4RL4A

Crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
173
Chain Sequence
b'QGHMKRLEVSNQAKLPTQFGEFYIQCFREKGSKDHLVVFTPNFSQNPLVRLHSECLTGDALGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKVNAYALQDKGYDTIQANEMIGFKDDERDYSVAGEILEYYRIKKMRLLTNNPKKIAALEKYAEVTRESLIVCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP cyclohydrolase-2
publication title Structural and biochemical characterization of GTP cyclohydrolase II from Helicobacter pylori reveals its redox dependent catalytic activity.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 54
structure length 173
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.5.4.25: GTP cyclohydrolase II.
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00925 GTP_cyclohydro2 GTP cyclohydrolase II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10990 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rl4A00
2BZ0A 4RL4A 2BZ1A 4I14A
chains in the Genus database with same CATH superfamily
1H6AA 5F7OA 1ZVVA 4RFSB 1UBHS 4DQKA 4FGLA 3ABSB 2GBLA 3NBQA 4N12A 3V4SA 1JXOA 1PR5A 4NBWA 4WRRA 2BP7A 2MSEB 3DP7A 1I1NA 4BV2A 5JZBA 2WMDA 3NV7A 1R0KA 2CJFA 2I29A 3J7AC 2O50A 4JWTA 4L57A 1DKLA 4ZCPA 1T43A 1M1YB 4DSNA 4TVBA 5HJ5A 3QLUC 1AMOA 2F4NA 1P9LA 1M2JA 4H2DA 3CO5A 2DX7A 4KIUA 4F9FA 1ML3A 4KK3A 3KYIB 4OL0A 1G18A 3G0BA 1X1QA 6Q21A 1I24A 2IHJA 1YZUA 4MJ7A 1KAMA 1ECPA 2B9EA 2ZB4A 3RKUA 3IR5A 4L4YA 3BREA 3SSAA 4QOSA 3GEBA 4CZ2A 4DHWA 1MJNA 1ZXBA 1I5RA 1L8XA 4EMBA 5BSTA 1DC7A 1H4QA 5J2UB 2V7XA 2OEPA 4YV7A 4CEIB 3G0GA 3H5IA 3UUGA 2XLCA 1Z4NA 1L5VA 4ZVLA 3RS7A 4YV1A 3VUEA 2P27A 2APJA 5FI5A 2R4TA 3AERA 2DUJA 1RADA 1D7AA 3EIXA 4NSNA 3RKSA 3TJZA 1N6LA 5CA0B 5IT0A 3P2IA 1U9IC 4KGXA 4XD7D 2VYQA 2BFDA 1MR3F 2GLXA 3FFBA 3VRHA 1GPBA 1BFDA 5JTTA 2F64A 3V4VB 1SB9A 1L5OA 3SYRA 4Z4GA 5KQLA 1I9CA 2FMKA 2V7TA 1UP4A 1JS1X 3EEFA 3PC4A 2QTTA 4HI0E 3VR5H 1QHYA 4YMIA 4Z8YA 5ALYA 1JIQA 3O95A 5DGDA 4R9NA 5DNAA 3ZZ1A 5JFOA 2C2BA 3AUYA 2B34A 2B20A 3MEQA 1Z47A 3QKSA 2I7DA 2YV5A 2UYOA 3D1LA 1E3TA 2DULA 1SXHA 2W43A 2BLNA 2NU6A 2EV9A 3W3AA 4Q3BA 4ZPXA 2O23A 3T7TA 4C20A 5BVGA 1KH1A 5JYDA 1X9GA 5JC8A 1XL1A 1RRMA 2OD7A 3PHGA 3WO0A 2O0KA 2OWDA 3V2UA 3HCEA 5DTJA 3W5VA 1P80A 2OAQ1 3F90A 3IELA 4JT4A 4FBGA 4KV9A 4OXXA 4MGKR 4QDOA 5I5EA 2CNKA 2VJOA 3GD5A 3VO8A 5DJ5A 4OK6A 3EPJA 1QH9A 4I14A 2ZT7A 2I4IA 3PE6A 9ATCA 4AWXA 1ZL0A 2NSLA 1C7JA 3BGDA 5I01A 1Q14A 4ZOLB 4R6XA 2CEAA 1C1HA 4LFAB 2AWOA 1RXVA 2W4QA 1DCFA 1T9BA 3F2VA 1YU6A 3SKVA 2QTBA 3R5SA 1J2JA 3FAZA 1U8FO 2R8ZA 3M9WA 3N0TA 4IMRA 2JJYA 3AZQA 3BCSA 1JNXX 4L9SA 4P54A 2F4VB 4KGZA 3GARA 1EIZA 2B3TA 2NTYC 5M04A 3RJ5A 3JRXA 2PG3A 1I3NA 3ZVKA 5HCIA 1XD8A 4M83A 4DCUA 3K0CC 4INPA 4KGVA 2GNOA 5CT9A 1E77A 2KS6A 2O48X 4M4SA 4BVHA 5EMHA 1HYHA 3CXRA 1SCAA 4XM2A 1XRPA 4JEHA 4AZ0B 1Z22A 3L79A 4F3NA 3TUJC 5CAEA 3Q10A 1WL8A 4NABA 1CFJA 5KQMA 5IH3A 2R6HA 4O8ZA 4L74A 4P38A 4AG3A 4IFIA 4YDQA 3U0VA 1UBNA 1OYYA 4J1TA 5LDHA 3K9FC 3OKCA 1R0RE 3HBMA 2CC2A 4R9RA 4UE3S 3AUTA 5BQOA 1ZLXA 3VC7A 3D8SA 2AVDA 2DPHA 1AHHA 4MUXA 3GV0A 3UICA 4UNRA 1XLVA 2D74A 3RT1A 3WYAA 3UG6A 2IVFA 3NR2A 3G2NA 2V8BA 2PMWB 4EVIA 5SZIA 3KKOA 5CFOA 3T9EA 3VBCA 5H02A 2A30A 4DCJA 4DDKA 5KAMA 1XTBA 1T35A 4QNRA 2JHCA 1UMKA 3G2QA 2B4RO 2E4XA 3IAS1 1GAJA 2J07A 3CEMA 5LZ9A 3WLMA 1W88B 3N1UA 2VJLA 3GLKA 1Z74A 2ZIAA 2QX7A 4BEWA 4N5LA 3G59A 5I9LA 1NR1A 3DL0A 3CZ4A 3A6LA 5JAQA 2O14A 4KYUA 1LDNA 1Y9ZA 1W5EA 1GRCA 1H8HA 2C97A 2ATXA 1QG2A 2F2TA 3QV1A 4HFMA 2ZZMA 1B2RA 4ZAGA 1PNVA 3JD3A 5LIRA 1Z4IA 3MRVA 4ZOAA 2CE2X 1E1NA 4M37A 1XD2A 3A6FA 2GM9A 2XRFA 3T1VA 4CTJA 4M0DA 5K05A 3H5OA 1MB2A 1T2UA 2AXNA 3HY6A 5KNDD 4DAOA 1JPUA 2AOTB 2JCGA 4I2NA 4EG8A 3MS4A 4TMKA 4PAMA 3ZWDA 1RJ9A 1N6RA 4KVFA 1Y82A 2YV3A 1WBBA 2DFNA 1H6DA 1GU1A 4IAOA 3GLQA 4P08A 3V7FA 4IR7A 3ER6A 4NICA 3D3WA 3OIDA 3PX2A 2E5WA 3PR1A 4RPLA 3FUTA 5HMLA 1W4LA 1G1AA 1VIAA 5JXIA 1E2FA 2FQWA 1X2EA 2BUBA 3D2BA 3A06A 4FHDA 1EJ6A 3GAAA 4R31A 3DVQX 1OSNA 2XDQA 1V9LA 3R6DA 3WL6A 1B00A 3KL2A 2A4MA 4GZ6A 2UZAA 3D1VA 3AHFA 4WFKA 1VL5A 1N25A 4N40A 1P1CA 4YYZA 1YI1A 2XDWA 3R0JA 1P5RA 4IUCS 1P81A 2PL1A 1U8EA 2IZOA 1CCWA 3EISA 2I0FA 3A6DA 4DA8A 1QV9A 1AD2A 1Z45A 3KT0A 4UUOA 3EWIA 3K1AA 3NTOA 3SC4A 4CKCB 1IBCA 1HTTA 1FB5A 3HXMA 3C4JA 2QVCA 3KHTA 3LDFA 5CTJA 4M8SA 3ADKA 5A3VA 1DU4A 4P92A 4RETA 4BDTA 1E2QA 2F7SA 2VSFA 2RGYA 3PTLA 1RLOA 3EGIA 4KQIA 1BRMA 2ZPAA 3UK1A 4Q9IA 4CG0A 3SE7A 4BMVA 1V35A 1Y81A 1US8B 5E9WA 5BXQC 3HXOA 1FXWF 2HHHB 2ZUDA 1Y3CE 2GLUA 3VZCA 2WFAA 3ROKA 3WGMA 2C5FA 2LUOA 4JJZA 1B76A 4BKUA 3TK1A 1HA3A 2WIBA 2Y6VA 3CTMA 3GLVA 1VJDA 3PA6A 1SVLA 1UT5A 1W2GA 2FUEA 3QFFA 4K1LA 4TXHA 1QGYA 1X15A 3OE1A 2QVLA 3UJAA 1BOOA 4TYYA 4RTRA 1L5SA 2B7CA 3D0KA 5JAOA 1EUDB 3UXEA 3H8WA 2XTJA 5EXXA 3R3WA 3GPCA 4NBTA 4TYMA 4XWTA 4Q6BA 1NVKA 5F52A 3EAFA 4LYJA 4DUGA 5A2QA 1U3VA 2X5NA 3CF2A 1U7DA 1NVWQ 3JQBC 3ICWA 3DMFA 3P1JA 2GAIA 2D5LA 4KBYA 1L5FA 4P82A 4WA7A 3ZZUA 3K0KA 1ZUNB 5KVSA 2R47A 1U99A 4WBNB 2ZBQA 3DYVA 1V1JA 1Y42X 3ZIAD 4FYIA 3RG8A 1LU9A 1XZDA 3WGNA 1G42A 1ZGBA 1XCBA 2Q5EA 3A3KA 1WQ3A 3WGKA 4B1FA 1C7QA 1ZLYA 2RKWA 4EJFA 2B1RA 3RFXA 1UZMA 5JSHA 4Z8XA 1UCFA 1YDWA 1PYOA 4N01A 1XRLA 5LD2B 2PH5A 1GAQA 2ZAYA 5H0IA 3LVQE 4OXQA 2Q5FA 2HDWA 1WXXA 2E7ZA 3BHIA 3U7RA 3KWFA 4LISA 5BSWA 1D1QA 3REQA 1MJFA 1ZC3A 4I5IA 3L18A 3VJMA 3UEOA 1KQPA 4GRDA 1PQWA 1KYVA 3EVZA 3P2MA 3I8OA 2AMYA 3WB1A 4DPMA 1FFEA 2PDAA 2OUIA 4F5EA 3U4QB 2CFTA 2H17A 1Q6ZA 4KH1A 3W6UA 2WVAA 2ZQYA 1ILWA 4P5PA 1ODJA 1YAJA 3QVXA 1S2GA 1FYWA 1FXUA 2AW5A 4HN4B 2L42A 4LC1A 1W8DA 2PYDA 4L8GA 4DZRA 3SD7A 1G8AA 3LGXA 2BGKA 3TBFA 5CFPA 3DPUA 1CRZA 1P7ZA 1RBMA 1X1DA 4QUBA 2NSYA 4XWYA 8ATCA 1TM5E 1DJLA 3TOZA 1SUSA 2QX9A 1I4EB 5B1HA 1VPLA 5G41A 5HIIA 2ORYA 4O4JF 3D7SA 3ZOZA 4LX0A 1LWNA 2GARA 1Z83A 3I04M 3DDHA 3K1TA 4V0QA 4YJFA 2C7VA 2GCIA 3GK3A 1N75A 3ZXXA 1TEXA 3FYUB 2YS6A 3VTKA 2RGCA 1PJRA 1Y89A 3KWLA 4C29A 2AN5A 2FDRA 4ZKDA 5GTDA 2JANA 5ADWA 4LFBB 5FULA 5BOSB 1PW7A 4OQ4A 5LKRA 1FMTA 3E4CA 1XWWA 2GTHA 1OWNA 4S24A 2GA9A 4L0QA 4RX1A 3SN6A 2WSYB 4E0BA 2E6KA 5K0SA 3L5OA 2DFVA 4WDQA 2CWWA 2GPSA 4PSUA 1AF4A 4HP8A 1E2DA 3FCEA 2C7OA 4IOJA 4R81A 1XU7A 2G1JA 3ZJYA 2V4ZA 2W48A 1XI2A 2PEYA 3R8XA 3RSQA 2QN9A 2WWTA 2X42A 2AJBA 3E1SA 3SQMA 4D3XA 1U28C 3JD0A 1JQ3A 2D1FA 5TC4A 4S12A 3WLNA 5BNIA 2MHCA 2VP9A 2FEOA 3AO0B 2X1VA 1V95A 1TFRA 1YJQA 5SZKB 5KYWA 1BMDA 2FFBA 3WYCA 3ZBQA 1E2JA 3DO5A 3HPRA 3HUTA 1YDFA 4ZVSA 2DWPA 1BAPA 3ZGXA 1P0CA 3V8QA 2FW9A 3P32A 3HBJA 5CPFA 4IKOA 4CCWA 4CU2A 2XJ9A 2ZJAA 1B6GA 2GGSA 5KTOA 1TD1A 4KQGA 1N2GA 5TX7A 2BUAA 1PUJA 3W5IA 1J8YF 1YZFA 3NUGA 4NYMR 4LXUA 4IWYA 1P73A 4E5YA 5I4CA 3FWHA 5AH0A 5I7OA 1HNZB 5KYYB 1GZVA 2B1IA 4GYJA 3U56A 3T7DA 3DR5A 2J3EA 3KALA 4MVJP 3EF1A 2C8JA 4WOBA 1ZN7A 3G23A 5BN1A 3SBDA 3P5SA 4LBVA 4Y30A 3TL6A 2DTDA 4G4IA 3TPFA 2GVZC 3T5GA 4TL7A 2I4TA 2ZI9A 3IVAA 1JFFA 1GUDA 4PGMA 1E92A 3PHJA 1Y1LA 4X90A 5KTTA 3NBMA 3DAPA 1I36A 1CY4A 4PNHA 4UHBA 4LJSA 4CR8A 5AM4A 3LPNA 2CY0A 4J0FA 2C1ZA 1NRIA 4RESA 3E5HA 4EA9A 1UKZA 1RU3A 4R05A 2DTEA 3V2GA 5KYKA 1GV1A 4NXNB 3OUTA 2VVTA 3PRYA 1U0TA 4DV1B 4H4DA 2VUIB 1EM6A 1ZUHA 2ZOSA 4X7RA 4J7XA 3RFTA 1A82A 3GUVA 3AEUB 5JXJA 1OH5A 5JALA 4HAZA 1FZTA 1Z6ZA 3WS7A 2FSHA 4FI3F 3C85A 2WC1A 3DOUA 3B6KA 3TTUA 2PS3A 2GVNA 2R66A 3AI2A 2JJQA 2CVPA 2EQBA 4KX5A 4YJDA 4HNQA 3S4YA 4JR2A 2I76A 2C2YA 3JTEA 4TWZA 3L0YA 2HDHA 4OGLA 3VHXA 3GT7A 4BO9A 2NU7B 3CUTA 2V4UA 4HWPA 4N82A 2IUTA 1U0LA 2GBGA 2HPAA 3F3YA 4IXWA 1Z56C 1ZMBA 5D85A 1ZIPA 3Q3IA 4I4LA 4DM3A 1HTBA 5MN4A 5KU7A 1I01A 1LTKA 2YNMC 1ZCAA 5AUOB 3IPAA 5K0CA 3F8WA 1F2UA 4BFCA 1CZKA 2FQ1A 4F45A 4GVPA 4QJIA 1E1DA 1IXSB 4D26A 2FN3A 4RKRA 4KPGA 4OY3A 1XR3A 1QLWA 4HVLA 1SIUA 5AESA 2VK8A 4C2AA 421PA 3LBHA 4D56A 1HMYA 1XDUA 3QA9A 4ITRC 4MWDA 3TLGB 3L8EA 3DAOA 4PLGA 1RAHA 4W1PA 1KQNA 1AZTA 3A11A 4Q01A 1Y7TA 4MYTA 4EPWA 4JIMA 4GOXA 1KFCB 1N5DA 4J2TA 1XTRA 2Q41A 3OOJA 2EZTA 3HVJA 1PFQA 4GP6A 1S4MA 4RD6A 3AFGA 4RPKA 4UXJA 1KAQA 16PKA 2WJJA 3NTXA 1T9GR 4WCFC 1EX9A 3H1BA 3ZOKA 4Q3OA 5IAAA 2ZBGA 3IX7A 1FLNA 2GJKA 4TTIA 1KI2A 1QHHB 1EUYA 2AK3A 1BWQA 3AHCA 3MJ4A 5K8JB 2O6HA 4DKXA 4QFMA 2O5EA 2ADMA 5KTPA 3E8MA 3K73O 2BELA 4YHBA 5G4KB 4EHLA 3NTUA 3ZXSA 4D3DA 5JH7F 3TB4A 5AW7A 1H3NA 4MV7A 2QU8A 2E6UX 1WEHA 2HF8A 4YMHA 2OE2A 1QJ4A 5F7JA 5IN4A 3UOWA 3O83A 2JG3A 2AFRA 4J0DA 2FE4A 5TVGA 3D6AA 2QTVB 3E22B 4HRXA 1ZIXA 2AVNA 3C24A 3KV3O 4V03A 4WN9A 1U1CA 4TUYF 3IMGA 1BXZA 1P77A 1P61B 4Z9FA 2MINA 4N5NA 4S1WA 2JJ1D 2YC2C 3LNCA 1E3QA 2QGZA 3IQIX 3UT5A 5EPOA 3VZBA 3DAGA 3ZQ6A 1W49A 2MSLA 4WZAA 4UPVA 1N32B 5FPYA 3VISA 4ZEXA 1Z68A 3LZCA 5IBQA 3IB3A 2H1WA 4LF8B 4LK2A 3EZXA 1Q0HA 1DARA 2AC2A 3HKCB 4EAQA 2YN2A 3U62A 3BMOA 1BZYA 3FNRA 3ZY5A 5B5SA 3UJCA 1T5TA 3ZZTA 1H2AS 2QTFA 3OZUA 2Z5LA 3H1AA 5CVTA 2ZJ4A 3FG9A 4ODIA 4REOA 1ISIA 3CA8A 1PTJA 2C4TA 3D6HA 3DDCA 3PFIA 2IZ1A 2A92A 3FTCA 2GCEA 2XMQA 2FLWA 3GRFA 2H08A 2VAMA 1HZZA 3BZWA 3C6BA 3DBHA 3PQCA 4HDQB 3PENA 5A4FS 4EDFA 1DGQA 1A9QA 1C4XA 1JWBB 4LOIA 4DNOA 3V1MA 2PS9A 1QUEA 3L0CA 1QAQA 3ZWXA 1ODSA 4JUCA 2PL9A 2HO4A 3H2IA 3TF5A 2WINI 1CS0B 1A04A 3A4IA 4B84A 3RAJA 2ZAOA 3IUJA 4TV8F 3TR6A 1YRHA 1DIOB 2HSJA 3KJFA 3LXXA 4YMSA 5ALQA 5EL0A 3SBXA 3HCDA 2V7BA 4PAQA 1AQJA 3JD1A 3JZFA 3R7AA 2VBCA 5LA6F 4MHSA 1XZLA 3B20A 3D81A 4JR0A 3WDSA 2YYYA 2IV3A 2BKAA 4ALNA 2HFJA 3L6EA 2FR8C 4X85A 3AVTA 4J4TA 1TAHA 2HMYB 3SQDA 3N28A 3VX4A 1A9XB 3NP9A 1YKGA 1FMLA 1D1TA 1WABA 3HI6A 4GNKA 4II3A 4ZDWA 4A7PA 4KVGA 1E8NA 4YAIA 3UXYA 2J9FB 5CNJA 2CJWB 5CLGA 3PD0A 2QHXA 2XUPA 3HB7A 1IXKA 1D2RA 1N5RA 2XT6A 3LWDA 4FYWA 4K9RA 4CL3A 1B41A 2C0QA 4ZOBA 2IY7A 3OWXA 3RIEA 4E2WA 2DQ4A 1KYQA 4EJSB 5JIBA 1Z3CA 2QRGA 1UFRA 2F3TA 3JCZA 3RD5A 1CQXA 2R68A 4MV6A 4C88A 3KUKA 1SVNA 1WOYA 4H7KA 2X0NA 4D6XA 3I8SA 1GKKA 2JAUA 3W05A 3IDOA 1JR4A 4Y2SA 4AN1A 1LW7A 3VMMA 2ZEJA 3TWOA 3ZV3A 1UXIA 1A8PA 1EH5A 4UCWA 4QJ5A 2NVWA 3CVJA 2WWVD 3IILA 2O8BA 3TMYA 4PCLA 1OX5A 4PIVA 4DXAA 2PNFA 3LS2A 2JC3A 2HV9A 2A3RA 1QQTA 1VJTA 3WK4A 1QCCA 3PNLA 1R9JA 4GZMA 1E9VA 1O0SA 2HZBA 2YYZA 3QUCA 2YCBA 3LQ1A 2TMKA 2JFPA 4IZHA 4UMDA 5ANRB 3L7YA 3UH0A 3ZQ4A 2EHJA 1G5TA 2XGGA 2PGLA 3Q5EA 3RI3A 3SBEA 1DPFA 1QVVA 2G5TA 2PKYX 2QJRA 3KK0A 1ORHA 2C5GA 3DOIA 1IXRC 4ZANA 3T8YA 2QM8A 3MN1A 5HA5A 1DVRA 1PLKA 3GJ7A 3FBTA 2RARA 1MFPA 2WP0A 2NM0A 5CIWA 3T3EA 1NYTA 2EGUA 4NNJA 3ZGLA 3WA7A 4KN5A 2XH8A 5FTNA 2VZEA 1KMHB 4B6QA 1N77A 1KIMA 1G5HA 1O97D 1ZCZA 2EEPA 2HLPA 2IDMA 3CB4A 3IS3A 1YKSA 3KZCA 5C1BA 1N7JA 1E98A 1A96A 4XCQA 4HS9A 5DNDA 1EAMA 5ADVA 3P0FA 1AKWA 3RSOA 2YVQA 2YHIB 1ZOOA 1UPUA 4C4TA 3P2EA 4ANFA 1XMOB 3FZEA 1QYCA 2NOAA 3PDHA 2RG1A 4RPCA 1AK1A 3C6XA 2BCEA 3ML1A 1G63A 4AJPA 1GU0A 3VAZA 1D4OA 3T3GA 1UJBA 4AI6A 1Y1QA 1DLIA 5HFJA 3LF1A 3EMDA 5IDVA 5EXTA 3TX6A 1BMTA 3E61A 3FNGA 4DMUB 2WFMA 5L3RA 4FONA 5EQJB 3RF6A 2FXIA 3W34A 1X80B 2XAAA 2WLTA 4G5GA 2JFGA 3GLRA 1BYIA 2XUOA 4EZBA 3GPBA 3B1FA 1GG8A 1MJ5A 1I8TA 2ZATA 1U65A 3C5VA 2L19A 2B2CA 3GQBA 1GTL1 1TVKB 1LDEA 1PD0A 2IPNA 5TARA 1FUUA 1IJKA 2V0NA 1K08A 5JVDB 3KLPX 5I7UA 1IM2A 2DR2A 1GNSA 3HXKA 4J0JA 1WMAA 2VHEA 4WKOA 4BASA 3ZDXB 2OFPA 3VKHA 1PJ4A 4GMFA 1SKBA 3OEWA 4PG8A 2VP4A 1FJ2A 1QH8A 3P2KA 1QYIA 4UOQA 5FO1A 1U3DA 4P0PB 5KWSA 3LUCA 3X1XA 2AOXA 1AA6A 1K86A 4GBGA 3FVTA 5A9RA 3BWBA 5AJXA 3TZEA 3IVMA 1DX4A 4BQNA 5DIZA 2RB4A 2XMPA 1U9JA 4MINA 1UEJA 3ZLTA 5JANA 4PF1A 3ADDA 2DWOA 2OBBA 1PG5A 2H1IA 4MJXA 3JVEA 3CX6A 3F96A 1D9ZA 2P8SA 4FX5A 4O4HB 1JVBA 1TF5A 2JVKA 1SVUA 4FFNA 3SEAA 1QQAA 1BFUA 4JQZA 4I50B 5CM8B 2A5DA 3UXMA 1YR2A 3TTWA 3NCHA 2WYVA 4RY2A 4US0R 5D5QA 4F1JA 1KU6A 4LZWA 3PQ5A 4A0GA 5DHQA 4IV5A 5A9SB 1E9RA 3OQHA 2AZ4A 3V9PA 3P5BA 4QLBA 2Z8YM 3DEFA 2C98A 3R23A 4B4DA 4FBLA 2QYTA 5JG7A 3Q7EA 4B3MB 1RKQA 3P2JA 1JIUA 1MEOA 3OPYA 2O3JA 5FNVB 1C1XA 2IYPA 3KYCA 1CUZA 1FFGA 1OAOA 3NBAA 4G84A 4RCZA 4RVFA 5DCUA 5BP7A 2V5AA 1TUBA 1X9HA 1UXJA 3B3AA 3AHJA 3T4UA 2JGFA 3U3RA 3JQCA 3A0RB 1LBSA 1XTQA 1SOMA 1ZNXA 1P1KA 5T6BA 4E31A 2Q5JA 3H65A 4RK0A 1Z5NA 3DUFA 2ZS7A 3KLNA 3KM0A 5EP4A 1VM6A 4QICA 1T91A 3IHLA 3OFSA 4A03A 3E7DA 3MJHA 2RGNA 1H9CA 2OMEA 4M8KA 4FEYA 2QYOA 2X13A 1T5LA 1KDZA 2R6JA 3A1EA 3T0GA 4KFUA 3WGGA 4DM4A 3AUSA 1QORA 5LOVF 4QDKA 3WB0A 1N2SA 1C8KA 5H8WA 1SM4A 3OQIA 4K6CA 3I32A 1O57A 4HMQA 3DTVB 4QPPA 1N5KA 1O1YA 1I0IA 3LW7A 4BNJA 3O1JC 2YQ4A 4CL8A 2F62A 3H5LA 1VIMA 1TCUA 1E3LA 2OHFA 1JP7A 4HQKA 4O4IB 4R2LA 5DSTA 4A2WA 3AL3A 3AKCA 3MTDA 2PSHA 3VOSA 3AF6A 4IHJF 1NVFA 1Q0RA 1CJMA 3HCWA 4JJ4A 4N3BA 3OQ1A 2H2FA 2ZJ1A 2EL7A 1NW5A 4QT4A 3ONWA 1C41A 1IFXA 1WPRA 2D8MA 2GA8A 1OBVA 1AX9A 4FMCF 1O58A 2M32A 2YRXA 3EGOA 2XF8A 4FMBB 4L7QA 4MRPA 3VYWA 1SHTX 4BNHA 5JO0A 3UKJA 5J2TB 3TW8A 3OT1A 5EHIA 4LSGA 2VF7A 5BV8A 1A0OA 3D1JA 1CJUC 1C0EA 2D2VA 2ZYVX 3UFXA 4EB6B 4V0RA 5TPZA 1JFSA 3B13B 1NJGA 4LYDA 2QXYA 1HGXA 2HX1A 2W6QA 5CVCA 3VH1A 2XCSB 1H8HD 1HT0A 2VH1A 2YXEA 3AI7A 1J4AA 1NUTA 2WG0A 4B8WA 1IUPA 2R48A 4YAGA 1ZQ1A 5IXJA 1YZ3A 3IODA 2ASEA 5COQA 2IL1A 1DSSG 2CDNA 2EWWA 2BV3A 1KH2A 2VG8A 2ZJ7A 4X63A 1THMA 2PRYA 3T34A 3CBGA 3DPSA 4RJLA 2H48A 2QJOA 3EXHB 5KX5F 1QDLB 2VTKA 5A3RA 3F6EX 3EAQA 4RL4A 3KYDA 4PQEA 4UBKA 4AO6A 4BE4A 2G1UA 5EERA 3EB9A 5ABPA 1UQUA 1BA2A 2PX3A 4NNOA 1FDTA 1U90A 3QU7A 4DV3B 2CHUA 3HJBA 5KCMA 4HNGA 1PEYA 3INYA 3OOHA 5DNUA 1W25A 1EGQA 4EG5A 1EI9A 2FWPA 1MH1A 4F3TA 5MHTA 1OKKA 1SKUA 3G5TA 5FOXA 3CV3A 1AKRA 1UQTA 4N5MA 5FWXA 5IKXA 2IHTA 2W2TA 3HN6A 3ZVLA 1UT8A 1K7FB 3CF4A 3EVNA 2ZYTX 1DOZA 2IEIA 4J7UA 4HH0A 5HGXA 2Z9BA 4MLZA 2ZI3A 2B4KA 1KMMA 1HUQA 1G8HA 3GUCA 1T4DA 3MQFA 2IEAA 4YPOA 1XNGA 3UHFA 4F9EA 3FSEA 2J67A 4ER3A 1R66A 1W85B 2JD2A 2IGBA 5ERYA 2X14A 3ENWA 3OT5A 4O2BB 1ZK2A 4DLBA 1Z5PA 4DDUA 4PIPA 1VZ3A 2CLOB 2RKOA 1H3FA 1GCAA 2C3MA 4TRJA 1U6KA 3VFDA 5K20A 3HSYA 3C3KA 5HF6A 5BSRA 3IPYA 4H6XA 2AXPA 2GEBA 3CH4B 4MVJE 5HTKA 4ZZ2A 4BU1A 2QUIA 3DDUA 4LMRA 1TDJA 2WSSA 1CD5A 4HUQB 4HFNA 1L8LA 5A7GA 5FBQB 3URMA 1MGOA 3JVIA 4M2LA 5AKLA 3AVWA 1R5NA 1Z0KA 4TYQA 1TAQA 1U8UA 3FNQA 1CSEE 1NUQA 3MAJA 4RVUA 3X2FA 3DLIA 3ZTWA 2BH9A 4MRRA 5H81A 1V47A 2WYHA 2QZ9A 4L4UA 5KHOC 2RIRA 1VL0A 1NVEA 2QPLA 2ZAIA 3DHYA 4JOBA 4MTCA 4WBXC 4AP5A 4CLOA 1U7PA 1WD5A 1ORWA 4Q19A 1T8RA 1G8KA 1QYVA 2Q4BA 3L6OO 4DUGD 1ZGGA 1Q83A 5KS2A 1HTWA 4DR3B 1T2DA 2AT1A 4IDDA 3IVGA 3O47A 3ZVMA 3O0DA 3KCNA 4HB3A 1TQ4A 2G5GX 4KPFC 1E1RA 4PG4A 4F4DA 4D57A 3ONDA 1LTHR 4I4CA 4CV2A 1JHZA 2GZHA 5GOZA 1BCRB 4X1YA 5FORA 4MR7A 4KUGA 4CFYA 3DW1X 2Q46A 3H0CA 1PR4A 3PFBA 4QU0A 5EIAA 4BWGA 4RCYA 2IYSA 2P5UA 3PYMA 4O5AA 5EOVA 1L5QA 1NBEA 2WSMA 3AZPA 3EMVA 4IVPA 1R64A 3W8RA 1JEJA 3OZIA 3MMNA 1W5TA 3MNFA 2NXCA 2WZDA 2CUTA 1RWOA 1NOIA 1LK0A 5DB4A 3EXG1 3UV3A 4DCVA 4LOHA 1CQWA 3GZNA 5LLSA 2OCDA 3LHDA 3PA8A 2PNJA 1FDOA 1KEPA 3NJ4A 4DQLA 4DMHA 4LK3A 2C8VA 4ZO9A 5D3ZA 1CU1A 2GTPA 2Z08A 3K0HA 2HIMA 3GU3A 2C3UA 4QWMA 3UWDA 2PVPA 5ALGA 5ARCA 1RM0A 3T7EA 2Q45A 4BMZA 3N2LA 1WF3A 5KI6A 1XP8A 4C7JA 3KKKA 2DSNA 2NT3A 3ZWNA 2XVZA 2QKYA 1E1YA 1Z35A 2FSVC 2ZSBA 4U7HA 3IR7A 4DC0A 2PWZA 3GCZA 5CP8A 1Q0SA 4EYOA 1AUPA 3EG5A 3BS4A 3ESRA 4LQDA 2FJUA 4RMIA 4BX9A 4PG5A 4PZEA 1P7YA 3GUZA 3G13A 5EZQA 2O8DA 4ZO6A 5T57A 3L7IA 3SYLA 3NS7A 4Z0PA 2QR2A 4QDXA 4XXHA 3L93A 5DP1A 5CB4F 4WPGA 4Q7MB 4DLXA 1Y6QA 3K4QA 4L22A 4NONA 3H42B 1WBJB 3TKYA 2LGJA 4FKBA 5AI9A 1N2IA 5IFKA 2AN9A 4KODA 1GHTA 4IICA 3MT0A 1PV4A 4MHOA 1QJCA 5A5DA 4V38A 2GF2A 1IUOA 3AR5A 4KE9A 4I0WB 2QT0A 4IJ6A 5CTAA 2YKGA 1EK5A 2RAPA 3NPAA 1MJGM 2OGSA 4HN2A 3QEMB 3GLGA 4BN4A 4ZCSA 3WYDA 5BURA 2C4KA 2PS0A 2Q4DA 4ND6A 4YFYA 1QDEA 2X22A 3D7LA 5HGJA 5JXWA 1QH1A 3WC4A 2GLTA 1CHDA 2IQ5A 3OKAA 1EINA 2CFOA 3A2MA 1N6IA 2JIOA 3AG5A 4YNBA 5HIMA 4MX8A 1JLSA 4NZYA 4TT8A 3TCXB 2H4JA 1DELA 1ZD1A 3WVNA 4QUAA 2QN3A 1DLJA 4F71A 3FOBA 1CWUA 1XTKA 2FB9A 2ZJOA 2XVYA 3LKDA 5J4HA 2CF6A 3AH8A 1M2NA 1R12A 4X45A 2Q1WA 4PCUA 1OBCA 4YBRA 1TPYA 4A5OA 4QODA 3SBOA 5K6AA 3WHPA 6PFKA 4ER7A 2B5WA 5K3OA 4ZV9A 1F0PA 5AW9A 4AJOA 5IT4A 3MD0A 2BR4A 4RVGA 4OI0A 2IQIA 3NU1A 4YCAA 3QBTA 4BFUA 1W34A 2O7RA 2ZRNA 4U02A 2IDJA 4FLMA 4Y2GA 3QUQA 1Q16A 3I2FA 2ZJFA 3E82A 2IW3A 1WS6A 2FZGA 4ZIRB 1HOTA 1YGYA 2BHTA 4P7GA 1L5ZA 1PV2A 2J3MA 5DXJA 3VR2A 1JIKA 1LK5A 1WJGA 1F7UA 1L5MA 2O20A 3J81A 4X5OA 1YASA 1VQ1A 3H83A 1FVHA 2B37A 4MUNA 4F97A 3R3ZA 5FDFA 4OI4A 1DRJA 1VSTA 4EENA 5E2AA 4AMUA 4G8DA 5TRTA 1VBFA 4ZO8A 3VH2A 1XROA 4CEIA 4MEAA 4EX7A 1NLYA 5DCYA 4R8VA 2ETXA 3C3JA 3MWEB 3F9CA 1KJ8A 3JZMA 1I6KA 4J94A 4W9NA 4Z4QA 3TXYA 1YZLA 1ISRA 2G0TA 3KZXA 2CHFA 1E3DA 1CW2B 1ZW1A 1D4ZA 4KWIA 4MULA 5FPQA 1IVSA 1M0EA 1KBQA 1SCUB 1Y1RA 2CL7X 4ND5A 5BUZA 1E6UA 2WJWA 1GA6A 4BMXA 1UBEA 2HLHA 1UPFA 2GAOA 2VPYA 4PLWA 3TMKA 2RH4A 4PX5A 1C9EA 4C05A 3QY0A 2IS1A 3BX1A 5IXSA 2JI6A 1E4YA 1EJ2A 1XZNA 3WZMA 2NO9A 4TQ9A 1E94E 3DONA 5AP9A 5FA8A 3DM9B 5GY7A 1AZLA 2EW1A 4XYLA 5JMTA 2GZDA 2FOXA 1GFZA 5K0NA 2D4HA 2OECA 4ZK2A 3C3PA 4KC0A 2VT2A 4KQ6A 3A9SA 3COVA 1OLSA 2FN8A 3NUZA 2JRLA 1T6XA 3RHZA 4CF3A 4DLRA 5JR3A 5LBTA 2ONCA 3RTDA 3R3UA 4MUBA 4TLLB 3HH8A 2XDYA 4HBGA 3RQIA 4ACAA 5ALDA 2I4MA 1AO0A 3M1YA 4KQXA 1QP0A 4ZWNA 1HG1A 2VT7A 1D4FA 2UVPB 3M6AA 4QL3A 4LRSB 3H8JA 2LE0A 3T7SA 4A8TA 3LG2A 4A92A 1GKUB 2QI9F 3FPAA 4UEKA 1G5FA 2JBHA 3IT3A 4MPDA 4NOKA 4XJSA 1IBKB 3VTAA 1L5RA 1FRVA 3X2SA 1QKIA 3HU5A 4ZOLA 5FR2A 2PLNA 3AB8A 2O52A 2SICE 3HNOA 3I2GA 1QX3A 2XD4A 1UBKS 2BCGY 1WB6A 2JKZA 2W0MA 2Y0BA 1FTGA 3CRNA 4MNTA 4TL9A 3MHPA 4G5FA 4Z2YA 4C7XA 4PN7A 3KETA 1BQ4A 4HX5A 2HNBA 3GHYA 4YRNA 2JIZD 1W1WA 3F5DA 1PW5A 3V1NA 4KHPB 4O5OA 4BNVA 1TO2E 4AYWA 3NBYC 2QRQA 3Q8WA 5ES4B 3TTYA 2BGRA 2VHZA 3HA7A 1PSDA 4QVIA 1X3SA 1IWPB 2XW6A 3GGGA 4HNRA 1GOTA 4LWZA 2YWEA 2BGJA 5DN9A 4YRJA 2QXTA 4KFSA 3TSAA 2ZRLA 4AZ0A 1ES9A 2EVWX 1ISFA 2QAGC 4F8YA 3ZY2A 5JRDS 5ERGB 3Q9NA 1I2CA 1WULS 4JVLA 2G08A 2BHLA 5ALWA 2HU2A 2VCEA 4IDFA 4G26A 2EZ8A 3JQ9C 5EE0A 3E3MA 2CV1A 1HOXA 4PWYA 3AOEC 1TCAA 1KHHA 1VZ2A 1SFRA 3FLAA 3ICCA 4LQLA 4WMLA 2V3WA 1OGIA 3L6RA 2FRVA 4R2JA 5HJ2A 3RJTA 3W7BA 2IIVA 3RS5A 4M0KA 3WFZA 2C9MA 4KXVA 3Q7PA 5H7XA 1Z16A 4RZUA 2FP4B 4QOJA 4QVGA 3FWNA 2MSWA 3MFQA 2QUBA 1D6MA 1W88A 4OHXA 1C30B 1N2OA 1HK7A 1RABA 4LC9A 5EZ6B 1DV2A 2ZUCA 4M49A 5JQWA 1DADA 4R0VA 2JI4A 4Z7OB 2J08A 2P9EA 2IY8A 5I47A 4UAJA 3CMCO 3EF0A 4QD3A 2W8BB 4CKEB 1GUZA 4G9BA 1G9XA 4CLRB 5EMKA 2Z43A 4XQCA 2YXDA 1QOPB 3GCWA 3N0WA 2OFOA 4WNIA 4Y7CA 3IV6A 3O2QB 4OLJA 4YXWA 4HAYA 2OG1A 1UBUS 1E9FA 3CLSD 5F3DA 3GYGA 1KZ1A 2A86A 1V8PA 4BNTA 2OBNA 3H16A 5JLJA 2YXBA 3ORQA 3MTQA 1KJZA 4FMDF 4X91A 4WK0B 3W9UA 2A3NA 4RZHA 5TQVA 1V3QE 1AH2A 4QARA 2W4IA 4HUTA 2FG7C 4G2TA 3K15A 4GMXA 4PFKA 2CHVA 5G02A 3IEIA 1BQ3A 3KXDA 2Q28A 3QEBZ 1BGWA 4HDSB 3TAXA 3KNZA 1GSAA 2XEXA 4NL4H 4BO3A 3MW8A 4F4UA 5KB3A 2IPMA 4G0YA 5LJIA 5LIPA 3H1TA 4FKMA 5DXAA 3HWX1 4U3JB 4PCAA 2VNHA 3GN1A 4URVR 1NTOA 2P2SA 5C4MA 3H2JA 4D5GA 4DB4A 1I80A 3H18A 2PZGA 3GLTA 2JFVA 4RY8A 2QN1A 1OYOA 4MQFB 1H2RS 3T7AA 4CFSA 2JFBA 1JMVA 1C9YA 4O2LA 1E2IA 1ZM2A 1MP0A 2EXXA 3HA2A 4B83A 5KTNA 1DO2A 1FYEA 1UM9A 2IKQA 2ZT5A 3ABZA 2C83A 1U1IA 2BM8A 5AKEA 3T61A 3UVEA 1N8TA 2CBZA 3PXUA 4G5YA 4CL0A 1T5DX 3SKXA 5CDUA 4B3RB 4JLMA 4ZO4A 4XX1A 1NBIA 5JY6A 2W2OA 3HVHA 3KVYA 4UEWA 1DQSA 1RQPA 1RJFA 1KI6B 3CY6A 1VKZA 2AZDA 4TN5A 1RRGA 3LRPA 3QPAA 1IY2A 4RIIA 3GJSA 1G4HA 4EKEA 1E3WA 1U0OC 4YP9A 4RNDB 3WGIA 3QYPA 1US8A 1AQYA 1N1MA 1PWEA 2B83A 4LNHA 3CX4A 4HJXA 1RQ2A 2B7BA 3ETDA 5EHZA 4LZOA 1IU9A 2WWYA 2QT9A 4F38A 4EQZA 5JUWA 2GJ8A 4ZA2A 4Q9HA 1XVLA 1OWMA 3S2UA 5U4XA 3U1VA 2Y8EA 1H4VB 1IDN1 1IQ0A 4NE9A 3VR6H 2BR5A 3R9XB 4BMOB 4GXNA 1EUDA 3E2MA 2FW1A 4OA8A 4LFCB 3BSYA 1JG3A 1JYFA 1H1TA 4ZYWA 4TN1A 2PTGA 3IOBA 1OIWA 1V11B 5F21A 3RAEC 4OXYA 3IHKA 4YV2A 4JFAA 4JA2A 1ZUNA 3LOUA 4B35A 4KFTA 4F3KA 4N18A 2QLBA 4MKGA 3ORYA 3PC7A 2VH5R 1YE5A 1QAMA 1P75A 1F8XA 2P1DA 5IH7A 2BFCB 5C51B 1RCFA 5THKA 3LKVA 2HN9A 4ZQEA 3UATA 1ZGJA 2J6CA 3MHTA 5LZ5A 4PZPA 4H18A 5A04A 1I30A 4LE0A 2CUKA 4DTIA 1NONA 1PZNA 2R3SA 3O3CA 4MRMB 4UM7A 2H7XA 5KPJA 2QIOA 1RWNA 2E49A 2VBIA 3HJAA 3GC6A 2IWRA 2CFRA 4IKEA 4EW6A 5CB8A 3TZBA 1ISHA 4I9GA 4R7ZA 3E3LA 3GI1A 2Q7DA 3WRXA 3TQCA 5BVHB 4PC3A 2J32A 2B9VA 3AVQA 2HB6A 3OZAA 4PSVA 4LVNA 5TGTA 2FW8A 3FTPA 5ESDA 2OYSA 3CVOA 1NDHA 3ZD9A 5EMLA 4R9VA 1CULC 1GGJA 2OLJA 2X9VA 4L5YA 4AM8A 4DLPA 1AGPA 2GR9A 4BTLA 3K05A 1A4RA 4EHJA 2KSQA 1CF2O 3TEFA 2HHAA 4NYIQ 1KPHA 4B9EA 1GRRA 1ZBQA 2H3EA 3VSCA 5AVXA 4PGFA 1L2TA 2ZI6A 4G1CA 3SLKA 3N07A 2VP6A 5THQA 3Q2OA 1HQKA 1I13A 5ITWA 2J6BA 4DQDA 4L3OA 4LRWA 2MDTA 3LQFA 3QWHA 3R3XA 4HJRA 1BXKA 1VFPA 5EG5A 2OV4A 1K92A 2HXSA 3SJ7A 3O6VA 1NQXA 2GETA 1RQRA 2HU8A 3Q3HA 4M86A 4TMXA 1GFWA 2H65A 4MGIR 1R6DA 1DNPA 2EWMA 3RS2A 4BVLA 1H6BA 1TM1E 1ITZA 2I78A 2VK1A 1K75A 4MYDA 2Y1LA 3WIVA 2NZ8A 3TM4A 2AH5A 2ZKIA 4XIYA 1AKMA 2P4HX 4AICA 1CYDA 3EIQA 3Q0EA 5IBCA 1MTOA 1Y3DE 4N41A 1QFYA 1XK6A 1Y9JA 4JBWA 3NBFA 1U02A 3WJ7A 3TJRA 1CUJA 4ZGWA 2E5LB 2Q0XA 4ZMRA 2P6PA 2PGNA 1DHRA 4FYJA 1KZ7B 1ZKDA 1ECCA 2G25A 5J47A 1TK2A 4DNFA 4DNPA 2IKSA 1YVDA 4P7JA 1U2ZA 1VPDA 3ZE2B 1BU8A 3BE6A 3N59A 4G09A 3U1BA 3UJNA 4LG1A 5A4DA 1WG8A 1QG0A 5JASA 3QM1A 5CX1A 4C7OA 2BHNA 5ALXA 4IIXA 2WLSA 4BVBA 3N7AA 2EFHB 2ZPUA 3L8HA 4QEDA 2YMPA 4EG4A 2PZEA 1EQUA 1Q0QA 3Q1LA 1CQPA 4MW0A 1ESDA 4KVZA 5C35A 2AN1A 5L7TA 2XYQA 1LK7A 1MB0A 1SU7A 5KJEA 3PJFA 1ZEJA 3PX3A 5KYYA 1JIIA 1UKAA 2NTJA 3VNUA 3O38A 1PHPA 1BDBA 4RZSA 1FOEB 2JLQA 4RKEA 1L5NA 2C4NA 3P0IA 3DE5X 4S35A 3O74A 3V80A 1C9JA 1FXSA 2DPYA 1R0YA 3GL9A 2ZBDA 3I58A 4C2BA 1PNQA 1XX6A 2LVBA 3CRW1 3ABQB 1PNTA 1S3SA 3F5QA 1HLPA 2GZMA 2VJPA 1V1RA 2Q7XA 3EHDA 3PZRA 4HO1X 3E27A 1E60A 1JKXA 1XELA 3Q88A 4J6FA 2BGGA 2D00A 2HBZA 7YASA 1MG5A 1C0LA 2BFMA 2KWIA 1IEWA 2XUHA 3GXBA 3S5UA 3O7MA 1FSGA 5HRUA 4B9AA 4LKRA 4H7EA 4MJ3A 2P62A 1BJRE 4NC9A 4MRAA 1F6DA 1KK3A 5FTJA 3HPQA 4ZAYA 2PLFA 4XDGA 3HO6A 3UY4A 1NXPA 2GNPA 3H2HA 3PV0A 4IRXA 4RBNA 5EIBD 2WR8A 1F8YA 5TR9A 2ZDHA 1DBVO 3OZVA 3CZMA 5GIOE 4WCFB 3ZCQA 4E33A 2BEVB 4RJTA 3KZ1E 3S40A 1JFLA 2IELA 3GAZA 2WHPB 3DV0B 2VT6A 3NTRA 3ZWBA 1L5HB 2ORED 4BFXA 1PN3A 1RCTE 2WP8J 3IIEA 4WLOA 5AHRA 3G8AA 3SEZA 4QOIA 3QFHA 2BKVA 4JYCA 1IJBA 4X95A 1MW8X 2M6RA 3H75A 1XMJA 2J46A 1KEVA 1CZHA 2NU7A 1Z38A 2PUJA 3KCQA 4YAUA 1P8JA 2OBFA 3QWBA 1QQ5A 4ZZIA 2AC4A 4I4TF 3THYB 5LZ2A 5A2GA 5FUMA 5EC8A 5IYZB 1IOLA 3QKWA 4ENPA 8OHMA 5AW4A 4D7AA 1MDBA 4HNAB 5ALPA 3HCOA 1YR7A 3IUMA 3JAWB 5AI4A 4HAOA 2OG2A 4DV6B 1RMQA 1EVYA 4AP9A 4BGEA 1K7CA 4L3VA 2OM2A 1CXZA 1QFJA 2PRJA 1ZRNA 2JFYA 5ESRA 1EVKA 5GMOA 4A0QA 2E0IA 1XCJA 5ALZA 2EOAA 5GZ6A 4F12A 3U16A 2AL7A 2QORA 2E4YA 2FY8A 2I6XA 5JPDA 1OKKD 2ZRBA 1THTA 2E4AA 3T7KA 4YP1A 1XQYA 1LVGA 4PRZA 1GITA 2V74B 3PQ7A 4G4SP 1G20E 1RQ7A 2NYVA 1U1GA 3L0DA 2OXTA 3WHLA 3AMVA 1JKMA 2LBPA 2Z95A 2OYRA 4F2PA 1HLGA 2OV8A 3BBLA 5AKIA 2MYNA 2PBFA 1G38A 4QQKA 3ZI4A 5CNIA 4E07A 2EP8A 1Y1KE 4W7SA 4HLQB 1QHHA 3H5AA 4RSGA 3CUYA 5DU2A 4B8ZA 4GU5A 4B73A 3GGPA 4EITA 1GPAA 1KK2A 5CNMA 3NFRA 5BQPA 2FNAA 2HIAA 2Q3FA 4HH1A 1L8OA 3NCTA 4J8PA 2BISA 2MR5A 1KH3A 1RQLA 4HDNA 4HPWA 2IP1A 1EFTA 1K7YA 4K9LA 4YQZA 5JWHA 1OPRA 2ODQA 3BH7A 4LYYA 1QWOA 5TJHA 5CLFA 1J2RA 5DISB 2VDLB 1P2TA 3TW0A 3E22A 1P9NA 3MS7A 2NPIA 3B2EA 1K3UB 2GBLC 3OFVA 4AUKA 2H4HA 3LXUX 4KIGA 4LTMA 4JVMA 1VCMA 5TY0A 4C6HA 1MHTA 5DGHA 1IPEA 1M54A 1U5AA 4BIIA 2A0KA 1IBRA 1RKBA 5KOYA 5KTSA 1Q0ZA 2IW1A 2Z56A 4I1SA 4L8WB 2QP3A 3R6LA 4ICIA 4Z0HO 5J40A 2CSUA 3MWFA 3OLYA 4PZCA 4B46A 2RC5A 4QYXA 1X38A 3C39A 1PUIA 2OA0A 3SEQA 4FHGA 2NNLD 5DHPA 4JP2A 4DPLA 2HMVA 2D0IA 3TTXA 4Y3UA 1GEGA 3D7KA 3NT5A 3PGVA 3PXAA 5IKOA 3VYUB 1NE7A 4LF9B 1HL7A 4W7HA 5T8KA 2C4UA 1AHNA 1R8SA 2P7IA 2FZKA 2NSDA 4MWEA 4FFRA 2OXRA 4DVGA 2X3FA 3EIHA 2X5OA 2F43A 3F71A 3N6VA 4BZWA 1XWFA 3ZDBA 4M1EA 1DC8A 4L2IB 5E3IA 4F9TA 2ZYAA 2HU5A 3THWB 1GCIA 1POXA 4EB8A 2ZJ5A 4ZAZA 3WV4A 1CS0A 3AIMA 3IE2A 4FGJA 3ZCRA 2GILA 5DKFA 5LL6P 2JJ8A 1FS4A 2J3IA 2POQX 1J56A 2JHPA 3L0BA 2FSFA 2JAOA 3R5FA 4W5WA 1E2HA 3FBWA 1RAAA 4BJ1A 4OFZA 4BQOA 5AHXA 2W58A 1N6HA 1R9NA 1VB5A 5CK4A 2WTAA 4Y0VA 2YJGA 3WZ2A 4A2CA 3IXMA 1WTAA 4OHKA 5I9MA 5BSEA 2REXB 2V7EA 1UWKA 1M2HA 1C3LA 1HO3A 1VG0B 4QAJA 3HLYA 2EJCA 4QXAA 3D2CA 1PV1A 2C4MA 3KQNA 3BGIA 4Q82A 1IBLB 3ELDA 2CF5A 3NHPA 3D8RA 5CHYA 1BSVA 1E9BA 2YBEA 3PCTA 1XTTA 3GA7A 3HCCA 4EJ2A 3V33A 4DR6B 4J75A 2CJWA 4BLOA 3WK5A 1ZZGA 2ZYUX 3C5EA 3F3KA 4FVTA 2SECE 2A6PA 2OBMA 5IEBA 5FNZA 4CG2A 3MJRA 2EJTA 4E5DA 4LQCA 4UCXA 4GRAA 2O54A 2O8VA 4EJSA 5FAKA 2ZULA 1JQDA 3G8DA 1CNFA 2G8LA 3OURA 4GR5A 3V4PB 3A4TA 2Z9DA 4RTNA 1Z08A 3FHJA 3DBRB 4OLFA 1PR0A 5EGNA 1SU6A 2LR0A 2WIDA 5HQJA 3DD5A 4N7MA 1N7IA 5DLQC 2H4ZA 3GNQA 4ROSA 4BMCA 4RY9A 1UZLA 2J9RA 1KRHA 1Z6XA 3I62A 1Z0ZA 5BMVF 1PZGA 2H2IA 3D4OA 3DNPA 5REQA 1J07A 1L4YA 2QMZA 4LRTB 1TUEA 3KUUA 1K5GA 1ZUD1 2Y66A 3I01A 3OLZA 4UATA 4MW6A 1W0KA 5EWMB 5ICMA 1T34A 4G07A 1WXQA 4QRHA 5LWQA 1V9CA 1FDIA 1KJ9A 4Y7DA 5JD4A 4TTAA 2IZ5A 5EKTA 4J1TC 4CKBB 4IDGA 3QE3A 2RHHA 2DQKA 1RXUA 3OAAD 3CMMA 3UWKA 3OTOB 2BGWA 3LUPA 1NMYA 2CVOA 3DNFA 3IPLA 1ORIA 3HDQA 1SVKA 2GXUA 2FKNA 4FHZA 4DR1B 1GQSA 3AHHA 3RU2A 1QZZA 1Z2OX 1KRWA 3ILXA 1KMHA 1X70A 4ZVRA 4D45A 5ALVA 1CUFA 1MIOB 2ZYGA 5EHXA 2X6QA 4J0IA 1GQYA 2VWHA 4GXQA 3A1FA 4P5EA 1W4RA 3EXG2 2QS9A 3OTIA 4OEHA 4J3NA 5LN1A 2V54A 1L5LA 4X94A 4YJ3F 5B6PA 1WZ2A 1XRRA 3Q6IA 2EFGA 3HXLA 1PWZA 2VXCA 3KO8A 4V1CI 5L6MB 1EUCB 4Q3KA 2VJDA 4YRFA 1QIJA 1XEXB 5KQPA 2UXCB 4AJ9A 3CLHA 5ISMA 3KR0A 1Z62A 3SS9X 1N6PA 3T41A 3W6PA 2G4VA 3BXXA 1JN0A 4PRYA 3AM3A 3EG9B 4IDOA 4JEMA 3VR2D 2WG1A 5CBKA 1GILA 3B85A 9MHTA 5BW4A 2H4YA 1J2TA 1X0VA 1N1GA 4UNIA 3WWPA 2ZRGA 1OU4A 4MA5A 4KCGA 3QKUA 1ACJA 5AKZA 3DEZA 1ADYA 2P5TB 3MB5A 2F1JA 1VE5A 2WIAA 4BATA 4LJ8A 1ML4A 2C84A 4IF6A 4RXMA 3W77A 3ZGNA 3NOVA 4L50A 4Q9KA 3TZCA 3VU3A 4QAQA 1GCGA 1JEQB 5DE3A 1MRZA 2REOA 3E9YA 2XYHA 3KT3A 5JFGA 1DBQA 4FYXA 1L7BA 1TVKA 2UUOA 5E7QA 1PSWA 1G9SA 5JVDA 4OMCA 5HZKA 2YV1A 3MCZA 3QXCA 3BDIA 2DFTA 4Q7LA 1KI4A 1AKQA 3GWZA 4GYKA 3V3TA 1LZLA 2W6CX 4JB0A 4B71A 1E2PA 4KN8A 3RUEA 3LY8A 1EBBA 3E81A 4YS6A 2QRVB 4C0QC 1D6SA 2UZ3A 1CR0A 5EKUA 4MLCA 1U2EA 4D9HA 3L0ZA 1C8BA 1GN8A 1N0WA 3UHPA 4B87A 1VGQA 4HNUA 1YQQA 1Z4JA 4K7JA 2R6FA 2QP4A 4XI9A 2YXLA 1XCPA 1E6MA 2YWFA 3ETLA 1WY7A 5CCEA 5CXSA 2H5IA 4UVGA 3WTBA 1AKNA 2BFEA 3GYBA 4F11A 1A2KC 5JJKA 1W5SA 1Z17A 3TLKA 3H6GA 5F64A 4WACA 5F98A 1ZGHA 2CVQA 1O6GA 3L1KA 4KPEC 4O4HA 1XZKA 3OE7A 1HL3A 3MUOA 2I34A 3DMTA 3GEIA 1BE0A 4IH9A 3JQ8B 4I50A 1JGTA 3NOOA 2VWPA 3ZZ0A 1DWPA 4K9KA 2Q6IA 4X71A 3FCAA 3ITKA 3N9IA 4M7PA 5A9SA 1KS2A 4EKYA 2PY6A 1BMFA 1BD4A 2F67A 3FGZA 4X6UA 5HYVA 1ZMOA 5L95A 2OCIA 4ZQIA 3JX9A 1T5IA 5FNVA 4D1YA 3W06A 2Q3LA 2VSXA 4KOEC 3KV1A 3KWMA 3OI7A 4JXXA 1C2TA 4E5PA 2NAFA 4ZVMA 5TT0A 2CMGA 2IYWA 1DXOA 4OQLA 4GLOA 2V5UA 4OYLA 4ZHQB 1CLUA 2OVBA 1FX1A 3UUWA 4EMSA 1KR5A 4N65A 1RLIA 4QHYA 3O90A 1YMVA 1R10A 1F1BA 4UNPA 1XZJA 4FFMA 3EXFB 3C3BA 3DC7A 4HC4A 4K26A 1HLDA 4JMLA 2Y05A 3PC2A 4X93A 2A33A 4Z4EA 1KAOA 2AEEA 4JYMA 3L07A 3TAUA 3K92A 4ENTA 1D6NA 1PL6A 1RQNA 5LWHA 3IO5A 3B6MA 1M2KA 4ZKEA 3GPDG 1EX1A 2VJNA 1PGOA 2QAIA 3MERA 4LJ5A 2YVLA 5LZ4A 4J16C 4MS4B 4BQQA 4MIYA 5LFAA 2XNDA 3AM5A 4HNHA 3F47A 4WY5A 3ADOA 4TZ0A 1SBIA 4QQ8A 5JNVA 3UCXA 1VTKA 2WFZA 4EJ6A 4DSUA 5H4HA 4LEIA 2Q27A 5B1DA 1D2HA 1Y5IA 1M1XB 1GEEA 3DVRX 3I23A 1IHUA 1RYMA 1Q3HA 2CSXA 3OCWA 4O08A 1TM7E 5J2TA 1ZH4A 4M0FA 3P45A 1B8NA 1IDOA 2A9PA 2JH8A 4EB6A 4I81A 1KY3A 2TECE 5FYDA 1DJOA 2VP5A 3IBFA 5JS6A 4E4YA 3S7ZA 1RHRA 5CVDA 3O4JA 3WFIA 1OTYA 3FETA 4GVXA 4GT1A 2ZB3A 4Q4HB 1PKXA 4JASB 4UEOA 1T8SA 1EUQA 1N9GA 1G8GA 2HRZA 4LNUA 4M6WA 4WESB 2OUKA 4AAYA 4GMDA 4C89A 1A9YA 5FFMA 2P8JA 5AW6A 4G3XA 4NRDA 4RV9A 4YXWD 4K9NA 5I4BA 3EMKA 2ZWPA 4WXEA 1XDGA 2AWNA 4AWBA 2BN4A 1Q3KA 5IJXA 1H1DA 1Q1QA 2GK7A 3GO4A 3TYXA 2AX3A 4KDEA 4ACBA 4BCCA 2MU1A 4E08A 3O8BA 4OJQA 2COKA 4ZEOA 4J0EA 2LWIA 2QVGA 4UVHA 4YI5A 4DLTA 3PVZA 2WYIA 3TX2A 1HH4A 3SYNA 3QW2A 3QOFA 1T6BY 2VZ8A 4P7FA 4H3HB 2HJGA 2TMDA 3K72B 2XA9A 1J1IA 1WEKA 5IC5A 3GD7A 2NZYA 2BEJA 3HCRA 4PW0A 4F2WA 4S2EA 3RC2A 3A28A 5JSQA 3C8DA 3C6ZA 1RZ3A 4DEVA 1LDMA 5DOZA 5G40A 1H2ZA 4RY0A 4MS1B 4QUGA 1C1DB 1QANA 3CR8A 3QBVA 3STTA 1W35A 3WHIA 3OF5A 1QWSA 2FGJA 3QFTA 1W85A 1KZ6A 5BW6B 4MUFA 1JDSA 5K4HA 1E7YA 2OC9A 3V55A 2D6FA 3G8CA 2J87A 5HEKA 2HJHA 3FGPA 5AK4A 3LCJA 1FFSA 4PYNA 1EFDN 1QHEA 3TBKA 3UB3A 2YY6A 4JD5A 2ZRHA 1KMCA 3DKKA 4R68A 4U8HA 3V8VA 3WADA 3AW8A 3GRZA 3QYAA 5AKGA 4Y1FA 4NCJA 3IUPA 1C4OA 4EABA 4HRVA 3L7OA 4NARA 5F77A 2XD9A 2GXAA 1Q7RA 1QLJA 1W46A 5DNWA 5HQTA 5LBUA 8ABPA 1VPWA 4CMCA 4RYLA 1ZXXA 3OESA 5F2EA 3OQVA 1Z5WA 2DPLA 4TKUB 3O8QB 2XQIA 2GFQA 2F6RA 3EXEB 2IFTA 1Q95A 3O3OB 4BLUA 1T10A 3VXKA 5FB3A 3IUEA 4HYTA 3VZSA 1SU8A 3CRVA 4R2IA 3KQPA 1OLUB 3G6KA 4TXJA 3TZHA 4BWFB 2AEFA 3T7RA 1DRWA 4AC9A 2YHSA 1XZ8A 2X41A 4HKTA 5DGIA 5D3KA 3TQOA 2II6A 5MFPA 2ZAGA 3MUEA 5I7AA 3U4CA 1P4GA 1E1MA 3SCZA 1RC1A 4HLUC 3R0XA 1NQ5A 2OZLB 3ACDA 3ZQKA 5AQ1A 2GRJA 1WVIA 1TVCA 1E0DA 1Z6PA 4HWTA 4TTTS 5FBRB 3KR1A 1DDIA 1OIVA 1ODCA 2R00C 1VLQA 1XDZA 3ANMA 3ZU3A 2VXBA 1GZ6A 2KYRA 3JVUA 3KOXA 4BEVA 2XKJE 3HU1A 3UZUA 3TLZA 2BI4A 2RGGA 1P33A 4WN3A 1T2AA 5AUPB 3ILVA 3CUVA 1X0XA 4XFJA 1XCLA 4JI5B 1CF9A 5FL7A 3SZOA 3ILHA 4QFDA 1C3XA 5F2KA 3HJGA 1WLYA 1ABFA 3KB2A 4KXNA 3S7TA 5LQAA 1NQAO 3DO8A 3PHBE 4FDUA 2H54A 1KYTA 5DBFA 3FZNA 2IS6A 1QHSA 4BX2A 4AYXA 2PLAA 3DDWA 1Z88A 5KNCA 4FOPA 1D1PA 2GUGA 5HKAA 1U3WA 3GJZA 1BOFA 3L2OB 4FGKA 5LQRA 5FPSA 2ZANA 1DKQA 1G55A 2W5UA 3SQLA 3NKLA 3QMMA 3QXXA 3M3PA 4QNMA 1EG2A 1CIPA 1ZSYA 3KPWA 1JT9A 4G0XA 2TSYB 5JRZA 3DDNA 1X1CA 2AK2A 4MRVA 3MOSA 1T3HA 5AJTA 3PFFA 4YLEA 4FDAA 2NYUA 1G16A 1TEZA 5K45A 1SRRA 4CJXA 4Q34A 4MDYA 2X8JB 2BFBB 5ICFA 2Y1DA 3M3HA 2C57A 4NV3A 3EWSA 2QF7A 5JCJA 5KYVA 4CDMA 4B3DA 1QE5A 2J5RA 1P62B 3IQFA 3QLUA 3P4XA 5CVJA 5FP0A 3JZDA 3RS9A 4EMTA 4JLAA 3M6VA 4RA6B 3P9XA 3ZLUA 4YAKA 3C2QA 1F2TB 3K1ZA 4NCAA 2NYRA 4QOGA 5KREA 3WL4A 1SWWA 4FM9A 1FU4A 1P5FA 3AF5A 3HYRA 5DBHX 3TQHA 1BDIA 4YRRA 3PD1A 4G89A 3RU7A 4MVCA 4BGUA 4RDIA 2QMQA 3RYHA 3QEMA 4QDZA 2VF4X 3B38A 3LDUA 2KHZA 5K99A 2C7RA 3FFTA 1NW6A 2ISCA 1XDBA 1OU0A 3A36A 3N6XA 2YZNA 4QELA 3N6RA 5LDDC 3WXMA 1VPVA 2ZTVA 3FA2A 1OR8A 2H7VA 4RABA 3I30X 4LUCA 3ZUGA 4WZ6A 5IMBA 4UFPA 5JNTA 2W42A 5FI0B 4LHEA 5B2EA 1U9IA 1FLDA 1UJ6A 2AMFA 1IPFA 2C2KA 1IOWA 4KJZA 4RXTA 3FIJA 4E5UA 3AU9A 4CM8B 3T5DA 1V6AA 4JI1B 2Q21A 1FW8A 1G7SA 1ESEA 1II8B 1M10A 3B60A 4Y8VA 1RRKA 2JVIA 3HXQA 1GVNB 4Q02A 5H68A 2CZGA 1SUEA 4Q00A 1RHKA 4RA9B 1GL9B 1WETA 4N7BA 2NZJA 1JTFA 4IILA 4GFDA 5K8UA 4R9SA 1MBZA 2RJOA 5CK5A 3RC1A 3NORA 1YK0A 1BS2A 1TYCA 3AUXA 3IBSA 4OGGA 1RI5A 2E87A 3MXOA 1P0IA 1NF3A 1XCMA 5EIOA 2PKXA 1LLDA 3IC5A 2OKGA 1RWQA 4NZMA 2V8OA 3GJ5A 4J7CA 2EATA 3WZLA 1VHLA 2BVNA 3D7NA 1P3Y1 4W9RA 3GELA 3VKUA 2H1FA 1V3TA 4UDXX 3QGMA 4CM5A 3MTGA 4EYQA 1B2LA 2R25B 2PAAA 1G21A 2XB6A 4FI3C 4LQ4A 4NFLA 4WK6A 4BMDA 4DCOA 3IDAA 4I1VA 1I7PA 1XZMA 4ID9A 1KKMA 1PTJC 1YGPA 2F3SA 2NUBA 1DC6A 1Z5VA 1D9XA 1JV2B 3I8XA 4X6LA 4ROTA 2OENG 2NACA 3JQ6A 4IP0A 3QELA 4EHHA 1T0BA 4PO1A 1A50B 1V5WA 2DG2A 2VCYA 3MWEA 1LPPA 3NEAA 4RANA 1UKVY 1F20A 1RLUA 4R1QA 4RV5A 2NO6A 1L7OA 4PYJA 1DC4A 2VJQA 4JITA 4CM6A 3I0ZA 3STYA 1KY2A 4PN3A 2Z9CA 1WMBA 3OZDA 1KMIY 1DT5A 3A1UA 3AJEA 3O5AA 1I4LD 4YPFA 1FRQA 3BORA 4M1KA 2C82A 2X8AA 3OPMA 4PC7A 4R16A 3TSOA 4TTJA 3K0CA 4PHTA 1IEXA 5FI3A 2HHLA 2NT4A 1TRHA 4LY3A 4FJ0A 2HA7A 4KKVA 1N2XA 4GQIA 3DR3A 1CY7A 1C3OB 1EZZA 1X8LA 2IXTA 2IHKA 3L7JA 4H7FA 4IIDA 3GCDA 4M7WA 2Z3WA 3IMKA 4NESA 3UPDA 1ZD4A 3HFJA 3FLMA 3RRYA 1LRJA 4OATA 4D9FA 4X3OA 5TF0A 1QZUA 3M6UA 5HXAA 2ZQZA 4LXIA 3UOGA 4YMGA 1NPDA 1WCXA 3KB6A 4JODA 1K0UA 3LLMA 1XJWA 2DGDA 3PVCA 4DWVA 2HQRA 2HA5A 3UN1A 4M9ZA 4QPJC 3RVSA 2CJPA 2HHJA 1QRSA 1EBUA 2HMUA 2AV6A 5FUYA 2OCYC 1NVTA 1Y34E 1SY7A 2X0JA 2QU7A 3BE5A 4WT7A 1ZJ4A 5EMJA 3W5UA 1VCHA 4DLWA 1UZAA 2J09A 3UHOA 4H27A 5C7IO 4QUJA 4FDVA 2R8BA 1BGXT 1LJLA 1E2MA 4WIAA 5BW5A 1E1LA 1HDZA 4B2LA 4DW8A 3EEYA 5IDQA 1ZJ5A 3ABRB 3ZY4A 2GM3A 1YB2A 1Q1ZA 2EZUA 4KMSA 4BNNA 1ZINA 5CH5A 2OMKA 4UE2A 2GJ9A 2G36A 2YIMA 3DUWA 1TVEA 1WWKA 2WYWA 4CETA 3PZBA 5ESWA 1SK9A 1JHYA 2FA9A 3M7IA 1UJMA 2GASA 1FRNA 4M0EA 3WTCA 3TQFA 4BV9A 4HV4A 5E9AA 2BH2A 4GC5A 2XOXA 3ZLJA 5A7FA 3FI0A 1DJMA 2H11A 2ID8A 1FJXA 2VA8A 4EL5A 1EA7A 2I7CA 4L0DA 2VYFA 4W82A 3EZ2A 1V4NA 3H9BA 1NAHA 4K6HA 4P84A 4QXPA 4ZP1A 1JBKA 1EK1A 2GEDA 2K4MA 1PDOA 3N74A 3PE3A 4KQFA 1E18A 4WXMA 5D51S 2ZIVB 5TVKA 4EHNA 3JQDA 1IB0A 4LXQA 1E2BA 3R7WA 1HE1C 3C97A 1D0IA 3IEXA 4FOSA 1MB4A 3IUYA 3OT4A 4MB2A 3KXKA 3IJ5A 4H7DA 5EVJA 3ZHVA 2C03A 3CLUD 4HB4A 3U7GA 2QOEA 2N3ZA 1Z9BA 2W90A 2Z09A 5CB6A 4CU5A 1DCTA 1QB7A 2C00A 4BO6A 4OSPA 2QUAA 1FEZA 2BMFA 3PEEA 1JIJA 4JAVC 3G2MA 4TV9F 2ZE8A 4GOKA 4O2AF 4ESVA 2C3PA 2ANCA 4F8EA 5HS6A 4XUCA 2YFYA 1KI9A 2WOOA 2VPTA 5BQXA 2WJAA 3BEOA 3UAVA 5J5VA 5KSWB 1F4LA 4OHWA 4D46A 2JEZA 2B0CA 3T1HB 2FP4A 2V6GA 4HX9A 4Y2QA 1STOA 1USUA 1FNDA 3SXPA 5IWCA 1A97A 4RE6A 3YASA 1C30A 2VTBB 1F8FA 1JL3A 4D98A 1K27A 2AG0A 1BW9A 3BZUA 3MG9A 8AT1A 1NZJA 2DHCA 2WVGA 5CW2A 4U39A 3CH7A 4CKEA 2X40A 3STUA 5JY1A 1V0JA 2NTEA 3WYGA 4AMBA 4CLRA 1K6EA 3PKIA 1KBOA 5CX4A 2FN7A 3U26A 5G3YA 1EGVB 2I87A 4DEYA 3A4YA 5LB4A 4EY6A 1TTTA 3OKFA 5G3ZA 5H70A 4B3TB 1R00A 4AXBA 3H9QA 4F86A 4NG4A 1V6SA 2PX6A 3K6JA 3KAPA 1R4ZA 1WHTA 2PO5A 5CJPA 3K70C 4L8LA 1V25A 3VR4D 1NJ8A 1JQAA 1KMNA 1ULAA 4EPXA 2QTNA 1U3CA 1UFOA 1ORDA 1YDMA 3DAYA 4GHWA 4C5BA 3OQNA 1V71A 3EOAI 1BX0A 1YR9A 4MVJM 2QLNA 1T6NA 4UASA 3SR3A 4DV5B 3PB3A 5EUQB 3KLBA 4D43A 4HDSA 3QP9A 4ZVOA 1NT2A 1Z73A 1R6VA 3K96A 4MVJG 1PNOA 3ITNA 2FW6A 2W6IA 4ZCLA 3WIEA 3KOOA 4JJFA 2XUQA 3JQBA 3RVNA 1EWKA 4AJ1A 1JJVA 2AR7A 3V4OA 5JBIA 1F38A 3USZA 4KAFA 1CDEA 4B2IA 3D4PA 2GD6A 3MTAA 5LM3A 4MQFA 1U9YA 4WZBA 2J31A 1W94A 2CMDA 2I2WA 1M75A 4GPZA 3DE6X 3PQ3A 2F3UA 3BD6A 4B33A 4DWOA 2W2MA 1JQ5A 3BTUA 3CF0A 4ED9A 3AP3A 3C45A 2GT1A 3D8NA 3GP3A 3L8YA 3J7TA 4U2GA 2ZE5A 3MIIA 1Z0DA 5FIUA 3F1LA 4RJ2A 2ZROA 3NGLA 1SMKA 4EW2A 1GUFA 3A6PC 3L1HA 5F78A 4HQ6A 2YJTD 1KI6A 2W93A 1F6BA 2VLIA 3VNSA 1K8QA 2PX2A 4LE1A 4WOJA 5BORA 3WQQA 2NXEA 4HEHA 3QVGB 3R1IA 3ADCA 4TKZA 5JD6A 2FPIB 4WA8A 5KC9A 3O0TA 1BE8A 2PWYA 4QU8A 4RAQA 4UBJA 3HSKA 1TLLA 4JUAA 3URKA 3E3AA 1S8NA 4D8UA 2XI4A 2HRQA 2WUEA 1IIBA 3WL7A 5LUAA 2JGLA 2J33A 3MGBA 4IJWA 3SZ3A 4M76B 4EA6A 2CLMB 4P3OA 4RWZA 1S1CA 1W0KD 2BT4A 2JGJA 1M0TA 2PCJA 3G0DA 3CF6R 2V97A 3AJAA 3HE3A 3JYLA 1XTZA 4QLOA 4RTMA 4Y1GA 1OGJA 2JATA 2CEKA 1QR2A 3WAKA 1RCUA 4E6EA 3HLKA 5JAMA 2ZM6B 3PDIB 1ARZA 1ECBA 1RXSA 3DKPA 3HCAA 4XM1A 4TSRA 6REQB 2XZPA 3C3YA 4YK7A 4LYAA 3ZS9A 5I9NA 2Y1KA 3O94A 4CMKA 1XNQB 1BN6A 2QX8A 1VCNA 3VJRA 1GR1A 3GJXC 5FJJA 5CCXA 2G17A 2FX5A 2VTVA 3B1ZA 3QHAA 4BN0A 3ZU5A 3PRJA 3IAUA 4A26A 4ZGGA 3HKDA 1TFUA 3DE7X 3OCCA 5IX8A 1F2VA 3L9WA 4CIWA 5TSDA 3KQQA 1YVRA 1NXWA 4YEDA 4BVFA 2DQZA 3MBKA 4U9IS 4BLTA 2RSLA 5LYJA 1WDTA 4D96A 5AVQA 1E0JA 5J2UF 2V58A 1RI3A 3AKEA 5EIBC 1R6TA 1R27A 2J3KA 4RH3A 3VPHA 5ALNA 3GFGA 4MQ4A 4GM1A 2WU4A 3ZWOA 5KQGA 5CA0F 3F73A 2DQSA 5KTRA 3C3CA 4I66A 3QFSA 1EDEA 3PEVA 4KLRA 4BP3A 4A2QA 2K7ZA 1NATA 3MWGA 3S28A 3K0AA 3HWSA 4BFZA 1SGWA 2P68A 1TIBA 2C5AA 2HYDA 2JAPA 3FPSA 3BWCA 5I8PA 1U8TA 1U0BB 2WTXA 1X1EA 3BFKA 4S1OA 5DSXA 2F8SA 1N7GA 3K7EA 2VRWA 2YOFA 3PD7A 1YA4A 2VDQB 3U6KA 1WD7A 4ARZB 4O3MA 2ZJYA 1MGPA 4DN6A 1E5VA 2FLKA 3JQGB 3U39A 3O3MB 1E89A 4K9MA 4AF6A 4CMBA 3FVVA 1IG0A 1CZUA 4YCNA 3D31A 4OM8A 1NASA 4DV4B 4I9HA 2FDXA 3D5QA 2QLMA 2XZOA 3LUKA 2O8FA 2O8CB 4C78A 1OAKA 3A9RA 2BJWA 2VF5X 3RAFC 3KUDA 2KW5A 1CVRA 1YMUA 3ETNA 2R97A 3LBYA 3QNWA 5HF9A 4W1QA 1XT6A 3O1HB 1HEIA 4H1HA 5HM8A 2ZRMA 4JOSA 5IPFA 3F8SA 1YOBA 1J70A 4HOYA 4I4IA 1XLUA 1QIFA 2PFGA 2VJYA 4Y9SA 4N47A 3LPCA 3S2FA 1WUIS 1YTLA 2WZBA 2DUUA 3DBLA 3DCNA 4AROA 1RKVA 2JLVA 3CPEA 4FXPA 2NU8B 4Y9TA 3PPWA 2X8LA 4Q7KA 4E88A 1PKEA 1K8ZB 4Q9AA 1Z28A 1QSGA 3OE7D 4PSKA 1N57A 3LTEA 3I1IA 2Q0HA 1JLLB 5T5QA 4MV5A 2BAGA 4D2IA 3KE9A 2G5CA 4B3BA 5K8CA 4EEZA 4UHHA 5GQSA 2DRIA 4GZLA 5JZOA 1W581 3ZLBA 3AHGA 1XKLA 1R5OA 3FRJA 4GBJA 3ZU2A 4DUZB 2C07A 3IBGA 2X6TA 1K4KA 2Q8PA 5EJEA 5JATA 4KXYA 2K5UA 2WICA 1OLXB 3DT9A 3DM5A 4NK5A 3ZHCA 1VHQA 4FBMA 1LFDB 1C9NA 1KJIA 4NIMA 1HRDA 1X7YB 4BKRA 1OYWA 1UXOA 2G9RA 2NZUG 5FWAA 3NHMA 2Q3MA 3H4VA 3K8YA 3NO4A 3K2BA 4CQJA 5IJ0B 1CEEA 1VYUA 1XV5A 1ZVKA 1A8HA 1H5UA 2PT5A 2RHDA 3A1TA 3P27A 3Q7SA 4JBIA 4IIHA 3U09A 2PUBA 1LJ8A 5ELXA 4RJKA 3RRNA 4WGGA 2VQSA 2BBSA 3HDJA 4QTUB 4TROA 3S27A 1K6XA 1K8XB 4YR7A 2WM2A 1WW2A 1T1JA 4KSBA 4QT0A 5EKDA 4POAA 3KTAB 4EFMA 2W2KA 1EFRA 1NUHA 2OC4A 1AV7A 1OHHD 2PMDA 1H8EA 1D07A 2I1LA 2AJCA 4F3YA 3FZQA 4OUKX 3FLBA 2XLBA 2XNDD 3EYAA 1MZPA 3CKLA 3WKDA 2CLKB 2ZUVA 5TQ0B 1G1MA 3MJEA 5AJVB 2XOKD 3PCXA 4GKBA 3G2HA 4PXSA 3PFCA 1S5PA 3RVRA 3SHTA 3QFCA 3QYFA 3SVZA 4YQFA 1E3EA 2G3YA 5IASA 3UNXA 3A05A 2WFLB 5T4FA 4WCFA 2HXGA 5EINA 2BEVA 3WRYC 2IYAA 4M1YA 3AJDA 5IVDA 4KFCA 2O4CA 2AC7A 3W04A 2LDXA 3DV0A 1L5HA 521PA 1RQXA 1WXHA 1XTJA 1LI4A 3D4LA 3QNMA 2XZLA 4RSMA 3WGVA 1VJ5A 3X1WA 5E0KB 3RIMA 3VPCA 3NHWA 2WHYA 1KO1A 3MAAC 4NK4A 3I6QA 4RH0A 5DH9A 1FFWA 1KKLA 1RYHA 2O0JA 1B73A 3QPDA 2M1ZA 3RREA 2G6TA 4YQEA 4J2HA 1VJ1A 3G2OA 1A76A 5IYZA 1TT5A 4FIDA 1LNZA 3EN0A 1FX0A 3K16A 1SQ6A 4I3FA 2DR3A 1KRXA 2HPHA 5E4JA 3RANA 4HNAA 5GADl 3JAWA 1VJCA 4N8EA 4U63A 4RJJA 2BP7B 2YVAA 3UJDA 4DABA 1B16A 1O77A 3OO1A 4E7PA 2EZ9A 5BSHA 4BL5A 1U8CB 3QVUA 4WADA 2O2XA 3RSSA 2Y0CA 4Q15A 1P2BA 1T0JB 2CL5A 1Y8RA 1XHLA 3KRTA 2HJSA 4DSOA 1S02A 5JMPA 5DRYA 4F4IA 4Q66C 2ZR0A 3QW4B 3RIYA 2OGWA 3PNOA 3DE2X 3WGQA 1Y63A 2QYSA 4XH9B 4W7IA 4R1TA 5T4EA 1L3IA 3HMKA 3GGJA 3LL4A 2VZ9A 4FS3A 4K8RB 5KDLA 1J8QA 1L5KA 1NJ1A 1QONA 5EIEA 3AVVA 3V7UA 4BVKA 3TR0A 3W8NA 1KF0A 3GLIE 2FAXA 1FVXA 2WRZA 1SG6A 1S8FA 1YR3A 1OAAA 3JPWA 4HDMB 2EF1A 4GDFA 3RC3A 1ZU4A 4DLSA 5AVZA 4DDHA 4K9OA 2OXCA 4TYWA 2HNKA 4A23A 1Y6JA 1XAJA 5JAZA 4YXFA 3OZRA 1KFKB 3BTOA 3H1EA 4OYRA 3X43A 3TTVA 1JQBA 2VAWA 4RF3A 3W0LB 1R6AA 1MPTA 2A0UA 4TTVA 4DANA 4CTKA 2O5CA 5EI5A 3IKTA 1I4WA 1WCIA 3GR6A 4PBTA 2VDMB 4ND4A 3EODA 4EUHA 2ZJ0A 3THXB 5HBRA 4NCBA 3H5RA 1MW9X 1WRBA 3NM5A 2FN4A 5DF1A 4RCVA 4YRPA 4L3WA 3W5HA 3OOEA 1QCZA 4ZPJA 5BN4B 1Z0UA 3UHAA 4WBNF 3ND6A 3DKIA 5FUBA 4TS4A 3LLSA 3QKSB 1LDYA 2FR8A 2C9ZA 3IP7A 2ZB7A 2P0YA 5AO9A 5FBWB 4A5SA 2JLAA 1MUUA 2XB4A 4AK9A 4A8HA 4BKMA 2J30A 4EATA 3UJBA 2PE5A 1JXQA 1ZJZA 3HCNA 3P9IA 1FJHA 4LRQA 1B0AA 1WNFA 4PRLA 2ICAA 1LW6E 1P44A 3RBVA 3WAJA 2BWJA 3U4IA 2BI8A 4ZOCA 5KWVA 4BP9A 4BO1A 1SBYA 4G67A 2CLLB 3OQPA 3OZEA 1J25A 1YQEA 3TZQA 4B2YA 2UXBB 3GEGA 2O6LA 4Z9AA 1LI7A 4RELA 2RH5A 3LQRA 2CV0A 4RS4A 4PX2A 2WJ6A 1XNRB 4RDHA 3USCS 4IG9A 5C18A 3WDMA 1Z26A 2VH2A 1HETA 4BMYA 2XWSA 1OIXA 3WICA 1P2FA 3E03A 3PYXA 3STXA 4D8VA 4URZR 3TUZC 3THWA 1SEPA 4QM7A 1K8RA 3SNHA 5K09A 2X5XA 5FOUA 4X97A 3RK4A 4OHZA 3F1KA 2IZZA 4MYUA 1AS3A 3S2ZA 5WRFA 5FL7D 2R2GA 2VK2A 3V8RA 5BOVA 1OFIA 3MJDA 3ZKAA 3EGXB 2EW2A 1PWXA 4I1IA 2PUWA 4FSHA 3W5JA 5CAEB 1Z2PX 2OCAA 3MIZA 4G4GA 3NHZA 1HV8A 2R6GA 1JJFA 1Y80A 1Y9AA 3DZCA 4M87A 3HYCA 2ATIA 2I9PA 1SC9A 5C53B 1TMOA 1XEAA 1YIOA 3PI6A 4U6SA 4BNUA 1PIWA 2VI5A 4OHCA 3SX2A 3E53A 3EW9A 2ATVA 3CSUA 4GSKA 4DCPA 2HW8A 4YUZA 4JMPA 4KLZA 1DZIA 1XU9A 3FNFA 1TYBE 3TD2A 4HRAA 4QFCA 3GNSA 4EFKA 1UKCA 3S2EA 1QIGA 4MMYB 1TKBA 4Y2TA 3VJLA 4NOMA 5I48A 4XFKA 1E20A 3OA0A 5DK6A 1BWSA 1GCUA 4NBSA 3RYIB 4D8YA 1NL3A 1RWBA 1RBQA 3JTMA 4UAVA 3ED5A 1S01A 5H82A 4IWXA 1F17A 1JEOA 5E6UA 4JJAA 4P53A 1AUVA 3UK7A 3O4GA 2IEYA 2FSUA 2NO5A 3E23A 3QPBA 1OZFA 4KQCA 1I7NA 4AU1A 5SICE 3VNVA 1NHGA 3G8YA 3OJFA 4RENA 2YJ5A 3VSEA 4PZ9A 3G68A 3UQYS 5JCJD 3GLIB 3HJFA 4JGIA 2CFSA 1WR8A 2OK7A 4GOND 3FVQA 4P4GA 5AVVA 2FPPA 1GL3A 4QYMA 1TZJA 1TJ3A 4FUTA 2EP5A 2UXDB 5K0ZA 2AQHA 3IH5A 2ZIUB 1WPGA 4HF7A 5DLEA 1OROA 3CYFA 4K6MA 5E1BA 3TJMA 3VPDA 4HDCA 3ZYZA 1J42A 3PBKA 1E7SA 5JQGF 4P33A 4XTRA 1IZ7A 2Q2QA 4EOGA 1PJQA 3JW8A 1RHUA 1RACA 4IVQA 1T0IA 1FP2A 1FS6A 1XEWX 1AM4D 1H23A 2DY0A 4NMWA 4XJXA 5IEJA 2Z5GA 2D5AA 1OOEA 5SZJA 3HKEA 1ZR4A 1IWBB 1YCGA 1XD2B 3FVRA 3P7MA 5HE9A 1N33B 2OBXA 4G41A 5BR8B 4CKBA 1Y7LA 2OGTA 2PRKA 1YU9A 1YJAA 3LC2O 3OJ0A 4FGZA 1L7VC 4JLOA 2HH9A 1THZA 1GLNA 2HOQA 2VIIA 5JSUA 4D0RA 2EGGA 3KR2A 1ZRSA 2B7LA 3HUUA 2QB5A 3A3YA 3OICA 4KKXB 3GZ4A 4KZPA 4XIIA 2PUFA 1LDBA 1U81A 2VUUA 5I7RA 3F2IA 1MIOA 4DV7B 2VQDA 1L7PA 1G17A 3GLHB 4QEKA 5G0VA 4B6OA 1Q11A 4QXQA 1E1QD 4NU5A 3HEMA 5B1EA 4MQ5A 1ZN2A 1ZMXA 2BFNA 2IJGX 4YA6A 5AVOA 3IE1A 4V1CA 1JRLA 3DEYX 1GU7A 3KR9A 4L4ZA 2IHNA 1EUCA 1UKYA 1R0WA 1UWCA 2FZCA 2XDQB 1XEXA 4Y67A 2XXJA 2V59A 4FKZA 4ZXFA 1E5QA 3C48A 4UMVA 3CUEF 3EG9A 4HH4A 3PGJA 4RPJA 4V0KA 5K2OA 1SR8A 1W7AA 4RHXA 1DOHA 3BFPA 4DR4B 4NJMA 4OU4A 3WLAA 3AVUA 5IUJC 1QF6A 4G0NA 5EJ4A 3HGMA 3K1AB 1DIHA 2G1KA 2IUFA 2VXOA 3CRQA 3M3DA 4YRKA 5BRAA 2JAWA 2YASA 3ZD8A 1KJQA 3VBEA 1T3TA 3CKYA 3EF3A 4UTRA 2OOSA 4ENSA 5BSVA 5JSZB 2ECOA 2OHHA 4CIBA 5FFFA 5C8ZA 2HK8A 821PA 2AYYA 2ZUUA 4G2NA 3ETJA 4EIWA 4OQNA 5BY2A 1CB0A 2GCOB 1UXKA 3A1NA 1JSZA 1YR1A 1A27A 3CRMA 3I34X 3K2IA 4GQBA 2ZTUA 5ARDA 3DDOA 3RBZA 3UAOA 2N46A 3FPKA 1W0JA 2W2NA 3D5TA 1FFYA 3VQTA 4OQQA 4F84A 2XTNA 3PFNA 4NMHA 1LPNA 2PMCA 4W6ZA 4COOA 2QRVA 3FCXA 4HWKA 4RQUA 4CM3A 4A10A 2O1SA 3ODGA 3V1KA 3AM4A 4F91B 4BNYA 1E7WA 2QI9C 2EAUA 1VLLA 3NFYA 4P34A 3DKVA 3LA6A 4LW8A 4BAZA 2B21A 1GKIA 2W6OA 5A4AA 2IUSA 3I9NA 3SY8A 3ZWKA 3KXIA 1ZZEA 3MILA 1SXPA