4RL9A

Crystal structure of acinetobacter baumannii caro1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
205
Chain Sequence
IPVGARAEVGTTGYGGALLWQANPYVGLALGYNGGDISWTDKYDLDMDNNNVYLNAEIRPWGASTNPWAQGLYIAAGAAYLDNDYDLAKRIGNGDTLSIDGKNYQQAVPGQEGGVRGKMSYKNDIAPYLGFGFAPKISKNWGVFGEVGAYYTGNPKVELTQYNLAPVTGNPTSAQDAVDKEANEIRNDNKYEWMPVGKVGVNFYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein
molecule keywords Carbapenem-associated resistance protein
total genus 54
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.170 Mainly Beta Beta Barrel Porin Porin 4rl9A00
4FUVA 4RLBA 4RL9A
chains in the Genus database with same CATH superfamily
3SZVA 3AA6A 3FYXA 1GFNA 2K4TA 2KZ7A 1BXWA 3BRZA 4GCSA 4O49A 3UAQA 2JQYA 2R89A 3WI4A 3AA7A 5GTIO 3POQA 4D5UA 3HOEA 4JCHA 4KR8A 3VY9X 3VZTX 4C4VB 2N2MA 4RLCA 3HW9A 3WU2O 4FMSA 4AKRA 4FQEA 5ADXK 2X27X 2XTQA 3LK42 4N58A 8PRNA 1H6S1 2XE5A 4RL9A 4FSPA 5KAIO 3PGSA 2R88A 5TISO 1IZNB 3AAEA 2R4LA 3PQUA 4K3CA 3LK3A 2WVPA 1Q9GA 4O3ZA 5G38A 2KC0A 4AKMA 3AA0A 1MM4A 1Q9FA 2K0LA 1MPFA 3PGUA 4PUXA 5G39A 3SZDA 2W81C 3DA3A 4O4XA 5B5EO 4E1TA 3AAAA 2F1TA 7PRNA 1S5LO 4G76A 3T0SA 2X9KA 2GE4A 4GCQA 4AKRB 5IYUA 1E54A 2W80C 4LSFA 4UB8O 5H2FO 5FVNA 3PQSA 4Z3TA 2FGRA 2R8AA 2ERVA 1HXXA 3AA1A 1IZNA 3AAEB 3SY9A 2Y0LA 2ZFGA 3VE2A 3HOLA 4AYDC 5DL6A 4AYMC 4CTDA 5PRNA 3TZGA 2LHFA 4FZLA 3DA4A 3AA0B 4FZNA 2Y7SA 3VZWX 4FT6A 2WJRA 4KRAA 1ZHTA 5G26A 3GP6A 4LSIA 2XG6A 3POUA 4PJ0O 3UPGA 2J1NA 3A0BO 4FZMA 1P4TA 4PR7A 3WI5A 3AAAB 1GFOA 2KDYA 2Y0KA 5G3AA 4O4UA 1PHOA 1HXTA 2AXTO 2PORA 5DL5A 2KZ7B 2YNKA 4FRXA 3SYBA 2R4PA 6PRNA 2XE2A 5KAFO 4AYEC 4KR4A 5T5FA 3AA1B 4C00A 2JMMA 2IWVA 1ZHYA 4FESA 4C4VA 4K3BA 3PF1A 2FGQX 3BS0A 3QRAA 4UB6O 1BH3A 2XE1A 3LK2A 3O0EA 4E1SA 5JDPA 3DWOX 3T24A 2IWWA 4LSEA 3VZUX 1GFPA 3V8UA 3PGRA 3T20A 1ZHWA 2YPVA 3AA6B 3POXA 4O3WA 4RLBA 1QJ8A 3HWBA 3A0HO 3BRYA 4GF4A 1ZHXA 2OMFA 3NJTA 3SY7A 1T1LA 3AA7B 3PORA 4C69X 3LK41 5AFUK 4RJXA 4AZLA 2R4OA 1QJ9A 2M07A 4N59A 5E79O 3RBHA 4FRTA 3JCUO 4FUVA 4GCPA 1THQA 2ODJA 4RJWA 4N74A 2WJQA 2N2LA 3LK3B 5ADXL 2LFUA 3LK2B 2MHLA 4O3YA 3PRNA 1GFQA 2XE3A 4XNLA 4XNKA 2Y2XA 2XMXA 2PRNA 1HXUA 3QRCA 4FOZA 2MNHA 3UU2A 2XTRA 4JFBA 1ORMA 2F1CX 1MM5A 3G7GA 2QTKA 3JTYA 2R4NA 3KZIO 5DL7A 5B66O 5GTHO 3C5OA 2KXPA 2ZLDA 3VY8X 2F1VA 5D5DA 4B61A 4BUMX 1PRNA 1GFMA 1QJPA 5GV0A 2J4UP 3VE1A 3A2SX 4GHBA 1BT9A 1T16A 4AYNA 4FSOA 5EE2A 3NSGA 4F4BA 4AUIA 4AYID 3DWNA 2Y0HA 4D65A 3SYSA 5AFUL 4IL6O 1OPFA 4D64A 1OSMA 1G90A 4N75A 4AFKA 1YS5A 2M06A 3EMNX 3K19A 4G75A 3KVDD 4O3XB 2O4VA 1ZHZA 4QQ1A 5DL8A 4U9CA 3DZMA 4LSHA 2KXPB
chains in the Genus database with same CATH topology
3SZVA 3AA6A 3FYXA 1GFNA 2K4TA 2KZ7A 1BXWA 4GCSA 4O49A 3UAQA 3WI4A 3AA7A 3POQA 4D5UA 3HOEA 4KR8A 3VZTX 3VY9X 2N2MA 4RLCA 3HW9A 4AKRA 4FMSA 5ADXK 2X27X 2XTQA 3LK42 4N58A 8PRNA 1H6S1 2XE5A 4RL9A 4FSPA 1IZNB 3AAEA 3PQUA 3LK3A 1Q9GA 4O3ZA 4AKMA 2KC0A 3AA0A 1MM4A 1Q9FA 2K0LA 1MPFA 3SZDA 4PUXA 2W81C 3DA3A 4O4XA 4E1TA 3AAAA 2F1TA 7PRNA 4G76A 3T0SA 2GE4A 4GCQA 4AKRB 5IYUA 1E54A 2W80C 4LSFA 5FVNA 3PQSA 4Z3TA 2FGRA 2ERVA 1HXXA 3AA1A 1IZNA 3AAEB 3SY9A 2Y0LA 2ZFGA 3VE2A 3HOLA 4AYDC 5DL6A 4AYMC 5PRNA 3TZGA 2LHFA 4FZLA 3DA4A 3AA0B 4FZNA 2Y7SA 3VZWX 4FT6A 4KRAA 1ZHTA 5G26A 3GP6A 4LSIA 2XG6A 3POUA 3UPGA 2J1NA 4FZMA 3WI5A 1P4TA 3AAAB 1GFOA 2KDYA 2Y0KA 4O4UA 1PHOA 1HXTA 2PORA 5DL5A 2KZ7B 2YNKA 4FRXA 3SYBA 6PRNA 2XE2A 4AYEC 4KR4A 5T5FA 3AA1B 2JMMA 1ZHYA 4FESA 2FGQX 3QRAA 1BH3A 2XE1A 3LK2A 3O0EA 4E1SA 5JDPA 3T24A 4LSEA 3VZUX 1GFPA 3V8UA 3T20A 1ZHWA 2YPVA 3AA6B 3POXA 4O3WA 4RLBA 1QJ8A 3HWBA 4GF4A 1ZHXA 2OMFA 3SY7A 4C69X 3AA7B 3PORA 3LK41 5AFUK 4RJXA 4AZLA 1QJ9A 2M07A 4N59A 3RBHA 4FRTA 4FUVA 4GCPA 1THQA 2ODJA 4RJWA 2N2LA 3LK3B 5ADXL 2LFUA 3LK2B 2MHLA 4O3YA 3PRNA 1GFQA 2XE3A 4XNLA 4XNKA 2Y2XA 2XMXA 2PRNA 1HXUA 3QRCA 4FOZA 2MNHA 3UU2A 2XTRA 4JFBA 1ORMA 4JCHA 1MM5A 3G7GA 2QTKA 3JTYA 5DL7A 3C5OA 2KXPA 2ZLDA 3VY8X 2F1VA 5D5DA 4B61A 4BUMX 1PRNA 1GFMA 1QJPA 5GV0A 2J4UP 3VE1A 3A2SX 4GHBA 1BT9A 4AYNA 4FSOA 5EE2A 3NSGA 4F4BA 4AUIA 4AYID 2Y0HA 4D65A 3SYSA 5AFUL 1OPFA 4D64A 1OSMA 1G90A 4AFKA 1YS5A 2M06A 3EMNX 3K19A 4G75A 3KVDD 4O3XB 2O4VA 1ZHZA 4QQ1A 5DL8A 4U9CA 4LSHA 2KXPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUV A;  4RLB A;  4RL9 A; 
#chains in the Genus database with same CATH topology
 3SZV A;  3AA6 A;  3FYX A;  1GFN A;  2K4T A;  2KZ7 A;  1BXW A;  3BRZ A;  4GCS A;  4O49 A;  3UAQ A;  2JQY A;  2R89 A;  3WI4 A;  3AA7 A;  5GTI O;  3POQ A;  4D5U A;  3HOE A;  4JCH A;  4KR8 A;  3VY9 X;  3VZT X;  4C4V B;  2N2M A;  4RLC A;  3HW9 A;  3WU2 O;  4FMS A;  4AKR A;  4FQE A;  5ADX K;  2X27 X;  2XTQ A;  3LK4 2;  4N58 A;  8PRN A;  1H6S 1;  2XE5 A;  4RL9 A;  4FSP A;  5KAI O;  3PGS A;  2R88 A;  5TIS O;  1IZN B;  3AAE A;  2R4L A;  3PQU A;  4K3C A;  3LK3 A;  2WVP A;  1Q9G A;  4O3Z A;  5G38 A;  2KC0 A;  4AKM A;  3AA0 A;  1MM4 A;  1Q9F A;  2K0L A;  1MPF A;  3PGU A;  4PUX A;  5G39 A;  3SZD A;  2W81 C;  3DA3 A;  4O4X A;  5B5E O;  4E1T A;  3AAA A;  2F1T A;  7PRN A;  1S5L O;  4G76 A;  3T0S A;  2X9K A;  2GE4 A;  4GCQ A;  4AKR B;  5IYU A;  1E54 A;  2W80 C;  4LSF A;  4UB8 O;  5H2F O;  5FVN A;  3PQS A;  4Z3T A;  2FGR A;  2R8A A;  2ERV A;  1HXX A;  3AA1 A;  1IZN A;  3AAE B;  3SY9 A;  2Y0L A;  2ZFG A;  3VE2 A;  3HOL A;  4AYD C;  5DL6 A;  4AYM C;  4CTD A;  5PRN A;  3TZG A;  2LHF A;  4FZL A;  3DA4 A;  3AA0 B;  4FZN A;  2Y7S A;  3VZW X;  4FT6 A;  2WJR A;  4KRA A;  1ZHT A;  5G26 A;  3GP6 A;  4LSI A;  2XG6 A;  3POU A;  4PJ0 O;  3UPG A;  2J1N A;  3A0B O;  4FZM A;  1P4T A;  4PR7 A;  3WI5 A;  3AAA B;  1GFO A;  2KDY A;  2Y0K A;  5G3A A;  4O4U A;  1PHO A;  1HXT A;  2AXT O;  2POR A;  5DL5 A;  2KZ7 B;  2YNK A;  4FRX A;  3SYB A;  2R4P A;  6PRN A;  2XE2 A;  5KAF O;  4AYE C;  4KR4 A;  5T5F A;  3AA1 B;  4C00 A;  2JMM A;  2IWV A;  1ZHY A;  4FES A;  4C4V A;  4K3B A;  3PF1 A;  2FGQ X;  3BS0 A;  3QRA A;  4UB6 O;  1BH3 A;  2XE1 A;  3LK2 A;  3O0E A;  4E1S A;  5JDP A;  3DWO X;  3T24 A;  2IWW A;  4LSE A;  3VZU X;  1GFP A;  3V8U A;  3PGR A;  3T20 A;  1ZHW A;  2YPV A;  3AA6 B;  3POX A;  4O3W A;  4RLB A;  1QJ8 A;  3HWB A;  3A0H O;  3BRY A;  4GF4 A;  1ZHX A;  2OMF A;  3NJT A;  3SY7 A;  1T1L A;  3AA7 B;  3POR A;  4C69 X;  3LK4 1;  5AFU K;  4RJX A;  4AZL A;  2R4O A;  1QJ9 A;  2M07 A;  4N59 A;  5E79 O;  3RBH A;  4FRT A;  3JCU O;  4FUV A;  4GCP A;  1THQ A;  2ODJ A;  4RJW A;  4N74 A;  2WJQ A;  2N2L A;  3LK3 B;  5ADX L;  2LFU A;  3LK2 B;  2MHL A;  4O3Y A;  3PRN A;  1GFQ A;  2XE3 A;  4XNL A;  4XNK A;  2Y2X A;  2XMX A;  2PRN A;  1HXU A;  3QRC A;  4FOZ A;  2MNH A;  3UU2 A;  2XTR A;  4JFB A;  1ORM A;  2F1C X;  1MM5 A;  3G7G A;  2QTK A;  3JTY A;  2R4N A;  3KZI O;  5DL7 A;  5B66 O;  5GTH O;  3C5O A;  2KXP A;  2ZLD A;  3VY8 X;  2F1V A;  5D5D A;  4B61 A;  4BUM X;  1PRN A;  1GFM A;  1QJP A;  5GV0 A;  2J4U P;  3VE1 A;  3A2S X;  4GHB A;  1BT9 A;  1T16 A;  4AYN A;  4FSO A;  5EE2 A;  3NSG A;  4F4B A;  4AUI A;  4AYI D;  3DWN A;  2Y0H A;  4D65 A;  3SYS A;  5AFU L;  4IL6 O;  1OPF A;  4D64 A;  1OSM A;  1G90 A;  4N75 A;  4AFK A;  1YS5 A;  2M06 A;  3EMN X;  3K19 A;  4G75 A;  3KVD D;  4O3X B;  2O4V A;  1ZHZ A;  4QQ1 A;  5DL8 A;  4U9C A;  3DZM A;  4LSH A;  2KXP B; 
#chains in the Genus database with same CATH homology
 3SZV A;  3AA6 A;  3FYX A;  1GFN A;  2K4T A;  2KZ7 A;  1BXW A;  4GCS A;  4O49 A;  3UAQ A;  3WI4 A;  3AA7 A;  3POQ A;  4D5U A;  3HOE A;  4KR8 A;  3VZT X;  3VY9 X;  2N2M A;  4RLC A;  3HW9 A;  4AKR A;  4FMS A;  5ADX K;  2X27 X;  2XTQ A;  3LK4 2;  4N58 A;  8PRN A;  1H6S 1;  2XE5 A;  4RL9 A;  4FSP A;  1IZN B;  3AAE A;  3PQU A;  3LK3 A;  1Q9G A;  4O3Z A;  4AKM A;  2KC0 A;  3AA0 A;  1MM4 A;  1Q9F A;  2K0L A;  1MPF A;  3SZD A;  4PUX A;  2W81 C;  3DA3 A;  4O4X A;  4E1T A;  3AAA A;  2F1T A;  7PRN A;  4G76 A;  3T0S A;  2GE4 A;  4GCQ A;  4AKR B;  5IYU A;  1E54 A;  2W80 C;  4LSF A;  5FVN A;  3PQS A;  4Z3T A;  2FGR A;  2ERV A;  1HXX A;  3AA1 A;  1IZN A;  3AAE B;  3SY9 A;  2Y0L A;  2ZFG A;  3VE2 A;  3HOL A;  4AYD C;  5DL6 A;  4AYM C;  5PRN A;  3TZG A;  2LHF A;  4FZL A;  3DA4 A;  3AA0 B;  4FZN A;  2Y7S A;  3VZW X;  4FT6 A;  4KRA A;  1ZHT A;  5G26 A;  3GP6 A;  4LSI A;  2XG6 A;  3POU A;  3UPG A;  2J1N A;  4FZM A;  3WI5 A;  1P4T A;  3AAA B;  1GFO A;  2KDY A;  2Y0K A;  4O4U A;  1PHO A;  1HXT A;  2POR A;  5DL5 A;  2KZ7 B;  2YNK A;  4FRX A;  3SYB A;  6PRN A;  2XE2 A;  4AYE C;  4KR4 A;  5T5F A;  3AA1 B;  2JMM A;  1ZHY A;  4FES A;  2FGQ X;  3QRA A;  1BH3 A;  2XE1 A;  3LK2 A;  3O0E A;  4E1S A;  5JDP A;  3T24 A;  4LSE A;  3VZU X;  1GFP A;  3V8U A;  3T20 A;  1ZHW A;  2YPV A;  3AA6 B;  3POX A;  4O3W A;  4RLB A;  1QJ8 A;  3HWB A;  4GF4 A;  1ZHX A;  2OMF A;  3SY7 A;  4C69 X;  3AA7 B;  3POR A;  3LK4 1;  5AFU K;  4RJX A;  4AZL A;  1QJ9 A;  2M07 A;  4N59 A;  3RBH A;  4FRT A;  4FUV A;  4GCP A;  1THQ A;  2ODJ A;  4RJW A;  2N2L A;  3LK3 B;  5ADX L;  2LFU A;  3LK2 B;  2MHL A;  4O3Y A;  3PRN A;  1GFQ A;  2XE3 A;  4XNL A;  4XNK A;  2Y2X A;  2XMX A;  2PRN A;  1HXU A;  3QRC A;  4FOZ A;  2MNH A;  3UU2 A;  2XTR A;  4JFB A;  1ORM A;  4JCH A;  1MM5 A;  3G7G A;  2QTK A;  3JTY A;  5DL7 A;  3C5O A;  2KXP A;  2ZLD A;  3VY8 X;  2F1V A;  5D5D A;  4B61 A;  4BUM X;  1PRN A;  1GFM A;  1QJP A;  5GV0 A;  2J4U P;  3VE1 A;  3A2S X;  4GHB A;  1BT9 A;  4AYN A;  4FSO A;  5EE2 A;  3NSG A;  4F4B A;  4AUI A;  4AYI D;  2Y0H A;  4D65 A;  3SYS A;  5AFU L;  1OPF A;  4D64 A;  1OSM A;  1G90 A;  4AFK A;  1YS5 A;  2M06 A;  3EMN X;  3K19 A;  4G75 A;  3KVD D;  4O3X B;  2O4V A;  1ZHZ A;  4QQ1 A;  5DL8 A;  4U9C A;  4LSH A;  2KXP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...