4RL9A

Crystal structure of acinetobacter baumannii caro1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
205
Chain Sequence
b'IPVGARAEVGTTGYGGALLWQANPYVGLALGYNGGDISWTDKYDLDMDNNNVYLNAEIRPWGASTNPWAQGLYIAAGAAYLDNDYDLAKRIGNGDTLSIDGKNYQQAVPGQEGGVRGKMSYKNDIAPYLGFGFAPKISKNWGVFGEVGAYYTGNPKVELTQYNLAPVTGNPTSAQDAVDKEANEIRNDNKYEWMPVGKVGVNFYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenem-associated resistance protein
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein
total genus 54
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.170 Mainly Beta Beta Barrel Porin Porin 4rl9A00
4RLBA 4FUVA 4RL9A
chains in the Genus database with same CATH superfamily
4G76A 5KAFO 5E79O 4AUIA 4AKMA 2J4UP 1ZHTA 4O3YA 4E1SA 3T24A 1BT9A 4XNLA 2Y0HA 5ADXL 3SYSA 3PGUA 7PRNA 3T20A 3HOLA 4AZLA 4AKRB 5G38A 3O0EA 1THQA 4LSEA 4UB6O 3BRYA 5IYUA 2XE5A 3AA1B 3LK3A 5JDPA 3DZMA 1GFNA 4N58A 3SZDA 4AFKA 4B61A 3VY8X 2Y2XA 4C69X 1IZNA 2MNHA 2JMMA 1OSMA 2R89A 3AA7A 4G75A 5KAIO 1GFQA 4FQEA 2F1TA 4Z3TA 2WVPA 2K4TA 1T1LA 2WJQA 3JCUO 4O4XA 6PRNA 1MPFA 1PHOA 4FZLA 1ZHZA 1H6S1 2K0LA 3PF1A 4GCPA 4AYID 3AAEA 2KZ7B 3DWOX 3JTYA 4FESA 2X9KA 4N59A 5ADXK 2OMFA 3DA4A 4AYEC 5EE2A 2R88A 4K3BA 4AYDC 4AYNA 3PGSA 1ZHXA 2R4NA 2X27X 3LK42 4JFBA 4KR4A 4LSIA 3UU2A 4GCSA 3KVDD 4N74A 3AA0A 3SY9A 2IWWA 4PUXA 2IWVA 3TZGA 3WI5A 1BH3A 4O3XB 4JCHA 1P4TA 4FSOA 4N75A 4PR7A 4RLCA 3UPGA 5TISO 1Q9FA 3HOEA 5DL7A 4BUMX 3DA3A 1QJ9A 3POXA 4RJXA 4XNKA 2W81C 2XE1A 2Y0LA 2Y7SA 2AXTO 4FSPA 1BXWA 4KRAA 2PORA 2XE2A 5PRNA 4QQ1A 3SY7A 1G90A 4C4VA 1HXUA 4AYMC 3LK2A 2YPVA 1E54A 2LHFA 3LK3B 4RL9A 1T16A 2W80C 2YNKA 3VY9X 4D5UA 1OPFA 2KDYA 1HXTA 2ZFGA 2MHLA 1IZNB 4RJWA 3AA7B 3LK2B 3NSGA 1MM5A 1QJ8A 2R8AA 2QTKA 1ORMA 4O3WA 4LSHA 1GFPA 2XG6A 4RLBA 4UB8O 5DL5A 5DL8A 4F4BA 4K3CA 3EMNX 2ERVA 5G3AA 1S5LO 2GE4A 2ODJA 3HW9A 3VZUX 3AAEB 2R4OA 3NJTA 5GV0A 2R4LA 2XTQA 2FGRA 4E1TA 5AFUL 3HWBA 1GFMA 4FMSA 5G39A 2M06A 4FOZA 3VZTX 3QRAA 2LFUA 1QJPA 1HXXA 4FT6A 2KXPA 4O49A 2O4VA 3WU2O 3KZIO 5T5FA 3AA0B 3V8UA 3POUA 3C5OA 3WI4A 3G7GA 3QRCA 2R4PA 2JQYA 3PORA 2XMXA 3SYBA 2F1VA 3VE2A 2KXPB 5H2FO 2FGQX 4U9CA 3PRNA 2WJRA 4GCQA 3BRZA 4PJ0O 3AA6A 4AKRA 1Q9GA 2PRNA 4C4VB 8PRNA 5D5DA 4GHBA 3AA1A 3K19A 3SZVA 2M07A 3VE1A 5GTIO 4KR8A 3DWNA 4O4UA 3T0SA 2J1NA 4FZMA 4D65A 2XE3A 2ZLDA 3AA6B 4LSFA 2XTRA 3A2SX 5AFUK 3A0BO 2Y0KA 5GTHO 3RBHA 1PRNA 1MM4A 3UAQA 3AAAA 4CTDA 3PGRA 3A0HO 3LK41 4D64A 3PQUA 5DL6A 5G26A 4C00A 2N2LA 5FVNA 4FRXA 3VZWX 4FUVA 2KZ7A 5B66O 1GFOA 3PQSA 3AAAB 2KC0A 3FYXA 3POQA 3GP6A 1ZHYA 4GF4A 1YS5A 3BS0A 1ZHWA 4IL6O 4FZNA 4FRTA 2N2MA 4O3ZA 2F1CX 5B5EO
chains in the Genus database with same CATH topology
4G76A 4AUIA 4AKMA 2J4UP 1ZHTA 4O3YA 4E1SA 3T24A 1BT9A 4XNLA 2Y0HA 5ADXL 3SYSA 7PRNA 3T20A 3HOLA 4AZLA 4AKRB 3O0EA 1THQA 4LSEA 5IYUA 2XE5A 3AA1B 3LK3A 5JDPA 1GFNA 4N58A 3SZDA 4AFKA 4B61A 3VY8X 2Y2XA 4C69X 1IZNA 2MNHA 2JMMA 1OSMA 3AA7A 4G75A 1GFQA 2F1TA 4Z3TA 2K4TA 4O4XA 6PRNA 1MPFA 1PHOA 4FZLA 1ZHZA 1H6S1 2K0LA 4GCPA 4AYID 3AAEA 2KZ7B 4N59A 3JTYA 4FESA 5ADXK 2OMFA 3DA4A 4AYEC 5EE2A 4AYNA 4AYDC 1ZHXA 2X27X 3LK42 4JFBA 4KR4A 4LSIA 3UU2A 4GCSA 3KVDD 3AA0A 3SY9A 4PUXA 3TZGA 3WI5A 1BH3A 4O3XB 4JCHA 1P4TA 4FSOA 3UPGA 4RLCA 1Q9FA 3HOEA 5DL7A 4BUMX 3DA3A 1QJ9A 3POXA 4RJXA 4XNKA 2W81C 2XE1A 2Y0LA 2Y7SA 4FSPA 4KRAA 1BXWA 5PRNA 2PORA 2XE2A 3SY7A 4QQ1A 1G90A 1HXUA 4AYMC 3LK2A 2YPVA 1E54A 2LHFA 3LK3B 4RL9A 2W80C 2YNKA 3VY9X 4D5UA 1OPFA 2KDYA 1HXTA 2ZFGA 2MHLA 1IZNB 4RJWA 3AA7B 3LK2B 3NSGA 1MM5A 1QJ8A 2QTKA 1ORMA 4O3WA 4LSHA 1GFPA 2XG6A 4RLBA 5DL5A 5DL8A 4F4BA 3EMNX 2ERVA 2GE4A 2ODJA 3HW9A 3VZUX 3AAEB 5GV0A 2XTQA 2FGRA 4E1TA 5AFUL 3HWBA 1GFMA 4FMSA 2M06A 4FOZA 3VZTX 3QRAA 2LFUA 1QJPA 1HXXA 4FT6A 2KXPA 4O49A 2O4VA 5T5FA 3AA0B 3V8UA 3POUA 3C5OA 3WI4A 3G7GA 3QRCA 3PORA 2XMXA 3SYBA 2F1VA 3VE2A 2KXPB 2FGQX 4U9CA 3PRNA 4AKRA 4GCQA 3AA6A 1Q9GA 2PRNA 8PRNA 5D5DA 4GHBA 3AA1A 3K19A 3SZVA 2M07A 3VE1A 4KR8A 4O4UA 3T0SA 2J1NA 4FZMA 4D65A 2XE3A 2ZLDA 3AA6B 4LSFA 2XTRA 3A2SX 5AFUK 2Y0KA 3RBHA 1PRNA 1MM4A 3UAQA 3AAAA 3LK41 4D64A 3PQUA 5DL6A 5G26A 2N2LA 5FVNA 4FRXA 3VZWX 4FUVA 2KZ7A 1GFOA 3PQSA 3AAAB 2KC0A 3FYXA 3POQA 3GP6A 1ZHYA 4GF4A 1YS5A 1ZHWA 4FZNA 4FRTA 2N2MA 4O3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLB A;  4FUV A;  4RL9 A; 
#chains in the Genus database with same CATH topology
 4G76 A;  5KAF O;  5E79 O;  4AUI A;  4AKM A;  2J4U P;  1ZHT A;  4O3Y A;  4E1S A;  3T24 A;  1BT9 A;  4XNL A;  2Y0H A;  5ADX L;  3SYS A;  3PGU A;  7PRN A;  3T20 A;  3HOL A;  4AZL A;  4AKR B;  5G38 A;  3O0E A;  1THQ A;  4LSE A;  4UB6 O;  3BRY A;  5IYU A;  2XE5 A;  3AA1 B;  3LK3 A;  5JDP A;  3DZM A;  1GFN A;  4N58 A;  3SZD A;  4AFK A;  4B61 A;  3VY8 X;  2Y2X A;  4C69 X;  1IZN A;  2MNH A;  2JMM A;  1OSM A;  2R89 A;  3AA7 A;  4G75 A;  5KAI O;  1GFQ A;  4FQE A;  2F1T A;  4Z3T A;  2WVP A;  2K4T A;  1T1L A;  2WJQ A;  3JCU O;  4O4X A;  6PRN A;  1MPF A;  1PHO A;  4FZL A;  1ZHZ A;  1H6S 1;  2K0L A;  3PF1 A;  4GCP A;  4AYI D;  3AAE A;  2KZ7 B;  3DWO X;  3JTY A;  4FES A;  2X9K A;  4N59 A;  5ADX K;  2OMF A;  3DA4 A;  4AYE C;  5EE2 A;  2R88 A;  4K3B A;  4AYD C;  4AYN A;  3PGS A;  1ZHX A;  2R4N A;  2X27 X;  3LK4 2;  4JFB A;  4KR4 A;  4LSI A;  3UU2 A;  4GCS A;  3KVD D;  4N74 A;  3AA0 A;  3SY9 A;  2IWW A;  4PUX A;  2IWV A;  3TZG A;  3WI5 A;  1BH3 A;  4O3X B;  4JCH A;  1P4T A;  4FSO A;  4N75 A;  4PR7 A;  4RLC A;  3UPG A;  5TIS O;  1Q9F A;  3HOE A;  5DL7 A;  4BUM X;  3DA3 A;  1QJ9 A;  3POX A;  4RJX A;  4XNK A;  2W81 C;  2XE1 A;  2Y0L A;  2Y7S A;  2AXT O;  4FSP A;  1BXW A;  4KRA A;  2POR A;  2XE2 A;  5PRN A;  4QQ1 A;  3SY7 A;  1G90 A;  4C4V A;  1HXU A;  4AYM C;  3LK2 A;  2YPV A;  1E54 A;  2LHF A;  3LK3 B;  4RL9 A;  1T16 A;  2W80 C;  2YNK A;  3VY9 X;  4D5U A;  1OPF A;  2KDY A;  1HXT A;  2ZFG A;  2MHL A;  1IZN B;  4RJW A;  3AA7 B;  3LK2 B;  3NSG A;  1MM5 A;  1QJ8 A;  2R8A A;  2QTK A;  1ORM A;  4O3W A;  4LSH A;  1GFP A;  2XG6 A;  4RLB A;  4UB8 O;  5DL5 A;  5DL8 A;  4F4B A;  4K3C A;  3EMN X;  2ERV A;  5G3A A;  1S5L O;  2GE4 A;  2ODJ A;  3HW9 A;  3VZU X;  3AAE B;  2R4O A;  3NJT A;  5GV0 A;  2R4L A;  2XTQ A;  2FGR A;  4E1T A;  5AFU L;  3HWB A;  1GFM A;  4FMS A;  5G39 A;  2M06 A;  4FOZ A;  3VZT X;  3QRA A;  2LFU A;  1QJP A;  1HXX A;  4FT6 A;  2KXP A;  4O49 A;  2O4V A;  3WU2 O;  3KZI O;  5T5F A;  3AA0 B;  3V8U A;  3POU A;  3C5O A;  3WI4 A;  3G7G A;  3QRC A;  2R4P A;  2JQY A;  3POR A;  2XMX A;  3SYB A;  2F1V A;  3VE2 A;  2KXP B;  5H2F O;  2FGQ X;  4U9C A;  3PRN A;  2WJR A;  4GCQ A;  3BRZ A;  4PJ0 O;  3AA6 A;  4AKR A;  1Q9G A;  2PRN A;  4C4V B;  8PRN A;  5D5D A;  4GHB A;  3AA1 A;  3K19 A;  3SZV A;  2M07 A;  3VE1 A;  5GTI O;  4KR8 A;  3DWN A;  4O4U A;  3T0S A;  2J1N A;  4FZM A;  4D65 A;  2XE3 A;  2ZLD A;  3AA6 B;  4LSF A;  2XTR A;  3A2S X;  5AFU K;  3A0B O;  2Y0K A;  5GTH O;  3RBH A;  1PRN A;  1MM4 A;  3UAQ A;  3AAA A;  4CTD A;  3PGR A;  3A0H O;  3LK4 1;  4D64 A;  3PQU A;  5DL6 A;  5G26 A;  4C00 A;  2N2L A;  5FVN A;  4FRX A;  3VZW X;  4FUV A;  2KZ7 A;  5B66 O;  1GFO A;  3PQS A;  3AAA B;  2KC0 A;  3FYX A;  3POQ A;  3GP6 A;  1ZHY A;  4GF4 A;  1YS5 A;  3BS0 A;  1ZHW A;  4IL6 O;  4FZN A;  4FRT A;  2N2M A;  4O3Z A;  2F1C X;  5B5E O; 
#chains in the Genus database with same CATH homology
 4G76 A;  4AUI A;  4AKM A;  2J4U P;  1ZHT A;  4O3Y A;  4E1S A;  3T24 A;  1BT9 A;  4XNL A;  2Y0H A;  5ADX L;  3SYS A;  7PRN A;  3T20 A;  3HOL A;  4AZL A;  4AKR B;  3O0E A;  1THQ A;  4LSE A;  5IYU A;  2XE5 A;  3AA1 B;  3LK3 A;  5JDP A;  1GFN A;  4N58 A;  3SZD A;  4AFK A;  4B61 A;  3VY8 X;  2Y2X A;  4C69 X;  1IZN A;  2MNH A;  2JMM A;  1OSM A;  3AA7 A;  4G75 A;  1GFQ A;  2F1T A;  4Z3T A;  2K4T A;  4O4X A;  6PRN A;  1MPF A;  1PHO A;  4FZL A;  1ZHZ A;  1H6S 1;  2K0L A;  4GCP A;  4AYI D;  3AAE A;  2KZ7 B;  4N59 A;  3JTY A;  4FES A;  5ADX K;  2OMF A;  3DA4 A;  4AYE C;  5EE2 A;  4AYN A;  4AYD C;  1ZHX A;  2X27 X;  3LK4 2;  4JFB A;  4KR4 A;  4LSI A;  3UU2 A;  4GCS A;  3KVD D;  3AA0 A;  3SY9 A;  4PUX A;  3TZG A;  3WI5 A;  1BH3 A;  4O3X B;  4JCH A;  1P4T A;  4FSO A;  3UPG A;  4RLC A;  1Q9F A;  3HOE A;  5DL7 A;  4BUM X;  3DA3 A;  1QJ9 A;  3POX A;  4RJX A;  4XNK A;  2W81 C;  2XE1 A;  2Y0L A;  2Y7S A;  4FSP A;  4KRA A;  1BXW A;  5PRN A;  2POR A;  2XE2 A;  3SY7 A;  4QQ1 A;  1G90 A;  1HXU A;  4AYM C;  3LK2 A;  2YPV A;  1E54 A;  2LHF A;  3LK3 B;  4RL9 A;  2W80 C;  2YNK A;  3VY9 X;  4D5U A;  1OPF A;  2KDY A;  1HXT A;  2ZFG A;  2MHL A;  1IZN B;  4RJW A;  3AA7 B;  3LK2 B;  3NSG A;  1MM5 A;  1QJ8 A;  2QTK A;  1ORM A;  4O3W A;  4LSH A;  1GFP A;  2XG6 A;  4RLB A;  5DL5 A;  5DL8 A;  4F4B A;  3EMN X;  2ERV A;  2GE4 A;  2ODJ A;  3HW9 A;  3VZU X;  3AAE B;  5GV0 A;  2XTQ A;  2FGR A;  4E1T A;  5AFU L;  3HWB A;  1GFM A;  4FMS A;  2M06 A;  4FOZ A;  3VZT X;  3QRA A;  2LFU A;  1QJP A;  1HXX A;  4FT6 A;  2KXP A;  4O49 A;  2O4V A;  5T5F A;  3AA0 B;  3V8U A;  3POU A;  3C5O A;  3WI4 A;  3G7G A;  3QRC A;  3POR A;  2XMX A;  3SYB A;  2F1V A;  3VE2 A;  2KXP B;  2FGQ X;  4U9C A;  3PRN A;  4AKR A;  4GCQ A;  3AA6 A;  1Q9G A;  2PRN A;  8PRN A;  5D5D A;  4GHB A;  3AA1 A;  3K19 A;  3SZV A;  2M07 A;  3VE1 A;  4KR8 A;  4O4U A;  3T0S A;  2J1N A;  4FZM A;  4D65 A;  2XE3 A;  2ZLD A;  3AA6 B;  4LSF A;  2XTR A;  3A2S X;  5AFU K;  2Y0K A;  3RBH A;  1PRN A;  1MM4 A;  3UAQ A;  3AAA A;  3LK4 1;  4D64 A;  3PQU A;  5DL6 A;  5G26 A;  2N2L A;  5FVN A;  4FRX A;  3VZW X;  4FUV A;  2KZ7 A;  1GFO A;  3PQS A;  3AAA B;  2KC0 A;  3FYX A;  3POQ A;  3GP6 A;  1ZHY A;  4GF4 A;  1YS5 A;  1ZHW A;  4FZN A;  4FRT A;  2N2M A;  4O3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...