4RL4A

Crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
173
Chain Sequence
QGHMKRLEVSNQAKLPTQFGEFYIQCFREKGSKDHLVVFTPNFSQNPLVRLHSECLTGDALGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKVNAYALQDKGYDTIQANEMIGFKDDERDYSVAGEILEYYRIKKMRLLTNNPKKIAALEKYAEVTRESLIVCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP cyclohydrolase-2
publication title Structural and biochemical characterization of GTP cyclohydrolase II from Helicobacter pylori reveals its redox dependent catalytic activity.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 54
structure length 173
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.5.4.25: GTP cyclohydrolase II.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00925 GTP_cyclohydro2 GTP cyclohydrolase II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10990 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rl4A00
4I14A 2BZ1A 4RL4A 2BZ0A
chains in the Genus database with same CATH superfamily
2OZPA 4G4GA 1GPBA 1ZK1A 2FFHA 2I2FA 3OPYB 4FIDA 3U9TA 4XOUA 4KP7A 2RGNA 5CK5A 5JPDA 1S8AA 2Q1UA 3KSUA 4X8HA 1E1RD 2HSJA 3DPIA 1SC9A 3GNSA 2E1PA 2AIRA 4J91A 2PLFA 1CERA 1YFKA 4KO1S 4HH1A 4FNGA 2QU8A 4HX5A 3V1LA 4F4HA 5IKEA 4CBVA 3N2EA 1P74A 4V0KA 3BORA 3P4YA 3HCRA 1M2JA 1ZITA 1NBME 4Y6GB 1O1YA 4N5NA 4PGMA 5L7WA 1SVSA 4MMXB 1AS3A 1A9QA 2IIVA 1NY5A 3AV0B 3NZEA 1OU4A 2G67A 1IBSA 5KJEA 3LV8A 1FDWA 2GD0A 3LOUA 5F3WB 1JA1A 1CUAA 3AOEC 3OH8A 2F90A 3Q7EA 4MUNA 5ER9A 3VAZA 3HGQA 3MRXA 3JQBC 4JL5A 4BB5A 1L4YA 4BFWA 3L18A 4O8ZA 4AKIA 1EUCA 1K2VN 5EIHA 5JC8A 3PI6A 3B82A 4JT9A 3A04A 4PAMA 1UBGA 3EUWA 2RI0A 4B83A 5JXHA 1PLKA 3GLUA 4KK4A 4ROTA 3SE7A 2A3RA 1J6UA 1HNNA 4JKIA 2NV2B 2I2XB 2OMKA 3K15A 1ZMOA 3IAM6 1EDZA 2Y1XA 3OVMA 4QICA 5FPYA 4QSHA 1NI4A 5IDQA 1D4FA 4TRRA 1AQLA 2CD7A 1PGNA 2C78A 2PA0A 3L07A 4UNNA 2B7LA 3DV0A 3ECSA 5LZ4A 1K8RA 4KLAA 3UJ3X 1QO0A 3KIPA 1TMGE 4ZARA 3EXIB 4HDNA 4CJXA 3GLQA 1KF0A 5CFQA 1P2UA 2DFTA 3L7JA 3QE3A 4MMYB 4B7ZA 2NVBA 3G79A 4HS9A 3FNBA 2H7YA 1NVVQ 3JD2A 4JR1A 4EG7A 3DD1A 4X8OA 3RROA 3EBPA 3ZKWB 1UKYA 2DC1A 4A6PA 1PDOA 1JDSA 1ZP6A 2H59A 3PPIA 4IV0A 4F56A 1C1XA 4FJ0A 4L51A 4XGQA 3KEMA 5FI3A 1P2SA 4Q3CA 5K3SA 1QRSA 3MJ4A 4MQFA 5DHFA 1Y6GA 1CB7A 1ZC3A 3NVAA 1PTJA 3G17A 1E9RA 2OXEA 1R9JA 4WY2A 3QUCA 4YEDA 4XRRA 3CUVA 3K7EA 1A9ZA 4JQYA 4XYMA 1YOVB 1Y8QA 2JK0A 1K5DA 2X13A 4RABA 3IAS6 3NHAA 4Q66C 5IAAA 1LGYA 4AWXA 1E0JA 5A5VA 3L41A 1FP6A 3ESQA 4GWKA 1PV4A 2QRLA 5E6RB 2I7CA 1IOWA 2A3NA 1QS0A 3C98A 4D56A 4G89A 5G0UA 4GVLA 4ID3A 1X8JA 2WA2A 3PUIA 3U09A 2WF7A 1RCUA 3IE0A 1V5FA 3VZBA 1TTQB 1M2HA 3IDSA 4DY6A 4BQRA 4X91A 1EWVA 5DNWA 3N2YA 1M66A 4YRFA 2HMUA 4ZIRB 5LYJA 2B7BA 2ODPA 4JLAA 4O4LA 5CCBA 5BOSB 4PTLA 5JDIA 2FP3A 1HE4A 1QYIA 1OX4B 1WY7A 1Z6XA 2PXAA 5DK6A 2GAJA 2X6QA 3FN4A 3W6PA 3OOHA 3A3YA 4RF3A 4HAXA 3OUUA 2VWHA 4LW8A 4PSAA 4DYHA 3AKZA 2OZKA 1S0UA 2HGSA 1NXTA 3AEUA 5DGIA 3HBLA 2VBGA 4W7IA 3SQDA 4BX3A 3R8CA 1NN0A 3EN0A 4GMXA 4CIAA 4G6ZA 4WESB 4YBRA 2YICA 4TRMA 5BN5B 5KTSA 2QMHA 3T9AA 2G1UA 5JAUA 3L0BA 4WXEA 2ZZMA 4HYEA 1ZCZA 2QMUA 3R24A 3QVMA 3I28A 3ZCQA 3JAKA 4KI7A 4C06A 4M0MA 2COEA 3DOFA 2RKBA 2HD4A 3EQ6A 5EJ9A 4R3UC 1J2JA 2ARKA 3CF0A 1B8VA 1ZGBA 3AVUA 3JWGA 5FL7A 4YWJA 1ODTC 2CXXA 3NASA 1LTKA 1RIIA 5D3KA 2CHQA 1NFQA 1Q1BA 1XJCA 1YACA 1YAJA 4P34A 5HCUA 2VP4A 1V4NA 2RHGB 1GGJA 4Q4DA 4PYJA 1BMTA 2ORWA 3ELUA 1BTOA 4JVMA 4PZZA 3SHVA 3UWPA 3W05A 4FILA 4C0JA 1I7LA 2POCA 4GOKA 5DTRA 1I3MA 3QVGA 3AY7A 1MOQA 4Z4QA 3TW8A 4FR2A 1TUBA 2FSVC 2QY9A 1XJQA 1I80A 3T34A 3R5KA 2HFKA 5FNZA 4F60A 2JBAB 4XIIA 5A4FS 3OZAA 1V71A 3OEYA 1BX1A 1IE3A 3E2IA 3GVIA 3MOGA 1UZUA 1ZIPA 4YMLA 5LXTA 4MV8A 4QVGA 4WADA 3WKCA 4YRSA 1OOEA 2R3SA 4EPYA 4GX0A 4X7MA 4BNKA 2PEZA 1BCSA 2GVNA 1QOZA 4BP8A 2GPAA 2I7TA 3QLVC 1O95D 1U5AA 5HIJA 2D13A 4YP5A 3BB4A 1CRPA 4NDZA 1N1MA 3AHFA 4WK0B 1C9MA 4S24A 3V4SA 2P3QA 5LVAA 1OASA 1X2BA 2XUIA 3GW8A 2PYIA 3BL6A 2CL5A 4Y6OA 3E3LA 2GBGA 4P6VF 5AYVA 4ZMSA 2LVBA 5EE1A 5AP9A 3MQFA 2ONJA 1SCDA 4LDJA 4MWSA 1JDBC 2O7QA 3NNDA 2IVFA 1I4OA 1UBRS 2C61A 3KVRA 3O8OA 5CGQB 1JB1A 2GASA 5LIRA 5LJIA 1COZA 1HDRA 4DCTA 2IXAA 4F84A 1W48A 4AULA 4E2WA 1JG1A 4GXTA 4EUEA 4QATA 2A4KA 2XECA 2W70A 4NCNA 4K6GA 4YJ2B 4YJDA 4WKBA 2O9JA 2VP0A 1QHIA 1YL7A 4CDGA 2ONCA 4B40A 3MK31 1NI4B 2P2DA 1J21A 1RD4A 5B3JA 2V6IA 3CLUD 2FAXA 3DV0B 3WMEA 3X1KA 3GCXA 4D98A 1N2ZA 2CSUA 4DV5B 2IELA 2P8SA 4WNYA 5I8ZA 3V4FA 5BT8A 3AVPA 2ACEA 1KMNA 5T4BA 4HDNB 6YASA 1E2UA 5GP1A 1V11A 3I0ZA 2Z9CA 1E59A 2ZQYA 3QSYA 2G1KA 3O84A 3WXBA 1K3UB 1Y1LA 4GG1A 2GESA 4CKXA 2Z58A 1O4VA 1J39A 1O89A 1V3QE 3H75A 4B4WA 3NBKA 2IDJA 1MKYA 4GEGA 2ECPA 2OG2A 1ZLXA 2W6PA 3PQ3A 1E98A 1R4AA 2I2BA 2WSLA 4MQFB 3PJRA 4L95C 1VLLA 3AILA 4N18A 4EKDA 1E2QA 3Q98A 3FVVA 1CJUC 1X7ZA 4RE5A 5EUMA 4KJZA 1XPRA 1Y8QB 4B3DA 1OR8A 2PT9A 3RFVA 5EJ8A 4CZ2A 2RKOA 5F7OA 2VDKB 1BE8A 1QFJA 2O8NA 2XSZD 3ECCA 5TPZD 5JFTA 1U9JA 1F8UA 2R4TA 5LZ5A 1VPVA 3O8CA 1QS0B 4DNOA 5BSHA 2EFCB 3DL7A 1FYEA 1NUHA 3GXBA 1RXYA 2JRLA 3ORHA 2HSEA 2VK8A 4RKFA 2YZGA 4Q9JA 5AOVA 5TC4A 3HY3A 2IF2A 3ZXUB 2IXDA 4BQNA 4F38A 2OESA 2FUG1 4G84A 4P36A 3DO6A 4CUKA 4PYOA 1GQ2A 1ADGA 1V96A 1X42A 2BOVA 1DRKA 2NT3A 3B6MA 3FXAA 3KYBA 2NZYA 2ZQ5A 3GJ4A 1C8VB 1QMGA 1AUXA 3L0OA 4L7QA 3VR4H 3BN3A 2CDRA 1KYTA 1XROA 3N74A 4K9NA 2QP3A 4M8KA 2FZ5A 4OM7A 1EUQA 5K0SA 4O5OA 3Q72A 4HGZA 5C5IA 1CUSA 1JG2A 3DMTC 3M6MD 4YO8A 5JVDA 1M9NA 2W6ZA 3O3OB 5JAQA 2RHHA 2OP0A 4NH4A 4RORA 3PNOA 3DOIA 3CSSA 4IQGA 2FG7C 3AEUB 1ZEJA 3RNLA 3PQ6A 4HEJA 1QGDA 2IPLA 3BE6A 3GLFE 2BM9A 4M22A 1YC5A 2EBUA 5ITVA 2O6LA 4B7AA 4C87A 5F5XA 2OHGA 2PE5A 4LV6A 2MDTA 4HBZA 4AW9A 1T1GA 2VKTA 4CF7A 2RGAA 4MR9B 4IQFA 4GSYA 5TGZA 1CZOA 3R3VA 3ZQ6A 1A5BB 3EVBA 3K5IA 3O4HA 3PFIA 4EELA 2OCPA 1RR6A 5B6IA 4CV3A 5JUWA 4UUOA 4XSGA 3QEOA 2EC5A 4LJKA 1NP6A 5AVZA 2PZ8A 4AN4A 4RVUA 4MIEA 1KJQA 1B74A 2FRVA 1AUQA 1GPLA 4IGAA 5EEHA 4OATA 3M70A 4HNSA 3KUXA 1LJLA 3RK1A 1U7OA 5KVSA 1HSZA 3A7EA 1T4CA 1GR0A 1KBOA 4FPXA 1QCZA 4FIZA 2X0NA 1R50A 5AKKA 4BE4A 1CUDA 1E3TA 3KCQA 4QDTA 3E4CA 4X6UA 4KQKA 3V46A 2WJHA 1I4TD 1P8AA 1BRMA 2IPXA 1S01A 4DR2B 2HOQA 3G0OA 1JH8A 1JFFA 3BILA 1LC0A 4G85A 4ZQHA 3CRRA 1EE1A 4G4SP 3FRJA 4C2TA 1RBYA 2XNDD 3JD3A 3N70A 3NT4A 5LXTB 1DLIA 1SCNE 3P9CA 1Q0SA 1I7PA 3IDQA 4IGIA 4OV6B 2VSYA 1RWBA 3FF4A 4TRJA 3LYLA 3VH2A 5FI1B 4OLJA 5BY2A 3IODA 4C6SA 3AJEA 5K4AA 2DWOA 3HBMA 4D26A 1QUFA 3OZBA 3LF1A 1GSHA 1RYEA 1RAHA 4Q0MA 1ORHA 3NX4A 5C4IA 3HZRA 1KK2A 1NW5A 2Z30A 3X1ZA 3KOMA 1SY7A 2VDMB 2E5WA 2ICAA 1P6QA 2R751 5DYTA 4B4DA 3JZMA 4MQLA 3BWXA 2FQ1A 2Z2XA 4DMHA 4OHMA 1SFRA 3FZEA 2ABWA 1MIOB 4N40A 1SKYB 3IDZA 5IARA 1XAIA 4JIMA 4EFKA 3I76A 1AY0A 1T8TA 3BC1A 2PPLA 4JSTA 3WHIA 1M7BA 3B9BA 2W2OA 4WK6A 3O8OB 5D1NA 1ADJA 3INRA 4JZKA 3EDYA 3GBPA 3RFCA 2JFHA 3QV2A 1O94D 5H3CA 4TWJA 4HNUA 1U8ZA 4WXPA 1FEZA 2E2WA 4QXRA 2Z2KA 3K8OE 5EPEA 2DFLA 3RLIA 1Z5VA 3DHWC 4M8NE 3W3AD 2IX3A 3JVIA 3Q7RA 4WCFA 5SYAA 3FE2A 4G5XA 4ZRMA 1N7JA 4CCYA 2IPMA 4GPTA 4F85A 2FWRA 4X1KA 2WG2A 1MN6A 5B7QA 2UYCA 4FONA 4MXDA 3WO1A 5EGSA 1Z7EA 2X7JA 1UBFA 1ZNZA 3BCHA 3TQSA 1VMIA 2PUJA 3N6RA 2PH5A 4DIKA 2YRFA 4CF6A 1U2TA 1V11B 3C16C 5BOVA 1W85B 3LL4A 2EGUA 3GI1A 4HNRA 1JHRA 4LJ7A 1RVDA 4RPKA 5ERYA 3MINA 3TQFA 4NQZA 4JZYA 2FSUA 3DBRB 3UUEA 3VPGA 4CW7A 5JFGA 4D25A 2XNJA 1RVV1 4MIYA 2X76A 3EW7A 1ULUA 3UPDA 1K92A 5JRJA 2ZZKA 3EG5A 4LGYA 1P2FA 2H9IA 2PO7A 3MCAA 3DDHA 3U4DA 4EW3A 1SCKA 1SBIA 3VC2A 2VNKA 4EJ0A 1AHIA 2GPTA 1YA4A 2M98A 5B53A 4KQ2A 1P18A 2ETXA 1IZ8A 5CDFA 2CHEA 1GNPA 3VPCA 3G2MA 2FMHA 5BMVB 2PGJA 4WI1A 1L5NA 1P4GA 3G1TA 2P0YA 4JSYA 2B4YA 3DL4A 2J46A 3LQ2A 4ZOLA 5L4NA 4D43A 1YR9A 3CR7A 4MW1A 2JEZA 2TMGA 2YZKA 4UHJA 3IMCA 1T3HA 1PL8A 1WD5A 3JQ7A 3MS2A 4JJAA 1OC2A 4DB2A 1E9CA 1QZXA 1Q7TA 1Q7GA 2F3SA 3SC3A 4Z5XA 1QTIA 1AF7A 2UZ3A 3GRCA 1Y34E 1DIOB 1NJ5A 3BTOA 1U31A 1S2DA 2AG8A 2PRJA 2WVJA 2ODWA 3ZWXA 1U3CA 2CXUA 4E94A 2A1TR 2YQZA 1CSEE 2CNKA 1EUYA 5JVDB 2JIOA 4H1UA 4MYSA 2LDBA 2QHXA 4RS3A 3RSCA 2C2BA 3ZUGA 1KFCB 2B2CA 1EFRA 2MINA 1P75A 1RYNA 4LOHA 3BJEA 3WGMA 4B82A 4QG7A 1P5HA 4DSOA 4II2A 3ZU6A 2GCOA 3ONWA 3P4UA 4P81A 3HKEB 3QJYA 1R6AA 4CIDA 4JI5B 4CMCA 4CLEA 4D8UA 2QR5A 3K35A 4JLDA 4JU9A 3BWBA 1A2QA 1UXKA 3ASUA 4YMHA 5B55A 3JYQA 1L8AA 4YDSA 1XMQB 2OR3A 3WYAA 1JHOA 1GAWA 1LTQA 2O2GA 3A9UA 3BBLA 5LMCA 2D06A 4TZTA 4EVSA 3LE8A 2W5UA 4JYAB 3Q5EA 3WWZA 1S1CA 1E7RA 2CZQA 2GN6A 2J3IA 1CUZA 3FOWA 3MTGA 3R0IA 5EPUA 1C8KA 3WNDA 4BRWA 1KEEA 4P5EA 4ENPA 3G68A 3HU3A 1QHYA 4GEKA 4F6RA 5I47A 4OLAA 2W6JA 4FYHA 2Q4RA 3V55A 4A73A 1K6XA 2FPMA 4DLRA 2JLXA 4G0NA 3VPAA 2QX6A 4DSZA 4R1PA 4ZXFA 2FEWB 2HLDA 1ZOIA 2DPGA 3L6RA 3Q11A 2R79A 3IQEA 4UCWA 5T8KC 3RYCB 1GTSA 2CMGA 3LQQA 4U3JA 1LPPA 2HSZA 2CXPA 5B1YA 2B35A 1NP3A 1UAGA 1JHPA 3IBGA 1YR7A 2ZYWX 4XGNA 1CZLA 2AC4A 3CZMA 4I08A 1UP7A 4A92A 3H9JA 4HRAA 1O7JA 5H8WA 1E8DA 1N0UA 4PR0A 4RD6A 4E5KA 3HJNA 4R8LA 3DEZA 4XWYA 3PBKA 1G20A 1JLLA 1H9AA 4FI3F 4KPGA 4HR7A 5A4IS 1ZCBA 2ZK7A 3R6LA 1FSGA 5CIQA 2JAUA 3PDHA 5LP1A 1Y4ZA 3X1DA 3FNHA 3ZD9A 4DDUA 2FMKA 3UJCA 2BYTA 5A4DA 1GEGA 2HPVA 4KW7A 3RVRA 3WK6A 3K20A 2QD3A 1P0CA 5FJJA 3QXHA 1YCDA 2ASEA 4F3NA 4JBNA 4U00A 2Q3EA 4CMEA 1U2QA 2CLOB 3HB0A 3WWDA 4PFQA 2IT1A 3DLIA 3T9BA 1M33A 2Z4TA 3N87A 3Q15C 2O57A 1VBNA 1GY8A 2Q07A 2R9VA 1SUEA 3QBEA 5IZCC 1HT1E 1QANA 2I4IA 2IOFK 4IIJF 3GA5A 4UZSA 2R1TA 1WQ1R 3SJCA 4DJJA 3LQ1A 3AEXA 1JBKA 1KERA 1CQXA 1H1DA 1YS2X 3HYSA 4KNWA 1ESNA 4IS2A 4QUDA 2HY7A 2JKZA 1G3RA 2PV7A 4LVOA 3BWDD 3L5KA 4C2BA 1PEDA 4BQPA 3P94A 4ODIA 1MC1A 2VPQA 3P9IA 5DF1A 5EHIA 1MX9A 5A9SB 4OI0A 1DLJA 1FVFA 1I9CA 1OXMA 1PWEA 1EGVB 2C9ZA 2PL5A 2VHJA 4H3VA 3KRTA 4MVJF 4X1KB 5JWOA 5K0CA 5HS6A 2ID9A 2ZSKA 2CV2A 2IBTA 3BK7A 5JLJA 1R15A 2W2QA 5CFPA 4L0QA 1AHPA 1A72A 3FLBA 5JS2A 1KI2A 1AXEA 1VI2A 2HQ1A 2UZ0A 3GJ6A 3RVPA 3QLUC 3EDCA 4IBOA 3NJ4A 4Q7MB 2Z43A 3ZG6A 5EINA 2JFZA 2F3QA 3GOHA 3V97A 4BFSA 3F7TA 1WL8A 3R7DA 5BPFA 4W5HA 2Q5JA 4OB7A 3NTOA 3CMCO 2F2TA 1OTXA 5IG2A 1QCCA 3A1DA 4YMTA 4FEEA 1L5ZA 3LPCA 4LY0A 1PYOA 5CYPA 3RFTA 1YHNA 2FPPB 2QRNA 3IPCA 1ISGA 5DIZA 4DEVA 3TJMA 2DCUA 1AO0A 2GPBA 1BXGB 2WVGA 5H5JA 3IQHX 3IC5A 4OQLA 1B3RA 2VI5A 4IXDA 3ZLVA 4EMTA 4K9KA 2NIPA 4K46A 1HMYA 4YJ3A 4RLHA 3R41A 4KMSA 1H6AA 4F3YA 5HNKA 3B12A 3C3KA 1MH9A 3JQ7B 3PUKA 4O2AB 2DY0A 3ZHYA 1DIHA 1A77A 4DY4A 5COBA 1GPMA 4TMTA 2OV6A 3AZQA 3Q6MA 1KEPA 4TLDA 1M72A 2VDPB 2QUZA 3MEQA 2DUWA 4PY2A 5B1DA 2FQQA 2ZVDA 3H4MA 1CV2A 3PT9A 1CETA 3D3NA 3GFOA 4FNAA 3PDIA 1RWQA 3DE0X 3TCNA 2HA2A 3BH6A 3INNA 4A91A 2CMHA 1E7QA 2Z5VA 1PX0A 2I6QA 2WUEA 3FMOB 4LZLA 4KAXA 5GIPE 5KZMB 1JG6A 4MKXA 3A4MA 1A76A 4W8OA 3URKA 3V4RA 1GPH1 1I13A 2XVMA 2HSWA 1L3CA 2GAOA 4BUJA 5MN4A 4DDMA 2GCOB 5KTTA 4YCAA 1DRWA 1XDUA 1XPJA 2PLRA 4AK9A 4OHRA 4C1NA 5IZ4A 3VPXA 3SEQA 3VGJA 2D0DA 2O1XA 2DWQA 4QDUA 4U7FA 2BM8A 1QTRA 4UM9B 2OB2A 4J07A 5GJCA 3U7EB 3BIXA 4XDGA 1VC2A 1SWVA 1KGDA 3VPDA 3WYNA 4UQLA 3KLBA 2BR5A 2YV1A 1RJEA 4MKIA 3PC4A 2XVYA 2I6SA 2GZ2A 1N2CA 3PXDA 3VR4A 3LP8A 3ZHXA 1Z2OX 4WLEA 5JADA 1IDN1 1N8TA 4ZO7A 1RDFA 3W06A 4LIPD 2YJ6A 3ACDA 1GA4A 2PBFA 4ZYZA 5KHLB 2P9YA 1JA0A 5K3FB 1DOHA 4TV9B 3WX0A 2GUGA 4WGGA 1JG4A 4P4LA 5FOVA 3EWAA 2YWXA 3IXLA 4Z99A 5TMBA 3FWNA 5G0WA 4YPOA 1ISHA 3MWLA 4Q34A 4UBMA 5KTKA 4M9UA 2VNJA 3V8NA 3BMQA 2RC6A 1GIAA 2GBLA 5FOWA 3EB9A 2Q27A 4O1HA 4KZKA 1GTL1 1YJAA 1WXFA 1Y5RA 1SULA 4UXHA 4TLCA 1VGQA 3IEUA 3AFMA 3WR5A 1JIVA 2Y6VA 4OH1A 1N6NA 3SM3A 4QZVA 2YYAA 1KY4A 1S3SA 2HK7A 4BRSA 4I99A 1PRYA 2RIPA 4C29A 1JKMA 1NZJA 2FU5C 2C7BA 2VPZA 3FPEA 5G41A 5HQ3A 4AKSA 5L45A 1Z16A 5LWHA 5EKTA 3WL5A 2DG2A 1SBYA 3TLJA 3PR2B 2V8OA 4KOAA 1HZJA 4DABA 4GC9A 4R8MA 5CDYA 3P9KA 2P8JA 4KTTE 3RVDA 3LW7A 4EGFA 2WZCA 2ZWIA 1ZOPA 2BMDA 2R1TB 3N5KA 2FK7A 3GD5A 1SC4A 4GQBA 4RHYA 5J2UB 1GNSA 3KDSE 4WCDA 3KJXA 4AJNA 3ADCA 3C3PA 2N3ZA 4ZZIA 3EIHA 3O73A 4DUGD 3IB6A 4NYJR 3QOXA 4Q3NA 4P9NA 3ST7A 2DH6A 5KQMA 4R1TA 2YWCA 1EGHA 4HH3C 5AH0A 1G17A 5C8YF 5JMWA 5C51B 1SXPA 2PMBA 2GSWA 2HJWA 2IL1A 4KSBA 4PGHA 4JUDX 4IW3B 4YMWA 3V7YA 3EDMA 1YDHA 4EY8A 4A0GA 1CRQA 1FJ2A 1CZRA 3A26A 3OEEA 5EKSA 3BGSA 2O8BA 2A5YB 2AYXA 2PX4A 3W8DA 1WP4A 4RDHA 1JIJA 2RH9B 3C4VA 1C3OB 3G2KA 3IQWA 3QXXA 4Q00A 2FKAA 3RBZA 4GYKA 5HUQA 4F1JA 5B37A 2Q9BA 3HV2A 4AVYA 2WR8A 5I3ZA 3FFAA 4OREX 2GK3A 4KFRA 3F5MA 2ZI6A 4TYYA 1OCEA 3L1KA 4UKDA 2V59A 5AOAA 1V4VA 1U6KA 2LCFA 4I5DA 1UMCB 4RJ2A 4DZZA 3DUFA 5LLTA 5CFNA 4JELA 4K3VA 1N2SA 4UUNA 1P1IA 2REBA 3N8IA 2PKXA 1WW2A 5KWJA 4ZP1A 4JYPA 2B0CA 1WZCA 3H1EA 2XH8A 4JNKA 3R0JA 1ZM4A 1FRFS 3N8KA 2D1RA 2H85A 2GK7A 2R85A 3COSA 4K9PA 4BVFA 4OXIA 3JZAA 3TJRA 1PFWA 4NARA 5ELLA 3BX1A 1H5QA 1I30A 4PGAA 4ACAA 1J2UA 1E4VA 2W4IA 5B58C 1HGXA 3HXMA 4TS3A 2ATVA 1D2HA 4YJ3B 1KS9A 1VE6A 3AP3A 1BRTA 2D1FA 4IEIA 1SOWA 2ZJ3A 1N2IA 3BZBA 5KSYA 4RCYA 1Z17A 5GMOA 5CB4F 3QVUA 4KO3S 4D4JA 3B1WA 1FUYB 1XTRA 4HAWA 3PYMA 4BKRA 2AN9A 3LVBA 1WS6A 5BR8B 2BVNA 3E35A 3EFEA 3ZIDA 4Y7CA 5A2GA 1N3LA 3C48A 1G8MA 1M73E 2CYCA 3GGOA 3HACA 4NECA 4TXLA 4EDHA 1N33B 3ZI4A 5FOUA 3WIVA 2DAPA 2VYND 3JQ9A 5KWEA 4XUCA 2JLWA 1QR2A 1PCXA 3SEAA 4DMGA 2E4WA 1J70A 2H00A 1A88A 2NQ2C 1XLVA 2QG9A 3CCCA 2XMBA 3DNPA 3I23A 1ECFA 3Q9UA 4U1RA 5CVUA 5FPQA 5AVYA 2F4VB 1WKCA 2A9PA 5K7SA 4ZOBA 3A6DA 4BCBA 5IUJC 2WG1A 1UQTA 2IYFA 4HQ6A 2XAUA 2Y71A 3M5DA 4PCVA 4JP1A 3ZJVA 2OCBA 2Z1MA 1AKQA 5L9AA 3G0DA 4RQTA 1V9SA 2XUQA 3GD7A 4FKBA 5ULLA 3STHA 3K1AB 1A9YA 2AUMA 2NM0A 1N2CB 2BUBA 3H3JA 4JI3B 4DA8A 3EQZA 4WOKA 5CT4A 2NUAA 2I7DA 4N54A 4N76A 1PZHA 2EZTA 2JAPA 4JLWA 1P61B 4C2AA 2IK8A 4YCCA 1QKIA 1XRSB 1P19A 2G4VA 3AYXB 4Q24A 4X20A 3P7MA 3PLAE 1LRLA 1WX1A 2ZFUA 4F5ZA 4BXOA 4JBXA 3RJMA 3MB8A 2G83A 2OO3A 4EPTA 1RXUA 2MCFA 1X7YA 1D04A 5K6AC 2FF7A 3E5MA 4C4AA 4D0LB 1U4NA 3NHBA 4QFMA 2VDLB 4I4NA 4YRAA 2G9VA 4I1SA 3WG9A 1PD0A 2H5EA 4YP0A 1EFCA 2F3UA 4X8MA 5CDUA 2Y1KA 1WXEA 4CEIA 1B7GO 1Z88A 3EAGA 2OCGA 3MJVA 2BEUB 5L40A 2FF5A 2EIXA 3HA3A 3ISTA 5FTLA 4XWGA 4OHUA 1C9NA 4E5NA 1XCJA 4NOKA 4RFSB 3EYWA 2EGGA 1HL7A 1CBUA 2PR2A 4JK3A 4XIYA 4CU5A 1PZMA 3KPVA 3BB3A 5TF0A 5JJIA 4JJ7A 4BMYA 3U80A 1FE8A 4UDOA 5KJFA 2DUMA 3IUPA 3QFCA 1TIBA 4ZQEA 2GN4A 4DWWA 2EX0A 3EFOA 1PFVA 1WMAA 3EOZA 5LP6F 1GCAA 3LT2A 5BSWA 4GOND 4ND4A 2K4MA 3HBFA 4EO4A 421PA 1HT3A 3GQBB 3C4JA 1J0XO 1GGKA 2RAVA 2PR7A 4TVSA 5LOVF 2BBSA 5HILA 3EZ7A 1F20A 3ZZTA 4P2GA 5IAGA 1I5EA 1KR2A 2NXJA 4HNAA 4IVPA 4RTRA 1AUVA 5E6UA 4AQ7A 3WLEA 1G64A 1NFFA 2HNKA 1Q3TA 3L06A 4MI9A 1ECLA 4R2HA 4YP6A 1Z5ZA 1WKVA 2ZROA 3HUUA 1P1BA 3IYLW 3NC0C 4X0EA 5JWRA 1ATIA 1MW8X 3J7AC 3RIGA 2H1CA 1MO2A 3HA5A 1TGYA 1Y6QA 2IWHA 3HCDA 4KR0A 5JDIC 5LN1A 2ZJAA 2WIAA 4FD2A 4CVNA 3A3OA 4KWTA 2OY0A 2HQOA 4MP3A 3KR9A 3OZFA 1W36C 2XTJA 2ZB7A 2RHWA 2FCAA 4W5QA 4MITA 3IP7A 1N3BA 1G8SA 1Q1NA 4I8DA 1NQAO 4Z4IA 5I5EA 3QMVA 5LBUA 3W8RA 4MWDA 3C3XA 5DI3A 1J07A 3I34X 1CVRA 3OKFA 3ABSB 2RG1A 4CT4B 3N28A 4JP2A 2E89A 3DB2A 2VR1A 2D00A 1XRJA 1NLUA 4AMUA 5THKA 4FYWA 3L0PA 5KTOA 3LY5A 4YACA 1J7JA 2KLBA 1CFJA 4MV9A 2K6GA 2WIJA 4FJ1A 2SCUA 3I6YA 5CEEA 2OWDA 1M5RA 1DEHA 2HJVA 4MUHA 4DARA 5NULA 2J5KA 2W2XA 3VR1A 2WHXA 4EKGA 3P9ZA 2PX6A 5AT1A 2Q1SA 4NZZA 4PO9A 3RG8A 2GEJA 3IOYA 4FWIB 4D3YA 1EBBA 4NFLA 2XWPA 5EE0A 5AW1A 3QVWA 4BQFA 2PX3A 1DAOA 2XA9A 4TLEA 4UATA 1XC7A 1XRMA 2FWIA 3PUYA 3AR5A 1YS9A 3MB5A 5FO1A 3HEMA 5J2TF 2I62A 4G2NA 1JEAA 4E51A 4MDYA 1UFQA 4LZOA 4RS4A 4BN0A 3I8OA 4QDXA 3RFXA 3RE1A 1ZN9A 1PIWA 2OYCA 2XXAA 1YB1A 5IEJA 2Q0QA 4AWAA 4BV3A 1P9OA 4L7VA 5IYZA 1QYCA 3WYBA 5IT5A 2R86A 4PS0A 1P0PA 4C0KA 1KAGA 4R9NA 3WLKX 4C4TA 3A6HA 3KZKA 2O3RA 2EJCA 3PFWO 5EMHA 1CXZA 5HDQA 1V7ZA 4Z1MD 3H05A 5LU8A 2XGSA 4PQGA 2I4TA 4PX5A 3HK2A 2P3LA 1KU0A 3BL8A 3MSCA 3P5SA 4WDQA 4LRWA 1X8XA 5B64A 1D5CA 1ZH4A 4Z49A 1S2GA 3JYOA 3MJSA 5DGDA 4JSRA 4Q37A 5IKPA 1C4OA 2J3LA 2C57A 4RZQA 3VC7A 1RZRA 5E4TA 3ENZA 1WBBA 1MZPA 1KDVA 2I4RA 3OM0A 5L3QA 2HBRA 3I2JA 4B6FA 4MCAA 1Y3CE 1SMKA 2H18A 5EHXA 2BGGA 2GYWA 2WVAA 4Z51A 4MWCA 5ICSA 3U7FB 2XB2A 4NCKA 1U2PA 1EBFA 1NZFA 3SZLA 1DL5A 3R5HA 2ZB3A 1IN4A 4ZQGA 2NUAB 3F7MA 1QQBA 5FAKA 4FGSA 2NWQA 1XVLA 4LI0A 3FNGA 2JFBA 4OMFG 4ITUA 1QAMA 3EEFA 1EVIA 4A8TA 3KPJA 2O3JA 4DA6A 3VJMA 3R3ZA 4BXOB 4OAOA 2BM0A 4NL4H 5DHSA 1XNQB 1K08A 5BV1A 5KQPA 1V2HE 3NALA 1A3CA 1RM3A 1E1DA 2V4ZA 1R9NA 4Q9LA 4EABA 4PONA 3CW2A 3EXFB 4G4IA 3USES 2BISA 1L8XA 2C2GA 4GVPA 2YJTD 4LUCA 1IEWA 1D4OA 3UA4A 5CW1A 4DLSA 1T9GR 1KH1A 1Z63A 3CWZA 3OFNA 3K8QA 4FUQA 4H3KB 4IIEA 1JTEA 1M0TA 1WVMA 1CUIA 2GNOA 5SYNA 3LO5A 4U8GA 3V8QA 4EF6A 4TS4A 4YLEA 1BIFA 4YT2A 4R5MA 5HZKA 2I87A 1J1IA 2WWGA 3PX3A 4JWTA 4E5MA 3PDJA 3K6RA 4KYTA 1GOTA 2PANA 3H7AA 3WE7A 4RAQA 3NKVA 4EM6A 1PWZA 4K28A 4B6OA 2VWQA 2OE2A 1DFGA 2IZ6A 1Y7TA 3GFVA 1O8CA 4P53A 3LXUX 3KG2A 4H6VA 3ZQ4A 1D03A 1NXWA 3H86A 3EFOB 2GF9A 4DBZA 3ZEAA 2J87A 2Y2UA 4YN3A 5F4ZA 5ALQA 4H59A 4ANFA 2ISSD 4H6XA 4LZWA 3KQTA 4HFJA 3ZWMA 2QTZA 4YUAA 4N5IX 1HUQA 2O5RA 4X90A 3THXA 5JU6A 2ZI9A 3LX5A 4B3RB 3L7MA 4G86A 3M1LA 3SG0A 1ZD2P 3WBKA 2QVLA 2H1OA 1SVKA 1BVRA 1ULSA 1VL1A 1X1EA 1Z0DA 2XEDA 4XD7A 3X43A 1SXJA 2CJFA 2O3SA 2O7NA 1JKXA 3D6HA 5L3ZA 3ZCUA 3GLFA 1PGJA 4PZPA 3U6KA 1UOQA 4BEWA 3FVQA 1V1MA 4YYEA 2HQRA 4LK2A 2GKOA 2WKRA 1TD9A 1MPTA 4O59O 3D4IA 1BGWA 4LVUA 1Q0QA 3VMFA 2O0JA 3B7PA 4LXUA 3AHIA 1V8BA 2GZHA 1YZKA 4LAFA 2DWPA 2PSEA 1UJBA 2F1HA 3KEOA 1HG1A 1OI7A 1A8SA 2OV8A 3L9XA 1KTVA 1VE9A 4L6CA 4YDQA 5IVIA 2A2ZA 1E63A 2DU8A 2OD9A 1EJBA 1NQTA 1XHEA 3NORA 4TLLB 1D1TA 1VIMA 1U9YA 3ZK7A 3IT2A 2IV3A 2ZYIA 2HRBA 3HZOA 1CQZA 1O97C 3JQAB 4J9UE 3OWHA 3TUIC 3KFLA 2EJBA 3PD0A 2GLXA 1QHFA 4NBSA 5AKEA 4ZAZA 4FC7A 3UBTA 1JU3A 2SCUB 3GJZA 1Q0HA 2EDAA 5K6RA 2QN8A 3IAFA 1JWLA 2M1ZA 3I61A 3IMFA 1U8TA 3LMKA 2F64A 2PZAA 5CLJA 2YH2A 2XNKA 1I6KA 2Y0PA 3N2KA 5DCWA 2X0FA 3WQSB 3C8MA 4MUGA 3E23A 4GQIA 1FNBA 2LW7A 1Y6RA 2REXB 3EH2A 3BSFA 4NTZA 2IYAA 2X40A 4Q1DA 4AY5A 2IOQA 3MBIA 4ESHA 2E4XA 1NW9B 3ZWOA 5DULA 4M46A 3ZWNA 1U2ZA 4BN4A 5GY7A 4N9QA 1BZYA 1E1KA 1RQXA 9ABPA 3QWBA 2XYQA 1XZIA 2CNWA 1ID1A 5AKLA 1Z68A 2YR0A 5D86A 3LGSA 5JXIA 1N25A 1WU7A 3QA3E 4LPKA 4QRDA 8AT1A 4EAAA 1GPUA 4E6PA 3PXAA 3OZRA 1L5KA 1GDDA 1RZVA 4I8XA 4J7CA 1I1QB 4G1EB 1T9BA 1V8PA 2J9ZB 1H8HA 2CBXA 2Y05A 3AY3A 3N07A 2UUOA 4J6FA 2WMDA 4LBZA 2JW5A 4DDTA 3AUSA 4WKNA 1R0CA 4ZDKA 1MAAA 2BGJA 4RPCA 4XR4A 1T5SA 3T1OA 3CSDA 2VSNA 4W7SA 1ELOA 4KDRA 2DF8A 2PVCA 3OESA 2E82A 4HB3A 4OP3A 1M67A 1EX6A 2P6MA 2RBEA 4TKUB 1HSOA 1RJDA 4BO8A 5JXGA 1T8UA 5B6JA 3HADA 3TIIA 2QRHA 5BQFA 5CDHA 5L3QB 4AO7A 2FEKA 3LM8A 3H2YA 4QYXA 2XBLA 4UC0A 4B6RA 1AZWA 4M8SA 4W1SA 4GR4A 2G70A 5LKRA 2ZUSA 2QE7A 4ZOAA 1LX7A 3GDFA 1KVSA 4REQA 1IATA 4LRUA 4FGKA 1PLJA 3KQPA 1TJ5A 2ID8A 3R5TA 3C5WP 1AB5A 1KKMA 3AKDA 4HCJA 3R8XA 3CZRA 1FW6A 1USVA 1KVRA 2IDKA 5LCXA 5IBRA 1FFXA 1EFVB 1TI7A 2OHVA 2RE8A 4WCFC 2W6CX 1S2LA 1QIKA 2H57A 3H97A 1KI1A 3LZ6A 1KJNA 3HVUA 4JUBA 3WK8A 2QIOA 5J63A 1PJQA 1RCTE 4QASA 4PINA 1T1SA 4GSLA 721PA 1J1UA 3ZTTA 2ENWA 3UPUA 1QIJA 2QB5A 2HRDA 2WTBA 4HUJA 3TRIA 4LDNA 1W87A 5DVZA 1V3TA 3OFKA 4Y18A 4GI7A 3G5UA 5ICCA 3KNZA 2HPHA 3NHMA 4D42A 4JB3A 1UDXA 2YXNA 4O4JF 1ZGCA 2ZE7A 3BJMA 5EZQA 1KZGB 1CYEA 3RSLA 1SVMA 1DUVG 3B1KA 4C6HA 2OHIA 4ZOQI 4HQ0A 2X2OA 3A1WA 3K4PA 3SQNA 2PAAA 4ETIA 1U2GC 2NTVA 1BMFA 1SOAA 2JZCA 2Q2NA 3EZ9A 2FN4A 3G2NA 1Z4MA 3I2KA 3PXUA 4JP5A 3RUAA 1DX4A 3LUGA 3DLPX 4QBGB 3M0EA 2FDXA 4F45A 1CF9A 3WYCA 4XI9A 4W5NA 5AVKA 1Y1SA 2WC1A 2BGIA 1T4DA 3M8KA 4Q4HB 4XM0A 3UJDA 4KITB 1HFEL 3THXB 1P6XA 2FUKA 1M3SA 1JXOA 1VZ2A 5CW2A 3IILA 1H2HA 2VAWA 1B4DA 3MN1A 4MEBA 4UHBA 3T5DA 3T5CA 2VT6A 3IQDB 1I14A 5HTKA 2R5WA 3IBTA 1ZJ6A 1SXJB 4EKYA 2WG0A 3KELA 1WSBA 4UU8A 5BNFA 4B0PA 3GGJA 4PO3X 4BU1A 1PJTA 2GH1A 1QP4A 3WAKA 4P35A 3K9HA 5DWVA 3PEUA 3T35A 2AJBA 1N57A 1U11A 3DZHA 3PHCA 4HGYA 3SEZA 1G3UA 1HQDA 2P41A 1LXCA 2NACA 3THSA 2Q0HA 2DLDA 4B84A 3PKIA 1AS2A 2BZ1A 2AE1A 5CLIA 1GU0A 1CUCA 4KAAA 1H2RS 1QO0D 5ADUS 1T0PA 2Z3WA 3HNOA 2XQKA 3K6SA 1RLUA 3RVBA 3AB8A 1QTQA 1U8FO 4H31A 1P60A 4O1MA 2F8LA 5ECYA 4KR2A 3HDGA 2GK4A 3R5SA 5D3ZA 4FMCF 4KBFA 3RRZA 3VNVA 4F1WA 1JEQA 4JLOA 4MYUA 4M9CA 1NDQA 3FCUB 3GARA 1C1YA 1XMPA 4MB6A 2PCLA 4XVQA 1G6Q1 1IY9A 1TQDA 3B2EA 1VYUA 4WPGA 3EDQA 4CKYA 4P5DA 2NU9B 4C20A 2Y1GA 3OWXA 1GG2A 1XYGA 3IP5A 3DXFA 1BYIA 3QX7A 2AZXA 4IUYA 4YAUA 2YBEA 4XOIA 2FLWA 1Z0IA 4J1TA 3HI4A 3I52A 1Z4NA 1M8GA 4B4KA 4AKTA 4H7DA 4LXHA 4RZUA 1UJ5A 2DERA 3GAZA 3H5WA 5HF8A 4IH4A 1RC0A 1UJMA 1US8A 4MWGA 1CQJA 4E03A 3GPLA 4NPAA 4UZFA 4FS3A 5DM1A 2V74B 4RPIA 3H3FA 1DWOA 5G0VA 3OLQA 2V4UA 3T06B 4IIVA 2HJGA 3LA6A 3R23A 1L7AA 3SC6A 3OZIA 2XYHA 1U81A 1K9SA 4ALJA 3Q8LA 4D8TA 1N36B 3TLBA 2J3DA 2R8BA 3QY9A 2CUNA 2K7FA 5DHQA 2A57A 4UEJA 2WB4A 3KR1A 3EYAA 4FGZA 4HS4A 4ZVOA 2F55A 4Y9UA 2DUNA 1W36D 1S4MA 3KE9A 3GXOA 1F5NA 2JAHA 4IJ5A 3VR6D 4AUMA 4X60A 1NWCA 2GZ3A 2YHIA 2AJ8A 4C0QC 4LBYA 1RRMA 4ZK6A 2HH9A 1Z75A 2IOFA 2J45A 5DIFA 4P98A 4UHKA 4JL8A 3LXMA 4PFSA 3RSQA 4MKRA 1AGXA 2GPJA 4YUVA 3RRYA 4X62B 2QQ5A 3BWMA 4QUEA 4BNTA 1LV8A 1XELA 4CMEC 5KYWB 1CQPA 2OV3A 4MVWA 2NXEA 2AOXA 1NY6A 5JLAA 4MJLA 1CC1S 2BSXA 4RPGA 1A7UA 3AV3A 2VQSA 4WZBB 2RGXA 3QIVA 4JJ6A 3A32A 1H8EA 2ET6A 2JIDA 2OZEA 4F6CA 6REQB 5G4LA 1XYYA 1ZVVA 3RU3A 1LSSA 3LXRA 5CAEA 1DJQA 3HWSA 5FTKA 1RACA 4OUKX 5AXBA 3VC1A 4RTPA 1E62A 2YWFA 3D3EA 1JF8A 1FFXB 1UBOS 1X7HA 2I1WA 1GL3A 2HQSA 3DZBA 5FL7D 3TYXA 3W1VA 4AZTA 2D8MA 3IR5A 1U1GA 3W6ZA 4LNUA 1AKVA 1F6DA 2FUEA 4BFLA 1UJCA 4UXIA 4YXFA 2VT7A 1EP9A 3T7KA 3IQZA 2QXTA 2DTXA 1SXGA 4LJYA 3DS8A 1AH2A 1UEJA 4Q6WA 3K9LA 1APBA 1T36A 3B78A 2AMJA 5AHKA 2C9MA 4WKPA 1JHDA 2WJGA 5HKKA 2WNSA 2QM8A 1IN1A 4HN4B 4KGZA 1ZUWA 3OQ1A 3TMYA 1ONPA 1RWOA 3D8BA 4IEFB 3UT6A 4Q93A 4ETWA 2EIHA 3FROA 1NVAA 4UCFA 1CPYA 1Z0KA 1ZJWA 1JR3A 2ZYDA 5ALHA 5KTPA 1N6KA 1N5RA 3G5MA 2ZRAA 3PQ7A 2GOYA 3F9IA 1SBCA 3O8DA 3O82A 4I36A 1IVYA 4YGXB 3ED5A 5FUBA 4B81A 4LWPA 2NX2A 4HFMA 4JITA 4F04A 4DLVA 5AXDA 4DVGA 2QLLA 3A7DA 1QDLB 2OQIA 2VDUE 3PS9A 4URYR 2A9RA 3JCZA 2VK1A 1U7HA 2ZTSA 4HP8A 5CRIA 2YHAA 5J5CA 3ED1A 3N0TA 3WKBA 1MBZA 1Y4UA 3ADBA 2AQKA 3BH7A 1QIGA 1YE8A 2C2MA 2YX1A 4H6WA 4I4TA 4QU9A 4E2YA 5HGXA 2VOEA 2MSEB 5F7JA 4DUZB 3KEQA 3OICA 1N2HA 1L5VA 2XWJI 3C41J 4GPZA 1MAUA 1ZS9A 3Q0EA 4R84A 4RW0A 1PZFA 2ZYUX 1CW2B 3VZRA 2X0JA 3BWYA 1ECJA 3G49A 3VU8A 3CVXA 4YB8A 4D6XA 5HMMA 1Q0ZA 2C77A 3CRW1 4XASA 2C00A 4B45A 1WEKA 2PG3A 4NCHA 5EE5B 3WGQA 1V45E 2DSTA 4X00A 3WKDA 3GJYA 4AURA 3AR8A 4IKPA 2WDPA 4Y2JA 5DU2A 5FOXA 5LPNA 1XQ1A 3DVAB 1GZHB 5TQVA 3VNAA 2VUSA 3L0CA 1DC8A 4O4IF 6ADHA 2CVOA 3HJBA 3MT7A 3ND6A 5IT4A 2H48A 1Z73A 1X8LA 2IXEA 5HOEA 5IFLA 3UJHA 2Q8NA 4QDKA 1KQFA 1B76A 2IODA 4JJEA 1XE3A 2OFFA 3R9IA 2FVXA 4M53A 4MUJA 1AMOA 2JFGA 4I46A 5IM4F 2OCXA 2FZ4A 1YZVA 4A0RA 5M7EA 3DV2A 2WYHA 1U2SA 2HBQA 3H5IA 5HVNA 2R7MA 1JEQB 1RHMA 3EIFA 3QQ5A 5LB2A 3RS2A 4YMGA 4M0DA 1XEXA 3ZQJA 3DG9A 5DE3A 1K7EB 1RAIA 3FFTA 1WU8A 1N4DA 4DSTA 4FWTA 1DAHA 1ZGJA 2BHLA 3KQYA 2GHQA 2CFIA 1WDLA 2C8VA 4A5SA 4X64B 4KPFC 1BQ3A 5BNZA 3QX9A 2KJQA 1WQ4A 2BKAA 2WHRA 5AK4A 2ZDQA 3QVSA 1EUDA 3FPJA 3REOA 4D4KA 4QUGA 3UUGA 1P39A 4NBNA 1US8B 4S1WA 2CJPA 2PZGA 3B2NA 5G40A 3U56A 3GLHA 4D9BA 1OY1A 3C43A 5ECDA 3BE4A 4G4JA 5JBNA 4MR7B 4B7XA 2FSPA 5CITA 1Z26A 1UMBA 3DLBA 3R2JA 4M1SA 4QO7A 5F7XA 2ZIWB 2WBLC 1XRLA 4MS3A 3KLMX 3UOAB 1FSFA 1NUPA 1NVUQ 5B36A 3VZDA 3T7EA 3EGVA 5F9MA 3ZS9A 2HIHA 4FFMA 3ZVMA 5AJYA 1HDYA 1TFRA 3RTCA 2WAMA 2W2LA 2E4UA 4PZDA 4WL0A 3JD0A 2Z2JA 3OSZA 4KH1A 3H2IA 1S8NA 4PSCA 5FPTA 4PPFA 4HD8A 4AS2A 1JHVA 4PWZA 2XCRB 3W1WA 2GBPA 3VH3A 2P9HA 4ZAVA 1QGED 1O97D 1PI3A 1SQFA 4RHEA 3RQIA 4F06A 2ZSFA 4GHWA 4KO4S 4OHZA 4FB4A 4YQEA 2J32A 3A9RA 4KUHA 2OLJA 2HMTA 4WLVA 1NNLA 4LEIA 4CCSA 3H17A 3RVLA 1Q44A 1ZRNA 2YMLA 3BICA 3L79A 4U7TB 3CVWA 4L57A 3ABOB 3HKCA 5TS2A 1NM5C 1P3JA 4KXQA 2D5AA 2G08A 2J09A 5FPHA 1FTYA 3QU4A 1IFXA 1VDZA 2VDJA 1YONA 3KXIA 5I7AA 1PHRA 4LNUB 1RWXA 4NQRA 5F12A 3C1AA 3U0VA 3PUZA 4I6JA 1F0NA 4RMJA 2X2PA 1DKQA 3QOFA 4J7XA 1NVFA 5IAOA 2PGIA 2GN1A 3ITDA 5FAXA 3DEYX 1RJ9A 2C7OA 4TUYF 2EQAA 3GWZA 1JMVA 1T36B 4MARA 3N2LA 2HZBA 1NRXA 3AM3A 4M0FA 4M88A 4ZU1X 2ZWMA 4PAQA 2XA1A 2XIQA 2BEWB 4TMYA 1Q17A 1DO0A 3QFRA 4W4TA 2VYQA 1HE8B 3LO8A 1UAYA 4EFLA 1PG2A 1JDNA 2YN0A 4ZVMA 4LV5B 2AFHE 3TAHA 3LBYA 1XXLA 4JYZA 2B0JA 2SKDA 4REOA 5JYBA 1NBIA 2PLAA 3PWZA 4XFDA 4YVFA 1I7DA 1L7XA 5I7SA 3RU9A 5ETJA 1U8CB 1Z06A 4YRDA 1PGPA 4DV7B 2QI9F 2JAOA 4WOPA 3L4BA 4KXYA 4MAMA 2ON6A 1ACMA 1TCCA 5I45A 2G7ZA 1KZHA 3FOEC 3IX7A 1I0IA 1M8PA 4PX2A 1YJ8A 3BF7A 4RKEA 1K66A 2JCXA 3NEAA 3TUZC 1WBDA 1UBNA 3GU3A 2PVSA 5DX8A 2XLBA 3I73A 3ESAA 4I4TB 4Q4JA 4RF2A 3SOZA 2PWBA 1MJFA 2A7XA 2ZR9A 3NS7A 1N2EA 3ONFA 4JJ4A 5GPBA 1X0VA 3QELB 1GUDA 2GYUA 2E49A 4P4UA 1N32B 3ZY5A 1NIPA 1M2VA 2FW0A 3H9BA 2E85A 1GR1A 5JXWA 1CR6A 1E2LA 1GHTA 3IAHA 4AG5A 4F86A 2YXBA 1TAUA 3TTUA 5B30A 1XU9A 4BQOA 2XQGA 1VQ1A 2H51A 1EQAA 2ZAYA 1DG1G 3B1ZA 3DO8A 3I1YA 1OXKB 1DIRA 5JPIA 1MJ5A 1RKBA 2DBRA 1MB2A 3BFPA 1R7RA 2OFWA 3BZWA 2Q21A 4POAA 1YB7A 3JZDA 4C1BA 4D2IA 3IOCA 1U99A 3FSJX 1TF5A 4MSUA 3U3XA 2QNBA 4ZYUA 5C7OO 3U9SA 3KQMA 3R7LA 3WLSA 4R4JA 2AXEA 1LKZA 2P4SA 3E2PA 4CR7A 1QVRA 1W1UA 3DFIA 1DKNA 1N7GA 5T41A 4QJ4A 4HRVA 1X6VA 2PFGA 4JKOA 4QRIA 2GO7A 5E9JA 3U3MA 3HO6A 1DUSA 1XEXB 1KI6B 2QR3A 3ZU5A 5JG7A 5HKLA 5CR9A 3NMUF 1H2FA 821PA 3ZWAA 1SB8A 1NYQA 2JB9A 3BKWA 4W99A 1PEYA 1E1YA 1JRLA 2C9DA 2EG9A 2FI1A 1RHUA 2YYZA 2QRGA 3OD5A 2GZRA 4L8FA 4AU1A 4ARZB 521PA 4Q1BA 4BB9A 4C0LA 2AHRA 5MN6A 3S8EA 1EUDB 3GZNB 4C03A 5HE9A 1KPGA 1N6PA 1W8IA 3IHLA 2W7TA 3MJHA 4JUFA 2W43A 4CTMA 1DZIA 2DE0X 2PUWA 3GLHB 2QW1A 4INJA 1PT7A 3DTYA 1VG8A 2BFBB 2JA2A 4A9AA 4IIJB 5FRDA 2FETA 2PMCA 2CNBA 5AKIA 2DETA 3O94A 4FZRA 4K9SA 2ZRHA 2YW9A 2FMUA 2IXFA 4AQYB 1WY5A 1NP7A 3K9NA 2DBYA 4PO1A 2AUNA 2ZSUA 4PRKA 3WNCA 3C1UA 1YUBA 3Q85A 4MS3B 5ES3A 2ZVPX 1FDTA 4Y2UA 3GLGB 3BD9A 3S7ZA 5AVOA 1VCMA 3KUCA 4EJFA 1RSZA 1YQUA 1PR2A 2CDNA 1QGOA 3DDZX 4R16A 1TM1E 3SHFA 3TG8A 2D74A 2H8GA 1IJBA 2OYSA 4YRNA 4A82A 3MJEA 3O38A 1EFRD 1ND6A 3A2KA 1R8SA 1H22A 3FGNA 4RXMA 3VXKA 3N53A 3ZCRA 5EVCA 2GAFA 4HPJB 4ZT5A 2KI5A 2JLYA 4MYHA 3L7AA 4MHOA 3N8GA 5KVVA 3IQXA 4L3WA 1NU8A 1Z0AA 3SKXA 4UM9D 5AMXA 1ZY2A 1NW6A 1GAJA 1KY5A 3A9TA 3DCNA 3GX1A 2VZ9A 4MV3A 4ND6A 4W8GA 4MEAA 3R3YA 4UNIA 4ZQFA 3DDNA 3HCCA 4J0IA 5EP2A 3HKCB 1TO6A 1G8KA 3JWHA 1P0FA 3KHUA 4OQQA 4URHA 4JN6B 5SZHB 3R8FA 2W6JD 3RUHA 5INTA 3HLTA 5E0KB 1T8RA 4CNBA 3F3MA 3O4GA 1DKUA 1F06A 4GL4A 3Q2OA 1TYEB 1WW8A 5DHPA 1H2AS 2BMFA 3EEIA 1UM9B 4HWGA 3O4FA 3T5TA 4POOA 2HLDD 2JLCA 1K06A 2NO9A 2A94A 4J9VA 1X92A 4MP8A 4RIGA 1RJ9B 3K6JA 1OD6A 1F4PA 4CG2A 1N2XA 4M7WA 4QOIA 1W75A 2PKWA 3E27A 2X0IA 4QU0A 4ZQBA 3E9DA 3GVPA 4UEKA 4MW4A 1M1YA 1K8ZB 1THTA 3A2LA 2PY6A 3KJZA 3LKVA 3WOVA 1M0WA 1WM1A 1AV7A 4E3WA 1QO7A 4XDYA 2PGAA 2C3OA 1GT91 4KQCA 4JI1B 4DN6A 5CIYA 1BVHA 3L2OB 3AX6A 4JQOA 5ESDA 3ELBA 1NOJA 4QAJA 5F1YA 5A06A 2HSDA 3BE8A 4JB2A 3P9YA 1CEEA 3D7RA 3G0BA 4OCZA 1SEVA 3KTOA 1KNQA 2A0UA 3E9QA 4I2NA 2PKEA 2PKCA 1E99A 1T1JA 2W2VA 3CG4A 4G4SO 2WF6A 2HNBA 1SHUX 4QELA 1ZIXA 2Z08A 3P96A 5FI5A 4Q9KA 4EA6A 2WMYA 4Q4JB 3RS5A 5AW5A 3OPVA 3EC2A 1PWXA 2P77A 1JQAA 4DAEA 1FX0B 2Q1WA 2W6IA 3ZYZA 4PF1A 4AF8A 2RIRA 4YGYA 1CY2A 1XZMA 1D2EA 4JLPA 4N5MA 4EJSA 5KHAA 5J3JA 1XK6A 1XMJA 2IYOA 2IZ0A 1KK0A 1BN6A 1MX3A 3OY2A 4IXMA 4X3PA 1E2MA 2YWJA 2QXYA 2GHIA 3P2IA 3VAYA 3SI7A 5J59A 4TYMA 4RGQA 1P7YA 1U04A 1KIAA 3BMCB 2IE0A 2XGGA 4MQ4A 3QUQA 4PBTA 1E6CA 2VJNA 3CNLA 3LF2A 4AQDA 4MUXA 1SC6A 1ORDA 3B1XA 3QRWA 2XZLA 4BO6A 3F2IA 1XR3A 1YNSA 3C2QA 4GKKB 3EZGA 3TH5A 1U65A 4D74A 4JBIA 2R7LA 1KFKB 3RYHA 2GVDC 3LGXA 3KOUA 2PJDA 1U63A 2PWPA 1GGEA 3T1YB 2C1ZA 3OPXA 2EEPA 1J2RA 1TKBA 4BHTA 3LGAA 4ZVVA 5KDLA 1YTUA 4DSUA 4RA6B 4IY1A 4EIWA 2HWKA 5C7LO 1KFBB 2LCIA 1QV9A 3LU1A 3UYLA 2NU7B 4PQRA 3FHCB 2I8AA 2BMAA 2OECA 2VDVE 1OH7A 3CRNA 2E7ZA 2Y4NA 1UFOA 3LK7A 3LC2O 2JF0A 2FPLA 4AX4A 2V03A 1YRQA 5FFFA 2YYSA 4RHTA 3FLAA 4GR5A 2YIVX 4X63A 3NBMA 1LDBA 3UT0A 2COKA 2XJ9A 1AN9A 3DWFA 3L05A 4P3XA 1Y1TA 3VR6H 1U2DA 4BC1A 3TIGA 3L7NA 5AIBA 1QLWA 3LLVA 3AERA 3KTDA 4G37A 4ENUA 2FEMA 2BBTA 2D0OB 1QIEA 1WULS 2G0TA 2BGMA 1BEZA 4KACA 5HCIA 3SX2A 4OBBA 4AO8A 4RIEA 5KOYA 3OX1A 2YKGA 3IAM1 5HYVA 1SG0A 2KHZA 2G5TA 1TQ6A 2NSHA 4XRGA 1Z9BA 3RTBA 1XX6A 3V7WA 1TUIA 3K96A 3IEXA 1JE1A 4FYIA 3SFVA 4UJ3A 1E6WA 5FTMA 1OMOA 3JQGA 4CFZA 1LSJA 4NYMR 4DCVA 2PLNA 5C4GB 3KT3A 1G6OA 2BGNA 5C8YB 3ZIAA 2IGTA 4L5CA 3K30A 1TUEA 3J81k 5DLDA 1DTEA 5J4YA 2P27A 2GT1A 3EXHA 4ZI7A 2QSJA 3OCJA 1NHGA 2BGKA 3D4OA 2JG3A 1KSGA 2IU0A 4Q3OA 5JFOA 1YQTA 4QPZA 1C9KA 2HIAA 4JUAA 1P1KA 2N47A 2WAYA 1RBZA 1SVUA 2YWBA 2J0SA 4U7DA 2FUG6 2O2HA 2PD6A 1KZ7B 1NA5A 2O7VA 4AN1A 2HT1A 4XVRA 3GHHA 4Y9TA 2V0NA 5LQUA 2PZMA 3RRMA 4X24A 5ESXA 3VFDA 2QOEA 4F6LA 4N6NA 4TMVA 2J3HA 4DV0B 4IOJA 1CDEA 2MYTA 3B1YA 5EZ6B 5ELMA 3RBAA 4G5YA 1ODKA 3UK0A 1MV5A 3OIWA 3VR4D 1MGPA 1RYDA 1ADFA 2AG1A 3PC6A 1LCIA 1ZICA 5TVKA 4B8ZA 1G38A 5AKJA 1SXJC 1ZRHA 4QQFA 3LVQE 4JA0A 3RF6A 1IHYA 1AD2A 3RTEA 3AF5A 3ZBUA 3KDAA 3MERA 4IILA 4B9EA 4ER0A 4AJJA 3CVUA 1U8XX 2E5FA 4U7HA 4M2LA 1XTIA 4PTZA 4DGSA 3UHPA 3WLHA 2CB9A 1FFWA 2R5NA 2ZRFA 1W0KA 4TM8A 1SHJA 2I4NA 2H9YA 3NATA 1ZD5A 1M2KA 5GJVC 5CB4B 3H0CA 4NMXB 3LG2A 2P6UA 4WKGA 5U4XA 3REGA 1Z6YA 4RGYA 4NE7A 1Q6YA 3IVAA 3TM5A 1IBRA 4MKGA 3UMCA 3ZHRA 3LBNA 5IHPA 1UXHA 2W48A 1AKNA 1DHTA 2IV2X 4QJ3A 1JHZA 1P7ZA 3FVRA 1XO1A 2QN6A 5HP4A 3QEKA 2VTVA 3CE9A 4G41A 1EFPA 3J80A 3HN2A 3U6BA 1IPEA 1DBRA 1UJNA 4BGDA 4FR0A 3QE9Y 3OLYA 3VKUA 4ZCMA 1G1MA 3SIRA 4IDQA 4ZOCA 3FYTA 1M1ZA 2FA9A 3GEPA 3GLIB 2OGUA 1JAHA 1PKEA 1RAFA 1ZSNA 4HDKB 3EIXA 5BQPA 1XZPA 4F8EA 1M2WA 4HYYA 1VL5A 1P0QA 2XDQA 4IZHA 1DS6A 2IEIA 4IG9A 3PHJA 2B4KA 3E7XA 1FP4B 1VGVA 4GXQA 4XLZA 3DYVA 3LDAA 4MW9A 5H59A 4J1NA 2VRBA 1P4RA 1FYVA 3RAPR 4B3HA 3L02A 2EJUA 3W04A 1W2WB 2C29D 4MI3A 4FQ7A 1XHLA 4TWRA 4TGLA 4MS4A 2VC2B 1II8A 3NHKA 4HMOA 5EKXA 1ZA1A 4F0JA 2O07A 3VH4A 4P7KA 1ZRMA 1U8YA 3PQEA 3GPCA 3O9MA 2O8CB 2OP1A 3TD9A 5J23A 3OEED 2GPSA 3HJFA 3RYHB 2G1PA 3B36A 2Q7DA 4AXBA 1PWHA 1EVQA 3CO0S 4D9EA 3GNQA 3QWIA 1ND5A 4H7FA 4BKQA 4N03A 1K98A 3L7DA 1KH2A 4GAEA 5GAJA 2E4ZA 1ODSA 2NYVA 4QGHA 1V8OA 3I2IA 1YQ9A 1SBZA 3IERA 3RRXA 5FBQB 2MTBA 1R74A 2AOUB 2KBFA 2CUZA 1MT3A 2YY5A 3CLVA 4U9UA 2JI7A 3C8UA 3D3WA 4DA0A 1XTBA 2X3FA 2XMPA 2QYHA 4Y67A 1XALA 5FWYA 4TMFA 2VNIA 4NYJQ 5T64A 4WZZA 3D8UA 1XTVA 4K3UA 4OI4A 3ICWA 3HMQA 4GZLA 5DX0A 2D1YA 1AA6A 2DHDA 3DMDA 2B8NA 4R1SA 2OL4A 2DTEA 3H42B 1BW9A 1TJPB 2ZRLA 3AERB 1GZVA 3VTAA 4B2YA 3RVMA 1P4HA 3ISVA 2JGEA 3R7FA 5G1OA 5LP6B 4GWLA 3UMMA 2BJWA 5K0GA 2O3QA 1LRJA 3LDUA 4NABA 1FFAA 3RH0A 2AI2A 3A28A 4DYVA 3HVHA 3GA7A 5KJCA 3NYRA 2FPIB 5LOVB 3G5LA 2QRKA 3OUTA 4WXRA 2CD9A 4FCTA 5E1DA 5E3IA 3WRVA 1RKVA 3F4BA 4I9HA 3GEBA 1OPRA 3ZGLA 1WB5A 4CIBA 2P7IA 2GEKA 3JATB 2NADA 3CINA 4F8JA 1SQ0A 3HJRA 1KP2A 3C15C 5M29A 1C7IA 1PP4A 1YRBA 3FMPB 2Q5EA 4TTSA 2IV7A 1YVRA 2C4TA 1X1DA 1XKQA 1XZQA 4FOPA 4YDHB 4RMNA 1C3EA 1TIKA 2K5UA 3SC2B 3TTTA 4KDFA 5C1OA 5JS6A 2XBMA 1DX9A 5T6MA 1L9XA 3FTEA 1EVEA 4D4IA 2G82A 4PX9A 2R44A 4L15A 4JQZA 1HFKA 1XMVA 2BEVA 4P58A 4NU8X 4BL5A 1B41A 5JC1A 2R84A 3BA6A 2GJKA 4YASA 1IVNA 1T5DX 2DM6A 2QTVB 2D7DA 1C7ZA 5JNSA 3TN7A 1GSOA 3AF0A 2N1BA 4PG8A 2PTGA 2F67A 2WHPA 1OFUX 2YC4C 3BIJA 2XZPA 3C0KA 2X1HA 5TY0A 2OM2A 4OF4A 3TKLA 2XDYA 1LDYA 3U3DA 3ZW9A 1VG1A 3V1YA 4Q5IA 4MGZR 5TSDA 4C88A 2BCEA 3QJGA 3WJAA 3GLGE 4BFVA 1HLDA 1UK6A 3SFTA 4KE9A 4MVJE 5GADl 1HI9A 3P52A 2J59A 1TYDE 1DWPA 2O7SA 2XNHA 4GRIA 2BBWA 4B8YA 3U19A 4OBEA 4CDRA 1JIIA 2GF2A 1FS5A 2J0UB 2XE6A 1SR8A 4LHWA 1JV2B 5PNTA 3RVSA 2P4UA 1IMJA 4D9CA 2XAAA 1UT8A 4M9RA 2I03A 4WUTA 3T9CA 1U94A 5ALKA 2OFXA 5DNYB 4YP1A 2N75A 2Q99A 3AM5A 3CUSA 5AW6A 3R0VA 5KHOC 2ZGVA 5CG2A 2JI6A 3Q7IA 2WFMA 3W5SA 5J2TB 3CF4A 5AI0A 2V6JA 5BUSA 1A2KC 3O2SB 1EEXB 2P9JA 5JOQA 4YT5A 1EFPB 2JLZA 1JAYA 2AT1A 3M81A 4ABTA 1YQEA 1I94B 3F74A 3DDWA 3TLEA 3QYAA 4MV7A 1ZIOA 2UUBB 2CWDA 2ZIAA 1PX2A 1CR1A 1D2AA 3WDMA 1COWA 2RSLA 3T7CA 4BJ6A 4YR9A 1NJSA 1XI2A 4GLFA 1GTG1 1UXJA 9MHTA 2J3EA 2YMQA 4US1R 4ZI3A 3TQCA 1WCWA 4B5LA 4ADSG 4IDOA 2Y76A 7YASA 2O20A 4PPNA 4PZ9A 3OCWA 4Q21A 5BNIA 1QFZA 3OZCA 1LDMA 4NYIR 2M6SA 4A15A 1N9ZA 1K3TA 1L4BA 2B36A 2NO4A 3AWIA 3DHNA 3H8WA 4ZO6A 2GD1O 1AOXA 4DWOA 4J1TC 1H2WA 6LDHA 4NICA 3ETNA 4QA9A 1THZA 4C7JA 3VOAA 4L4SA 2AFRA 4GPBA 1OIWA 5ALVA 5J1SB 1CZUA 1GNTA 2H54A 2P2NA 2ZI4A 3DDCA 1II8B 4Q18A 4UHEA 2JIZA 3SIPA 3W8EA 3K09A 3ZY4A 5JH7F 4MZXA 1DFIA 2G17A 2WV9A 2VK4A 4IDGA 5ICEA 3OOJA 4B9AA 1LPOA 3K0SA 4Q7JB 4C3VA 3FG9A 2HBYA 2OBLA 2WYWA 3HHEA 1FMLA 1H6BA 4WBNA 4F91B 1ZGZA 1DC5A 3Q8XB 1ZSVA 4AJ4A 2G06A 3WHPA 4YV2A 2JGLA 1B23P 4L85A 5FUQA 1EINA 2D5IA 1G5RA 5HGJA 4EL0A 2C9YA 1RWVA 2XCLA 2BD0A 2ETVA 2JGAA 2VSXA 3DXZA 5D5QA 4RKQA 4TWAA 5A05A 3V1MA 3WV5A 5HPYB 5D6OA 1CD5A 3HXKA 5E9WA 2QPTA 1HEIA 2V3CC 3UJ9A 4RF4A 4DCGA 3H1TA 4DREA 4LJ5A 1NX6A 2EJTA 3ZR4B 5AKXA 4LX8A 3D3WB 2XCOA 3NM5A 5C53B 1XU7A 3HL4A 4GMHA 2JZOA 4KSCA 4X84A 5FWYB 2LTAA 3D1LA 1MX5A 1A8HA 3ZJTA 4N41A 2GWHA 3BJZA 3JQAD 2FN9A 1YQXA 3F2VA 2CW5A 2EZ9A 1BX3A 4M55A 4OQXA 4OU5A 3JRXA 1QAOA 2OHJA 4PAGA 3F96A 4CQNA 2HHHB 1KIMA 2A5DA 2HJRA 1EG7A 4DWVA 2ZANA 3KQUA 3I9V6 3JALA 3UTDA 2GXAA 3MJDA 2JGKA 1E0AA 3WMFA 1JZTA 3OF5A 3O1IC 3MYRA 1TECE 4RLFA 1T3TA 3SLKA 5DXAA 3K5HA 2G3YA 4Q48A 4TQGA 2GPNA 1FCJA 3RC9A 4TKZA 1KR5A 1L7EA 1ZNYA 4MVCA 4RK4A 3K70B 4GLLA 4JUIA 1JPVA 4UCXA 4YDRA 3QI2A 1K8QA 4MYCA 1N6OA 3W6NA 1NVVR 3C85A 3CPEA 4BFXA 4N3AA 1AGPA 1QCYA 1SH7A 3FNIA 3WDKA 1IK6A 2I9PA 3IAAA 3P9XA 5L3VA 4ILKA 1HNZB 1LTHR 3BXZA 1PYGA 2C2XA 4Y1EA 3HNRA 4PYRA 2JI4A 3HXQA 2ZIEA 3T0GA 1KEKA 3IELA 1DEXA 5AKYA 3OJFA 4ZT3A 3VR6A 5JYCA 5E4JA 2BEVB 5KPJA 1BS2A 2O2XA 3I09A 1L5MA 4Y9SA 5FADA 3JQRA 3OU6A 5HW0A 5ELXA 1Z3IX 3OZVA 3Q0TA 1QYXA 4HGQA 2B8WA 3BVPA 3OY7A 1RZRD 3ZHCA 2BDEA 3OIGA 3SZ3A 2CJXA 2PL9A 3W5CA 1YRHA 5AESA 1N8SA 3Q8MA 2XKJE 4KU4A 1ZD3A 3P4XA 2XDWA 1F4LA 2PBRA 3HR4A 3NBYC 4TXNA 3W4JA 4WTOA 1FLNA 4D9KA 1KBQA 3OQVA 1LNSA 4DB4A 5C8ZA 3VKGA 4LZPA 1VRVA 2ZIXB 2C4VA 1CY0A 5EJMA 3ONNA 3ICCA 3T3IA 3H0EA 3KS9A 3INYA 3UJPA 1JGTA 1XD8A 4G97A 2ZB8A 1E2NA 3GGPA 4Y1GA 3DVSX 4CU2A 4JGBA 2EQBA 2PX8A 3LA8A 2XE4A 1O6FA 2Z6UA 3QV1A 5ERXA 5IDYA 2UXBB 4B3CA 4BNDB 2BGWA 5EXDA 1RM4A 3FTFA 1FRQA 4AZ3A 3Q3IA 1K75A 1JVSA 2FEAA 3Q41A 1N1GA 1Y5IA 2DMRA 2DR2A 5AFSA 2KM1A 5ARBA 2BP7B 1YV9A 3IS3A 2IUSA 3NXSA 4F4FA 3TI9A 3W5IA 2C2ZA 1JG7A 2JASA 2LE0A 2VAMA 2W8ZA 3OFND 2JH8A 2ZETA 3Q7TA 3VKFA 4JBWA 1J2YA 2X1MA 3JARB 1TTHA 3EVNA 3LCCA 3WS7A 3C7CB 4TT3A 1VKOA 3NEPX 2VP6A 1V7QA 5BWCA 2XBUA 4NCAA 3QLTA 4HAVA 4BB6A 3HXTA 3BYZA 1F1JA 4NAVA 3TKAA 3TZKA 3ADPA 4ZGGA 2ID7A 4D9NA 3V2IA 4UUQA 4PAOA 4HVCA 1TJ3A 5LM3A 2EARA 2WF8A 1C0IA 3A4NA 1XTJA 2C5GA 2V7WA 4MJXA 4NNPA 4DCCA 1MA0A 2AZTA 2M1XA 2FEPA 1A9XA 2Q6OA 2BMVA 3DOOA 4QVIA 5GTDA 4Y6RA 4LJ4A 1ULTA 5HE8A 1GQRA 1E7SA 1HZZA 1VSVA 3AFIA 4IR7A 5FBHA 1L6IA 1SOVA 1N0WA 1YA8A 2D1TA 2OGSA 2XTZA 4Q9NA 1WP9A 3MBOA 4C89A 2WPNA 1ZDMA 3MWDA 3N59A 5A3VA 3FOZA 3MGGA 1CRLA 1TM7E 1MV8A 1U9IA 1J42A 2QP4A 1KMHB 1ISJA 2WFZA 2X7HA 1SXJD 3F8SA 4LGCA 2A78A 1NQWA 2H7CA 3O0TA 4LXIA 5EE3A 3ZCXA 2WWIA 4DA4A 2H1WA 2Y1DA 1J0DA 1DBVO 1RPJA 2IY7A 3ETJA 3GJ3A 3UB4A 2YHUA 3QUAA 4KJXA 4PLYA 3GLIE 3UUFA 4BP3A 3UVEA 3WK4A 2I1VB 2JJQA 2ORYA 1A5TA 5H80A 4D6PA 5HOQA 2HI0A 5IC4A 4LJLA 4L3VA 1T0BA 3OCCA 3HYRA 5GWXA 4DMUB 3DH0A 2O0KA 3G23A 1GGFA 3IQGX 1JLKA 1GNRA 5K3DA 4B44A 2XD9A 1Z2PX 4IO1A 1RHRA 2A0XA 3UY4A 2VNHA 3CZPA 3OOEA 4GGMX 2V4MA 1MPXA 2IHUA 4WXHA 2VBCA 3UEOA 3ZXIA 4EFDA 1RYYA 1PTKA 4NC9A 4QARA 5LU9A 4C43A 5IN5A 3WDSA 1KEWA 1P5JA 1TCAA 3QF4B 4UAGA 2PRKA 3TL6A 4JJ8A 3SJAA 1V8ZA 1VJ1A 4L8YA 5TLSA 1JR2A 5E1BA 3AR3A 3G1WA 3KT0A 5I7OA 3QKUA 1CY4A 2A1UA 2WT8A 3JALB 2B61A 3W0LB 4X44A 1HYEA 5GVSA 1MOZA 4K8RB 3F49S 3QPAA 4OQMA 4X7BA 1GNLA 5JZMA 1I7NA 4WOBA 1E1CB 2X9QA 3MWEB 4JCOA 2Y4OA 4I3GA 4PSKA 4PZUA 2CNDA 2QJRA 1J23A 1CZNA 1NI3A 2CY0A 5L8VA 3JWPA 1B2RA 4G8JA 1ONBA 1TMKA 2X0KA 4IGKA 5JRZA 1P0IA 1L4KA 1YRLA 2OORC 4P7JA 4RSGA 3TPFA 4E14A 1HL3A 1GQQA 1QLJA 1J8QA 2CNWD 3DXYA 3H9CA 2WTXA 4JXJA 3RSHA 2UZIR 4L5BA 2HA0A 4A0SA 4AZ0A 1KJWA 3CUTA 3IP9A 3MMSA 2CFCA 2QROA 1FS4A 5C35A 3WIDA 4IWNA 1DIBA 4BKPA 4CLOA 3O93A 2PZKA 4EJMA 3CSUA 3WMXA 2Y0EA 1WUKS 2RBGA 4UTZA 3OPMA 1Z5UA 1H8HD 1HYQA 3HDQA 3IUEA 3MJRA 5E4YA 5LQAA 1VHQA 4RGVA 2I0FA 4CLRA 3W5DA 4NDNE 2PYDA 2EF0A 3FMFA 5ECGC 3GT7A 1IM8A 1AT1A 5TMDA 2R1UA 5EXSA 1XBTA 3F6PA 2OPHA 1W5EA 2G9QA 2KPOA 3GRYA 3NRBA 4PICA 1XZGA 3L4BC 1V41E 1E9DA 2AC7A 2CT8A 2CZCA 4ER7A 1UBLS 4ARAA 4B17A 1V47A 3ZOKA 3PJEA 1FNDA 4YIKA 3CKKA 2ZM6B 1UDCA 4P4SA 3VAAA 1E7WA 3JQ8A 4FMCB 3H5LA 1ZGHA 1Z18A 3V33A 5JCZA 2QE7D 3FDXA 4HVAA 5C52B 2HPAA 1GQYA 2WJWA 3ZY6A 3D7LA 3ZCPA 4QDOA 4LF4B 4RTSA 3CHYA 2ZWVA 4II3A 5ILOA 5CK4A 1FUEA 1HWYA 4Q1CA 5DBOA 3INTA 3QMPA 2JLSA 4TQ9A 1XMSA 1U0TA 1AN0A 2Q3CA 3C7AA 1ZK0A 4DQ0A 2HLHA 1RRKA 2VQEB 4LYHA 1L8OA 1X86B 1DAFA 2CCGA 4WDRA 4TXJA 3SBOA 2PKQP 4E7PA 4G36A 1URPA 2OM6A 3R9XB 1D6SA 4YPFA 5ICGA 1ZOSA 3W1EA 3SS7X 3KZCA 3KHSA 4WK2B 5EWLB 1ZUD1 3DMGA 2D8AA 5IUNC 4HF7A 2IH4A 4O2BF 2EZ8A 3KSAC 2DULA 4C0HA 4DMRA 1KGSA 2DX7A 3ETGA 3CZ4A 4DDVA 4EA7A 1D1QA 2QP9X 3SXUA 1G5FA 1TEXA 4PEVA 1XXHE 5F35A 4RGBA 3WLOA 2C04A 3D43A 1BKDR 3NXKA 4B0OA 1ZXLA 2PXXA 3JW8A 5IANA 3OQJA 3AT1A 2C3MA 3L8GA 2FW9A 2I34A 3GR6A 5LBIA 1SUDA 1T13A 1UXGA 3LY7A 4KRXA 4PXYA 1J97A 4LJAA 1OAOA 2PT7A 4L3OA 4R1QA 3PPXA 4YO7A 3IP6A 1O5IA 1BMFD 5G4KB 1B26A 1MFZA 2JBWA 5DEIA 3RUEA 2FWBA 4MVJH 5C0OE 1QRTA 1A9XB 1J22A 1K6MA 1TOAA 2QRUA 5DCYA 4KN5A 2ZUBA 1RXCA 1KAQA 5ENDA 4PU0A 3WIBA 3C5HA 4UDXX 1U2EA 1CEXA 3EG9B 5GGXA 4I1YA 4QPJC 3AJ8A 5BV0A 3UWDA 5GM1A 3ZW7A 4YJFB 1LBIA 2FV8A 5T67A 4DJTA 2FPUA 2V97A 2BH9A 5DGCA 1MHPA 4UCQA 4EA8A 1IG3A 1MT0A 4AJIA 2UDPA 4TWBA 4YCSA 3D0KA 3PHGA 5DKFA 3ZVNA 3BXFA 2OCIA 2WQZA 3ZU2A 5AVUA 3HB9A 2IEAA 2RGDA 4RH0A 3OEHA 1OLSA 3R9KA 4ZGBA 2C0CA 2D2IA 5KYTA 3G9XA 1Y3AA 1MRNA 5DTMA 1BHSA 1N0HA 3ORSA 2DBQA 2JGJA 4LC1A 3LPLA 2Z6VA 4LNAA 1Z5NA 4ED9A 3I0MA 4RENA 5KYUA 3ZH2A 2V3WA 2OKGA 5EHNA 5REQA 2AVDA 4L4XA 4ARSA 1DBSA 4ARBA 4GE0A 5AVRA 1X19A 3VZSA 4BNXA 2C0QA 3NDRA 4D9HA 3D1VA 5JD6A 1CRWG 3G88A 1SWWA 3QIAA 3USCS 4H6PA 3NIFB 5AHRA 5LDHA 3U7GA 5FA8A 2V0GA 3QVLA 2AD1A 4QSMA 4B33A 3OLZA 5K51A 2ZUEA 1BC5A 1B16A 2JJYA 3H2ZA 1P9NA 3PHIA 3OLXA 3DT9A 4GUAA 1P3DA 4QWMA 4GU5A 4R40A 4PPGA 2PL3A 3EARA 1U7XA 5JE8A 4IHAA 4YRPA 3ESCA 1HT0A 2HCTA 4KUEA 5BRNA 3RS7A 5KUTA 4DQVA 2IDMA 3OP4A 5E2BA 4HTFA 2R0QC 3RWBA 2H4JA 3OJOA 3UMGA 1I2CA 1XVUA 4EYQA 3QWHA 1HT2E 3JYPA 3NHZA 3QPDA 4J90A 3KL4A 3X1XA 3X1JA 3D7KA 1OA0A 1TZJA 3UXHA 1QHNA 1QM5A 3BTVA 4JB8A 1X80A 3TBHA 5IJ9B 2C2OA 4AJHA 4C3ZA 2IS1A 1JB9A 4AZ0B 2BTEA 4OMUA 1P7PA 3D7MA 1CIPA 3QXGA 2HIMA 1FVXA 1XAJA 4CLOB 1YUMA 1JFRA 3E84A 4WEQA 5JW6A 4Z0HO 1EAMA 5KYGA 7MHTA 1YE3A 1NV8A 1RC8A 3HEAA 4RD0A 4EYOA 4G07A 3LC0A 4QKQA 1ORWA 2AF4C 4TN1A 4OG2A 4BMXA 3SMQA 2FZCA 4O4LF 1KQNA 4QYIA 2GSDA 3RPEA 2C96A 4ALIA 5LYJF 1X7WA 3Q12A 3JD1A 2CFSA 3EJWA 2UUCB 1ZBQA 2O2EA 3PGKA 5AUQA 4JX9A 4U0JA 5IAEA 1AC5A 2YVAA 3H1PA 1CLUA 3AETA 4JX8A 3OZGA 1NAHA 3LBAA 4G5OA 3O21A 3P19A 3R3JA 3S2EA 3TDKA 5CD1A 4OYYA 1C2TA 4H7PA 7REQB 1XQYA 2DWUA 3ADKA 4BP9A 1UMKA 3KEGA 5C1PA 3N75A 4P4SB 3GJ7A 3JQ8B 4BFYA 4U2FA 2WQ6A 1UPUA 4ZKDA 1TQ8A 3EVGA 5H82A 3TFWA 1G21E 2FZVA 2PH3A 3AKCA 1CS4C 4IZ6A 1QK3A 1W9HA 3OQ6A 4LGVA 1H8ED 2OILA 3GDOA 4OSPA 3QY0A 3RHFA 4PW0A 3FMGA 1NQOA 3HB4X 1T3SA 2R6ZA 4WZAB 3OF2A 4YUWA 4XIGS 2DFNA 3SDZA 2Z3ZA 2PDAA 3ASZA 1EVLA 1L4MA 4PO8A 4TYNA 2XJ4A 2A0FA 3AU8A 1KY3A 1G3IA 3BRCA 1UCFA 1W30A 3DF7A 2DWCA 4A3SA 4NXNB 2H11A 1IY2A 3CR8A 3AP2A 3I2GA 3OO0A 3C87A 3RC1A 3UC5A 3PYLA 4TXHA 2AEJA 3RGWS 5ITZA 3FD8A 1VECA 5BN3A 3RLFA 1FU8A 3LHDA 2YXEA 3OTIA 3C6MA 3WP0A 4ABYA 1F2VA 3GEEA 5HKKD 4OI2A 2JANA 2P11A 1BGXT 1TAQA 4S1OA 1PVVA 1DC7A 2PIDA 4AG6A 1FXUA 2QZPA 4QM7A 4WX2B 1HYBA 2EKLA 1KYWA 2NUPA 2P9TA 1BKYA 1JR3D 1OFHA 2TYSB 3CUEF 3U7QA 4FYVA 5P21A 4DRXA 4GBJA 4ENWA 5MGNA 1XTPA 3B5IA 3EISA 1GZ4A 2ESRA 2MYNA 1Z8NA 5LXTF 4ARCA 3CTMA 4LJRA 3F6RA 1BDHA 5ALYA 5JY6A 1UWLA 5KWSA 4CM3A 1QHHB 2Z4SA 2J9FA 5BW4A 1BDBA 3W8NA 2PX0A 4I81A 1WSDA 3B13B 5J4HA 2WFLA 3DT8A 4KMRA 4FHCA 1L4FA 1BXRA 4CMHA 2YIDA 3GIDA 4NBUA 1L5WA 3QSGA 3WRYA 3H4VA 3SWWA 4XDZA 3U31A 1OTYA 3WK9A 2D2XA 4M21A 5CFLA 5LP6C 2GLTA 2H1VA 5CHYA 1EX7A 1CY8A 2YS7A 3H5NA 3IDAA 4MGKR 3WWPA 4ENSA 1J8MF 5FUWA 4MPTA 2QIPA 4OOEA 1BFKA 1T9DA 2BI4A 2VFAA 4FUTA 3P1JA 4I9GA 2MSNA 3WBBA 1WDMA 2PL1A 4PZCA 4DILA 2Q4DA 4QHSA 1XZDA 3NIGB 4FYYA 2JFWA 3EXHC 4NBRA 1DO8A 3LQFA 4B3JA 5L3SA 3Q5GA 3J81A 5IXJA 3OJ0A 3RUIA 5KYUB 5L7YA 5REQB 1Y8RB 5J5VA 3QEAZ 4JVSB 5YASA 3T3HA 1W19A 3B3QA 3O75A 1K6EA 2I29A 3WLFA 1PJSA 2CLIB 4FHFA 1WPXA 3WIUA 4V0ME 2X5XA 3TNLA 4CKBA 1UK7A 1P17A 1VL8A 2AW3A 2ZUCA 3KKOA 3OCXA 4HDCA 4URFA 2Q5LA 3CJTA 1KH3A 1ZG3A 3T15A 2G09A 3WXMA 3M6LA 2GARA 1MAHA 2BSAA 4K6KA 4E12A 2YRWA 2JNWA 4MDEA 2O8FB 4P32A 4R6WA 1MXHA 1FUKA 1WW3A 2FP4A 3R7SA 4D8YA 1AZSC 3IKMB 3PL5A 2ZSAA 4CMIA 1A4UA 2NZXA 4CN8A 3DUWA 3ICPA 4ZCQA 4RE6A 2UVDA 4GI3A 1EZ1A 1NIJA 3NUQA 3V8EA 5P8WA 3UAVA 1BHQ1 4IPTA 1RWWA 1DEKA 1I6LA 1M2FA 5FJIA 1M6VA 1ISRA 3FNRA 3H8JA 3OOSA 4A1FA 3BMNA 3LUCA 3C6QA 3P8ZA 5FD8A 5EMNA 3AFGA 4OFBA 3RW9A 1V0JA 1SCQA 2C7VA 1W8DA 2GEFA 3KE8A 1X80B 1H3NA 1QE5A 4QHYA 4UQOA