4RL4A

Crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
173
Chain Sequence
QGHMKRLEVSNQAKLPTQFGEFYIQCFREKGSKDHLVVFTPNFSQNPLVRLHSECLTGDALGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKVNAYALQDKGYDTIQANEMIGFKDDERDYSVAGEILEYYRIKKMRLLTNNPKKIAALEKYAEVTRESLIVCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP cyclohydrolase-2
publication title Structural and biochemical characterization of GTP cyclohydrolase II from Helicobacter pylori reveals its redox dependent catalytic activity.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 54
structure length 173
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.5.4.25: GTP cyclohydrolase II.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00925 GTP_cyclohydro2 GTP cyclohydrolase II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10990 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rl4A00
4I14A 2BZ1A 4RL4A 2BZ0A
chains in the Genus database with same CATH superfamily
3W6PA 2YZMA 5IAAA 3FOBA 1M8PA 2IW1A 2YMLA 2BSQA 1CVLA 3H86A 1YK0A 3Q7TA 4LFAB 3BERA 1ENPA 3OZAA 2IK8A 4MB0A 1IVNA 2FMKA 2Q2WA 1EGAA 3EBPA 5EI5A 2R86A 3UFXB 3RB8A 4JVMA 3UHAA 4H08A 1SHUX 1U11A 2FWNA 3MAAC 4G63A 3SXJA 4PYKA 2ZIEA 3ZD6A 1I32A 4WECA 3ZHQA 1LDMA 3MTQA 3AL0C 2QN9A 1E2IA 2WHXA 4JLOA 2IYNA 5G0TA 3K35A 1YZHA 2Y9MB 4JBLA 4D02A 1RKQA 3W1VA 3HGMA 2IITA 1JJIA 3QKTA 4J75A 4O33A 4JEIA 4X93A 4BO1A 4RZ2A 3RUPA 2ZRAA 3BH6A 1M0EA 3OOEA 4P4GA 3U0VA 4PXYA 3ORQA 5IDXA 1WZNA 4K86A 1M6WA 3K3PA 2Y0PA 1DX6A 3EH1A 4EB6B 1KJZA 3T5MA 3BWMA 2VDKB 4O8ZA 1ZC3A 1MENA 4H7KA 2DKFA 4M1KA 2VPPA 5HSGA 3OQMA 1KS2A 1EG7A 3HI6A 4DMKA 1SKYE 3KQSA 2GN2A 2ORIA 4GOJA 1ABBA 3SR4A 1Q21A 3C2QA 1OGJA 3B9QA 1IONA 2FLWA 4HY3A 5A9SB 4Y6LA 3IPCA 2R7AA 5IJ0A 3LHFA 3FCYA 4D6YA 1HDOA 3ABZA 3INNA 3QPVA 4MVJF 4AVYA 4B74A 3LA8A 4JKIA 4YAJA 2C7BA 1QVWA 3HZRA 1E79A 3H2IA 4LOLA 1E8DA 3COZA 4ND7A 4RX1A 3CCFA 3B2EA 4KZKA 3NT5A 2FR0A 1I1NA 5EZ5A 5ILQA 1RXEA 1ZNYA 4GYWA 5CH3A 3TW8A 3DNPA 2P8JA 2SNIE 1YA8A 2D5AA 2VJQA 5CW2A 2JGMA 1TJPB 1X9HA 5DYNA 1S6YA 3BWXA 4BMCA 1P3JA 5J4HA 4D3SA 1OB5A 4ZMBA 1ISGA 2XECA 3ZHZA 1TUBA 2F8SA 1LX6A 1SOUA 2A7XA 1C7IA 1QIJA 1IUKA 2ZW9A 3LKDA 4MB2A 3FPAA 1E1RA 3UJ7A 4XRGA 4L9AA 3F71A 4UEKA 3B7WA 1G16A 2HRQA 3VBEA 5CJPA 5JPIA 1AKYA 2DBRA 5FPPA 1Z15A 3JQCA 1LRKA 4CMGA 3QPUA 3H6KA 3Q7PA 2X4IA 4K81B 4OD0A 1H0HA 4I1PA 1XDUA 3VNSA 1ZRMA 4LQDA 1BYIA 5IM5A 1YACA 4HWTA 4CM3A 2C7GA 5CLHA 2QTCA 3ESYA 5GVRA 1R6BX 1N2JA 1JEJA 1ZCZA 1N2SA 1GVHA 1J24A 3I34X 2QXTA 3SXUB 3NGMA 5G3ZA 5H82A 3WLOA 2FPPA 3P52A 4B7AA 3SFVA 3U3KA 1JU4A 1DG9A 5AVJA 4QJ5A 4URFA 3DZKA 3IR5A 2D2XA 1P72A 2ZR8A 3RHZA 1AQLA 3A6EA 3NVMB 1I36A 1Z12A 4UULA 1V7QA 3R6TA 1K7CA 5G4KB 1W30A 5JROA 4OIMA 3RDPA 4ARZB 3GCWA 3PJFA 1CNMA 1BHO1 3L8GA 1NZFA 4IOKA 4IIEA 3RT1A 4HHEA 3R75A 1J20A 3L0ZA 1CV2A 1KJYA 5JD3A 1VYUA 4EHNA 3WDSA 1XD9A 5LOVF 1QC5B 2YWHA 3RTEA 3O8QA 4OSEA 1J5EB 5LDDC 2POCA 1IOLA 1L7OA 3UOWA 3AZPA 3ZQUA 1E4VA 4GLFA 3W9YA 1N7IA 2ODEA 1U0TA 4URYR 5JBNA 3DWEX 4R9SA 5DK4A 1WNFA 5JH7A 1NVFA 3GFGA 3LPNA 3AKEA 4C7OB 2H0QA 1UUFA 2GQ0A 3CH4B 3GELA 3QY0A 1P5FA 3FSJX 4DA4A 1MFZA 1YMVA 2HREA 5EUBA 4L2IB 1R8YA 3LU1A 1QMGA 1SJ9A 2CLLB 3GFQA 1YDWA 4J1NA 3UXYA 4NFSA 4WY8A 4KXNA 5EMKA 5K8CA 3ADPA 3T3OA 2BONA 4CEJB 1J9GA 3DP9A 4MKIA 3TVTA 1DI0A 4YJGA 1R0XA 1PJQA 3C5HA 1DJLA 3LY5A 4E14A 1UC4B 4O2LA 1FUIA 3SX0A 5IYZB 1YKSA 1WMEA 3NUZA 2J45A 3HVKA 3MMSA 2J32A 4JKOA 3KVNA 4M21A 1MOSA 1R6VA 3LMKA 1Y1KE 4WNYA 5HUJA 3MT0A 3PENA 2ZWAA 3S99A 3L0SA 3D8TA 4EL5A 3GN1A 3TBFA 2C9BA 5KIAA 4B9AA 4QU5A 3M6LA 3K09C 4A4DA 4W8HA 2D59A 3KR2A 1N5OX 1RYZA 4HZUB 4RFSA 1R6AA 2VS1A 3ZDYB 2G36A 2ZWOA 1DFGA 1FNNA 5ICMA 5FA8A 3WNVA 3K72B 3IULA 4JBWA 3RC2A 2N0SA 3CX6A 1FMCA 2UVQA 3BRWD 3V1KA 1H69A 1T8WA 4LS3A 2FFHA 1FMLA 5CP8A 1EHCA 4KLZA 3S8MA 4TTIA 2CZGA 4N5DA 3U62A 2CV2A 3GLQA 3OLWA 1VBMA 4HX9A 2EJVA 4LQLA 1P6QA 2C82A 2JASA 3T3PB 3AG6A 4AUMA 5FV4A 4J2HA 2JFGA 4PHTA 2IWHA 2YTZA 1ZHHA 3A7EA 4X44A 2QYTA 1MXFA 1NIPA 4LZZA 3UJPA 4WUTA 5KWEA 1TYDE 1Z0KA 3IESA 5JE8A 1LV7A 1ZOIA 1P6UA 1IXKA 1GZHB 2D1YA 2HAEA 1GA6A 2GVZC 4LVCA 1U9JA 3ICEA 1SBYA 2QRNA 1SXIA 1WHTA 2ZRPA 3ZD8A 1NW7A 3AVXA 1U3TA 2ZAYA 1H2AS 2W6QA 2IV3A 1RLUA 4H1HA 4ITVA 4AKHA 1W9HA 3A9SA 2HHLA 5DF1A 2VEOA 3GQBA 3GGCA 2RHGB 2CCKA 2C9MA 4X65B 1OIXA 3MSXA 4XH9B 5DKFA 5DW0A 4DDWA 1CDOA 1AKRA 4MGYR 4TT3A 2X6QA 2RI0A 3RSOA 4P5DA 2PMCA 2W2MA 4O4LF 1Y1RA 5HQ3B 1Q7BA 1CHDA 3EVBA 1I94B 2WWWA 5AK3A 5G3YA 3PL1A 1Y6RA 3C0KA 4I2NA 4OQPA 2I8CA 4MVJG 5D00A 2WVJA 3S2EA 4G9EA 3DE4X 2C4WA 3DLPX 2WUWE 3P2MA 4JL8A 5IDQA 1NHWA 3ACBA 1U99A 3QKUA 2FJ0A 4FVTA 3I1IA 3OT1A 4TX1A 5HMMA 4J0QA 2G88A 4MJXA 2J6CA 2OCYC 4AZTA 1KDTA 4OJTA 2ZXFA 2CLIB 1JE0A 4N6GA 4K6MA 2HZBA 4XSHA 2NZVG 3IT0A 1DOZA 3U7QA 3FNEA 3ZH9B 4CT0A 2GYYA 3EEQA 1AMOA 4HDCA 1QRUA 2G7MC 3O8LA 3B1ZA 2F8TA 2AR0A 1O96B 1VKRA 2V7WA 3L5KA 3LBYA 5KVQA 4WL0A 3TCXB 5DGXA 1QMPA 2BISA 8OHMA 5B6PA 2AZ4A 3IIIA 3JVDA 4IV8A 2ZZKA 2XUKA 3E84A 4JUFA 4PVDA 5JISA 5L95A 1YBHA 2NACA 4BMVA 4HNAB 4D43A 4RL4A 3MS2A 4NCHA 1U3WA 4ALLA 1TD1A 2EDCA 2GEVA 5CUQA 2OUIA 5DW3A 4ZXPA 5MGBA 5FUXA 2PM8A 2YY5A 2L0XA 1XJWA 3MINB 4OY3A 4F3RA 4OUDA 3A31A 5ENZA 5L3SA 3G2PA 2GEJA 1NMXA 2N9UA 3BB1A 3BQNB 3KSUA 4FQ5A 2BFEB 3WNZA 3UCXA 2Q6VA 2QNBA 3EAQA 4GOND 3NYRA 4KLAA 4XWAA 3QELA 4OU4A 1VMDA 3ROMA 4EHFA 4C06A 5JC1A 3A9RA 1ZMRA 1TVKB 2HJVA 4PC2A 4C6TA 2O4UX 5C4GB 2Z4RA 3P0HA 2VG8A 1VOTA 1OOEA 3EZ2A 4BDSA 3AUKA 3KXDA 4D82A 1IJBA 2IP1A 2NO4A 2ONYA 3IAXA 5CR9A 1Y5MA 3LT4A 1KH3A 2FN9A 2WWIA 3WMGA 2D1FA 4HVTA 2CYBA 3INRA 1BX3A 1VGRA 4GZ5A 4RF4A 3L93A 2NWQA 1K8YB 4LRUA 3SSAA 4CKCA 2NUAB 1W5TA 1II0A 3QVJA 4F1WA 5IDYA 5BVGB 2R8EA 1YJXA 1ZOPA 3K1TA 1CR1A 2MWMA 5EIEA 2E4YA 5E7MA 2ZE5A 3CE9A 5B3KA 3LL4A 4M38A 4Z3DA 5B1YA 1EVYA 3JWIA 4K1LA 2Q7OE 1QQBA 1JIXA 2ZYGA 4MW2A 2H9YA 2P78A 1N75A 2H9IA 2DXIA 2G1UA 4NYIQ 4JP2A 5BR4A 4O1HA 1SEPA 2VNSA 3PD1A 4PAGA 1EK5A 4X6YA 4BP1A 4EY5A 4DR7B 1Z4JA 3VJRA 1ORDA 3GEBA 4ZXFA 1ZSNA 2P2SA 4PCUA 3U5ZB 4HN4B 4RBNA 3H2KA 2G82A 2INGX 4TVSA 2B8EA 4ALJA 1T43A 5LIRA 2DHRA 1IZ0A 1P0MA 3AVPA 3I9JA 4B7XA 1KFJB 6PFKA 5L4NA 1IHXA 2MYPA 3ETDA 3KNZA 3ZWBA 3M49A 4HAXA 1F8GA 3NQ41 4IFBA 2WICA 4EUSA 4RIGA 4BZWA 1M34E 3DWIA 2Q8QA 4WI1A 3TYXA 1WQ1R 3CE6A 3EVFA 2QD4A 4U7DA 3EY9A 3PXDA 3ZW7A 1F8UA 4OGGA 4YAFA 3M89A 2IS2A 3JQFA 3FHTA 1ECGA 1VFNA 3NEAA 4A0RA 3WGIA 4MIEA 3BS4A 1GGKA 1UK6A 2NXWA 4LHVA 2A0YA 4MWSA 2IHZA 3DOFA 3RC7A 4E5UA 3BD8A 1TJYA 1FQOA 3MUEA 2CK3A 2QM8A 2B7BA 2H57A 4MR9B 4V38A 5BSHA 1Y89A 2WZCA 4JLWA 3E3NA 2GM5A 1CKEA 4JVOA 1NN3A 1LPMA 1SEVA 1EBFA 1R3DA 2FX3A 3MJHA 1DKNA 1DJQA 4PSDA 1XEXA 3KETA 1P2SA 1D5CA 4JMPA 3FR7A 1DKMA 3TUJC 2Q41A 2LCFA 1XCJA 4LE2A 1Q0HA 3LSTA 5EJ9A 2FYTA 1X7WA 4OM7A 5FYDA 3UWSA 3TPCA 4ENRA 5JNRA 3G0HA 3E5RA 4YJKA 3KOMA 3GAAA 1VRCA 2AOUB 1WEKA 2ZIWB 4J7XA 5CMLA 4A0HA 4NV0A 3OECA 5FO1A 1RWXA 4TYWA 2O8EA 2HFJA 1RZ3A 1SZJG 2BKVA 5D01A 5B7PA 2PFSA 2WTBA 1N1DA 5DULA 4HQKA 1ADFA 5C8ZA 1VA5A 1H6CA 4KPGA 4D42A 2GEKA 4R6XA 1K8QA 1S0UA 2PSHA 2WTNA 2X40A 4MB6A 1FX0A 5TQJA 4RNCA 3WGVA 2Y99A 4E5KA 1Z7YA 4AF8A 3N0VA 3HJRA 1MA0A 4GXRA 1G0OA 4HZIA 4RPGA 4UOZA 1S2GA 3JY6A 4YT8A 4HTFA 4KR3A 1L7BA 3PTLA 2IYEA 4LZPA 1B0PA 2YYYA 3DBOB 5A3SA 1QM5A 2EWVA 1SAYA 4H0FA 4XJXA 1MD9A 2ACKA 3BGVA 3RSCA 3RSQA 2JDID 1PR3A 1RJGA 2WHPB 1EE1A 2GZ2A 4MI9A 1A8QA 1DBVO 3BK7A 4RJ2A 5JBQA 1OKKD 4N8DA 4RELA 4Q66C 4DMGA 2VZLA 3NAMA 3MEQA 3PGA1 4Z99A 3K1YA 3NNNA 3H7AA 2HBYA 3BFJA 4IXNA 3T7KA 4HATA 2Q8PA 4LNUA 5CH5A 3M6FA 2C61A 1KI9A 1EFRA 2GZRA 821PA 3O90A 3WOVA 4LY9A 4NBKA 2F9FA 2C9CA 1LK0A 1TEZA 2SBTA 4M0UA 1X1DA 5G53C 1E2BA 3TFWA 2SKDA 3WLTA 1QYXA 2XWJI 3H5LA 4NAVA 3ZGZA 4ZCTA 4Q7QA 4BMXA 1HQCA 4KEAA 1SZPA 3D4OA 2YJ3A 4CGZA 4BNDB 4P31A 2QW1A 2ZBDA 1DXOA 3RS0A 3ZWDA 3HHEA 3MOGA 5BWOA 5DBEX 5AYVA 1MZVA 1L7AA 4UASA 4DOMA 1QFSA 1D6MA 5BUCA 3P0RA 4NV3A 1A7UA 6AT1A 3OZBA 2DECA 2B25A 3SYNA 1ODSA 1V6CA 3TTTA 1XK7A 2ECPA 2GEFA 1JG1A 3LCMA 4HMQA 2HF2A 3Q8XB 4D92A 4B3CA 5JAOA 3TRIA 3A1WA 4EOGA 4KYVA 4N0MA 3BWYA 3A2MA 4JCCA 2HIAA 2Z2YA 4KPUA 1JHPA 3CNNA 3RSZA 3AGQA 4X41A 1Q7EA 3SD7A 3RYFB 1XF1A 5J1TB 3SICE 4B3IA 5IKXA 2FQYA 3LUGA 1I01A 2VXBA 3RTBA 2VBIA 2P7IA 3B38A 2JCSA 3E9QA 3IEXA 1B74A 4QPPA 3ZBQA 2XZOA 2CLDX 3T35A 4LZWA 2AQ8A 2ZYDA 3OZWA 4G65A 5IXJA 1O97D 3RLIA 5KAPA 1YVUA 1Z6QA 3HVUA 3JR7A 2PN1A 2XX3A 1H9BA 2X14A 4CCYA 2ACWA 3L07A 1U0HC 4U2CA 5E1MA 2C2ZA 2PFGA 3DL4A 4AW9A 1V2HE 4EW6A 4FFPA 2P62A 5IFLA 5SY6A 3UKJA 3CRVA 3SHQA 1YCFA 5K0JA 3STUA 4D9JA 2ZI5A 3WK8A 4N76A 1COWD 1RYBA 1B43A 1C30A 1Z0AA 3KD2A 4U2KA 1ETHA 4YRQA 2D5IA 421PA 3FFBA 3I9V6 5G2OA 1GPMA 1QCZA 2OE2A 1JQJC 4J1TC 1NG1A 2VLBA 5A2QA 1WL8A 2R96A 4I5GA 1PBNA 4BJ1A 2Y1KA 4BKQA 1AH2A 3WTCA 1ZIPA 3EQ8A 1RHRA 1N25A 3PJDA 4M0EA 4QQRA 3L01A 2C0CA 4URZR 2FCRA 3H9BA 1C8LA 4HRXA 2ZLBA 3ZJVA 3K5PA 4ZRNA 4N47A 3L6OO 4ZPJA 2AWOA 3JAWA 3KOUA 5KHOC 2FQXA 1FZTA 2Y1LA 4HGNA 1XHFA 1XZIA 4OHXA 1J8QA 2C9DA 3BC1A 5TGZA 3THXA 4OEHA 3GEDA 3HN6A 4TKVA 4FFBA 3WZLA 3GHYA 1YZKA 1P2VA 3ID6C 2AMYA 1G9TA 3GG2A 1YAJA 2OILA 3VAYA 2QQ5A 3ZGXA 3KFLA 3CPEA 2L69A 1O2DA 1BMFD 4LC1A 4DJFC 2W22A 1P18A 5CB0A 3DS8A 4Q3OA 2GO7A 4NDZA 2IYOA 1GSOA 1YIDA 3D3EA 3RNOA 3BK1A 4MWDA 4EYSA 5CT5A 2CCJA 1ZD5A 2P9TA 2PTHA 3G1WA 5JQGF 2OHGA 1TZ2A 3K1AA 5AJHA 5EIFA 4DRYA 3K0FB 2FW6A 3H3FA 1L5HB 2R6JA 2D6FA 5F7XA 1Z0ZA 3LD9A 1UAYA 1KYYA 4FZVA 4IDEA 1BHSA 4L8GA 3ZDCA 2WHRA 1CQJB 4PLTA 3WLSA 3V42A 1NBAA 4EZBA 2XEXA 3AILA 3HV0A 5BOSA 5LMNB 3B82A 2VK4A 1K98A 2EFJA 1E89A 3KEMA 2FQWA 3GFSA 3B20A 3TOVA 3GMIA 1RWNA 2YVKA 2FSUA 3PNSA 3T38A 2I4IA 3ME5A 4F46A 1EUDB 4JLKA 1GAJA 4BAZA 1RFLA 1Q0SA 3CUSA 7MDHA 5I7UA 2VRWA 5BW8A 2FN8A 2GVDC 4X0EA 4ZTZB 2I3DA 2XZPA 3HBLA 3NHUA 3HU1A 3Q1LA 5BQXA 3JS5A 2FR8A 4MWTA 3UUFA 4N7JA 3GD5A 1PFVA 3E8SA 4N54A 4WCFA 3DVSX 1WLSA 4B43A 3NONA 3G8CA 5CXQA 2OHIA 1T4CB 5IT9A 3FD8A 3W9BA 4QNNA 3EIHA 5AVUA 1AGRA 5JJBA 2HNBA 3ND5A 5L8VA 3H8VA 1R0YA 2YNMD 5LXTF 6CHYA 1X1EA 2JLRA 4W8GA 2I80A 4B3TB 3QEOA 2GN0A 2GILA 1KMHA 1IB6A 5DXJA 3UUWA 3OMXA 4TKUA 3HBNA 4DLKA 3RK1A 1QXSA 5LZ7A 3CNHA 1B8NA 3DTTA 3GP3A 4DIKA 3EHDA 4BFUA 1P39A 3JASA 4Y2XA 2Q6IA 4O2AF 3ETHA 4JR2A 3AI3A 3S29A 3BJRA 3B9PA 1FRZA 3BDVA 3QG1A 4IVPA 4LE1A 4Q1AA 2FW9A 2Q3HA 1DQRA 3F5FA 3GP5A 3I72A 4C14A 4DCJA 4DPKA 3HDJA 3EPKA 1J42A 3AUYA 5SZHB 3ZN2A 3K05A 3MCUA 3LBHA 4RMJA 4X7PA 4TMZA 2G7ZA 4RH0A 2KSQA 2ESRA 1QCYA 2WMNB 4NTZA 1HSZA 1QKIA 2WD7A 1Y98A 4V0LA 1N7GA 5AVTA 2CF5A 1X2EA 1A7KA 3G68A 5DASA 5ALMA 4RESA 3N70A 4J2OA 5LQCA 3IUQA 3U4QA 2CNWA 4QU9A 3EUEA 1VHDA 3OFVA 1QHIA 2JJ1D 3C3XA 1H2RS 4WJZA 1LZKA 4LF6B 3TZEA 2HA5A 3CGGA 5CW1A 3A4TA 1FDVA 2DWCA 3FETA 5U9CA 1QNFA 2PEZA 4F8JA 1AUPA 3O3MB 4DDUA 3ZWWA 3TF5A 2JVJA 3EIQA 2E3JA 3PRJA 1D9ZA 4UU0A 3ESQA 5F76A 3FPEA 3RCBA 2P8SA 1GGMA 1ZC4A 4KVFA 5EIAA 3GMSA 3QU7A 3VR5H 3G3EA 1JDSA 4W63A 4F21A 1Y8QA 2XUJA 4KBFA 4ER3A 3CQ9A 1ZD3A 5AQEA 2XEDA 4WCVA 3N5KA 4F4UA 4CG0A 1MABB 3W8NA 1CNFA 3KSRA 2ZSBA 3AEQB 3K2QA 1TK2A 2RKWA 4X61A 1EESA 3M2TA 3SPXA 1YJAA 2WT9A 2FPLA 5JS6A 2RC5A 2J7PA 4WBSA 3IYLW 1J99A 1A5AB 2R1TA 3L41A 1Z37A 3ZU3A 5MN5A 4GI3A 1NVTA 2CXUA 2OV8A 2I4OA 3AB8A 1XTQA 2GEBA 2UYCA 1C3EA 1G3MA 3IKMB 4AN4A 3GBVA 3ILVA 3TJMA 3K6SA 1GPYA 1Z6GA 2A0KA 2O8BB 1EBUA 4WLFA 1NUPA 1XVVA 3TO5A 4B4KA 3ENKA 2H4XA 1CZNA 5JVDB 5I4BA 2ZOSA 2WV9A 1NP3A 3PI7A 4KR0A 1NM5A 2Y27A 2J3JA 3BILA 2G25A 2HYIC 3FAZA 1KDZA 3JTMA 5ALQA 4Y2PA 4PICA 4Z8XA 2DJ5A 1V47A 4YXWA 4J76A 5IHPA 3PWKA 4GMGA 1E2UA 3I2KA 5ALDA 2AA3A 5IDVA 3W4IA 1CJUC 1D7OA 1HYEA 4TN5A 3FPCA 1E4OA 3LL7A 1JZSA 5KS2A 4PGGA 1ZXBA 2ZKLA 2G28A 1RQRA 2WB4A 1E9RA 1SU6A 3VKHA 4PPFA 3OQ1A 3BMNA 1G7RA 2D2IA 4K5QA 4EO7A 2FMFA 2IQIA 2IX9A 3QITA 2B21A 2JC3A 5L6LB 3HUUA 3T9EA 3DWFA 9ABPA 4QLOA 4QUIA 3PFGA 3IPYA 3MJEA 2VQFB 3TR6A 4MYCA 1G41A 2DBQA 1W85B 4EBBA 1Q0QA 1B1AA 3FNBA 1AHIA 3H5AA 4N3AA 4YJFB 1QQAA 1NM5C 1EJ6A 1I2CA 5C34B 4CQJA 3C6YA 4IDFA 1C9YA 1U2SA 5AIAA 1JVSA 1CRWG 1K75A 1FFDA 5CVCA 3TD9A 4DMMA 4EHKA 4UM8B 3KU1A 1R5OA 2BOVA 2FUNB 2IGBA 2QTAA 5JSYA 1GQSA 2NT4A 1G7CA 1X9IA 3QE0A 2HYDA 3NTUA 2XCSB 1B76A 2C54A 1W2GA 4E1BA 2J3EA 3COWA 4CM9D 5CXSA 4M98A 4ZT7A 3BEOA 2ZATA 1YBFA 5ALJA 4BJ6A 3NKVA 2E89A 1I3KA 4EMSA 3A10A 2QMOA 2QTRA 5ENDA 2GJ8A 2AJCA 3L7MA 2ZTLA 1M9NA 1D2RA 1Z08A 4TN1A 2E1PA 3S1SA 1JKMA 3WP1B 4IMJB 2ZI7A 1LF5A 2ZJAA 3FSEA 2V9CA 3F6CA 4WADA 1JEYB 2AVNA 2AQIA 3FHJA 3C74A 3LWDA 3STXA 3X1XA 1AQYA 3ZDXB 1U5AA 3EBOA 1X1RA 4IS2A 4GIBA 1M8GA 4GPEA 1I7QB 1PR2A 2FPWA 3TBKA 4QUJA 2ZIVB 1O08A 2FE4A 3UBMA 3UMFA 2FLKA 3SZGA 2GZSA 1LPAB 2XMCA 3P9ZA 5EXEA 3BD7A 5FH9A 2E21A 3K0SA 1SCJA 2QXUA 3CONA 1Z6XA 3KSDO 1LPBB 3A6LA 5FBLB 3RUCA 1AOXA 3WAKA 2W6NA 4AMUA 5KCZA 1A9YA 1U4OA 2XLCA 1Q15A 4YVFA 2NSDA 1XEAA 4QBFA 5IT5A 3EQ6A 2F64A 1UMDB 2NVUB 4MA4A 4OCZA 4DWOA 4DZRA 5AW9A 5LKAA 1BXRA 3EEYA 1N7HA 1ENYA 1SUWA 3CUKA 4GX0A 4ZU1X 3ZNOA 1DELA 4B4VA 2WWYA 3EYAA 3C1UA 1DJMA 2F67A 2FMUA 2LCQA 3BTSA 2RJNA 5BMVB 1ACLA 4DARA 7MHTA 1LK5A 3H11B 5DOZA 1ISFA 1U4NA 1AU9A 3FVRA 3CW9A 1DCMA 4L0CA 5IW8A 1NRIA 3VPXA 4XCXA 2OFOA 3BJMA 3EDQA 1FVHA 1UBFA 1YUMA 5K3EA 3H9QA 2ZIXB 3HB0A 4X6UA 2PIAA 1BQ4A 3M9XA 4HXYA 5AO9A 2ZPTX 4NPCA 3OAAD 4Z0PA 3JQ6A 4DV5B 6NULA 5HS4A 1UC9A 3FZQA 1XZQA 5TVKA 5CBPB 3E35A 2WIDA 1A9XA 3LGXA 3ZI7A 1GT91 1KPGA 3DZGA 2ZB3A 4KMMA 4NIMA 3P0JA 4G25A 4DMRA 5IF3A 3IBFA 3P9RA 2CHGA 4JI6B 1P44A 1R6DA 3BXEA 4UM5A 3ZZ0A 5JXHA 1EM8B 3OEYA 1KEVA 3OO1A 4MGZR 2OBLA 4JJZA 2O0LA 1BS1A 2LW7A 1E2LA 4BLOA 1OXMA 2FMTA 2QG6A 5FI1B 1JN0A 4LSWA 1AB5A 1E1DA 1TJ3A 2VCYA 2XTAA 2FZCA 2YFHA 3INYA 4HH3C 2YUTA 3WQHA 4E46A 2WWHA 5HWSA 3W5SA 4HPXB 4L5YA 2XKBA 5AW8A 4IP0A 5JJCA 4UCQA 3BE4A 4GBJA 2I1VB 2CNDA 4IZOA 3AFMA 2CVPA 4UVEA 1E2MA 3YASA 5JFOA 3R3WA 5FBKA 2V96A 1YR2A 4UAJA 4ZVKA 3VZCA 4L0QA 5ICCA 3O8CA 5FIUA 2M32A 2XUAA 2B6HA 3CCCA 3CISA 5KKCA 4ASUA 2X9NA 4EB6A 5F51A 2M6SA 2Z4SA 2Z9BA 2H2HA 2VDPB 4BNJA 1BCRA 3JPWA 3I8XA 1UBLS 2OHVA 3DMFA 5KYVA 3TKLA 4QBHA 3MT7A 4I9FA 1PZMA 1XTUA 3JALB 2B8JA 1FRQA 3PFCA 4GBMA 4WJKB 4G0ZA 2W6ZA 2OKCA 1EJBA 1GU1A 3B13B 1OXUA 3ICPA 3U7GA 2YBDA 4WE3A 4NKRA 1JB9A 3WNBA 3OZCA 4NYMR 1FVXA 4X3PA 2Y0EA 2W58A 2Z2IA 1GVNB 1P5JA 1BVRA 4IO0A 1VCNA 5T5QA 5CA1A 2FW1A 4NCNA 3U3DA 3U3RA 4A92A 3GW8A 5BUQA 3U48A 2C92A 5D5HA 3T5TA 1NBME 2GZAA 5D1HA 5F2OA 2WEKA 4DYVA 3DO6A 1J0XO 1KK1A 2ZRLA 4P38A 4RSMA 2GDJA 3T61A 3V4OA 4F4FA 1WCIA 1L5QA 3GUHA 3IO5A 1HE4A 3ZK9A 5C5CA 3IQWA 2Y3IA 2Z6VA 1G1MA 3KQUA 2VYND 4YPOA 1RW4A 1NF3A 2R8RA 3ZEIA 3L7IA 1W75A 1BN6A 4R01A 4XR4A 4EJSA 5CDGA 3VX3A 3EVAA 2A88A 4ZK6A 4RENA 4MQ5A 3WYNA 3SVZA 5JAZA 1CU1A 4DF3A 1OHHA 1CZOA 4M1ZA 3CT4A 2YQ5A 3UXHA 5JNUA 1OWMA 4CQLB 2WZQA 3HJCA 1UPCA 3CSDA 3VR0A 5C52B 2E1RA 3GRAA 1AURA 3NU1A 3S2ZA 4E1VA 1PWYE 1TJ4A 2C2OA 2G9VA 4XFDA 2RG7A 3ADOA 4Q3AA 4X8LA 2CDNA 2P2NA 4BJHB 3X2EA 5LQDA 3R3UA 3EZNA 1CULC 4YDHB 4YUWA 3W5BA 3HKDB 1BRMA 4FR2A 5F73A 3FMOB 4L3WA 4BHTA 2IH5A 3QGMA 2CUZA 1J5PA 1I51A 3NBUA 1VKJA 2C9OA 3ITEA 1FUYB 3KQKA 2QTBA 5E6RA 4PXSA 4YIHA 3MAGA 1CZLA 3B2NA 5BNZA 4W82A 3TLZA 1S96A 3LK6A 1Z5PA 5M7EA 1ONSA 3HA5A 4J94A 3VR6D 2F3SA 3DAYA 3SR0A 5BVHB 2SICE 4FOLA 4EJSC 3T4PA 1I24A 2XOXA 1Z4MA 4UVGA 3VHQA 4P0PB 4RPKA 1W47A 1H1TA 3MWDB 4WXHA 1QVVA 5HHTA 5HMLA 4AJPA 3T7AA 3HL4A 5GZ1A 2LKCA 3LUPA 3NUGA 2WAOA 4UBMA 3T7JA 4EDFA 4IDQA 2HA2A 2PD6A 1OLXB 1HT2E 1RACA 3T06B 4YACA 3N2KB 4V0KA 5HVNA 1JLMA 1GCGA 1J97A 1I5OA 1U04A 1VDZA 1U0OC 2OCLA 2P0EA 2X23A 5DIZA 3W04A 3IT2A 5JIBA 3T9CA 2IIBA 1VDMA 1EFVA 1T36A 4HEHA 4M8IA 4OKSA 3WMRA 3T9FA 2OHOA 4MWGA 2JFQA 2ZTSA 4GOMD 1BMDA 2YS6A 4GX1A 4ZAGA 3WJ1A 2W2PA 1JR2A 4A27A 1NL3A 1UJ2A 1O94D 1OI4A 4F60A 4LGMA 4NZYA 1P80A 3FNFA 4MWOA 4REQB 2BBTA 2ET6A 1XMXA 4FC6A 3BHIA 4ND4A 4FN4A 4ZAZA 3HVRA 5HP4A 1YAHA 2RHJA 5DN6D 1D1SA 3M9WA 4B0PA 1T1GA 2V59A 1SA0A 2AW5A 5H68A 5IYZA 4QVGA 5LM3A 4Y2JA 4RVNA 4D8VA 1OFUX 1AUQA 4PYLA 1JJBA 1NVDA 1RI5A 5J4LA 1C7EA 3B5JA 4W5WA 2R7LA 4R1QA 1G5RA 3FUWA 3AB3A 1BMTA 3R6WA 4DRZA 1Q7GA 1JWLA 1KGSA 1T5BA 4AIRA 2MSDB 4N03A 2GERA 2HQSA 3ZX5A 3RROA 1FLDA 1PD1A 4QL3A 2DWUA 3D2BA 2R48A 2ZSDA 2J0SA 3UHPA 2QVGA 3O38A 1JBQA 2C94A 2Q6LA 2VP2A 3IRUA 3AXTA 4Q9IA 3ZV3A 3TTUA 1J2EA 1I2AA 1FF9A 3PR3A 4UTZA 2J5KA 3ENVA 1W6RA 4J7UA 4RADA 1CIPA 2H06A 5TQ2A 4LXIA 5DNUA 7REQB 5GJBA 1N2HA 2YXPX 3IHLA 3VSDA 2VPTA 5HBGA 2GN9A 3V8NA 4YREA 1FCJA 1EM6A 1QDLB 1Y1QA 2QP3A 5KQLA 1YRQA 4JITA 3ZJUA 1V8DA 3HG7A 4RPIA 1EB9A 3MG9A 4ITUA 4PS1A 2Z98A 3FDZA 3I58A 3IAM1 3N28A 3TSOA 5K4GA 4EI7A 1IN5A 3IALA 4GS5A 2WWRA 3Q3VA 2H52A 3RVPA 3C3CA 4MARA 4JODA 5AR1A 4DT1A 5H0IA 1Z4IA 4B0OA 1MIOB 3K4HA 2A9KA 2O3SA 1I4TD 1W35A 4RIIA 4R31A 1D2HA 1FFCA 2QMZA 4C43A 3DV2A 4OPMA 2XPCA 2H9AA 1TZCA 2P69A 3MXOA 4N9WA 4OGWA 3RS2A 3TRKA 4YRZA 5M2QA 3DBIA 2FSSA 3V6LA 4F7WA 1PZGA 3UMYA 5DYIA 5B53A 3PUJA 3VKWA 1EX9A 2FEAA 2D74A 1T8PA 5AM3A 1KKMA 4JC5A 2ZBRA 4D79A 3EVDA 4B40A 4K6OA 5DOVA 5B5SA 4G1VA 4DV3B 3KEOA 5DDIP 3C39A 3QUAA 4IINA 4MQBA 3AJ9A 2IF0A 4KMOA 2ROQA 4XEUA 4YV7A 1V8OA 2QRPA 3NT4A 1M2KA 3AEUA 5BRAA 2ES4A 1YDEA 2YVUA 4G4GA 4ROSA 1EGMB 3T5GA 1D09A 3OHMA 1N6KA 4MGKR 4CQMD 2GHRA 4JI5B 3TM5A 1ZZEA 3NPAA 5FNVB 2OENG 1HNXB 1WP9A 2UUAB 4X64B 5T7BA 2A6PA 3VH2A 1MC1A 3SHVA 2WM3A 4H3SA 4RUKA 1QRRA 1A1VA 1ZGJA 1WF6A 1Z47A 4B6FA 2ADOA 4DR3B 1A72A 5E2AA 3O8NA 1T9ZA 2OHHA 4S3MA 5JMWA 2Q4DA 5KTKA 3QHPA 5AWFC 1OX4B 4WGFA 4K9KA 1SD1A 5IS2A 1GAXA 2QWXA 1XUOA 3WTBA 2JH3A 3VYTB 5AKKA 5JSKA 1IM8A 4M8KA 4C2TA 1QNLA 4I36A 2NU7A 1UADA 2G1PA 1P77A 4CDRA 1FLNA 4KNYA 3K9CA 3GT0A 4JVLA 3IURA 4KE8A 3COPA 5C5IA 2REQA 5H16A 1P1HA 2VJMB 3UAVA 2OWEA 4HNAA 4BAGA 1OTHA 4H77A 4PCVA 1I1HA 1HG0A 2YIJA 4YRLA 5D8DA 1CUIA 3P26A 2CDBA 5KNBH 4Q9NA 5HTKA 5JATA 3V4PB 2UDPA 1SK9A 5T64A 5CH8A 1HZZA 1MAVA 1E3SA 2X3YA 2AOVA 4EFDA 5C8DA 5D51S 2Y1GA 3DM9B 3QKSB 1BW9A 4UREA 4F4IA 3RC8A 1YE3A 2IY9A 5JQGB 2J9FA 4U6NA 3RC1A 1NYRA 1CUCA 3SEZA 3A4LA 4ZCQA 1A0OA 1QRDA 3AHFA 3G5MA 4JROA 1C3LA 4C29A 1X0VA 2VR1A 4GPTA 4X3CA 5CB6A 4GM0A 1VMIA 2W7TA 5EHNA 4ZU6X 2Z95A 3NI2A 3DTVA 1M6VA 2JLZA 1DO2A 1L7VC 1YZNA 2ATVA 1ZUD1 2WFMA 1ZN8A 2RAFA 3G02A 5AJVB 5M29A 4BB9A 2A9OA 2VO1A 2JRLA 1AXEA 1R15A 2HLPA 4AB1A 2Y1XA 3EK2A 2QUBA 3AERB 3JQAB 1D2MA 2DJIA 2NTYC 2C42A 3NTQA 4WDQA 4Z0TA 5BWNA 3QYJA 4BRUA 2KQUA 4WV3A 3EE6A 1IY8A 1WXWA 1XQVA 2B69A 3R3JA 4ADSG 1P5RA 4Y2RA 1BDHA 1VM6A 1QGUB 2GAFA 2Z9DA 3RHFA 1W2WB 1LI5A 3UV7A 4A03A 4GQIA 1IEQA 5F23A 5J5CA 1HZZC 1RT9A 4YLGA 3ZWPA 1BJKA 1VJCA 1WSBA 1GNQA 2JHPA 4LZLA 4XVQA 1EK1A 4YJ3A 4G0UA 2W71A 3SJUA 5JZVA 3VOTA 3HUTA 1SVLA 1RLOA 3IOBA 4D4MA 1DBIA 1QIMA 1EVIA 1K0FA 1ZM7A 2R1UA 2VDNB 1GG8A 2PGAA 3F9RA 2HLDD 3L7NA 3PNBA 4RZXA 2PQ0A 1OQAA 1NLMA 2P3QA 4GP9A 3TGWA 2F9MA 1SXPA 2P5TB 2ID4A 4L7VA 1K6MA 3L4KA 4BL5A 1U28C 2Q5IA 2YRWA 1QCDA 1OVGA 2GLXA 3PGLA 4I5FA 4BFVA 2GTHA 5LXTB 1KY5A 4GI5A 4WBNF 1HC7A 2V3CC 1J1IA 3OZXA 2WSBA 3NBKA 1Q1AA 3O83A 2C5SA 3L8FA 3D7SA 4TT8A 3IXLA 3OE4A 4L08A 2HEGA 4EY7A 3KBBA 4B3XA 1KK0A 3NHWA 1EZ4A 3REGA 1WO8A 4QA9A 3H5TA 2DR3A 4XJSA 5CAEB 2PZLA 5DNCA 3CF2A 2WAXA 4IJUA 4CFYA 2EJUA 3VPHA 3W5HA 3CLTC 1AV7A 4KODA 3O95A 5GQSA 3O82A 3X2FA 1MHTA 3DHEA 2RONA 1DWPA 1YZQA 4BS9A 2P6MA 3VV3A 4HL6A 4MUYA 1CJKC 4IIJA 3DOOA 4MR9A 4Y0AA 4XPIA 1O4VA 4LC9A 2GXSA 3MRVA 3RYIA 2X0NA 3BDIA 4A73A 4QJIA 3KQLA 2BMJA 2CGEA 4DXDA 1DP4A 3IRVA 4ACAA 4FLFA 4JNKA 4IX9A 3PJGA 4BV2A 3CZQA 1RCUA 1F6DA 2PYIA 2YIDA 3BTOA 3PB3A 3D7MA 3S27A 4LDAA 5CA0F 1NJ1A 1Q95A 3V2UA 2ZREA 3AT1A 1N3YA 3VUFA 1RC0A 1TECE 1V8ZA 3AP1A 4WQMA 3TB4A 1LVUA 4F5EA 1H4SA 1WXFA 5KNDD 3KCQA 4WFKA 4YMWA 2QIPA 2Z2KA 1RZUA 4QDXA 2HMYB 1PEAA 2O7VA 3CM0A 4AZWA 3UJNA 1M67A 2A9PA 1F60A 2DPYA 1TM1E 2JFBA 4PTLA 4C87A 4IDOA 3HLTA 4D8XA 3U6KA 5J1SB 4ARIA 2RGDA 2VH5R 4B45A 4R9VA 3DE1X 1E0JA 1OA0A 1NJ2A 4LJSA 3RS5A 1OZAA 4EVRA 2X8WA 3SP1A 1XD2B 3IKVA 3IL2A 3SJZA 1E2QA 3L1VA 1V4BA 2HDOA 2AOTB 4G0QA 2BKEA 1Y9ZA 2CXTA 3GOQA 4X8OA 3G9QA 4GC5A 2K2WA 1KGDA 3ZBTA 4OXQA 4BFLA 4CG3A 4EHIA 1OH6A 2PQ2A 3H4VA 3F9IA 4M9UA 3OQNA 1ZN9A 2ENWA 2HA6A 4LVNA 5COQA 4AX4A 2H1WA 4GG1A 3THYA 2Y8EA 2GM4A 1H6DA 1WB5A 5JEDA 1W4RA 3IODA 1V95A 3OHSX 1Z17A 4DUGA 3TIGA 2HHCA 5J9FA 2F8MA 3L8DA 4GOOD 3DDCA 3MYRA 1GKUB 2Q3LA 4DIEA 3RVOA 1IBLB 4AZ0A 3Q3IA 1LPSA 4U7WA 1JR3A 3SXPA 5JSZA 4S2EA 1I0IA 3BRCA 4KQ9A 1DIOB 2ALJA 2O20A 3HY6A 2DZDA 3OWOA 4Y6PA 1K27A 2XE8A 2Q3MA 1ZGZA 3L7BA 3E5NA 2C77A 5CEFA 4GBED 3KOWA 1GSIA 2MT9A 4FCVA 1HOXA 4PWZA 1B93A 1XU7A 4Y6OA 3IDSA 5HF9A 1G8GA 4ZEVA 2EYUA 1LQ2A 1ZISA 4QOHA 4CEIA 1XAGA 2W6IA 4OM8A 1XROA 1PV4A 1BJTA 2CNLA 3G23A 3ZC3A 3PXCX 1V37A 1R2QA 4QFDA 3N8IA 1GUAA 2VTVA 1QANA 5CU7A 3QV1A 3WHLA 4KN6A 2QKYA 4K40A 3R7WA 3QXJA 1EUCB 1RPAA 1RWVA 3ND9A 1XQ1A 2W2OA 1I10A 4EKGA 3VO9A 4IEFB 3T1QA 1IN6A 3A4YA 5LCXA 2KBEA 4P4LA 3OQIA 2CE7A 3ZLTA 4H0NA 3VC1A 4DIFA 4D74A 5E6UB 1RAGA 3IOEA 4L50A 1L7PA 4A0FA 4UEWA 1GG2A 2UZIR 3LDGA 3RFXA 3E3OA 3BUSA 4NMMA 3DBVO 4RMHA 3CF6R 1K3TA 4TZ6A 1R8JA 4CU5A 1Z2PX 1Q1BA 1KOGA 4M60A 3JSXA 1E2NA 2JIRA 2ISQA 2IUEA 4D9HA 2QS9A 2JFYA 5C4MA 1IHPA 4NXMB 2ZBQA 3X3HA 1NW8A 3OQHA 2ZUWA 5B1EA 3A27A 2YXEA 2O19A 1UK7A 2QRGA 3UCEA 3BXPA 1VLZA 1PLJA 4YFYA 5IU6A 1JKJB 4ZREA 5GGXA 4OXRA 5E4TA 4BZPA 4R41A 2F3RA 5EZYA 2X7HA 1JYFA 4IILA 1C41A 1HL3A 1G9SA 4Q9HA 2OBXA 4YWJA 2R11A 1JVNA 4Q3DA 3ZTYA 1GAWA 4BLQA 2C2KA 2GPYA 2F62A 1D0IA 1TCVA 3GFVA 4C0XA 4EMBA 1DE0A 1KTIA 4Q4HB 2BFWA 3L5OA 2PXAA 3OZRA 2B4AA 4H16A 3FW1A 3HMQA 4CEHA 2H1FA 3FPKA 3DLBA 1CUUA 1WZEA 3CX7A 4GDMA 4NQRA 1QTNA 3F1KA 2BGRA 2EF1A 4MUEA 3ZDRA 3FF4A 3QTBA 2AYYA 4MTLA 1PUJA 1VL2A 5K4AA 1GRRA 3FUTA 4I7EA 4QSMA 1M1ZA 1L3CA 4LI3X 4EGJA 4YALA 2XB4A 2VYFA 2H1IA 4UHBA 2Z56A 3AF4A 1TUIA 1MQ9A 5C80A 3D4BA 1Q7TA 2CVQA 1U3CA 3Q41A 3E23A 1HE2A 2BM1A 5EHGA 1NBMA 2QW0X 3DKKA 5C5DA 1NG9A 5U4XA 5IKPA 2ZRNA 1JB1A 2P30A 3ZQ6A 3DAFA 2PO5A 3O94A 1GHTA 1E7MA 2FE1A 1VFPA 1E2HA 3CFYA 1YS1X 4WH0A 5L51A 3QUCA 3VPBA 2Q1UA 3N8DA 2G09A 3CUYA 1J21A 4CE6A 4DV2B 1KDOA 4KWTA 1ZD2P 1D4ZA 5EMHA 2GF2A 1DXYA 2ODAA 2VHTA 4H9GA 4KBGA 4LRQA 3TI9A 3ZCRA 5EQJB 1OLSA 3CZPA 4KUHA 1JAHA 3WA7A 1F2UA 1Y6QA 4JV5B 1H05A 3CNLA 1G8SA 2CHQA 3H65A 2FW7A 3B7GA 1L5HA 4BNVA 3I1JA 4W8OA 2JRCA 2Q2QA 3LOQA 2GUGA 3HK2A 1FLAA 2SCUB 4FBLA 4GF5A 1QZXA 1RWMA 3S7ZA 4F1JA 4C22A 1U3DA 3GRPA 5FWYB 3H1FA 1AUOA 4DMLA 3ZJTA 1P3DA 3H9CA 2VAVA 3E7XA 3HBMA 2XB6A 3K0AA 1W36B 1UQUA 4Q4AB 4EQ6B 2WPDA 2Z43A 5IBCA 4BLVA 2WT4A 3GJXC 1M83A 2P0YA 2RGBA 4OL9A 3MB8A 1LUAA 1VE3A 1EUDA 3V1MA 2BM8A 5AHWA 4POAA 5H4HA 5U1PA 1DOHA 5A0FA 1QLJA 3IHWA 3CLKA 4F8YA 1Y42X 2TMYA 3WYBA 1UBOS 1U81A 4R7ZA 4HEA6 4QGSA 3KQQA 4MYHA 1Z2CA 4P58A 5L7YA 3R0ZA 4OHVA 4P5EA 4R9UC 1NBWB 1KFBB 2IP4A 4WKOA 1H5UA 1Y7LA 1Z4NA 3L18A 4ZODA 4G6ZA 5LIPA 4RWEA 5ECDA 1IQ0A 1PT6A 4BCCA 3LBAA 2JLQA 5EGNA 3RFCA 2YCBA 4M0PA 4UHCA 2YMPA 4DREA 4PVCA 3FLEA 2Q0XA 2FWBA 2WYIA 5EWJB 5AW0A 4TRMA 2XRYA 4L9WA 4Y9SA 4Z3KA 1WUKS 1U7HA 2IYSA 4YCDA 2AD5A 2FQ1A 2FWMX 3B6JA 3IVCA 3VYVA 1RXYA 5CCBA 3GEHA 4HWPA 4WZZA 4EW1A 3DD1A 4QYTA 2ON6A 4MW7A 3MLEA 5TPWA 2ICAA 3W5JA 1T1JA 2C2YA 2WUVA 1IUNA 4GPBA 4JYCA 5CGQB 3CLHA 1X1CA 2R4QA 3QYPA 4HTAA 4IQGA 4Y9TA 1C0EA 1DIBA 2FX5A 4EUKA 1II8A 2OCBA 4ZOBA 3NGXA 1SXJB 3KWFA 1IXRC 5DNDA 3WLIA 4D8YA 5CJJA 3HNOA 5CM2Z 5AOBA 5CTJA 4HNHA 4UEOA 1KKUA 1C7FA 3SOPA 3KSAC 1C5KA 2J7KA 5K1ZA 1H2FA 3FPGA 4IX1A 4PX2A 4KHPB 3SF8B 1TQDA 2Z8ZA 2NSJA 1NVMB 4TQAA 1EVLA 1TIBA 1K68A 5B4VA 2V03A 5YASA 4CM8B 4RK0A 4DNFA 1RPZA 3HY3A 3O75A 2VHZA 4O4IF 4CFSA 2O0KA 4PZYA 4BBZA 3MWEA 2HK7A 2H31A 4MV5A 2VPQA 1UP7A 2NTEA 4QUBA 1KSHA 5EKTA 4R9NA 5FWAA 1QUFA 1NP7A 4W1PA 2Y0CA 2OVFA 4FEGA 2B34A 1I4EB 2IL1A 5C2JB 1XEFA 1YQXA 5HA5A 3FUCA 1YHNA 1NVXQ 3EF1A 1QR2A 2JCGA 2QU8A 2V6JA 1NW3A 3EGDB 3G0DA 3VU1A 2M1XA 3DV9A 1TPYA 1YB6A 3SM9A 4RVOA 5HM6A 4H1TA 2A5LA 4BLUA 5HX7A 4J4HA 2QL7A 1MLDA 5J59A 2WBLC 5AM4A 4ESOA 1BKDR 1N5DA 2O2CA 2XMSA 4Z1MA 1MTZA 4MVJH 4NENB 4LGCA 2X77A 4N5NA 4Q15A 4BNLA 5LL6P 1ZUHA 2D1RA 1E98A 3JD1A 4JOQA 5AJTA 1J2RA 3TLYA 5B3JA 1UWCA 1ODJA 3NVAA 2I7VA 1GZ7A 1D1PA 4GNKA 5FA6A 5CDTA 3OLZA 3WK5A 5CD9A 2VBGA 4DCMA 4FK8A 3RIHA 5JDCA 2DUNA 4J03A 5BWLA 1GTJ1 1XZAA 4K9QA 4V24A 3W2HA 3AI7A 3F49S 1Z5VA 3IOMA 3ESXA 4OHOA 1H2XA 2IEBA 2GPNA 5F3DA 4CMKA 3RANA 2WUGA 2XRFA 4L4XA 4LJ8A 1USKA 1ICEA 4ZICA 2NYVA 4I3HA 1W88A 3RAEC 3K70B 1OJLA 5AIBA 5ICEA 3U9LA 1T2FA 1OYOA 1IPFA 3EGXB 3HUEA 2PG3A 4HGZA 3BICA 4CIBA 2I7CA 1N2BA 1EXDA 2PANA 2A67A 1O89A 1CS0A 1ISRA 4ECAA 1FQWA 1P0QA 3DW1X 1ULSA 4MUMA 1SIBE 4Z9BA 4NDAA 1XRNA 2IEAA 3NEPX 4DSTA 1YCGA 1X87A 2C5HA 3IMKA 3WNQA 2FSIA 3N2NA 4HDOB 1P2GA 3C6ZA 4BMSA 2R00C 4WNAB 4C4XA 5A7FA 4K9RA 1FP2A 4KKVA 3D3QA 3NJ4A 3HXKA 5B3JC 3GFOA 2B4QA 1AN0A 3KUDA 2R60A 2RHRA 3HCWA 5HR5A 2BMEA 3PPWA 5D85A 1OFGA 2VZ8A 2R5WA 4DANA 1MRSA 2ZIFA 4LJ9A 2R6GA 3QVOA 5JDCC 1KWKA 1JHQA 1WG8A 4Y9DA 5L6MB 1DKLA 1XDDA 3SSMA 3AHJA 2IXAA 2CD7A 1CUGA 1GUDA 1EAMA 2ZJ5A 3KB1A 1N9KA 4OHKA 4IL5A 2Q5FA 1BG6A 3T9AA 2REXB 3MBKA 4X1KB 1YFZA 1A76A 1RYDA 2HSZA 3ILSA 3QOFA 1X8JA 5EIBD 3HWWA 3N5CA 3P9SA 4OJMX 3SS8A 2QRZA 3CLSD 1YFKA 1CW2B 4QWWA 2I6QA 3UA4A 3ZE9A 4YAOA 3I42A 1KVUA 4DA8A 3G2IA 1TK3A 3ANMA 3K9LA 3B6KA 3NBYC 4PLHA 3KV1A 4R54A 1E9DA 5JJ5A 5A62A 1GAEO 3HXQA 2RHBA 2GETA 2Z09A 5L3SB 4LWPA 3Q8KA 5GONB 4W5RA 4ETIA 2IQ5A 4OX9B 1OAOA 1Y8RB 1GEGA 1KEPA 3ZDBA 3CR8A 4QU8A 5H59A 4K9DA 4ZP1A 1WPRA 1Q77A 3MTBA 5IJAA 2O1EA 5GAJA 2HRBA 1FNMA 5BSTA 3VO1A 3GK3A 1RI1A 1Q17A 3PFWO 1JXQA 1Z6ZA 3RW9A 3WYGA 1JU9A 1PTKA 2WG2A 3EB9A 3IO3A 2QNRA 3EZFA 4GZ6A 4D4IA 1YFJA 5TX7A 3GZJA 1QX3A 1ZX1A 1JP7A 1UC8A 3LCRA 3T99A 3TFQA 4E2YA 5KYWB 1FUUA 5A4KA 2PHZA 5JUWA 1R0RE 3CKMA 1WDMA 3MWFA 1U1GA 1RBQA 5FI5A 3HY4A 1NSTA 2IFTA 1AKQA 2XXJA 2ATXA 4LCJA 5HIJA 5TQVA 4WWHA 3JR3A 1LD3A 4UCXA 5C7LO 1SC4A 1T6XA 2H00A 4LZJA 3V8VA 1TTTA 4LSZA 5KSOA 1S3FA 3GG9A 3Q88A 1WPQA 4WN9B 2QR3A 4F2DA 5T67A 3NKFA 4PNZA 1XFDA 4QOGA 3VTFA 1JDJA 1BRTA 5EJ5A 1J1ZA 1G5PA 1VMKA 3H5RA 2BDUA 1HR0B 1P7CA 4G07A 1OAOC 4YMTA 5IAOA 1F14A 1PX0A 2VPWA 3KLBA 1E94E 3LC7O 5G1NA 1NI5A 3QX9A 5JS8A 3F6BX 3H5NA 1LFDB 1E3MA 1EYZA 2NXEA 1CY2A 3H11A 1SBIA 3FRIA 4R7TA 4XVHA 4YP9A 1Z0FA 1PJSA 3BKWA 1OFVA 3REOA 2EC5A 3C1TA 3RADC 4ARUA 4PZLA 1AO3A 2WLSA 3KT6A 1L1RA 1P0FA 2BEUB 1E96A 3NMUF 3RVKA 1RWOA 4LISA 2ZIXA 3ZHRA 4CNBA 1UINA 1IN7A 2GJAA 3FYSA 2N47A 4CLHA 4HDQB 5IZCA 5JNLA 3KJQA 1EA7A 3V4VB 1XNJA 2MINB 2NSLA 3QX3A 2EERA 3COVA 3HA3A 4NH4A 3R3VA 1TU4A 2DCMA 1TLTA 2GM3A 4YLYA 1R64A 5ABPA 5LU9A 2F1OA 4V2UA 3NATA 4HH4A 3H8JA 3MXTA 3PUHA 4JT9A 2CE2X 2W83A 2ZS7A 3Q98A 1P1JA 2P27A 1T9KA 1NT2A 2AV6A 3PNMA 4LBZA 2B5WA 1U7WA 4HV4A 4XYGA 3N39C 3WXBA 2QT1A 2YV4A 1OU0A 2V9ZA 5HRUA 4RXUA 4H7PA 4Q48A 1U7UA 3HZZA 3NX4A 4NFYA 1OZFA 1SHLA 1Q16A 2JGKA 3O26A 1S2IA 1FPQA 1PEYA 1FNBA 2OD2A 4A5SA 2GNOA 1NR7A 2GFQA 1A2KC 3R8XA 2MMCA 1ID1A 2AHRA 1RADA 4C0WA 4LRXA 4W4TA 3UHFA 4C3UA 4OTZA 5LA6F 1ZVMA 3AINA 3PIIA 1BKYA 5CLFA 3OTQA 1S02A 3PT5A 2C31A 3RIYA 3X1DA 1SQGA 2H4WA 3I1FA 4M8LA 4UBKA 2CC2A 5IZCC 2VT7A 3U4HA 3OICA 4Q7KA 4PG7A 3U3ZA 3SDZA 4ZMSA 5I3CA 3QU2A 3Q40A 3ND6A 4EWLA 2WU8A 3ZDAA 2JFNA 1GPBA 2R6CA 2BFAA 1KU6A 3EFBA 3KLOA 4E30A 4B1FA 4FYVA 5TR9A 3PHBE 2BN4A 4IHQA 4MMXB 1HWYA 4FJ1A 4BBJA 1UODA 2NQ2C 3Q9LA 5EERA 1R5JA 1KR5A 5FT9A 3T54A 6GPBA 1V2GA 2FW0A 1HMPA 1LDNA 2HPZA 4LMPA 3NHFA 4G4JA 4UE3S 4YQEA 4XOIA 2O2IA 2VP3A 4QQNA 4BQRA 1GARA 3G9UA 4TV9A 1LRJA 5KTSA 3S40A 1GL6A 1B8UA 1XFAA 5E6SB 1YIOA 2AUNA 3RS7A 2MJLA 4X62B 1N5IA 3F3YA 1ZGAA 2Q5QA 3Q5GA 4X66B 1F2VA 1M1UA 2G4VA 2JHCA 2X5NA 4R9RA 5BV2P 1EXWA 1TA0A 4WKPA 3HNPA 2H08A 1UZUA 3U3MA 2BGJA 2PYDA 4KAXA 3V8RA 1YBMA 1FSZA 4I99A 3VGJA 1A98A 4DUZB 3VKGA 4RL6A 4UKDA 3SI7A 1CFZA 2PMKA 4AYTA 3NTLA 3ZXYA 3RE1A 4GXTA 3QBDA 3JQ7A 4W5QA 2H4YA 3NTVA 5DX8A 1WY7A 3BZUA 3G49A 2VRNA 3EAFA 2LZ0A 3G8AA 4IWYA 2GZDA 2PH1A 4TTRA 3SHOA 2YC2C 1CUAA 2JBAA 3D8UA 1IB0A 1Z5OA 3IQHX 1U8ZA 3M5WA 2B1IA 1MO3A 1V43A 1CD5A 1JQEA 3IH5A 5FBVB 3DFUA 4ZHQA 3E2PA 3EH2A 4OMFG 3R7NA 3UK6A 1U0FA 2WA2A 3ORYA 3DBRA 4Z49A 1RZRD 3HU5A 3UJDA 3DMTA 3B1YA 2QE7A 4QNMA 1XRMA 2Q4TA 4DW8A 4DRXA 2PWBA 5JEEA 1GQQA 3WRYA 2HBQA 1SXQA 1QG4A 4RGQA 3QEMA 3ESCA 2P9HA 4CKWB 2WABA 1SG6A 1VE7A 2BGTA 1PI3A 3E9CA 3L04A 3QBEA 1T0PA 4R2MA 3UIEA 3ODPA 4DCGA 5CA0B 2CT8A 3K2BA 1A77A 1ADGA 2JIPA 4P35A 4OYHA 2R6HA 2QRLA 1XZLA 2WP8J 2GSDA 2R6ZA 2A1UA 2ZQZA 3OIGA 4CWAA 4DLAA 4QODA 4DWJA 4EW2A 2I4MA 1EUYA 1U3GA 3EWIA 3H6GA 1DRVA 2G71A 4F71A 3SQWA 1T5LA 2GNPA 4FEAA 2FUG6 2NVWA 5K6AA 2YXDA 2ZJ2A 4Q3KA 3NB0A 4IIDA 3A1VA 2IEDA 1OAKA 3LKVA 2YBEA 1FU8A 4L28A 1N0VC 3HJAA 3O4FA 2AMVA 1I4LD 2G6TA 4UBOA 4EG6A 2J67A 3NHJA 5I5GA 2NU9B 4DA9A 4BXOB 3DMTC 5B4TA 3Q72A 1BIFA 4LK3A 1PV1A 2O2GA 2HU7A 3WRYC 2JLCA 1ONBA 2OK7A 3O47A 3SC4A 3VFDA 1FTQA 1UBCA 1YHZA 3IHTA 3BFXA 1G2PA 4DHWA 3QVVA 3I30X 1JNYA 3ECSA 4QOEA 3UAXA 3UC9A 4QVKA 2CJPA 1YR6A 2W2NA 1E4YA 5KTOA 2O1SA 4DCPA 4ECEA 4FDTA 5KTNA 4G1UC 2NMVA 4FYIA 5KTMA 4S1VA 2AFIB 1SXJE 2FPGA 4W7SA 2WYUA 3RRJA 3AVOA 5K6AC 2OAGA 2QTTA 3MD0A 2BFOA 5TT1A 4V1CA 3GZNB 2ZYAA 1CY7A 2Z3ZA 3HCBA 1E1QD 4EA6A 5C1PA 1USIA 3D8NA 5DWVA 4EPVA 5BYKA 4TS4A 2Q8NA 3KOYA 5IAEA 5HF8A 4CLXA 4DMFA 1Z2OX 3RSHA 4UTPA 2Q0QA 2LXNA 3HCOA 1OU4A 2P4HX 2V7UA 4PE5B 3D59A 3MPUA 1O95A 4U39A 1N34B 2AEFA 4NJOA 4OMUA 3OEHA 4F85A 4JLJA 1QB8A 5ALFA 3E4CA 3M70A 4HN2A 5LWHA 2FP3A 3FYCA 1I4DD 1V8PA 4XDGA 4RKQA 1NUHA 2F4NA 3LQ1A 3MJCA 3A36A 5E9QA 2CHEA 3IXMA 1Z4OA 4QBGB 4DCCA 4NJMA 4ABTA 2WAYA 3UAYA 5J4YA 1J8VA 1KU0A 2X7XA 5C35A 4C88A 4L3OA 4QTUB 2IYUA 2RBEA 3X1WA 2BGNA 2GAJA 1LX7A 4UDOA 2VNAA 3DQZA 2GPJA 1M8KA 4FMCF 3SC6A 3LW8A 4OQDA 4Q02A 1XN4A 1J8DA 2VUUA 3FKQA 4RIHA 1KMMA 2HJ9A 1NUAA 3IE0A 1YI0A 3G82C 3DZ8A 4PYIA 4U5QA 5ALUA 3TPFA 4J4BA 3W3ZB 3OIWA 1NNSA 3P96A 4GI1A 4LYFA 3NWEA 1UM8A 2ZDGA 3NXSA 4GXQA 1KZ9A 1OE0A 2FEKA 3ORRA 5A5VA 4QIHA 2X7JA 1JH8A 1GG9A 1NZJA 1UAAA 1PEKE 4ON9A 3QMPA 4RCVA 4BMZA 3E7PA 2A9VA 2HIMA 4QVIA 4RM2A 4ND6A 1RJFA 4AY3A 2J5BA 5ITSA 1EQUA 1XWFA 4G5HA 1MG5A 4Y3UA 3RBZA 1ZMBA 2WQ6A 1T5SA 4YRKA 1NW6A 1HOTA 4RSGA 5KYUA 2DUJA 3HWX1 1T2CA 1E5TA 3QP9A 2Y76A 2YYAA 5HCIA 2ZAMA 5FNVA 3PKIA 4S24A 5BWMA 1RDFA 3IMEA 4Y7DA 2JJYA 1VL1A 4BFSA 1AGNA 2JS7A 1M2GA 1P1BA 3UV6A 4I55B 2VHXA 5EXPA 3NAGA 4QD3A 4RY8A 1T4MA 1XXHB 3KXLA 1M2OA 3FOAA 3U49A 3VX4A 4D41A 1ADBA 3HDVA 2ZRMA 3VR5A 3LOPA 1N3BA 1OX4A 2ZBGA 5EUCA 1D5WA 1T3ZA 3WB1A 2IZ1A 3PIDA 4LW8A 3NPMA 4D5EA 5GJCA 3DMDA 4IXMA 1Y33E 4R4JA 4B9EA 2DQ4A 1QV9A 3QENA 3VDRA 2OMEA 1E6EA 3BIJA 5AK0A 4ZQIA 3TBHA 2A84A 1CG6A 2QVLA 3P2IA 4FW8A 4QUGA 3AJ8A 3ISVA 4O59O 5HXAA 1JECA 4E2ZA 1E1MA 1E2JA 2VJMA 4OJKA 3BWEA 1GDTA 2GRUA 1AHPA 3IP8A 3BMQB 5H02A 3TR0A 1R9NA 2GBFA 4OA5A 1E2KA 1YB7A 4GM1A 3VYUB 4GSLA 2H59A 1FYFA 3C85A 3ELUA 5AK6A 1KAOA 1VIYA 2NVBA 2YZGA 3AUFA 4JYMA 5ANRB 3VI4B 2WIJA 3GJYA 4CV0A 3DXXA 4UUPA 2CV1A 2EQ5A 2BI4A 3QKSA 3KUKA 4XFJA 4LECA 1W25A 4GPZA 1H4QA 3DYVA 2OXCA 4QHYA 2RHCA 3CIOA 4E5SA 1U0RA 4BEWA 1FXWA 2V5AA 5CIWA 1QPZA 3RIEA 2F43B 5FA5A 1C7QA 1E7SA 2ZJ1A 1TW3A 3KVOA 4HEJA 4C3VA 4QM7A 4KLNA 4CLEA 2E7ZA 3QPWA 4NU0A 1XMOB 2W6JD 2XYVA 3WB2A 4FKBA 3GRZA 1YVPA 2FTKE 4BBAA 3FNQA 3FWNA 4O5OA 1V0JA 3C8DA 2IIQA 3PYXA 4H7FA 4DZZA 1E3LA 4EX6A 4N3GA 1WIWA 3BK2A 3FTCA 4J9UE 1ORIA 2AJDA 4YAWA 1LSOA 1ZJ5A 2V8OA 2FFAA 3PHCA 1TJNA 1ZL0A 2O1WA 3ZU5A 1GQRA 2YX1A 3D81A 3ZXIA 5JYCA 2CJWA 2DH6A 2B2NA 4R8LA 2CFTA 2O3TA 1P4AA 2VJPA 4PF1A 3G7UA 4KG7A 3E6AA 3O5AA 1THMA 1M2NA 1C3OB 1T8TA 2BZSA 3G1TA 1C8BA 3KDPA 2OFFA 2X41A 2Q3CA 1OVMA 3ORFA 4IH9A 4OIFA 3KKNA 3O74A 4FB5A 3GLVA 1ZJ4A 3UO8B 1YFLA 1JFSA 2ID7A 2MMGA 2NLOA 3KRTA 4NV1A 1IULA 3IVRA 2ZTMA 3LNTA 5JAQA 5CPBA 1XAJA 1JG3A 2R6AA 3GAFA 3JAKB 4DVGA 1NAHA 1RLMA 1IY9A 4EY6A 1KSFX 3HB5X 1MO2A 2OGUA 2IRWA 3K94A 3E2MA 3S55A 2K4MA 4L72A 4AK9A 2ZULA 1BOOA 3E5HA 5EJIA 3O9MA 2AD1A 1L1FA 3O4GA 4M1QA 4HVCA 1NOKA 2Q3EA 3TLKA 2OSBA 4E4YA 3ER8A 3BX1A 3IA2A 1Y8ZA 5HBRA 3W06A 3AB7A 3IGFA 1YJBA 2P9JA 3GDOA 2G8NA 4Q1CA 2VF8A 4Q6WA 4ZHSA 2WNHA 2JEYA 5BO5A 3I6YA 4PINA 3QWIA 4ZGBA 1QGYA 3RWMB 1L2TA 2COEA 5BURA 3ICOA 1VC2A 3X1JA 3L9XA 1IL0A 2J33A 1OXBB 2O2HA 3FBGA 2W0MA 2RC6A 3BH0A 1JDPA 4HX5A 3WQBA 3IEVA 2JZCA 3INTA 3T3GA 2CXHA 2VQSA 1SIOA 2XOKA 2ADMA 3IPLA 4NZZA 3KBOA 4O4IB 2HCBA 5EY5B 1ZITA 5F52A 3VHRA 4FYWA 3KQHA 2XNJA 1BEZA 5JH7F 1L4FA 1KYIA 3SG0A 3T95A 3GEGA 3DPSA 4PPNA 1A9SA 2PMBA 1OCEA 5F98A 1R74A 2PVCA 3GPLA 2O4CA 3OUUA 1OI7A 1OV6A 1VJ1A 4MYTA 4KB5A 1U02A 1ULUA 1Z56C 2DKNA 1N9GA 2FZKA 3LW7A 1PZEA 1SVIA 1U8TA 2JPDA 4CKEB 4CF4A 1C7RA 3IAFA 5DI3A 4FMDF 3ZKAA 1EZ1A 1U9ZA 1QFJA 3IJEB 4B71A 2R47A 3TSAA 3UJ8A 4I6EA 3FLBA 1O6FA 4JOSA 1SGWA 2NSYA 2JVKA 3EFOA 1TQ2A 2LNDA 3UB3A 5JU6A 1ZIXA 1KQOA 3OH8A 1IBRA 1QIEA 2PS3A 2CLCX 2FMIA 3GY0A 4FTWA 4UAGA 1FW8A 4E5MA 1M1NA 1C7ZA 1N77A 2CHUA 3DOUA 2XNHA 1ZM2A 1CEYA 2QT0A 2NX2A 4PLWA 3ZWVA 4HYYA 1GLVA 3GRUA 5ALKA 4GGPA 2XCRB 3PDIB 1XKLA 2VYCA 5DSTA 4F6RA 2IUTA 4KXYA 1XTVA 5AJUA 1FOEB 4JVNA 1BDJA 3TSZA 3H2ZA 1AD2A 2VP4A 3N2GA 4KAAA 2V5VA 3G5UA 3L7AA 2QUJA 3DAOA 4KC0A 4MO2A 3I12A 4KWIA 1O9GA 4RY2A 4WOJA 5DEIA 1VIDA 3P4UA 2K6GA 1FNDA 1H5QA 2OL4A 1O9BA 3NC4A 4FIDA 2NTJA 4JX9A 3JQ8B 2XKKA 3K73O 3PD7A 3DUFA 4R71A 3DZDA 4HQRA 4JMLA 4E70A 3CSUA 3ZUPA 2E5FA 4NNJA 4TZKA 4LDZA 1ZK2A 5IMSA 1VGVA 3K31A 1PS0A 2GARA 1HE8B 1CDZA 1FS4A 1ESCA 2DRIA 4M0DA 4Q16A 5CHEA 3RVBA 4CLRB 2ZJFA 3PXGA 3FROA 1ECJA 3UY4A 5KWSA 4JHXA 1YRLA 1NTRA 1SN7A 1ZOOA 2JG3A 1Z13A 1ZMOA 3ADCA 1IATA 3R5FA 3UC5A 5JZOA 1QIGA 5C8YB 3N7TA 1EUCA 2EQBA 2LUOA 2B9VA 5DHAA 4QPJC 1ZXXA 5GM2A 3VJLA 1ZHOA 3TZCA 2QPLA 1KMIY 3PUYA 5EMLA 5E7QA 1P2BA 2CXNA 4BVHA 2PXHA 1KBOA 3QLEA 4UFPA 3Q5EA 1NVUQ 3V1YA 1BWQA 1SOWA 1CP3A 2NYRA 2FRVA 1UDBA 3V1UA 3BFVA 3K5IA 2C2GA 2YJ5A 1OZGA 4CT5A 4PAWA 2BYTA 2RK3A 3WKBA 1MB0A 2HNKA 3D1VA 3ZCXA 5BV0A 1NV9A 3AX6A 3NEJA 1RU3A 3L46A 3EAGA 2PRZA 3L6BA 1KDYA 6LDHA 2WQ7A 2PBFA 3K92A 2B4KA 5BWBA 3G2KA 2EFCB 4KBYA 5DLPA 2A5FA 2ZROA 4L51A 1JQ5A 2F1IA 1P4JA 3P20A 2QF7A 4J16A 3EIXA 4AU1A 2OEPA 1GTZA 5JRDS 1VIVA 4YMUA 1HKHA 2EKQA 4LZOA 1RM3A 1T0UA 4ZT4A 2YYZA 4OKIA 4CG1A 4JLUA 4JI7B 1Y1TA 1R16A 2UKDA 2XITA 4JBHA 1PWZA 3ILHA 2WNIA 3KAJA 1ODFA 3NWOA 4UHKA 3TKAA 1W5BA 2HF7A 2YWEA 4TWIA 3S5UA 2PQ6A 1O0CA 5P8WA 1K8ZB 3K4QA 5JY6A 1SBHA 3NHZA 2AW3A 4RZUA 1Q0LA 2VEDA 3A28A 4X20A 8LDHA 3OE5A 1O6CA 3PXEA 3BGSA 3I4CA 5TPZA 3HNRA 1JHYA 4C0LA 1PDWA 4Q34A 5D87A 3ZHSA 2D3WA 5K01A 2MYNA 1DQZA 3HWRA 1W44A 4IJVA 3IIJA 2AFIE 3T7EA 1LLCA 4UOQA 5IK2A 2KX7A 3RJTA 5HDQA 3UKDA 1RPTA 1RBMA 4YX9A 3O4VA 5FLEX 2GS9A 3EY4A 3LP5A 2D8AA 3NAZA 2PBLA 2C9YA 5E4YA 3JD3A 1C1XB 1NVBA 5EG5A 4J16C 4AWXA 1ECCA 2DFTA 3UAOA 2H7XA 1EFPB 1VIAA 1DO0A 2F1JA 3D6MA 5T6MA 5A9RA 4R81A 5EHZA 2J87A 3KYDB 3LCJA 4GZLA 2BJVA 2HJWA 4FLMA 4RANA 1PNQA 4W7HA 3VZBA 5KKAA 4JYZA 1XTJA 2V55B 2V54A 4I4TF 1NA5A 2XGGA 1XE3A 4NBVA 2NXJA 4NWIA 3RFUA 3Q8MA 2A3NA 1GN9A 1M2HA 2GDZA 1B6SA 4NAHA 4C76A 4JQCA 2J9ZB 1DEAA 2HJSA 2R7NA 5FHRA 1FFAA 2PUWA 3F6RA 5EHIA 4L16A 2VTEA 3NDRA 3LPLA 4XWTA 4RHXA 4BTVA 4ZI7A 5BN4A 2IDKA 3ZCQA 4EPYA 3I1YA 1CUZA 4HAVA 3UA3A 1GUFA 1USUA 1HYHA 1SKQA 4KAJA 4D96A 3ANSA 2ZE6A 3RRYA 4ZIRB 1M5UA 2DF8A 4X1YB 4CR6A 2VHCA 1DAFA 2CNKA 4XA8A 3TW0A 2VHQA 4X54A 2R4TA 2YMMA 4Z0HO 2QYHA 3E3LA 3BH7A 4CKBB 3HFSA 2DTDA 2PZGA 3HM2A 3U16A 4WBXC 4O08A 3TMAA 3SEFA 4DYHA 4QZVA 2G5CA 4D2IA 5EP4A 4XLZA 1JLLA 2AJTA 1KI6A 1OA1A 3R0XA 4UM9D 5DLQC 3U80A 1BSVA 4B3BA 4DG5A 3AYXB 5JAPA 3EWAA 1JAZA 2WWGA 1H4TA 3EFEA 3H9UA 3N0WA 3QF4A 4Z4GA 1EH5A 5CHYA 1E77A 3V33A 4YYZA 2ZVJA 2BR3A 2RGNC 3IV7A 3L7LA 2KYRA 3RAJA 4CI0B 4EB0A 4EGAA 4RTOA 4PX3A 3ZVRA 5KC8A 2Y6UA 3UYKA 3B89A 1WHSB 5I8WA 2RHOA 3ZIUA 4Z4CA 2JL1A 2O8NA 5LA6B 2XWPA 2WPNA 3GF4A 4HGOA 4BWVA 4A9AA 4XB1A 2H1OA 3FOCA 2QT9A 3BM5A 3NNSA 1KYWA 2EP7A 1X8XA 1EP3B 2JFVA 4GYYA 5FBZA 4DV6B 1CLUA 1QHYA 5L7TA 2QD1A 2WJYA 3O8OA 4KUEA 4P6VF 4ZCLA 5J3JA 5ERGB 2F3PA 3QKRB 2XA1A 2DPMA 1P2TA 5DCYA 2PMEA 2BTQA 1L0BA 1XXHE 4E08A 2CJFA 2ONKA 2QUKA 3OPYB 5FPYA 4KCGA 3CR3C 5DCWA 1XQXA 3I8OA 4XWKA 4AUKA 2GA9A 1CUVA 3UKOA 3I0ZA 4CDNA 1XJCA 2P1DA 4RA6B 4P92A 1LBIA 5KX5A 1QRSA 3D6VA 1JR6A 1B3BA 3GL9A 2MYUA 3HUFA 2QYOA 4NG4A 4NOMA 1JKIA 1UM9B 1SNYA 4Y2VA 5EIWA 5ICGA 2NU6A 1QAOA 5A03A 1EEXB 1K6EA 2ZRBA 2IXTA 4XIJA 3NDBB 2GLTA 1ZESA 2A0FA 3WB0A 4MJLA 4P4SA 2BHRA 2QJRA 1ZWLA 4OLBA 3HKCB 3T5CA 1OWPA 3P0FA 5MHTA 1MAWA 2R84A 1U2PA 3BMCB 3V8MA 4Y1RA 1EK6A 1F06A 3QOYA 1L5OA 3W9SA 4KQMA 5D6NA 4DEYA 1RXCA 1TYBE 2P9EA 4ZK2A 3KJNA 2WSYB 1N1EA 3DDNA 3ER6A 2ZRCA 4D9EA 1U6JA 3RYCA 3D6AA 3OZUA 3B36A 2GF0A 4JJ4A 3AR5A 3EGDA 2DFKB 4FYXA 2PMFA 1RRGA 3C4QA 3RJMA 5B58C 4TYYA 5FEMA 1ZSVA 3NZEA 4I3FA 3RYHA 1KIMA 2IHBA 1XJQA 2IHTA 4HGPA 4BX2A 1OD6A 4ZC8A 1SXJC 2QN1A 1IRXA 2AFVA 1THZA 2JJQA 4FGJA 5GV8A 1JWAB 2RHHA 4CIDA 4TL9A 1V1MB 1KK2A 1TU0A 4ODIA 1IXYA 4B7UA 5T41A 2CUNA 2FEOA 2ERYA 2B7CA 3IUSA 5BQOA 4XJVA 2Q49A 5HE8A 1XPUA 3O4RA 4EKYA 5JCXA 3NW9A 3AUTA 2WKWA 3GB9A 1QWSA 1G8YA 1N8KA 5EOVA 2FH5B 1F4LA 2ZTVA 1OY1A 4RK1A 4BCDA 2AOXA 3D2CA 1XQWA 4UNQA 4PC7A 1W0KD 2XB9A 2XGSA 2FG7C 3O9VA 5EP3A 1JBKA 2J31A 4ZT6A 4ZEOA 3RU9A 1ZR4A 3JVEA 4N8EA 4WOKA 1J2YA 4GXNA 1Z7EA 1KBQA 2QRQA 5EJFA 1C0IA 3WGKA 5KNBA 4F9TA 3R9WA 3TG8A 3OVMA 3VMFA 4JASB 3WLLA 2B7LA 2WA1A 1GXSA 3UOGA 4KQCA 4QO7A 3WKEA 2R62A 2Z58A 3UXMA 1EUQA 3GX1A 1NE2A 3KJGA 1ETUA 3ZWYA 3ITDA 4FJ2A 4L0DA 1XU4A 1L7NA 4NONA 3PPYA 1PS8A 1W87A 2I6TA 3I9OA 3NWJA 1YVEI 4RVFA 3PL5A 2X0IA 2ZVQX 3PXBA 5MN4A 3ECAA 3MWYW 3U31A 1A7JA 4JSTA 3BWDD 2ASVA 1EX7A 2J9YB 5BMOA 4RQUA 1WXEA 1RCFA 1NONA 1V5WA 2E18A 1SH7A 1JEEA 4WNAA 5LUBA 3NHAA 5LB4A 4OGFA 3FUVA 3KKPA 5EE1A 3K0HA 2WJPA 2UUCB 3H9GA 4DA7A 2BZ1A 1WPXA 4N12A 3LDAA 3DA8A 3SLRA 2WWTA 4XD7D 4KE7A 1QTIA 4YP0A 1EMDA 2Y68A 2PV7A 1TFUA 4G1EB 4JD5A 1BNCA 4RO0A 3LA6A 4W1QA 5EXTA 3V4SA 4S0ZA 2CMHA 1ATZA 3SIXA 1KZ7B 1K5PA 2J5XA 5FV7A 4C30A 4EHAA 4YQFA 2JHFA 3CNQS 4XM1A 3IDQA 3KDSE 4B34A 5L4SA 4KDCA 2HO5A 4LSMA 2AG1A 2VOJA 3IE2A 3D02A 3KFXA 1N36B 4GUAA 2W6OA 4LF8B 2SKCA 3ENZA 3N8HA 3AWDA 1YE5A 2Q4EA 1CRPA 1S2LA 4MWZA 1WWKA 2I2DA 2QUHA 4DNOA 3GWZA 3M6MD 5ES4B 1GQFA 5A0TA 1CEXA 5IEBA 3B6ZA 2Y1FA 3QVTA 4Z4FA 4JXZA 1VL5A 2XWBF 1IHUA 5FBWB 3EWNA 3OA0A 3GH3A 1TO6A 4OP1A 4BIMA 4V0NA 1V1RB 1VECA 2ZFUA 4G5OA 2EJCA 2W4QA 4ZQCB 3FOZA 1XG5A 2VSXA 3ENWA 4UAVA 3LTEA 1Y37A 4H7HA 4RLFA 3AI1A 2YJGA 1CT9A 1SM4A 1FYWA 1P4SA 4OOFA 4G09A 1IVYA 3GI1A 1A5SB 3IEKA 4D0SA 4UHEA 4V03A 1Z9BA 3DWGA 4N0DA 2J0EA 3R23A 7GPBA 2HCJB 2RHTA 2Y6VA 1TE2A 4HDRB 3R44A 4FDLA 3IQZA 1TT5A 3V8BA 3BGDA 1B00A 2RAVA 5B7GA 3W5AA 3H13A 4WD3A 3PGKA 1EHYA 2G9RA 5FL7A 4DABA 2JLWA 3CMCO 3AIKA 2JFWA 2PH7A 2QI9C 3DMGA 2QORA 5CDUA 5HKAA 2FGJA 3KKQA 4RZ3A 5CB4A 4YHHB 1A3CA 2G80A 1LSSA 1RJWA 4JYBA 2HMSA 5ELLA 3NBMA 4M46A 3URKA 3WHIA 3X2SA 2BGIA 2P11A 2QQEA 5GP1A 3DMPA 1XCLA 2OGSA 4UM7A 1ZM3A 2G9ZA 3THOA 3TSWA 4EH1A 2HW8A 4US2R 1DC4A 1R6XA 1NASA 2JLSA 3AF2A 4FDVA 4B6SA 4KO2S 4Q3CA 5G41A 4UXIA 1EB8A 2QLFA 1EFDN 3A6KA 3PHLA 3KKLA 5DIFA 5F33A 2CLFB 4O2RA 4DMHA 5JFGA 3PICA 1RLJA 3NRBA 1SVUA 5CVEA 3ISJA 3WLFA 1MMFB 1G4UR 2AYZA 4LOKA 3SQMA 4INOA 5I4IA 1PYOA 4LYHA 1QHHA 1KBZA 3PS9A 4CPDA 5BQPA 2IHNA 3VC2A 4QJ4A 4M1MA 2ZRIA 2I55A 3KUXA 2XYRA 3ESRA 5HZMA 2HJGA 3QLVA 2PXXA 4ZDIA 1XHEA 1KI1A 1X70A 2QD3A 2V9PA 1FP4A 2W8BA 3MN1A 3MOSA 4BQQA 4UPEA 1CY1A 2MINA 3COJA 3IBYA 2DVMA 4C4ZA 2ZBVA 2QR5A 4GBGA 5EWMA 2B37A 1KMNA 2HJRA 1PJAA 2HXSA 4XX1A 5EKSA 3DZJA 4E7OA 2WDPA 2FSVA 1L9KA 3ANYB 3IKLA 3A7DA 4G8JA 4JUDX 4U2GA 1AG9A 2IEIA 2JFHA 4TTAA 4UMEA 5J2UA 2HWYA 4JYPA 3TLGA 5K3FA 2G3YA 3O2JA 2K5UA 4YV1A 1UT8A 4QU0A 2OUKA 1C4KA 1NC3A 3FTNA 1CC1S 1AQJA 3U9SA 3N7UA 2A94A 4I5IA 1KJIA 3GVCA 4G26A 4IJ5A 4PZUA 4D8TA 3LSYA 4RKWA 1J56A 5JXGA 4X24A 1UT5A 4EA7A 4INZA 4OO3A 3F7MA 1JHUA 2XQGA 3PCXA 4TVBA 3VR2D 2PBRA 1VSBA 1UJMA 2AG5A 2COUA 5IJ0B 2C0QA 2IYWA 3L84A 4YGYA 3BRSA 4AJ4A 5IUNC 3CEPB 2VCHA 3GUVA 2GOYA 5CD1A 2ZP1A 4A16A 5IC5A 5A6SA 1WZUA 2QLNA 4H7EA 1DDIA 2H29A 3QLVC 4EAAA 4FHEA 4YUYA 1HLFA 3G9ZA 3RTDA 4BZXA 4EQZA 4UNRA 1P45A 1E3WB 3CUVA 3OTWA 2OXTA 1J39A 1NSYA 2I34A 3RFFA 3PSHA 1XLUA 3TW8B 5A4DA 1AS3A 2FSVC 1SCNE 2JFPA 2RSLA 3M1LA 1KZHA 3KYBA 3OU2A 3S6JA 4D5GA 1XZ8A 3F2VA 3T3EA 1SCIA 2VHVA 3DGFC 1NW9B 1UBNA 1TUBB 4MICA 1SBNE 4UDNA 3SHWA 3U81A 4C0AC 4O6VA 4JH0A 5DGCA 1XLWA 1YS2X 2QMUA 2P2YA 2H4JA 3O93A 3TRJA 4YPVA 1KVSA 1CQIA 2ODQA 4RQBA 5C31A 1PVVA 2AC7A 4YBRA 1MG0A 4ATNA 3DFMA 4TMKA 4BVEA 4G0PA 1TMGE 1TD9A 3UQYS 4RPCA 4PBSA 2P2DA 1RXUA 4H2DA 3U56A 4Z4QA 5DI9A 3GEMA 3RM3A 3I2GA 1AUXA 1E6WA 3SYLA 4R1LA 4UMDA 2AK2A 2FUCA 2PFKA 3V9AA 3WNDA 1Y3IA 1PX2A 2MSWA 4I9UA 3K1ZA 1DTWA 5ED0A 1G8FA 2I1QA 1T5IA 3DO5A 3FGOA 4IR7A 4O3FA 5BSFA 4L5BA 2P40A 4RLQA 3U09A 4KXWA 2Z08A 4ESVA 3EJWA 1P4GA 4O5AA 4LSGA 5CG1A 1IRIA 1NMZA 1ZU5A 2AVDA 2OBBA 3NHYA 3TNDA 4BFTA 4K9PA 4CBVA 2C58A 3M6VA 4QDTA 4ZYLA 4QGBA 2W8ZA 3WDKA 1YV9A 5EWLA 1TTHA 1VI6A 2I2BA 4DXAA 1HV8A 5JZ9A 1SQFA 4HEA1 2EATA 1F1BA 2X0EA 3B1FA 5EJ7A 3THWB 3VZPA 4JJ7A 1WXGA 2XJ4A 3HCRA 3LT0A 4NMWA 2L2QA 4R8RA 1X7YA 3IT1A 3JZDA 2OV3A 1PQ4A 3O8QB 2BUCA 4PHFA 1PNVA 4RPJA 2P6OA 3F5MA 3HYRA 4REMA 3KTDA 2OYRA 4CKWA 4A1OA 2G40A 1LW6E 3KCNA 1TZJA 1YVDA 2ZM6B 3KUCA 1C4WA 5E8RA 2IE8A 5J2TF 3QXXA 3NOXA 1LBEA 4CL2A 5JH7B 1DWOA 1IHDA 2L18A 1QRTA 4LHEA 5GM1A 3KD3A 4MKZA 1I7LA 1VG0B 1NQTA 3CXUA 3F8WA 4I1YA 3DEZA 3AVQA 5WRFA 4R2HA 3GRCA