4RL9A

Crystal structure of acinetobacter baumannii caro1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
205
Chain Sequence
IPVGARAEVGTTGYGGALLWQANPYVGLALGYNGGDISWTDKYDLDMDNNNVYLNAEIRPWGASTNPWAQGLYIAAGAAYLDNDYDLAKRIGNGDTLSIDGKNYQQAVPGQEGGVRGKMSYKNDIAPYLGFGFAPKISKNWGVFGEVGAYYTGNPKVELTQYNLAPVTGNPTSAQDAVDKEANEIRNDNKYEWMPVGKVGVNFYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenem-associated resistance protein
publication title Small-Molecule Transport by CarO, an Abundant Eight-Stranded beta-Barrel Outer Membrane Protein from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein
total genus 54
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.170 Mainly Beta Beta Barrel Porin Porin 4rl9A00
4FUVA 4RLBA 4RL9A
chains in the Genus database with same CATH superfamily
4PJ0O 3SZDA 3SY7A 3A2SX 3RBHA 5G38A 3DA4A 1IZNA 4E1SA 3AA0B 1Q9GA 5AFUK 1PRNA 3DWOX 5DL7A 3NSGA 3SYBA 3AAEA 3PGUA 4N58A 5JDPA 4FT6A 4RJWA 5DL6A 4FZNA 2JQYA 4G76A 4G75A 2LHFA 4E1TA 2ODJA 4LSIA 2JMMA 4FSOA 5AFUL 3AA7B 3PRNA 2K4TA 1BXWA 4GCSA 1PHOA 2J1NA 2YNKA 3AAAA 3O0EA 4PUXA 3HW9A 4LSFA 2YPVA 4QQ1A 3LK3B 1BT9A 2WVPA 2KC0A 2R4NA 2R4PA 1P4TA 2XTRA 2F1TA 4U9CA 4C4VB 1THQA 3G7GA 4AYID 3WI5A 2M06A 4B61A 3AA1B 2XE2A 4GCQA 4AYEC 3DA3A 3KVDD 4O4UA 2R4OA 3PQSA 4FRTA 3K19A 4GF4A 4RJXA 3SY9A 2Y0KA 5GTHO 3JTYA 4O3XB 4XNKA 4GCPA 3QRAA 5IYUA 2FGQX 2N2MA 3VZUX 2KZ7A 3LK2A 4AFKA 1IZNB 2IWVA 3DZMA 3NJTA 4N74A 4BUMX 2LFUA 4GHBA 5DL5A 2ZFGA 4PR7A 1GFMA 2KXPA 2XG6A 3C5OA 2MNHA 4CTDA 2M07A 2R89A 3AAEB 3VZTX 4AYMC 4LSHA 2GE4A 3BRYA 4AKMA 3DWNA 3GP6A 5DL8A 3WI4A 2KDYA 1YS5A 2AXTO 5KAFO 3TZGA 3WU2O 3UPGA 1Q9FA 2XTQA 4FOZA 4O3WA 4O3ZA 5B5EO 4C00A 3AA6B 4KR8A 6PRNA 2ERVA 5ADXK 4FUVA 2O4VA 2Y2XA 2ZLDA 4AKRA 5FVNA 1HXXA 5TISO 3POUA 3SZVA 3UAQA 5GTIO 8PRNA 2PRNA 2XE1A 4FRXA 1GFPA 2R8AA 2WJQA 3LK42 4AZLA 7PRNA 2QTKA 3T20A 5H2FO 3QRCA 2F1CX 3UU2A 3VZWX 1E54A 4FZLA 1GFNA 2R4LA 3AA7A 1MM4A 1T1LA 3PORA 3VE1A 5ADXL 4O3YA 2IWWA 4AUIA 4N59A 3LK3A 4FMSA 1BH3A 2MHLA 3EMNX 2Y0LA 2XE5A 2OMFA 4UB6O 5PRNA 4Z3TA 4D5UA 3SYSA 1HXUA 5KAIO 4K3BA 3POXA 3HWBA 1QJPA 1MM5A 4RL9A 2Y0HA 5D5DA 4KRAA 4C4VA 5GV0A 1ZHYA 3HOLA 4D64A 3KZIO 3LK41 4N75A 1ZHWA 1GFQA 4D65A 2W81C 1H6S1 3AA0A 5G3AA 4C69X 3BRZA 3VE2A 4JCHA 2W80C 1T16A 1OSMA 4LSEA 4FSPA 3AAAB 4JFBA 3FYXA 5G39A 4RLCA 2N2LA 2Y7SA 2K0LA 2PORA 1QJ8A 1QJ9A 4K3CA 2R88A 1GFOA 1OPFA 1ZHXA 4FQEA 4AKRB 4KR4A 3PGSA 2X9KA 3POQA 5G26A 4F4BA 5T5FA 2XE3A 3BS0A 3T0SA 4AYNA 1ZHTA 3A0HO 2XMXA 1HXTA 1S5LO 1ORMA 4FZMA 3AA6A 3HOEA 1G90A 2FGRA 3JCUO 4AYDC 5E79O 2F1VA 5B66O 4RLBA 1ZHZA 2KZ7B 3LK2B 3T24A 3V8UA 4IL6O 5EE2A 2X27X 3AA1A 3VY8X 2WJRA 3PGRA 2KXPB 3VY9X 4O49A 4XNLA 2J4UP 4FESA 3PQUA 1MPFA 3PF1A 3A0BO 4UB8O 4O4XA
chains in the Genus database with same CATH topology
3SZDA 3SY7A 3A2SX 3RBHA 3DA4A 1IZNA 4E1SA 3AA0B 1Q9GA 5AFUK 1PRNA 5DL7A 3NSGA 3SYBA 3AAEA 4N58A 5JDPA 4FT6A 4RJWA 5DL6A 4FZNA 4G76A 4G75A 2LHFA 4E1TA 2ODJA 2JMMA 4FSOA 5AFUL 3AA7B 3PRNA 2K4TA 1BXWA 4GCSA 1PHOA 2J1NA 2YNKA 3AAAA 3O0EA 4PUXA 3HW9A 4LSFA 2YPVA 4QQ1A 3LK3B 1BT9A 2KC0A 1P4TA 2XTRA 2F1TA 4U9CA 1THQA 3G7GA 4AYID 3WI5A 2M06A 4B61A 3AA1B 2XE2A 4GCQA 4AYEC 3DA3A 3KVDD 4O4UA 3PQSA 4FRTA 3K19A 4GF4A 4RJXA 3SY9A 2Y0KA 3JTYA 4O3XB 4XNKA 4GCPA 3QRAA 5IYUA 2FGQX 2N2MA 3VZUX 2KZ7A 3LK2A 4AFKA 1IZNB 4BUMX 2LFUA 4GHBA 5DL5A 2ZFGA 1GFMA 2KXPA 2XG6A 3C5OA 2MNHA 2M07A 3AAEB 3VZTX 4AYMC 4LSHA 2GE4A 4AKMA 3GP6A 5DL8A 3WI4A 2KDYA 1YS5A 3TZGA 3UPGA 1Q9FA 2XTQA 4FOZA 4O3WA 4O3ZA 6PRNA 3AA6B 4KR8A 2ERVA 5ADXK 4FUVA 2O4VA 2Y2XA 2ZLDA 4AKRA 5FVNA 1HXXA 3POUA 3SZVA 3UAQA 8PRNA 2PRNA 2XE1A 4FRXA 1GFPA 3LK42 4AZLA 7PRNA 3T20A 2QTKA 3QRCA 3UU2A 3VZWX 1E54A 4FZLA 1GFNA 3AA7A 3PORA 1MM4A 3VE1A 5ADXL 4O3YA 4AUIA 4N59A 3LK3A 4FMSA 1BH3A 2MHLA 3EMNX 2Y0LA 2XE5A 2OMFA 5PRNA 4Z3TA 4D5UA 3SYSA 1HXUA 4RL9A 3POXA 3HWBA 1QJPA 1MM5A 2Y0HA 5D5DA 4KRAA 5GV0A 1ZHYA 3HOLA 4D64A 3LK41 1ZHWA 1GFQA 4D65A 2W81C 1H6S1 3AA0A 4C69X 3VE2A 4JCHA 2W80C 1OSMA 4LSEA 4FSPA 3AAAB 4JFBA 3FYXA 4RLCA 2N2LA 2Y7SA 2K0LA 2PORA 1QJ8A 1QJ9A 4LSIA 1GFOA 1OPFA 1ZHXA 4AKRB 4KR4A 3POQA 5G26A 4F4BA 5T5FA 2XE3A 3T0SA 4AYNA 1ZHTA 2XMXA 1HXTA 1ORMA 4FZMA 3AA6A 3HOEA 1G90A 2FGRA 4AYDC 2F1VA 4RLBA 1ZHZA 2KZ7B 3LK2B 3T24A 3V8UA 5EE2A 2X27X 3AA1A 3VY8X 2KXPB 3VY9X 4O49A 4XNLA 2J4UP 4FESA 3PQUA 1MPFA 4O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUV A;  4RLB A;  4RL9 A; 
#chains in the Genus database with same CATH topology
 4PJ0 O;  3SZD A;  3SY7 A;  3A2S X;  3RBH A;  5G38 A;  3DA4 A;  1IZN A;  4E1S A;  3AA0 B;  1Q9G A;  5AFU K;  1PRN A;  3DWO X;  5DL7 A;  3NSG A;  3SYB A;  3AAE A;  3PGU A;  4N58 A;  5JDP A;  4FT6 A;  4RJW A;  5DL6 A;  4FZN A;  2JQY A;  4G76 A;  4G75 A;  2LHF A;  4E1T A;  2ODJ A;  4LSI A;  2JMM A;  4FSO A;  5AFU L;  3AA7 B;  3PRN A;  2K4T A;  1BXW A;  4GCS A;  1PHO A;  2J1N A;  2YNK A;  3AAA A;  3O0E A;  4PUX A;  3HW9 A;  4LSF A;  2YPV A;  4QQ1 A;  3LK3 B;  1BT9 A;  2WVP A;  2KC0 A;  2R4N A;  2R4P A;  1P4T A;  2XTR A;  2F1T A;  4U9C A;  4C4V B;  1THQ A;  3G7G A;  4AYI D;  3WI5 A;  2M06 A;  4B61 A;  3AA1 B;  2XE2 A;  4GCQ A;  4AYE C;  3DA3 A;  3KVD D;  4O4U A;  2R4O A;  3PQS A;  4FRT A;  3K19 A;  4GF4 A;  4RJX A;  3SY9 A;  2Y0K A;  5GTH O;  3JTY A;  4O3X B;  4XNK A;  4GCP A;  3QRA A;  5IYU A;  2FGQ X;  2N2M A;  3VZU X;  2KZ7 A;  3LK2 A;  4AFK A;  1IZN B;  2IWV A;  3DZM A;  3NJT A;  4N74 A;  4BUM X;  2LFU A;  4GHB A;  5DL5 A;  2ZFG A;  4PR7 A;  1GFM A;  2KXP A;  2XG6 A;  3C5O A;  2MNH A;  4CTD A;  2M07 A;  2R89 A;  3AAE B;  3VZT X;  4AYM C;  4LSH A;  2GE4 A;  3BRY A;  4AKM A;  3DWN A;  3GP6 A;  5DL8 A;  3WI4 A;  2KDY A;  1YS5 A;  2AXT O;  5KAF O;  3TZG A;  3WU2 O;  3UPG A;  1Q9F A;  2XTQ A;  4FOZ A;  4O3W A;  4O3Z A;  5B5E O;  4C00 A;  3AA6 B;  4KR8 A;  6PRN A;  2ERV A;  5ADX K;  4FUV A;  2O4V A;  2Y2X A;  2ZLD A;  4AKR A;  5FVN A;  1HXX A;  5TIS O;  3POU A;  3SZV A;  3UAQ A;  5GTI O;  8PRN A;  2PRN A;  2XE1 A;  4FRX A;  1GFP A;  2R8A A;  2WJQ A;  3LK4 2;  4AZL A;  7PRN A;  2QTK A;  3T20 A;  5H2F O;  3QRC A;  2F1C X;  3UU2 A;  3VZW X;  1E54 A;  4FZL A;  1GFN A;  2R4L A;  3AA7 A;  1MM4 A;  1T1L A;  3POR A;  3VE1 A;  5ADX L;  4O3Y A;  2IWW A;  4AUI A;  4N59 A;  3LK3 A;  4FMS A;  1BH3 A;  2MHL A;  3EMN X;  2Y0L A;  2XE5 A;  2OMF A;  4UB6 O;  5PRN A;  4Z3T A;  4D5U A;  3SYS A;  1HXU A;  5KAI O;  4K3B A;  3POX A;  3HWB A;  1QJP A;  1MM5 A;  4RL9 A;  2Y0H A;  5D5D A;  4KRA A;  4C4V A;  5GV0 A;  1ZHY A;  3HOL A;  4D64 A;  3KZI O;  3LK4 1;  4N75 A;  1ZHW A;  1GFQ A;  4D65 A;  2W81 C;  1H6S 1;  3AA0 A;  5G3A A;  4C69 X;  3BRZ A;  3VE2 A;  4JCH A;  2W80 C;  1T16 A;  1OSM A;  4LSE A;  4FSP A;  3AAA B;  4JFB A;  3FYX A;  5G39 A;  4RLC A;  2N2L A;  2Y7S A;  2K0L A;  2POR A;  1QJ8 A;  1QJ9 A;  4K3C A;  2R88 A;  1GFO A;  1OPF A;  1ZHX A;  4FQE A;  4AKR B;  4KR4 A;  3PGS A;  2X9K A;  3POQ A;  5G26 A;  4F4B A;  5T5F A;  2XE3 A;  3BS0 A;  3T0S A;  4AYN A;  1ZHT A;  3A0H O;  2XMX A;  1HXT A;  1S5L O;  1ORM A;  4FZM A;  3AA6 A;  3HOE A;  1G90 A;  2FGR A;  3JCU O;  4AYD C;  5E79 O;  2F1V A;  5B66 O;  4RLB A;  1ZHZ A;  2KZ7 B;  3LK2 B;  3T24 A;  3V8U A;  4IL6 O;  5EE2 A;  2X27 X;  3AA1 A;  3VY8 X;  2WJR A;  3PGR A;  2KXP B;  3VY9 X;  4O49 A;  4XNL A;  2J4U P;  4FES A;  3PQU A;  1MPF A;  3PF1 A;  3A0B O;  4UB8 O;  4O4X A; 
#chains in the Genus database with same CATH homology
 3SZD A;  3SY7 A;  3A2S X;  3RBH A;  3DA4 A;  1IZN A;  4E1S A;  3AA0 B;  1Q9G A;  5AFU K;  1PRN A;  5DL7 A;  3NSG A;  3SYB A;  3AAE A;  4N58 A;  5JDP A;  4FT6 A;  4RJW A;  5DL6 A;  4FZN A;  4G76 A;  4G75 A;  2LHF A;  4E1T A;  2ODJ A;  2JMM A;  4FSO A;  5AFU L;  3AA7 B;  3PRN A;  2K4T A;  1BXW A;  4GCS A;  1PHO A;  2J1N A;  2YNK A;  3AAA A;  3O0E A;  4PUX A;  3HW9 A;  4LSF A;  2YPV A;  4QQ1 A;  3LK3 B;  1BT9 A;  2KC0 A;  1P4T A;  2XTR A;  2F1T A;  4U9C A;  1THQ A;  3G7G A;  4AYI D;  3WI5 A;  2M06 A;  4B61 A;  3AA1 B;  2XE2 A;  4GCQ A;  4AYE C;  3DA3 A;  3KVD D;  4O4U A;  3PQS A;  4FRT A;  3K19 A;  4GF4 A;  4RJX A;  3SY9 A;  2Y0K A;  3JTY A;  4O3X B;  4XNK A;  4GCP A;  3QRA A;  5IYU A;  2FGQ X;  2N2M A;  3VZU X;  2KZ7 A;  3LK2 A;  4AFK A;  1IZN B;  4BUM X;  2LFU A;  4GHB A;  5DL5 A;  2ZFG A;  1GFM A;  2KXP A;  2XG6 A;  3C5O A;  2MNH A;  2M07 A;  3AAE B;  3VZT X;  4AYM C;  4LSH A;  2GE4 A;  4AKM A;  3GP6 A;  5DL8 A;  3WI4 A;  2KDY A;  1YS5 A;  3TZG A;  3UPG A;  1Q9F A;  2XTQ A;  4FOZ A;  4O3W A;  4O3Z A;  6PRN A;  3AA6 B;  4KR8 A;  2ERV A;  5ADX K;  4FUV A;  2O4V A;  2Y2X A;  2ZLD A;  4AKR A;  5FVN A;  1HXX A;  3POU A;  3SZV A;  3UAQ A;  8PRN A;  2PRN A;  2XE1 A;  4FRX A;  1GFP A;  3LK4 2;  4AZL A;  7PRN A;  3T20 A;  2QTK A;  3QRC A;  3UU2 A;  3VZW X;  1E54 A;  4FZL A;  1GFN A;  3AA7 A;  3POR A;  1MM4 A;  3VE1 A;  5ADX L;  4O3Y A;  4AUI A;  4N59 A;  3LK3 A;  4FMS A;  1BH3 A;  2MHL A;  3EMN X;  2Y0L A;  2XE5 A;  2OMF A;  5PRN A;  4Z3T A;  4D5U A;  3SYS A;  1HXU A;  4RL9 A;  3POX A;  3HWB A;  1QJP A;  1MM5 A;  2Y0H A;  5D5D A;  4KRA A;  5GV0 A;  1ZHY A;  3HOL A;  4D64 A;  3LK4 1;  1ZHW A;  1GFQ A;  4D65 A;  2W81 C;  1H6S 1;  3AA0 A;  4C69 X;  3VE2 A;  4JCH A;  2W80 C;  1OSM A;  4LSE A;  4FSP A;  3AAA B;  4JFB A;  3FYX A;  4RLC A;  2N2L A;  2Y7S A;  2K0L A;  2POR A;  1QJ8 A;  1QJ9 A;  4LSI A;  1GFO A;  1OPF A;  1ZHX A;  4AKR B;  4KR4 A;  3POQ A;  5G26 A;  4F4B A;  5T5F A;  2XE3 A;  3T0S A;  4AYN A;  1ZHT A;  2XMX A;  1HXT A;  1ORM A;  4FZM A;  3AA6 A;  3HOE A;  1G90 A;  2FGR A;  4AYD C;  2F1V A;  4RLB A;  1ZHZ A;  2KZ7 B;  3LK2 B;  3T24 A;  3V8U A;  5EE2 A;  2X27 X;  3AA1 A;  3VY8 X;  2KXP B;  3VY9 X;  4O49 A;  4XNL A;  2J4U P;  4FES A;  3PQU A;  1MPF A;  4O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...