ9A 3OYHA 4M77F 5LJ3f 4QVCA 2K3XA 3OS1A 3E19A 3G6EA 3JB9D 1QP3A 2KQWA 1ZBXA 3L2RA 3GPLA 1VQ9A 1VUBA 4HA8A 3PMTA 5HK0A 4M78D 1RL2A 1I81A 2FYKA 2DTHA 2E1HA 1LOJA 1ZQ1A 4MMKA 4C8QG 3CC7A 3VJPA 2E10A 1Q86U 2K5IA 3OYDA 2JTMA 3OS0A 3G4SA 2EYQA 1UEBA 3CCST 2XG8D 4E47A 5LJ5h 1Q7YC 3HFOA 3QDRB 4ZN1A 4TVRA 2HNIA 3J81E 3HP9A 1BI1A 2K2VA 3PT9A 2O4XB 3X25B 2R5MA 3L2WA 2ZPHB 4RCCA 4L5GA 3JCMh 4M7DA 4M77G 3OYYA 4Z02A 5LJ3e 4M7AB 4R55A 2QA4A 3S3NA 3MP6A 4M7DE 4XTWA 3FJPA 3E1SA 3BFMA 3JCMf 4EMHA 5LJ5d 2A3LA 2RJCA 5HK3A 3M53A 1IREB 1S72A 4C92A 4ZGJB 3VUZA 2P4TA 4ZTJA 4XTXA 3RERA 4C92E 4ZN3A 5D6WA 1B34A 1JB0E 4PNOA 2VUBA 5KCHA 5FRMA 3O8VA 2K5FA 1XTDA 3MP8A 2M0OA 1P92A 1KHIA 3DKMA 3LLRA 3MHXA 4IUUA 5GANh 3DB3A 1G3YA 4M7AF 3M59A 5DM7R 3PIPA 1YJWT 5GAOm 1NJIU 4HCBA 3GNFB 3CCJT 3CPFA 5GAN8 4J5YA 4LD6A 1X75C 2DK3A 4JRKA 4Y91A 5GANd 4DA4A 3ZBDA 4ATOA 2CGHA 2LC4A 4OGCA 3MEAA 3JCMe 4CRIA 4E7LA 1UGRB 3QJYA 4XQ3A 5FU6B 2KY9A 4E7JA 4NL3A 5CAIA 3HRTA 2X35A 3MCAB 3BY7A 3WVEB 4PLLA 2VC8A 4RCBA 1VQOT 1UGPB 4FSXA 3DLMA 4C8QD 3JB9F 1I8FA 4M75G 4N4HA 5GMKi 2M16A 3OW2S 3VYHB 1QW1A 3QG1A 4M78F 3EFRA 4OB2B 2DZCA 2VXEA 3QYGB 2DIQA 5CR2A 4BI8B 3CMAA 2ZPFB 1K73U 4A4HA 4M7AG 3M57A 5I2SA 3OYFA 4L59A 3OY9A 1LNXA 2ZCFB 1KQ2A 2LRQA 3V8LA 5GMKj 4EMKC 2NLUA 4IUPA 1M1GA 4R56A 3CCSA 3JB9J 1KQSA 4NL2A 1BI3A 3RUXA 1N8RU 4EMKB 4OVAA 4OF1A 3CEYA 3JCMW 3UPUA 4HCCA 4VUBA 5IAYA 1KQ1A 5GAN3 2JTFA 1VQNA 2IVWA 3QKJA 5KCOA 4FM4B 4BB7A 3A8OB 2XHCA 4BDZA 3LGFA 4J7FA 3JB9G 2PVDB 2VV5A 2K3YA 3TCJA 4PJOC 1O9SA 3CCRT 3CBMA 3LWIA 1W2BS 1K8AU 1KD1U 3Q1JA 1WQWA 4M78G 4B9XA 1EIFA 4BY6C 2A7YA 2I2LA 4GY5A 4PLIA 4PJOB 1K9MC 3JB9H 5LJ3g 2CS7A 1YJ9A 3CCQA 3LW5E 1VQ6T 3GF5A 2RI3A 1X6OA 5CKBA 1K73C 3CCUT 1VQLT 2FB7A 3J7AF 2EIFA 2ZPBB 4ELZC 1VQ8T 3SWNC 1HK9A 2RJFA 2XICA 2XU8A 3OBYA 4C0DC 3JCMP 1YJWA 4RG2A 1N6AA 3V8KA 1Y96B 4KBMB 3CXCA 3CCJA 3SWNB 2KVQG 4OGEA 3DB4A 2KMTA 4JS5A 3CC2T 1G5VA 2KSSA 4N4IA 4FU6A 4KULA 3RMSA 2MAMA 3UDCA 2VXFA 1WNLA 3UWNA 3VYGA 1QVGA 5LJ3j 4ELYC 3GNGA 3G7ZA 5LJ5g 3OYKA 2X4WA 1XOVA 1PSEA 3A8MB 1QVFS 2RD1A 4M7AD 2KDSA 3CBPA 3CPWA 2LT1A 1Q7YU 1VQ5T 4LD9K 2XKOC 2EJGA 3JCMg 2Y4XA 1QVPA 5CCAA 2RHZA 5KE3A 4X34A 5GAOp 1VQKT 4C5HA 3FC3A 1R8OB 5EG2A 4M77A 3RKXA 4IUQA 3RMQA 4M77E 2KK4A 1XNIA 2CYZB 2QXFA 5LJ3h 3JRZA 2Y90A 1GXIE 1OZ2A 3OSSC 3I55T 4E7KA 3M55A 3CC4T 1UB4A 5LJ5j 2V8JA 3L2UA 3OS5A 1WJSA 2L3RA 1D3BA 1M1KC 2DTIA 2LCCA 2WSFE 5A0GA 3PTAA 5GANg 3V7RA 4EMGA 2EFIA 5LJ3d 2BKDN 5CKFA 3OYNA 4BE2A 3KBGA 3NTIA 1VQ4T 1W4SA 3TREA 3JCMQ 3CCRA 2YLCA 2QQ9A 3OYCA 4XTYA 4OB3B 3JCMc 3NTKA 2RH2A 3I56T 3L2VA 2PUOB 2OAUA 3LYIA 1JRIA 1OYXA 3LX7A 3OA6A 1VQ6A 4LDXA 3CD6A 2QQRA 3CCVT 3CCUA 5GANj 4A53A 1VQLA 2PQWA 4JLGA 2EJFA 2VGNA 2LT4A 1VQ8A 3OYLA 3GOXA 2DZ9A 3OMGA 3JSCA 2ZGWA 4M7DC 3CC2A 2O4XA 4M75A 3VUBA 2E70A 4J83A 4BE0A 1VIEA 2EWNA 2E6ZA 4M75E 2YLBA 3JCMd 3CMET 4M7DB 2QQAA 3RIRA 2QTXA 3OSVA 2RO0A 3A8GB 4C92C 1U1TA 4J7IA 5GAOr 2RHUA 3M4YA 3V7SA 4C92B 3M9QA 3ASKA 3OBWA 5HKCA 3OS2A 3FRNA 3OYEA 4FT4A 1VQ5A 4BI4A 4MZPA 1B34B 2LDMA 2O01E 3UT1A 3FIFA 5GMKl 4RG8A 3OYGA 2DD4A 2PVGB 2ZPEB 4MDXA 2LCLA 2RM4A 3TEEA 1VQKA 3OMCA 3C95A 4X9CA 4M7DF 4QVZA 4PJOD 2D0QB 4OB0B 3TU4K 5CK9A 3RKYA 4CI0C 3GLXA 2E65A 2JZ2A 2MF2A 2JOYA 1WGSA 2RHYA 5CQXA 3I55A 3CC4A 3URGA 3M58A 1ZHIA 2CZ1B 5CVIA 4M78A 3J80E 4BE1A 3V7CA 2QI2A 1N27A 2HBPA 4M78E 2XDDA 4NS5A 1K9MU 2GCXA 3FDRA 2WSCE 1KC8C 3ME9A 3HPWA 5A2QE 1VQ4A 2XD0A 3X20B 1G3SA 4DQ2A 4QQGA 1Y7XA 2QDYB 2L5QA 3FEOA 1M8VA 2RA2A 4XU0A 4JRIA 1LJOA 3A8LB 3GP8A 1WJQA 3SD4A 1FX7A 2B8AA 3L2ZA 3I56A 2E5QA 1BIBA 4J6WA 3NTHA 5D6YA 4XTVA 3S3OA 3SFMA 1BKBA 1UGQB 2KAFA 1M90U 4YTLA 3CCVA 2RHIA 5J26A 5CKDA 3QXEB 5DLQE 3QYHB 5KH6A 3MEUA 5GAOn 1WPYA 2GQVA 4LDUA 4JJNK 4C0GA 4E7IA 1YITT 2V8IA 1O75A 1AHJB 4A4GA 4BUGA 1Y07A 2EQMA 2XDPA 4BY6B 3MEVA 2FL7A 3NFCA 4FL6A 5GAN7 3OYMA 3HKSA 3AHUA 5GAN2 3PIOA 1M5Q1 3MP1A 5IT9E 3X24B 3OYBA 3META 3HRSA 1M1KU 2EQKA 4J6YA 2ZPGB 2CZ0B 4C0DB 2RHXA 4PJOF 1VQMT 2CZ6B 3QSUA 4A4EA 3G4ST 1M90C 2EQUA 4C8QA 2E12A 2K57A 3HRUA 4C8QE 1M4ZA 2P0KA 1M9SA 4WF2A 1Y71A 5GAN4 2H3JA 4ZGEB 2RI2A 1Y96A 4EDUA 1VQOA 5FU7C 2CZ7B 2RK1A 3HHTB 3N5BB 3PGGA 2ZPIB 4C8QC 3CCMT 3WXMB 3R6OA 2BIVA 2ZZDA 3A5ZB 2G3RA 4OB1B 1HXDA 3E9GA 1MGQA 3HFNA 4HCZA 2PVOB 5GAMh 4C5EA 1N9SA 4M7DD 2WSEE 4Q5WA 1S72T 2XI9A 4JS4A 5GAMf 1UGSB 2IG0A 1M1FA 3P8DA 3SDZA 1U1SA 4D6WA 4J6XA 1VQ7T 5GAN6 2FVUA 2EAYA 4A4KA 4IUTA 2DO3A 3QIIA 4PJOG 4M77C 3X26B 3OQ5A 4C92D 4L6V5 4N0AA 4O6JA 3CCLT 3BDLA 2RB6A 1YIJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYH B;  3A8G B;  4OB2 B;  3QYG B;  4RKU E;  2ZPF B;  4Y28 E;  2ZCF B;  2O01 E;  1DJ7 B;  2DD4 A;  2PVG B;  2ZPE B;  2DD5 A;  2D0Q B;  4OB0 B;  4FM4 B;  3A8O B;  3X28 B;  1QP2 A;  2PVD B;  2CZ1 B;  1V29 B;  5L8R E;  3WVD B;  2WSC E;  3X20 B;  3LW5 E;  2QDY B;  3A8L B;  2ZPB B;  2DXB A;  3A8H B;  3QZ9 B;  1UGQ B;  1QP3 A;  4ZGD B;  2PU9 B;  3QXE B;  3QYH B;  3VYG A;  2DPP B;  1PSE A;  3A8M B;  2PUK B;  1AHJ B;  3X25 B;  2AHJ B;  2ZPH B;  3X24 B;  2CYZ B;  1GXI E;  4XK8 E;  1PSF A;  2ZPG B;  2CZ0 B;  1IRE B;  2WSF E;  4ZGJ B;  2CZ6 B;  2DXC A;  3QZ5 B;  1JB0 E;  4ZGE B;  4KT0 E;  2CZ7 B;  3HHT B;  2ZPI B;  4OB3 B;  2ZZD A;  4OB1 B;  2PUO B;  2PVO B;  2WSE E;  1UGS B;  1UGR B;  3X26 B;  3WVE B;  4L6V 5;  1UGP B; 
#chains in the Genus database with same CATH topology
 1G2B A;  2LNV A;  1K73 R;  4XTU A;  3E9F A;  5IHK A;  2MWO A;  4A54 A;  1OX9 A;  2LX9 A;  2CP3 A;  4PL6 A;  2AT1 B;  1SEM A;  2PTK A;  1IGU A;  4LDV A;  1OI1 A;  2LQK A;  2K7A A;  3OB9 A;  4F7U F;  4RTX A;  3EGD B;  1PC0 A;  3REB B;  2HQX A;  2COZ A;  5DY9 A;  3CMA T;  5HCK A;  2QQB A;  2MCN A;  2VWF A;  3ZEH A;  3NHN A;  1OEB A;  1YBY A;  1WFW A;  4OP0 A;  3FB9 A;  2D6F A;  3JAM E;  2YRV A;  3UA7 A;  1BYM A;  2DX1 A;  1OU9 A;  5GJV B;  4ZGD B;  5IXF A;  4P5N A;  1KJW A;  4M75 F;  1D0X A;  2GNC A;  2DAQ A;  4RTT A;  2KYB A;  2JM9 A;  2L3Q A;  5GAN f;  3SEM A;  5LJ5 e;  1Y57 A;  4J9D A;  1QVF P;  2AHJ B;  4M78 B;  1KHC A;  3CCE A;  1RAH B;  3HL8 A;  5FU6 C;  1QVF A;  1TOV A;  1SSH A;  2KXD A;  2M1H A;  3G1J A;  1WJR A;  1G3W A;  2EQI A;  1SRL A;  2C06 A;  1VQ5 Q;  4LDW A;  2DXC A;  2F69 A;  1ZSZ A;  2HAX A;  1YJN T;  3H6Z A;  4OMF B;  2JMC A;  3KXT A;  1YHQ A;  4KT0 E;  2QEX A;  5CKE A;  3CBO A;  4IUR A;  3CME A;  4FYX B;  3CC4 Q;  1WHM A;  3FLG A;  2CKK A;  1D0Y A;  1NJI C;  1YI2 A;  4HVV A;  1HJD A;  4C5I A;  2BZ8 A;  4PJO A;  2F5K A;  4PJO E;  1RAA B;  4J8O A;  4XAX B;  2OTJ A;  4C5G A;  2CP2 A;  3ER0 A;  3C12 A;  2EVR A;  1OZ3 A;  4WTO B;  2V8K A;  5I2M A;  3SWN A;  4Y28 E;  1Q82 U;  3CD6 T;  2F5T X;  2EQJ A;  5FU7 B;  2D1X A;  5J39 A;  2L89 A;  1TWB A;  1VYU A;  5D6X A;  3EH2 A;  4JRQ A;  1AWX A;  3M5A A;  1SSF A;  3X28 B;  4AMC A;  3JCM b;  2FZC B;  1SKU B;  3WVD B;  3VS6 A;  1KD1 C;  1EZZ B;  4J9B A;  4N0A C;  3EG9 B;  2W0Z A;  2DYI A;  2OTL Q;  2JN0 A;  2JS2 A;  4HKE A;  1QQJ A;  2MI6 A;  1WQ7 A;  2EJ9 A;  1M90 R;  4M77 F;  1NG2 A;  4M78 D;  6AT1 B;  2DTH A;  2E1H A;  2DNU A;  1LOJ A;  4MMK A;  2O9S A;  2KRM A;  2JTM A;  1PD0 A;  2EYQ A;  1X6B A;  4E47 A;  4LUD A;  3QDR B;  3PT9 A;  2O4X B;  3JCM h;  4M7D A;  4Z02 A;  4R55 A;  3MP6 A;  4M7D E;  4EMH A;  3BFM A;  2RJC A;  5HK3 A;  3M53 A;  1IRE B;  3VUZ A;  2P4T A;  1LVK A;  4IUU A;  3DKM A;  3MHX A;  1ACM B;  3G6E Q;  1VQ9 Q;  1YWP A;  3PIP A;  2FZG B;  5GAO m;  4HCB A;  3GNF B;  5GAN 8;  4J5Y A;  4LD6 A;  2CGH A;  3JCM e;  3QJY A;  4XQ3 A;  4PLL A;  2QA4 Q;  3VYH B;  4A63 B;  1PRM C;  2NUT A;  3M0S A;  3JV3 A;  2DIQ A;  5CR2 A;  5KYW A;  1ZSZ C;  4FYV B;  3OYF A;  1M1G A;  4GBQ A;  2MIO A;  4VUB A;  5IAY A;  2NUP B;  3JB9 G;  2VV5 A;  4PJO C;  1O9S A;  3I9Q A;  2KXC A;  4BY6 C;  1EIF A;  1ZLM A;  4GY5 A;  2E3H A;  3JB9 H;  2RQR A;  5LJ3 g;  1B07 A;  1VQ6 T;  1G8X A;  2RI3 A;  3VS7 A;  5CKB A;  1RLP C;  1MNE A;  3E2U A;  2PZ1 A;  1KQS P;  4ELZ C;  1VQ8 T;  3SWN C;  1YJW A;  1WHJ A;  4C0D C;  3CMA Q;  1KQS A;  3V8K A;  4JS5 A;  3CCJ A;  3CC2 T;  2KMT A;  1K0S A;  3UDC A;  4KGV B;  1E7O A;  1TG0 A;  2F2X A;  3CCS Q;  2KDS A;  2E3I A;  4LD9 K;  4ANJ A;  2HSE B;  1AZE A;  1QVP A;  2RHZ A;  5KE3 A;  4C5H A;  2RQV A;  1PD1 A;  5EG2 A;  1WHL A;  2QXF A;  5LJ3 h;  2CYZ B;  1GXI E;  2Y90 A;  2LCS A;  1WJS A;  2L3R A;  1D3B A;  2DTI A;  2WSF E;  5A0G A;  3PTA A;  2EFI A;  5LJ3 d;  3OYN A;  3KBG A;  3NTI A;  2JTE A;  1UGV A;  2OI3 A;  1MMD A;  1K0X A;  2PUO B;  1VOM A;  3OA6 A;  4LDX A;  5D7U A;  2QQR A;  3CCV T;  4F17 A;  3OYL A;  3GOX A;  3I35 A;  7AT1 B;  3JSC A;  4M7D C;  2K79 A;  2L3S A;  4M75 A;  3QDF A;  2EWN A;  4M75 E;  4D8D A;  3CME T;  1M2O A;  2KBT A;  1T0J A;  1TUG B;  1U1T A;  5HKC A;  2QG9 B;  3FRN A;  2FZK B;  4FT4 A;  2O01 E;  2KYM A;  4RG8 A;  2DD4 A;  5KYU A;  3UAT A;  2PVG B;  1UHF A;  2DRM A;  2LCL A;  2COY A;  4QVZ A;  2JT4 A;  3RKY A;  1WGS A;  3URG A;  2YUN A;  3CD6 Q;  2RF0 A;  1PHT A;  4E6R A;  4PFZ A;  2QI2 A;  2SEM A;  1YP5 A;  4JJB A;  5A2Q E;  1VQ4 A;  3X20 B;  1G3S A;  2DET A;  4DQ2 A;  2J6F A;  2O31 A;  2FRY A;  3A1P A;  4JRI A;  2DL8 A;  2B8A A;  3L2Z A;  3I56 A;  2EYY A;  2EPD A;  1BKB A;  1UGQ B;  2L3P A;  2KAF A;  4R0K A;  1VA7 A;  1YCS B;  3QYH B;  4DEY A;  3MEU A;  5GAO n;  3I55 Q;  3MEV A;  2FL7 A;  5GAN 7;  4JZ4 A;  1AWO A;  1BK2 A;  3ZL7 C;  5IT9 E;  1MMG A;  2ZPG B;  4PJO F;  2W10 A;  2K2M A;  2P0K A;  1M9S A;  1VQO A;  3N5B B;  3PGG A;  1I0C A;  2ZPI B;  3R6O A;  2C0O A;  2ZZD A;  3A5Z B;  2G3R A;  2PVO B;  3MJX A;  1N9S A;  3I5S A;  5GAM f;  2IG0 A;  1VQ7 T;  1M1F A;  1U1S A;  4RTU A;  2FVU A;  2MOX A;  4AFS C;  1RAG B;  4AT1 B;  3UA6 A;  3CCL T;  4O6J A;  3BDL A;  1ARK A;  2GFU A;  1NBE B;  1D09 B;  3OW2 P;  1U5S A;  3OW2 A;  4PK4 A;  4ZTF A;  2D9T A;  5FRN A;  1K4U S;  5IN1 A;  4WCI A;  3JCM X;  1Z9Z A;  3T9N A;  4OMN A;  2FHD A;  2P0P A;  3S6W A;  1VQM A;  3QPH A;  1RLQ C;  3RES A;  1KC8 U;  5GAO l;  5IH2 A;  1RAE B;  4M75 C;  3TQ7 P;  4XU3 A;  3CXC S;  2RJD A;  2HBW A;  1BBZ A;  4M7A C;  3CCM A;  1Q81 C;  1QVG S;  2Y4Y A;  1RI0 A;  1SHG A;  3BDU A;  3LH0 A;  1JBM A;  2OTL T;  4MZT A;  3QBY A;  1JJ2 A;  2DPP B;  2QQS A;  1XQH A;  4X1V A;  3H8Z A;  2PUK B;  2KNB B;  1HSQ A;  3M54 A;  2DIG A;  4OML A;  2JNG A;  4LN2 A;  5A0L A;  1BB9 A;  5KYX A;  1FXX A;  1MMN A;  1WIE A;  4IKF A;  1TSF A;  4QQ6 A;  2CP7 A;  5GAO q;  1I4K 1;  4KUI A;  2LQ8 A;  1VQP A;  4C92 G;  1U8R A;  3GIB A;  3PNW C;  3H41 A;  1S1N A;  5LL6 S;  2EW3 A;  1BIA A;  3BE3 A;  5GAN e;  1FWZ A;  1G83 A;  2HEQ A;  2LP5 A;  4JDS A;  4A4F A;  4M77 D;  4DBQ A;  1M3C A;  3QUI A;  4HT8 A;  3G6E T;  2YDL A;  1VQ9 T;  5FLX E;  4DEX A;  4FCY A;  1KC8 R;  2K4Y A;  1PCX A;  1W1F A;  4DOV A;  2R5A A;  2KEA A;  2MMP A;  4JLI A;  2QA4 T;  1FMK A;  4C8Q B;  1DJ7 B;  2DXT A;  1JJ2 S;  3M0R A;  3MEW A;  1YHQ Q;  2X4Y A;  3OYI A;  1N8R C;  3CME Q;  2CP5 A;  3NPF A;  1ZA1 B;  2DTO A;  3P8B B;  1UHC A;  4IIM A;  2DYB A;  1BI0 A;  4BAC A;  1YI2 Q;  2ABL A;  4C0F A;  3SB2 A;  4FT2 A;  3VU3 C;  4KUD K;  1SHF A;  2OTJ Q;  2LJ3 A;  4N4G A;  2O2O A;  4JUV A;  3G71 A;  1ZA2 B;  4C0Z A;  4RUG A;  3F70 A;  5I22 A;  3OYH A;  2QTV A;  3OS1 A;  2AZV A;  1D1C A;  1ZBX A;  3L2R A;  1I81 A;  1RL2 A;  2DER A;  4C8Q G;  1M8M A;  3CC7 A;  4E7Z A;  1Q86 U;  2FEI A;  1JXO A;  3R6N A;  2ROT A;  3CCS T;  2XG8 D;  5LJ5 h;  3EGD A;  4TVR A;  1AZG B;  3HP9 A;  2A28 A;  1M1K R;  1SRM A;  4L5G A;  3VS1 A;  3OYY A;  1QWF A;  1TUD A;  4XTW A;  5LJ5 d;  2A3L A;  4Y92 A;  2GTO A;  2M02 A;  4XTX A;  2RQU A;  5D6W A;  2VUB A;  2M0O A;  2V1R A;  3LLR A;  4PJN A;  3DB3 A;  1G3Y A;  4M7A F;  3M59 A;  5DM7 R;  3EG3 A;  4DBF A;  2DK3 A;  4DA4 A;  3ZBD A;  2CH4 W;  2LC4 A;  4OGC A;  1IGQ A;  3EFO B;  2KY9 A;  3HRT A;  2HL3 A;  2LZ6 B;  1VQO T;  4FSX A;  2RQT A;  4C8Q D;  4N4H A;  5GMK i;  4AG1 C;  1QW1 A;  3QG1 A;  4OB2 B;  3QYG B;  2QAZ A;  4BI8 B;  3REA B;  1VQ7 Q;  3V8L A;  1ZSZ B;  2NLU A;  4NL2 A;  3CCL Q;  1PKS A;  2GQI A;  3UPU A;  1KQ1 A;  3M0T A;  5KCO A;  2XHC A;  4BDZ A;  1Q86 R;  2PVD B;  4K11 A;  2K3Y A;  1I07 A;  1OX8 A;  1K8A U;  3Q1J A;  1WQW A;  4M78 G;  2A7Y A;  2I2L A;  4PJO B;  2YUO A;  2CS7 A;  1YJ9 A;  3CCQ A;  5L23 A;  1K73 C;  3CCU T;  1OUL A;  1PM3 A;  2FB7 A;  1WA7 A;  1HK9 A;  2DBK A;  2XIC A;  3JCM P;  1N6A A;  1Y96 B;  3PE0 A;  3SWN B;  1G5V A;  1NEB A;  4FU6 A;  4KUL A;  5ECA A;  1X6G A;  3GNG A;  3OYK A;  2X4W A;  4M4Z A;  3CPW P;  1XOV A;  1QVF S;  1SG5 A;  2RD1 A;  3CPW A;  1Q7Y U;  1D1B A;  3JCM g;  2Y4X A;  1BCO A;  1IB8 A;  3FC3 A;  2D0N A;  1XNI A;  1AWJ A;  3JRZ A;  1AVZ C;  1QKW A;  3I55 T;  1UB4 A;  5LJ5 j;  1M1K C;  2LCC A;  3V7R A;  2YUQ A;  2BKD N;  5CKF A;  1YJW Q;  3EHQ A;  3CCJ Q;  4J9F A;  3TRE A;  1C1A A;  4RTW A;  3CCR A;  3OYC A;  4XTY A;  3NTK A;  3L2V A;  2LJ1 A;  2OAU A;  2V1Q A;  3H0I A;  4Z89 A;  1VQL A;  4A53 A;  4FW1 A;  2DZ9 A;  1K8A R;  2O4X A;  4J83 A;  1FYN A;  3JCM d;  4M7D B;  2QTX A;  3OSV A;  2DL5 A;  1Q82 R;  3SHW A;  3PVQ A;  3M4Y A;  4GLM A;  3OS2 A;  1VQ5 A;  3QWX X;  4BI4 A;  1YWO A;  4MZP A;  3OYG A;  3FIF A;  2IPO B;  2ZPE B;  4MDX A;  4B6M A;  1VQK A;  3OMC A;  4X9C A;  4PJO D;  4KGZ B;  4OB0 B;  4CI0 C;  3GLX A;  1YNZ A;  2JZ2 A;  2MF2 A;  2JOY A;  1K1Z A;  2K6D A;  3CC4 A;  3M58 A;  1Q7Y R;  2EYX A;  3V7C A;  4JPB W;  1K9M U;  3EH1 A;  1X2K A;  4PFP A;  1K76 A;  3HPW A;  1NYF A;  2DJQ A;  1NEG A;  1M8V A;  1E6H A;  1LJO A;  3SD4 A;  2E5Q A;  2NUT B;  2V26 A;  2KT1 A;  4J6W A;  3NTH A;  5D6Y A;  4XTV A;  3SFM A;  1CKB A;  5KYW B;  1ZBJ A;  2CH4 A;  4YTL A;  2RHI A;  5J26 A;  2ATC B;  1WPY A;  4LDU A;  1WXT A;  2V8I A;  1O75 A;  2EQM A;  2NUP A;  4PJJ A;  3H0F A;  4D8K A;  1M5Q 1;  1TU0 B;  3OYB A;  1QCF A;  1NYG A;  2MPX C;  1TTH B;  4LNP A;  4J6Y A;  1GCQ C;  1M27 C;  2AKK A;  3MPU B;  2BE7 D;  2QGF B;  4A4E A;  1M90 C;  3I56 Q;  2KE9 A;  3HRU A;  2FRW A;  2H3J A;  4ZGE B;  4EDU A;  5IHN A;  5FU7 C;  2CZ7 B;  3HHT B;  2BTT A;  2BIV A;  4HCK A;  2PNI A;  2J7I A;  2E5K A;  5GAM h;  4M7D D;  2AK5 A;  2WSE E;  2XI9 A;  2ESW A;  1UGS B;  5GAN 6;  4IUT A;  1X27 A;  2DO3 A;  1JU5 C;  3QII A;  3X26 B;  1M30 A;  1QCO A;  2RQW A;  1RI9 A;  4E7S A;  4F7U B;  4AFQ C;  1N9R A;  2HQE A;  2FPF A;  1D3B B;  3CCE T;  1YFN A;  1Q81 U;  2CSQ A;  1YIT A;  1ABO A;  3PVL A;  2K5L A;  3M4G A;  4Z8A A;  1IHV A;  2LX7 A;  1VQO Q;  5GAM e;  2LNH B;  2GFA A;  1CSK A;  2AKL A;  4X9D A;  1H64 1;  2D8J A;  2X3X D;  5FRO A;  4KH1 B;  1YHQ T;  1V29 B;  1YCY A;  2QEX T;  4FYW B;  4M7A A;  1KQS S;  4M7A E;  3OYA A;  5GAN 5;  3MO8 A;  2FO0 A;  1W2B P;  4M75 B;  1YI2 T;  1W2B A;  4QVD A;  4XU2 A;  5CO7 A;  3LWH A;  2DBM A;  4F7U G;  3QZ9 B;  1T3S A;  2OTJ T;  5KYY B;  2HL5 C;  2PU9 B;  2LTO A;  4XU1 A;  4QKU A;  1X43 A;  1YJ9 T;  3CCQ T;  5FW9 A;  3CCU Q;  2E6N A;  4DOW A;  4HT9 A;  2F2W A;  1YIJ A;  2KRN A;  4LDY A;  4FSS A;  1WLP B;  1QWE A;  2X4X A;  5KE2 A;  3FJ5 A;  3TVT A;  2OAW A;  2VYT A;  4XK8 E;  1Z9Q A;  1PSF A;  5GMK m;  2DRK A;  1OOT A;  2SRC A;  3CCM Q;  3DLL A;  3QZ5 B;  2JVV A;  4MML A;  3H0H A;  1UUE A;  2YRD A;  5CQY A;  4EMK A;  1UJY A;  2VGM A;  1X01 A;  2DXU A;  2BUD A;  2DEQ A;  3INZ A;  2RK2 A;  1LCK A;  3M0U A;  2MWP A;  3A98 A;  2ED0 A;  2DVE A;  3VKI A;  4RTY A;  1FMV A;  3QHS A;  1MMA A;  5GAM j;  3HSB A;  5A0D A;  2CT3 A;  4O5V A;  1MV3 A;  4MDW A;  3C4S A;  5HY6 A;  2DLP A;  2Z0W A;  1VQP Q;  1QCN A;  3TSZ A;  2QAS A;  4XTZ A;  1NZ9 A;  1GFC A;  1PWT A;  8AT1 B;  1WHH A;  3VV0 A;  2DMO A;  1BU1 A;  4M75 D;  5C6S A;  4QQD A;  2P84 A;  2DKG A;  1OPK A;  1GBQ A;  4M77 B;  1M2V B;  3ULR B;  2JMA A;  1YJN A;  4MZM A;  2LQW A;  3TSW A;  3KUF A;  2MK5 A;  3LH5 A;  5M9O A;  2YHT A;  1V1C A;  1AEY A;  1J3T A;  4J9I A;  5LJ3 f;  2YRC A;  4RTV A;  1D1A A;  2J6K A;  3E19 A;  2K9G A;  1XJW B;  1QP3 A;  2KQW A;  2DL7 A;  1PKT A;  3PMT A;  1WI7 A;  1ABQ A;  1ZQ1 A;  1M3B A;  3VJP A;  2K5I A;  5AT1 B;  3OYD A;  3G4S A;  2EKH A;  4ZN1 A;  1AT1 B;  1BI1 A;  3VS3 A;  3X25 B;  2R5M A;  1OU8 A;  4RCC A;  2L0A A;  4M77 G;  3O5Z A;  3S3N A;  4HXJ A;  3E1S A;  1S72 A;  4C92 A;  4ZGJ B;  3G71 Q;  3RER A;  4C92 E;  1B34 A;  3THK A;  2J6O A;  5FRM A;  1JQQ A;  2FPD A;  1P92 A;  1KHI A;  5GAN h;  2X3W D;  3M0P A;  2J05 A;  1YJW T;  1NJI U;  3CCJ T;  4Y91 A;  5GAN d;  2ECZ A;  4ATO A;  4CRI A;  4E7L A;  1UGR B;  1KSW A;  5FU6 B;  4KGX B;  3CQT A;  4NL3 A;  5CAI A;  2X35 A;  3BY7 A;  3EHR A;  2VC8 A;  2DL4 A;  3DLM A;  3JB9 F;  1I8F A;  3OW2 S;  2VXE A;  1FMW A;  2DF6 A;  1K73 U;  2ZPF B;  4A4H A;  5I2S A;  3RBB B;  4L59 A;  3OY9 A;  2XMF A;  2ZCF B;  1KQ2 A;  2LRQ A;  4EMK C;  4IUP A;  2JM8 A;  1BI3 A;  4OVA A;  3JCM W;  5GAN 3;  1ZUU A;  2GGR A;  1VQN A;  2IVW A;  3QKJ A;  4FM4 B;  4BB7 A;  3AT1 B;  3LGF A;  2P4R A;  3CCE Q;  2F1L A;  2ED1 A;  1OPL A;  1KD1 U;  1GL5 A;  2QGG A;  3EGX B;  3GF5 A;  2DA9 A;  2EGE A;  4HVU A;  1F1B B;  2RJF A;  2CUB A;  2XU8 A;  1IO6 A;  4RG2 A;  4KBM B;  2QEX Q;  2KVQ G;  3DB4 A;  5FWC A;  2MAM A;  3UWN A;  1TUC A;  4ELY C;  5LJ5 g;  1EX4 A;  1K9A A;  1PSE A;  4QT7 A;  2LT1 A;  1NJI R;  1JEG A;  2EJG A;  2VKN A;  5CCA A;  4X34 A;  2C0I A;  1TS9 A;  1E6G A;  1N5Z A;  3RKX A;  1WYX A;  1MUZ A;  1OZ2 A;  1Y0M A;  3OSS C;  4E7K A;  1YJ9 Q;  2A36 A;  3CCQ Q;  2B86 A;  3L2U A;  3OS5 A;  1B7T A;  2O9V A;  5FWB A;  4BE2 A;  1VQ4 T;  1W4S A;  3JCM Q;  4ZNX A;  4AFU C;  3I56 T;  1OYX A;  4DBR A;  1VQ6 A;  2JW4 A;  2FPE A;  5GAN j;  4JLG A;  3H9N A;  2EJF A;  2VGN A;  1VQ8 A;  1I1J A;  1KD1 R;  3OMG A;  3CC2 A;  3VUB A;  2E70 A;  1VYV A;  2RO0 A;  4C92 C;  4J7I A;  3M9Q A;  3ASK A;  3OBW A;  1UDL A;  1MV0 B;  2COW A;  3GBQ A;  2LDM A;  5GMK l;  1TXQ A;  4PJL A;  3TEE A;  3CCR Q;  3C95 A;  1T3L A;  3TU4 K;  1B3Q A;  2E65 A;  2RHY A;  5CQX A;  3VRY A;  1NM7 A;  4LE9 A;  5CVI A;  3J80 E;  4M78 A;  4BE1 A;  1VQL Q;  1N27 A;  2HBP A;  4M78 E;  4NS5 A;  2GCX A;  5I11 A;  3FDR A;  3EFO A;  2WSC E;  1X69 A;  1KK7 A;  1KC8 C;  4QQG A;  1Y7X A;  2QDY B;  3FEO A;  2RA2 A;  3A8L B;  3GP8 A;  1WJQ A;  1KIK A;  4KH0 B;  8ATC B;  4F04 B;  4KRT A;  1M90 U;  3CCV A;  2E4H A;  2CSI A;  1UG1 A;  3QXE B;  5KH6 A;  2ZAE A;  1VQK Q;  1C0M A;  2GQV A;  4JJN K;  2ENM A;  2M51 A;  4A4G A;  2AIR B;  4BY6 B;  2G6F X;  3HKS A;  3AHU A;  5GAN 2;  3PIO A;  3MP1 A;  4J9E A;  2OJ2 A;  1GCQ A;  1Q95 G;  1H3H A;  2RMO A;  2CZ0 B;  2QK0 A;  2RHX A;  4C0D B;  1VQM T;  3QSU A;  3G4S T;  2EQU A;  2E12 A;  2K57 A;  1M4Z A;  4WF2 A;  3MKD A;  2RI2 A;  1Y96 A;  2RK1 A;  3CCM T;  4C8Q C;  1WXB A;  3HTR A;  1YN8 A;  4OB1 B;  1VYT A;  2GTJ A;  3E9G A;  2QDL A;  3UF4 A;  4HCZ A;  4C5E A;  4Q5W A;  1S72 T;  3SDZ A;  4D6W A;  4J6X A;  2NUZ A;  2EAY A;  4A4K A;  4PJO G;  2DM1 A;  3OQ5 A;  3EG9 A;  4L6V 5;  2RB6 A;  1RAB B;  4PKC C;  2YUP A;  1HD3 A;  1IZ6 A;  1G3T A;  4E2F B;  4JJC A;  1VIF A;  2QYZ A;  5DLO A;  1W70 A;  1NE8 A;  2KT8 A;  2CT4 A;  1I5O B;  5J3B A;  5GJW B;  3QO3 A;  2J06 A;  4CC7 A;  1VQP T;  1UTI A;  3LGL A;  2XDB A;  1QP2 A;  1TH7 A;  2O88 A;  3QJ6 A;  2L8D A;  4AFZ C;  3P8H A;  4DBH A;  2CP0 A;  1R0C B;  4E7H A;  5LJ5 f;  2R58 A;  4CC4 B;  2RNA A;  1VQN T;  2DXB A;  1C6V X;  3A8H B;  4FYY B;  3EAE A;  1YIT Q;  3CPW S;  3QWY A;  3M56 A;  1BCM A;  1WXU A;  3M0Q A;  1VQ7 A;  2XID A;  4IUV A;  1I5L A;  2P0Q A;  2CRE A;  4C92 F;  2DJZ A;  1ZX6 A;  2GF7 A;  4BD3 A;  1WDX A;  3CCL A;  4EPC A;  4PFO A;  1Q86 C;  4FIB A;  4M78 C;  4RMO A;  3BW1 A;  3EFS A;  5CKH A;  2KR3 A;  4B9W A;  3JB9 I;  2DL3 A;  1OV3 A;  1NPR A;  3RKW A;  4II1 A;  1AWW A;  4M7D G;  3S3M A;  2E41 A;  4GLK A;  5KYN A;  4OMQ A;  1PRL C;  4ME7 A;  4BDY A;  4NOY A;  1WHG A;  2YXY A;  3PMI A;  5GAM g;  2LVM A;  5AYF A;  3G71 T;  2RJE A;  1U3O A;  3L2Q A;  1PG5 B;  1GBR A;  4Z88 A;  1M3A A;  5C0M A;  4JRP A;  2X4J A;  2YWW A;  2RI5 A;  4OMO A;  2I0N A;  1YIJ Q;  1GCP A;  3RNJ A;  1KG1 A;  1VQ4 Q;  1H3Z A;  2X9H A;  3EG0 A;  3CC7 T;  2OTL A;  5GMK h;  5CIU A;  4OMM A;  3KFV A;  3PFS A;  3OYJ A;  1NLP C;  1BI2 A;  4QW2 A;  4RKU E;  4ESR A;  4V2S A;  2HD0 A;  5I21 A;  2M9U A;  1IXD A;  3ZFJ A;  4CC3 A;  2DD5 A;  1NPP A;  2JUF A;  1H8K A;  2L2P A;  3JCM V;  3L1A A;  1K9M R;  3C94 A;  5GAM d;  1IRX A;  5L8R E;  4UC4 A;  3L42 A;  4C8Q F;  2R57 A;  5GMK e;  3V8J A;  2WAC A;  1K8A C;  2E64 A;  1RAC B;  4EIK A;  2XK0 A;  4J9C A;  3JCM J;  4LUE A;  4J9G A;  1MHN A;  1Q82 C;  2HKQ B;  4BI3 A;  2EKO A;  2NWM A;  4F7U A;  4F7U E;  2HSP A;  4QVC A;  2K3X A;  1RAD B;  2YSQ A;  3G6E A;  1ZUY A;  3GPL A;  3JB9 D;  1VQ9 A;  1U06 A;  1VUB A;  4HA8 A;  1OQK A;  3VS0 A;  5HK0 A;  2FYK A;  2E10 A;  3VS2 A;  2A0F B;  3OS0 A;  1UEB A;  1Q7Y C;  3HFO A;  3RR6 A;  3J81 E;  2HNI A;  2HZY A;  2K2V A;  3L2W A;  2K3B A;  2ZPH B;  1UEC A;  3EG1 A;  2QA4 A;  5LJ3 e;  4M7A B;  1WZO A;  1YJN Q;  3FJP A;  3JCM f;  5EC7 A;  4ORZ A;  3C0C A;  4ZTJ A;  4FW2 A;  4ZN3 A;  1JB0 E;  1SF9 A;  4PNO A;  5KYU B;  5KCH A;  3O8V A;  2K5F A;  3NGP A;  1XTD A;  3MP8 A;  2EBP A;  1GFD A;  5KYY A;  4RTZ A;  1LPL A;  2CDT A;  4LXC A;  1VQM Q;  3CPF A;  1X75 C;  4JRK A;  3G4S Q;  1A0N B;  3MEA A;  1W6X A;  4E7J A;  3IQL A;  3MCA B;  2RN8 A;  3WVE B;  4RCB A;  1UGP B;  2BZX A;  4M75 G;  2M16 A;  4M78 F;  2NYS A;  3EFR A;  1Q81 R;  2DZC A;  1RUW A;  2BE9 B;  4M7A G;  2DE0 X;  3CMA A;  1S72 Q;  1IHW A;  4PJM A;  3M57 A;  1X2Q A;  1QLY A;  1LNX A;  2LQN A;  4R56 A;  5GMK j;  3JB9 J;  1RAF B;  3CCS A;  3RUX A;  1N8R U;  4EMK B;  4OF1 A;  3CEY A;  4HCC A;  2KRS A;  2JTF A;  1H92 A;  3A8O B;  4CC2 A;  4J7F A;  2OX7 A;  3TCJ A;  2VVK A;  3CCR T;  3CBM A;  3LWI A;  1W2B S;  4B9X A;  4PLI A;  1K9M C;  3LW5 E;  1X6O A;  1VQL T;  3J7A F;  1MND A;  2EIF A;  1WHK A;  2ZPB B;  4F14 A;  3CXC P;  1GRI A;  2A08 A;  3OBY A;  3CXC A;  9ATC B;  4OGE A;  2KSS A;  4N4I A;  3RMS A;  2H3E B;  2VXF A;  1WNL A;  1QVG P;  3EG2 A;  2DEU A;  3VYG A;  1QVG A;  5LJ3 j;  3G7Z A;  1SPK A;  1EFN A;  2HMA A;  1KFZ A;  3A8M B;  4M7A D;  3CBP A;  1VQ5 T;  1VQN Q;  2XKO C;  3EGU A;  3NMZ C;  2EGA A;  5GAO p;  3U23 A;  1VQK T;  4OMP A;  1HYO A;  1R8O B;  4M77 A;  2H8H A;  4IIO A;  4IUQ A;  3RMQ A;  4M77 E;  2KK4 A;  1M2V A;  2ROL A;  3M55 A;  3CC4 T;  2V8J A;  2KRO A;  2VAS A;  1UE9 A;  5GAN g;  4EMG A;  2JXB A;  2EYW A;  2EYZ A;  2BZY A;  4F16 A;  2YLC A;  2QQ9 A;  4OB3 B;  3JCM c;  1N8R R;  2RH2 A;  4J9H A;  2DIL A;  3D7S B;  2JJ9 A;  3LYI A;  1JRI A;  2X51 A;  3LX7 A;  1NLO C;  3CD6 A;  3CCU A;  2PQW A;  1ZUK A;  2LT4 A;  5IXB A;  1WX6 A;  2ZGW A;  2LMJ A;  4BE0 A;  1VIE A;  2E6Z A;  2YLB A;  2CUD A;  2QQA A;  3RIR A;  3A8G B;  4JJD A;  2DFU A;  5GAO r;  2RHU A;  2JS0 A;  3OYE A;  3V7S A;  4C92 B;  1B34 B;  3UT1 A;  3CC7 Q;  1AD5 A;  2RM4 A;  4M7D F;  2D0Q B;  5CK9 A;  2MYS A;  1JJ2 P;  1PNJ A;  3I55 A;  1R77 A;  1VQ6 Q;  1ZHI A;  2CZ1 B;  5KYX B;  2XDD A;  2CP6 A;  1VQ8 Q;  2XD0 A;  3ME9 A;  3CC2 Q;  2HQH A;  2KI7 A;  2HCK A;  2L5Q A;  2HDA A;  4XU0 A;  2C0T A;  3VS4 A;  1FX7 A;  2LJ0 A;  4JZ3 A;  2FG0 A;  1BIB A;  2F2V A;  3S3O A;  3I5R A;  2M0Y A;  2RPN A;  1QKX A;  5CKD A;  1T0H A;  1RAI B;  2AZS A;  5DLQ E;  4HVW A;  3VS5 A;  4C0G A;  4E7I A;  1YIT T;  1AHJ B;  2D8H A;  4AG2 C;  1R0B G;  1Y07 A;  4BUG A;  2XDP A;  4FL6 A;  3OYM A;  3NFC A;  1CKA A;  1ZSG A;  1D0Z A;  2A37 A;  1QMC A;  1JXM A;  3X24 B;  3MET A;  2EGC A;  3HRS A;  1M1K U;  2EQK A;  3EGX A;  3RDV A;  1UJ0 A;  2CZ6 B;  3VRZ A;  2HKN A;  4C8Q A;  1JO8 A;  4C8Q E;  1Y71 A;  5GAN 4;  3CCV Q;  3WXM B;  5IHI A;  1HXD A;  2IIM A;  1MGQ A;  3HFN A;  2YT6 A;  4JS4 A;  2KGT A;  1V76 A;  2DVJ A;  3P8D A;  4C92 D;  4M77 C;  1AOJ A;  2GBQ A;  2VB6 A;  4N0A A;  1UFF A;  1YIJ T; 
#chains in the Genus database with same CATH homology
 4F7U B;  2LNV A;  1N9R A;  4PKC C;  4XTU A;  3E9F A;  1IZ6 A;  1G3T A;  2HQE A;  2MWO A;  4A54 A;  1VIF A;  2LX9 A;  2GFU A;  4PL6 A;  1D3B B;  5DLO A;  3CCE T;  1Q81 U;  4LDV A;  1YIT A;  1OI1 A;  1NE8 A;  2K5L A;  3M4G A;  2LQK A;  3OW2 A;  5J3B A;  3QO3 A;  3OB9 A;  5GAM e;  4ZTF A;  2D9T A;  5FRN A;  5IN1 A;  4F7U F;  2GFA A;  1VQP T;  4X9D A;  3JCM X;  1H64 1;  3T9N A;  5FRO A;  2HQX A;  2FHD A;  2P0P A;  3LGL A;  5DY9 A;  1QP2 A;  3S6W A;  1TH7 A;  2QQB A;  1YHQ T;  1V29 B;  3CMA T;  1YCY A;  1VQM A;  2QEX T;  3QJ6 A;  3QPH A;  2L8D A;  3P8H A;  3RES A;  1KC8 U;  5GAO l;  3ZEH A;  4M7A A;  1KQS S;  4M75 C;  3CXC S;  4XU3 A;  3OYA A;  4E7H A;  4M7A E;  5GAN 5;  2RJD A;  3MO8 A;  1YBY A;  4M75 B;  5LJ5 f;  1YI2 T;  2R58 A;  4OP0 A;  4M7A C;  3CCM A;  1W2B A;  3FB9 A;  1Q81 C;  4QVD A;  2D6F A;  1QVG S;  4XU2 A;  3JAM E;  1VQN T;  5CO7 A;  3LWH A;  2DXB A;  4F7U G;  3A8H B;  2Y4Y A;  1RI0 A;  3BDU A;  3LH0 A;  3QZ9 B;  3EAE A;  2YRV A;  1JBM A;  2OTJ T;  1BYM A;  3CPW S;  2OTL T;  3M56 A;  4ZGD B;  2PU9 B;  2LTO A;  2XID A;  4XU1 A;  4IUV A;  4MZT A;  1I5L A;  4P5N A;  2P0Q A;  1VQ7 A;  3QBY A;  1JJ2 A;  2DPP B;  2QQS A;  4C92 F;  2DJZ A;  4M75 F;  1YJ9 T;  1XQH A;  3CCQ T;  3H8Z A;  2GF7 A;  4BD3 A;  2E6N A;  2PUK B;  3CCL A;  4EPC A;  2DAQ A;  4DOW A;  4HT9 A;  1YIJ A;  4LDY A;  3M54 A;  5GAN f;  1Q86 C;  2DIG A;  4FIB A;  4M78 C;  4RMO A;  2JNG A;  5LJ5 e;  3BW1 A;  3EFS A;  5CKH A;  5A0L A;  2AHJ B;  2X4X A;  4M78 B;  5KE2 A;  1KHC A;  3CCE A;  3HL8 A;  1QVF A;  5FU6 C;  4B9W A;  3JB9 I;  1FXX A;  2M1H A;  1NPR A;  2VYT A;  4XK8 E;  4II1 A;  3RKW A;  4M7D G;  1WJR A;  4IKF A;  1G3W A;  3S3M A;  1PSF A;  2E41 A;  2C06 A;  4QQ6 A;  5GMK m;  4GLK A;  5GAO q;  1I4K 1;  4LDW A;  4KUI A;  2LQ8 A;  3DLL A;  1VQP A;  4C92 G;  2DXC A;  2F69 A;  3QZ5 B;  1U8R A;  3PNW C;  3GIB A;  2JVV A;  4ME7 A;  4MML A;  2HAX A;  4BDY A;  1YJN T;  5CQY A;  3H6Z A;  4NOY A;  5LL6 S;  4OMF B;  1BIA A;  3PMI A;  4EMK A;  3KXT A;  4KT0 E;  1YHQ A;  5GAN e;  2VGM A;  5GAM g;  1FWZ A;  5CKE A;  2LVM A;  3CBO A;  5AYF A;  4IUR A;  3G71 T;  2QEX A;  2RJE A;  3CME A;  1X01 A;  3L2Q A;  2DXU A;  2BUD A;  2CKK A;  3FLG A;  4JDS A;  4A4F A;  4M77 D;  5C0M A;  4JRP A;  2X4J A;  3QUI A;  2DEQ A;  4HT8 A;  1NJI C;  2RI5 A;  3INZ A;  2RK2 A;  3G6E T;  1YI2 A;  1VQ9 T;  5FLX E;  4C5I A;  1KG1 A;  2MWP A;  4PJO A;  2F5K A;  4PJO E;  2DVE A;  3VKI A;  1H3Z A;  4J8O A;  4XAX B;  3QHS A;  3CC7 T;  2OTJ A;  2K4Y A;  5GAM j;  3HSB A;  2OTL A;  5A0D A;  4C5G A;  4O5V A;  5GMK h;  3ER0 A;  5CIU A;  4DOV A;  3C12 A;  3PFS A;  3OYJ A;  2R5A A;  1OZ3 A;  2MMP A;  1BI2 A;  4QW2 A;  4RKU E;  4MDW A;  2V8K A;  5I2M A;  3C4S A;  3SWN A;  5HY6 A;  2XDB A;  4Y28 E;  1Q82 U;  3CD6 T;  4JLI A;  2F5T X;  2EQJ A;  5FU7 B;  2QA4 T;  4V2S A;  5J39 A;  2HD0 A;  5I21 A;  2L89 A;  4C8Q B;  2M9U A;  1DJ7 B;  2DXT A;  3ZFJ A;  1JJ2 S;  3MEW A;  2DD5 A;  5D6X A;  1NPP A;  4XTZ A;  2X4Y A;  1NZ9 A;  2JUF A;  3OYI A;  1N8R C;  3VV0 A;  4JRQ A;  2DTO A;  3M5A A;  3JCM V;  1SSF A;  3L1A A;  3P8B B;  4M75 D;  3C94 A;  5C6S A;  3X28 B;  4QQD A;  5GAM d;  2DKG A;  1BI0 A;  4BAC A;  3JCM b;  4M77 B;  5L8R E;  4UC4 A;  3L42 A;  3WVD B;  4C8Q F;  2R57 A;  5GMK e;  4C0F A;  3V8J A;  3SB2 A;  1KD1 C;  2WAC A;  1K8A C;  4FT2 A;  3VU3 C;  4KUD K;  2E64 A;  4N0A C;  1YJN A;  2XK0 A;  3JCM J;  4MZM A;  4N4G A;  2JN0 A;  4HKE A;  4JUV A;  1MHN A;  3G71 A;  1Q82 C;  3KUF A;  2EKO A;  4BI3 A;  4C0Z A;  4F7U A;  5M9O A;  2YHT A;  3F70 A;  2MI6 A;  4F7U E;  1WQ7 A;  2EJ9 A;  3OYH A;  4M77 F;  5LJ3 f;  4QVC A;  2K3X A;  3OS1 A;  3E19 A;  3G6E A;  3JB9 D;  1QP3 A;  2KQW A;  1ZBX A;  3L2R A;  3GPL A;  1VQ9 A;  1VUB A;  4HA8 A;  3PMT A;  5HK0 A;  4M78 D;  1RL2 A;  1I81 A;  2FYK A;  2DTH A;  2E1H A;  1LOJ A;  1ZQ1 A;  4MMK A;  4C8Q G;  3CC7 A;  3VJP A;  2E10 A;  1Q86 U;  2K5I A;  3OYD A;  2JTM A;  3OS0 A;  3G4S A;  2EYQ A;  1UEB A;  3CCS T;  2XG8 D;  4E47 A;  5LJ5 h;  1Q7Y C;  3HFO A;  3QDR B;  4ZN1 A;  4TVR A;  2HNI A;  3J81 E;  3HP9 A;  1BI1 A;  2K2V A;  3PT9 A;  2O4X B;  3X25 B;  2R5M A;  3L2W A;  2ZPH B;  4RCC A;  4L5G A;  3JCM h;  4M7D A;  4M77 G;  3OYY A;  4Z02 A;  5LJ3 e;  4M7A B;  4R55 A;  2QA4 A;  3S3N A;  3MP6 A;  4M7D E;  4XTW A;  3FJP A;  3E1S A;  3BFM A;  3JCM f;  4EMH A;  5LJ5 d;  2A3L A;  2RJC A;  5HK3 A;  3M53 A;  1IRE B;  1S72 A;  4C92 A;  4ZGJ B;  3VUZ A;  2P4T A;  4ZTJ A;  4XTX A;  3RER A;  4C92 E;  4ZN3 A;  5D6W A;  1B34 A;  1JB0 E;  4PNO A;  2VUB A;  5KCH A;  5FRM A;  3O8V A;  2K5F A;  1XTD A;  3MP8 A;  2M0O A;  1P92 A;  1KHI A;  3DKM A;  3LLR A;  3MHX A;  4IUU A;  5GAN h;  3DB3 A;  1G3Y A;  4M7A F;  3M59 A;  5DM7 R;  3PIP A;  1YJW T;  5GAO m;  1NJI U;  4HCB A;  3GNF B;  3CCJ T;  3CPF A;  5GAN 8;  4J5Y A;  4LD6 A;  1X75 C;  2DK3 A;  4JRK A;  4Y91 A;  5GAN d;  4DA4 A;  3ZBD A;  4ATO A;  2CGH A;  2LC4 A;  4OGC A;  3MEA A;  3JCM e;  4CRI A;  4E7L A;  1UGR B;  3QJY A;  4XQ3 A;  5FU6 B;  2KY9 A;  4E7J A;  4NL3 A;  5CAI A;  3HRT A;  2X35 A;  3MCA B;  3BY7 A;  3WVE B;  4PLL A;  2VC8 A;  4RCB A;  1VQO T;  1UGP B;  4FSX A;  3DLM A;  4C8Q D;  3JB9 F;  1I8F A;  4M75 G;  4N4H A;  5GMK i;  2M16 A;  3OW2 S;  3VYH B;  1QW1 A;  3QG1 A;  4M78 F;  3EFR A;  4OB2 B;  2DZC A;  2VXE A;  3QYG B;  2DIQ A;  5CR2 A;  4BI8 B;  3CMA A;  2ZPF B;  1K73 U;  4A4H A;  4M7A G;  3M57 A;  5I2S A;  3OYF A;  4L59 A;  3OY9 A;  1LNX A;  2ZCF B;  1KQ2 A;  2LRQ A;  3V8L A;  5GMK j;  4EMK C;  2NLU A;  4IUP A;  1M1G A;  4R56 A;  3CCS A;  3JB9 J;  1KQS A;  4NL2 A;  1BI3 A;  3RUX A;  1N8R U;  4EMK B;  4OVA A;  4OF1 A;  3CEY A;  3JCM W;  3UPU A;  4HCC A;  4VUB A;  5IAY A;  1KQ1 A;  5GAN 3;  2JTF A;  1VQN A;  2IVW A;  3QKJ A;  5KCO A;  4FM4 B;  4BB7 A;  3A8O B;  2XHC A;  4BDZ A;  3LGF A;  4J7F A;  3JB9 G;  2PVD B;  2VV5 A;  2K3Y A;  3TCJ A;  4PJO C;  1O9S A;  3CCR T;  3CBM A;  3LWI A;  1W2B S;  1K8A U;  1KD1 U;  3Q1J A;  1WQW A;  4M78 G;  4B9X A;  1EIF A;  4BY6 C;  2A7Y A;  2I2L A;  4GY5 A;  4PLI A;  4PJO B;  1K9M C;  3JB9 H;  5LJ3 g;  2CS7 A;  1YJ9 A;  3CCQ A;  3LW5 E;  1VQ6 T;  3GF5 A;  2RI3 A;  1X6O A;  5CKB A;  1K73 C;  3CCU T;  1VQL T;  2FB7 A;  3J7A F;  2EIF A;  2ZPB B;  4ELZ C;  1VQ8 T;  3SWN C;  1HK9 A;  2RJF A;  2XIC A;  2XU8 A;  3OBY A;  4C0D C;  3JCM P;  1YJW A;  4RG2 A;  1N6A A;  3V8K A;  1Y96 B;  4KBM B;  3CXC A;  3CCJ A;  3SWN B;  2KVQ G;  4OGE A;  3DB4 A;  2KMT A;  4JS5 A;  3CC2 T;  1G5V A;  2KSS A;  4N4I A;  4FU6 A;  4KUL A;  3RMS A;  2MAM A;  3UDC A;  2VXF A;  1WNL A;  3UWN A;  3VYG A;  1QVG A;  5LJ3 j;  4ELY C;  3GNG A;  3G7Z A;  5LJ5 g;  3OYK A;  2X4W A;  1XOV A;  1PSE A;  3A8M B;  1QVF S;  2RD1 A;  4M7A D;  2KDS A;  3CBP A;  3CPW A;  2LT1 A;  1Q7Y U;  1VQ5 T;  4LD9 K;  2XKO C;  2EJG A;  3JCM g;  2Y4X A;  1QVP A;  5CCA A;  2RHZ A;  5KE3 A;  4X34 A;  5GAO p;  1VQK T;  4C5H A;  3FC3 A;  1R8O B;  5EG2 A;  4M77 A;  3RKX A;  4IUQ A;  3RMQ A;  4M77 E;  2KK4 A;  1XNI A;  2CYZ B;  2QXF A;  5LJ3 h;  3JRZ A;  2Y90 A;  1GXI E;  1OZ2 A;  3OSS C;  3I55 T;  4E7K A;  3M55 A;  3CC4 T;  1UB4 A;  5LJ5 j;  2V8J A;  3L2U A;  3OS5 A;  1WJS A;  2L3R A;  1D3B A;  1M1K C;  2DTI A;  2LCC A;  2WSF E;  5A0G A;  3PTA A;  5GAN g;  3V7R A;  4EMG A;  2EFI A;  5LJ3 d;  2BKD N;  5CKF A;  3OYN A;  4BE2 A;  3KBG A;  3NTI A;  1VQ4 T;  1W4S A;  3TRE A;  3JCM Q;  3CCR A;  2YLC A;  2QQ9 A;  3OYC A;  4XTY A;  4OB3 B;  3JCM c;  3NTK A;  2RH2 A;  3I56 T;  3L2V A;  2PUO B;  2OAU A;  3LYI A;  1JRI A;  1OYX A;  3LX7 A;  3OA6 A;  1VQ6 A;  4LDX A;  3CD6 A;  2QQR A;  3CCV T;  3CCU A;  5GAN j;  4A53 A;  1VQL A;  2PQW A;  4JLG A;  2EJF A;  2VGN A;  2LT4 A;  1VQ8 A;  3OYL A;  3GOX A;  2DZ9 A;  3OMG A;  3JSC A;  2ZGW A;  4M7D C;  3CC2 A;  2O4X A;  4M75 A;  3VUB A;  2E70 A;  4J83 A;  4BE0 A;  1VIE A;  2EWN A;  2E6Z A;  4M75 E;  2YLB A;  3JCM d;  3CME T;  4M7D B;  2QQA A;  3RIR A;  2QTX A;  3OSV A;  2RO0 A;  3A8G B;  4C92 C;  1U1T A;  4J7I A;  5GAO r;  2RHU A;  3M4Y A;  3V7S A;  4C92 B;  3M9Q A;  3ASK A;  3OBW A;  5HKC A;  3OS2 A;  3FRN A;  3OYE A;  4FT4 A;  1VQ5 A;  4BI4 A;  4MZP A;  1B34 B;  2LDM A;  2O01 E;  3UT1 A;  3FIF A;  5GMK l;  4RG8 A;  3OYG A;  2DD4 A;  2PVG B;  2ZPE B;  4MDX A;  2LCL A;  2RM4 A;  3TEE A;  1VQK A;  3OMC A;  3C95 A;  4X9C A;  4M7D F;  4QVZ A;  4PJO D;  2D0Q B;  4OB0 B;  3TU4 K;  5CK9 A;  3RKY A;  4CI0 C;  3GLX A;  2E65 A;  2JZ2 A;  2MF2 A;  2JOY A;  1WGS A;  2RHY A;  5CQX A;  3I55 A;  3CC4 A;  3URG A;  3M58 A;  1ZHI A;  2CZ1 B;  5CVI A;  4M78 A;  3J80 E;  4BE1 A;  3V7C A;  2QI2 A;  1N27 A;  2HBP A;  4M78 E;  2XDD A;  4NS5 A;  1K9M U;  2GCX A;  3FDR A;  2WSC E;  1KC8 C;  3ME9 A;  3HPW A;  5A2Q E;  1VQ4 A;  2XD0 A;  3X20 B;  1G3S A;  4DQ2 A;  4QQG A;  1Y7X A;  2QDY B;  2L5Q A;  3FEO A;  1M8V A;  2RA2 A;  4XU0 A;  4JRI A;  1LJO A;  3A8L B;  3GP8 A;  1WJQ A;  3SD4 A;  1FX7 A;  2B8A A;  3L2Z A;  3I56 A;  2E5Q A;  1BIB A;  4J6W A;  3NTH A;  5D6Y A;  4XTV A;  3S3O A;  3SFM A;  1BKB A;  1UGQ B;  2KAF A;  1M90 U;  4YTL A;  3CCV A;  2RHI A;  5J26 A;  5CKD A;  3QXE B;  5DLQ E;  3QYH B;  5KH6 A;  3MEU A;  5GAO n;  1WPY A;  2GQV A;  4LDU A;  4JJN K;  4C0G A;  4E7I A;  1YIT T;  2V8I A;  1O75 A;  1AHJ B;  4A4G A;  4BUG A;  1Y07 A;  2EQM A;  2XDP A;  4BY6 B;  3MEV A;  2FL7 A;  3NFC A;  4FL6 A;  5GAN 7;  3OYM A;  3HKS A;  3AHU A;  5GAN 2;  3PIO A;  1M5Q 1;  3MP1 A;  5IT9 E;  3X24 B;  3OYB A;  3MET A;  3HRS A;  1M1K U;  2EQK A;  4J6Y A;  2ZPG B;  2CZ0 B;  4C0D B;  2RHX A;  4PJO F;  1VQM T;  2CZ6 B;  3QSU A;  4A4E A;  3G4S T;  1M90 C;  2EQU A;  4C8Q A;  2E12 A;  2K57 A;  3HRU A;  4C8Q E;  1M4Z A;  2P0K A;  1M9S A;  4WF2 A;  1Y71 A;  5GAN 4;  2H3J A;  4ZGE B;  2RI2 A;  1Y96 A;  4EDU A;  1VQO A;  5FU7 C;  2CZ7 B;  2RK1 A;  3HHT B;  3N5B B;  3PGG A;  2ZPI B;  4C8Q C;  3CCM T;  3WXM B;  3R6O A;  2BIV A;  2ZZD A;  3A5Z B;  2G3R A;  4OB1 B;  1HXD A;  3E9G A;  1MGQ A;  3HFN A;  4HCZ A;  2PVO B;  5GAM h;  4C5E A;  1N9S A;  4M7D D;  2WSE E;  4Q5W A;  1S72 T;  2XI9 A;  4JS4 A;  5GAM f;  1UGS B;  2IG0 A;  1M1F A;  3P8D A;  3SDZ A;  1U1S A;  4D6W A;  4J6X A;  1VQ7 T;  5GAN 6;  2FVU A;  2EAY A;  4A4K A;  4IUT A;  2DO3 A;  3QII A;  4PJO G;  4M77 C;  3X26 B;  3OQ5 A;  4C92 D;  4L6V 5;  4N0A A;  4O6J A;  3CCL T;  3BDL A;  2RB6 A;  1YIJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...