4RM8A

Crystal structure of human ezrin in space group p21
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
586
structure length
368
Chain Sequence
b'MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 130
structure length 368
sequence length 586
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm8A01
1Z2MA 1WJ6A 2K39A 4IWQA 4HXDA 2KDBA 4GXBA 1WXMA 3QARA 4EZKA 2N1WA 2VRRB 4EKUA 1S3SG 2ZZPB 3JYUA 5LXIB 1WX9A 2J7QB 4PYUA 2J0KA 2KDEB 3HIZA 3A1QA 1IPGA 1WX7A 4PS8A 4BOSC 1G6JA 2AEHA 4HCPB 2DHZA 2R2OA 3A33B 3W1YA 3RD2A 4DDID 1J8CA 2LXCA 3DVNU 4IM0A 4AJWA 4B95A 2KWUB 2M1MA 3QCAA 3H1UA 4MSQB 1C3TA 4ZRJA 3H7PB 1RRBA 1UGMA 1D3ZA 4IC7B 2WYQA 2KLCA 3NY5A 3M62B 1P9DU 2WDTB 3PTFC 1E5WA 2KDFB 3APDA 2Z0EB 3DVGY 1RFAA 3QAQA 2RR9A 4GSWA 3TMPB 5JHBA 2K8BA 4JL9A 3V61A 1OQYA 1OEYA 4MELA 3KUCB 4MM3A 2GMIC 3ONSA 2MRPA 5CHWA 4ICUA 3I3TB 4LJOB 3R66C 3HM6X 4HDQA 4W9DA 4MSMB 3VFKA 1WGRA 2KK8A 3AI5A 2AL6A 3QWZB 3K9PB 1WJNA 2RGFA 3HK0A 3ML8A 2KO3A 4A3PA 3PGEA 2KN5A 3JVZX 3ZVVA 1E8YA 2DAFA 3CSFA 5J17A 2KLGA 3HM3A 3BY4B 4EFOA 3R3MA 4W9JA 2FIDA 2MQJA 3MHSD 3RT3B 5D94A 3LDZE 2LVPA 4AJYB 1P98A 4BBNF 5E6OA 1JRUA 2M0XA 4NAWB 1SGHA 2HE7A 3C0RB 3IVFA 3L10B 3EFUA 4GMVA 4TKNA 5DPRA 4ANWA 3PVLA 3L08A 2O2VA 3A9KA 4OVVA 2XBBC 4WJNA 4CO7A 4RM8A 2MBHA 1RAXA 2RPQA 3APFA 4N9F4 3T8MA 4IM2A 2HD5B 1OTRB 2J0JA 4FULA 3VXWA 4DWFA 4WQOB 2DZJA 1WH3A 2V3SA 3PS6A 4I6NB 4AOFA 3KYDD 4HDOA 1EO6A 1WM2A 2CKHB 1I42A 2FCQA 5E6NA 2DZIA 2Y5BB 1EUVB 3GOEA 2LXAA 3L13A 4WJPA 1GNUA 1GJZA 1X1MA 2LVOA 5C23A 5JHAA 3VUXA 2MWSB 3DBRI 5LXHA 4G3XB 4WAAA 3ZDTA 1WR6E 2CU1A 2G3QB 1WMHB 1YX5B 2GBRA 3PRZA 2EKEC 1VCBA 4ZDVA 2L0FA 4KVGB 4XX5A 1Q5WB 3TIXA 4DXAB 2IO1B 3GZNI 4GB9A 1E90A 1I35A 2KWCA 4MGIE 4KDIC 1P1AA 2WWZA 3VTUA 2JT4B 4J6IA 4I6LB 3VH4B 5L83A 3VVWB 2JWZA 2AL3A 2ASQA 3KW5B 1SE9A 2L8JA 2DZMA 4DHZB 2FCSA 1J0GA 3IHPC 1P0RA 1WYWB 2G4SA 2N9PC 2I1KA 2NBVB 3KVFB 4HWIB 1OGWA 2FCMA 3W1SC 1QZEA 4K81A 1WJUA 2CR5A 3LJ3A 1WIAA 2LJ5A 3OJ4B 4GDKA 5C1ZA 2OOBB 4MDKE 3UGBB 1CMXB 1GC6A 3CMMB 2ZNVB 4TV3A 2IO0B 2ZJDA 4LCDE 4MGKE 2KTRB 3ECIA 3TL5A 4DHJD 1A5RA 3IG3A 1S1QB 1EF5A 2HTHA 3UINB 2KQ7A 3PPAA 3U8ZA 2DYBA 4NPNA 2W9NA 4NY0A 2K6QA 3MJWA 4ASWC 4ANXA 2ZEQA 2D2QA 3IBEA 3ZTCA 2KQSA 3ZRFA 3A9JA 2GBKA 4DDGD 5EDSA 2NBWB 1ISNA 3Q3JA 4BBNC 4G50A 1YX6B 3RZWC 5AZFA 4GDLB 1E8XA 3M63B 2M8SA 3V60A 2D07B 4I6PA 2ZNVC 4ANVA 4F7ZA 2XK5B 3N3KB 1NDDA 4KV2A 2NCNA 4OVUA 3X0WA 3K9OB 4II3B 1EF1A 1UBQA 2N7DA 1WY8A 1L2NA 2KC2A 2N9XA 4RM9A 1L7YA 2YVCA 4MJSB 4W9IA 3VQIA 4GU2A 4PYZA 3UIPB 2MSED 4YL8A 3NOBA 1ZKHA 1WM3A 2FIFA 3WIMA 2IO3B 4HJKA 3PT2B 2KXJA 3L17A 1WE6A 4BKGA 1E8ZA 4FHKA 3DDCB 3NHEB 4NQKE 1GUAB 2N4FA 2R2QA 4WJQA 3PZDA 2NPTB 2MBBB 2K6DB 2KX3A 3M95A 3PSEB 2O6VA 2KFKB 4FN2A 5CX3A 1C1YB 1V80A 2M4NA 3N32A 2LZ6A 4HPLB 2GBJA 2LRWA 2IBIB 3CF6E 2MLBA 2JZZA 3H9DA 4K7SA 2KC1A 1H4RA 4ICVA 2QHOA 1F9JA 2MA9B 4ZRKA 3EC8A 3ZDMC 3WAPA 3AU5A 4BKSA 3PV1A 3L0WB 4JIOU 3SDLC 3D32A 4KIKA 2V4LA 4EOYA 3ZNGC 3OLMD 1KOTA 2MP2A 3KYCD 2KX0A 2N7EA 4E71A 2BWFA 5AZGA 4WWOA 4HPMB 3JW0X 2KJRA 4NJ7A 4BVUC 4KSKC 1NBFC 5D6JB 1Q0WB 2DZKA 4FHJA 3ZNID 3B1LX 2C5LC 1E7VA 2ZVNA 3NS8A 2LVQA 3JSVA 4K7WA 2K1FA 1BT0A 2KMAA 2L0TA 2Z59B 2CHXA 2K25A 2O6VD 3QIJA 1WRDB 4BOZB 1IYFA 2JVCA 3ZO5B 5J18A 2JRIB 1UD7A 3UF8A 3VAWA 3ZW3A 1XD3B 2LD9A 5KHOA 1HE8A 3ZKJC 4DHZE 2N9EB 1WI0A 1P3QU 3V6CB 3P2BA 2G4DB 4BKSD 2JUOA 2EMTA 3EECA 4KDLB 2N1VA 3QX1A 3T9LA 3A1QB 4B9KA 3H7PA 3TJPA 4W9LA 1WGYA 1KLVA 3DVNV 4E3CA 3UQBA 2BWES 1NI2A 1ZGUB 4MGZE 2GBNA 3AXCA 4A3OA 3VHTC 1WX8A 3L16A 3S2AA 4KSLC 5KHQA 2LWPA 3U30A 1YIWA 2BKRB 2NVUI 4EZJA 3HHMA 1V6EA 1TZ1A 4IWOA 2GOWA 2FUHB 1LFDA 4RMAA 1YQBA 2KMCA 2KD0A 2IYDB 1UH6A 1WFYA 1TGZB 2JY6A 3O65B 3A4SC 4W9EA 5FR6A 2KVRA 4TUUA 1UELA 5LLIA 3DVGX 3OAWA 3ALBA 2IY0B 3PRPB 2ZCCA 3H7SA 2V1YA 1UZXB 3ZNHB 2EMSA 2GBMA 3OJ3A 4K7UA 4E74A 4KZ0A 2IO2B 2MBQA 4NAWA 4B6WA 2JRHA 4IUMB 3IFWB 3PHXB 2ZPNA 3QHTA 1LQBA 2JPHA 2WX0A 2LI5A 3KUZA 4IWPA 2KOXA 4WJOA 1V9JA 1E7UA 1OEYJ 4DK5A 2Z0DB 5BO4B 2L76A 1T0YA 4FJVB 3KH0A 2C60A 3WA0A 3ENEA 2PEAA 4HVBA 3DBSA 1V2YA 1WE7A 3UIOB 1FXTB 2HJ8A 5J2RA 1E8WA 4JLCA 3X23A 3ZRCA 1WZ3A 4DBGA 3SU8X 4F1SA 5AEKB 4EZLA 2BYEA 2O2VB 3A9KB 2C7MB 4W9GA 4W9FA 1WF9A 2LGDA 3RYTA 2XEWA 2I1JA 3W1SA 1WMHA 3JSVB 3QA8A 4GOCA 3NZSA 4NJ6A 2AWTA 4ZYNA 4M0WB 2KJHB 3DOWA 5G55A 3TCAA 4JQWC 5DPSA 2UYZB 2WX1A 4F8CB 2LGXA 4A20A 4EEWA 3PRMB 4FJZA 4M8MA 4MGYE 2BF8B 1WGGA 2K8HA 3QK0A 2AYOB 2BPSA 2DYOA 4G11A 1K8RB 1RLFA 2PPHA 4DHJB 2CHWA 5JH5C 2DAJA 3VDZA 1WZ0A 4NQLB 5G2NA 2MBEA 4CHKA 2B3AA 2DENB 2BYFA 2ZCBA 2NS5A 4IM3A 3ZUNA 1U4AA 2OJRA 2D10A 4W9KA 4AWJA 3N30A 1KJTA 3BINA 2L05A 3A4RA 2KTRA 2KWVB 3DCGA 1Q1OA 2MX2A 3PREA 3RULA 4AP4C 3RUIB 4FADA 5DPTA 1J19A 2C9WB 3R7QA 2KANA 5CHVC 3NZUA 4G0NB 2ZPYA 4IG7B 1GG3A 2JXXA 4ANUA 1TBEA 2L3ZA 2L7RA 1WXSA 4IW0A 3VH3B 3VUYA 3VTVA 4M8NA 4MEMA 4XZ4A 1Y8RC 2MBOA 4GDKB 2PE6B 2BKFA 4K1RB 4W9HA 5L95C 1H8CA 3QJZA 2KHWB 5D7GA 3PLVA 4BFRA 4X57B 2REXA 2L00B 3PLUA 4GDLA 2JZ3B 1R4NI 2NR2A 5DCNA 1VD2A 2DX5B 3AULA 2CHZA 4LJPB 2XK5A 2G45B 1LM8B 1SIFA 2A4ZA 2ZVOA 4GGQA 4FA6A 4JGHB 3TBLD 2FAZA 3L54A 4II2B 2RD0A 2PJHA 4HK2A 5CTRC 4MJSA 4MH0E 2BYVE 3A9JB 2C7HA 2KNBA 3QC8B 4LDTD 2IY1B 5JZEB 4TQ1A 4P7IA 3ZTDA 1ZW7A 3ZNZB 2JF5A 1YJ1A 2KDIA 2UWQA 4GN1A 1WR1A 1V5OA 2MW5A 3DQVA 3DPDA 2YLMA 3ZLZA 2A5UA 3RCZA 1IP9A 1WGHA 2DYMA 4FLHA 3DBHI 4EUTA 2NPTA 1V81A 1WJ4A 2LASA 3ML9A 4GIVA 3PHWB 1V86A 3UQAA 1PQSA 2KFKA 5AZHA 3WAOA 2D11A 1TTNA 1WGDA 3MTNB 4HCNB 1LXDA 2LUEA 4WWPA 1KM7A 1V5TA 4URKA 4AUQC 1Z5SB 5E6PA 5D2MB 3SHQA 4ZRIA 3Q3FA 1WXAA 2C7NB 5IAAC 1UBIA 3CSTA 3V6EB 3WANA 1R4MI 2KZRA 3EHVA 3U7DA 1XT9B 3M3JA 2KKCA 2LGYA 5TR5A 4FBJB 4CYEA 5CHFA 2RSUA 3B0AA 2D3GA 3H6NA 3WAMA 4TQ0A 4HLEA 2O6VB 5GMVA 1WXVA 2KFJA 4KZCA 1M94A 1V49A 5HKHA 3V62A 2FNJB 3VTWA 3KUDB 3APCA 3DBLI 1XQQA 2IZVB 2KTFA 2M17A 3AU4A 4XC2A 1YD8U 4PS3A 4FJYA 4BKTA 1AARA 3R7RA 3SD5A 1MG8A 2BGFA 4KIKB 4W9CA 4LDTB 5IA7A 4PS7A 2J0MA 2FCNA 1GC7A 4NNJB 4WWNA 2MCNB 3QQ8B 2MP2B 3VUWA 3WALA 2NBUA 3B08A 2CS4A 3ZIMA 2PE9A 3RZFA 2LRUA 2K8CA 2KJ6A 5DPWA
chains in the Genus database with same CATH superfamily
2V9HA 4HXDA 2KT7A 4WH4A 2VRRB 4EKUA 5LXIB 4PYUA 1WX7A 4BOSC 4YSYB 3RPFC 2R2OA 3RD2A 1J8CA 1GOZA 3AEGB 3PZ7A 2KWUB 2M1MA 1AW7A 2QJLA 5H92C 1RRBA 1UGMA 3NY5A 3M62B 1XEEA 1PGAA 1WRIA 3DVGY 3NG0A 5H8YE 4LTUA 1QLBB 5C3JB 3R66C 3HM6X 4MSMB 3VFKA 1FMAD 1WGRA 3AI5A 3QWZB 3K9PB 1MJDA 1D5MC 2RGFA 1D5XC 3PGEA 3ZVVA 3BY4B 4OW0A 1M4VA 3LDZE 1QQRA 1P98A 3AEDB 4OZBA 1EU4A 2HE7A 3L10B 2N0SB 3I63C 4ANWA 4RM8A 2LHDA 4N9F4 4WQOB 2BYTA 4AOFA 3Q3MC 3PS6A 4M00A 4M0WA 2KVZA 3PZ8A 2CKHB 1I42A 2FCQA 5JHAA 2LVOA 2MWSB 4LNFA 2QSDA 4G3XB 3GP7A 2G3QB 1WMHB 1I4XA 5IP4D 3PRZA 1CQVA 4XX5A 2IO1B 1E90A 1WGKA 1J7CA 3DBLB 1DGJA 2BS3B 3VTUA 4J6IA 2OHFA 2ASQA 3KW5B 3RNEC 4N59A 1WYWB 2FCMA 3W1SC 4AQ7A 1TJEA 4GDKA 3VR9B 1IBXB 1CMXB 2E6XA 3IG3A 1EF5A 2HTHA 2I38A 2KQ7A 3U8ZA 4NPNA 2W9NA 4NY0A 4ZOHC 4A9AA 1WYGA 3KWVA 3ZTCA 3C19A 4HROA 1RWSA 1YX6B 3N1ZC 4GDLB 3AEEB 2WXHA 2ZNVC 1TZOA 4ANVA 3NUHB 1NDDA 2NCNA 3X0WA 3K9OB 1L2NA 1ACCA 4RCOA 3VQIA 2LEKA 1TKYA 4GU2A 1HZ5A 4PYZA 2J42A 2WXQA 2MSED 5BMHA 3WIMA 2IO3B 4HJKA 2R2QA 2INCC 2MBBB 2BVCA 3M95A 3PSEB 4TSSA 1MFWA 1YOVB 1YJJA 1R4NB 2IBIB 3CF6E 2MLBA 3H9DA 4K7SA 1F2RC 2KC1A 3AE8B 2JQRB 4YSXB 3AU5A 3SDLC 3SFDB 1KRHA 2PLPA 1VJKA 3OLMD 1ZUD2 1KOTA 2N7EA 3AM9A 2JYEA 1RFKA 4NJ7A 2J53A 5D6JB 2DZKA 3B1LX 2WXIA 2C5LC 3NS8A 4K7WA 1WSPA 4RF1A 1WRDB 2WXOA 1IYFA 2JRIB 3UF8A 2LD9A 3NVWA 3ZKJC 1MHHE 1HXYD 1WI0A 3V6CB 1JQ4A 5BYQA 3EECA 2WXLA 3T9LA 5HFYA 4B9KA 1KLVA 1Y56A 3AB5A 2IGGA 2Y5CA 4MGZE 2BQQA 4ZHPA 1XLNA 3Q8EA 3L16A 3U30A 1YIWA 2NVUI 4EZJA 1VZ6A 1V6EA 4IWOA 4P16A 2FUHB 2KQ4X 2DNFA 2PW9A 1KF6B 2V3NA 3VR8B 1WFYA 2JY6A 3A4SC 4ARIA 1K53A 3AE3B 3H7SA 1C76A 3ZXRA 1N5XA 2EMSA 4E74A 1FCLA 1N61A 2RPVA 2IO2B 4KZ0A 2WLBA 3DWGC 4B6WA 2JRHA 2WXJA 1JROA 3PHXB 1LQBA 2JPHA 4RGOS 4IWPA 1E7UA 2CJOA 2Z0DB 2L76A 1T0YA 3WA0A 2PEAA 1V2YA 2ZW1A 1FXTB 3MC9A 4JLCA 3SU8X 4F1SA 3A9KB 4W9GA 2C7MB 1WF9A 5EE9A 1F0ZA 1WMHA 1HQRD 1FIQA 5HHDG 2WX1A 3MP9A 4FJZA 4M8MA 3NZ3A 2PIAA 2WDVB 2DYOA 4DHJB 1L4ZB 3B2FA 1V97A 3AEBB 2BYFA 3FC4A 5EE1A 1OQQA 2JU6X 3RULA 4FADA 1N63A 3RUIB 1XLPA 3IAM1 1J19A 3R7QA 2INNE 4IG7B 3HVZA 4ANUA 2L3ZA 1WXSA 3VUYA 4M8NA 4XZ4A 3FILB 1VZ7A 5L95C 3QJZA 4GDLA 5DCNA 1LM8B 1QILA 2FAZA 4HK2A 2BYVE 4IKGA 4UDUC 1DOYA 3ZTDA 5BMGA 2OJWA 1V5OA 3ZLZA 2W54A 2DYMA 4GIVA 1SXTA 3UQAA 3WAOA 1Z5SB 3SHQA 1N6ZA 1WXAA 1A70A 5D3IB 1MG4A 5E6JA 4FBJB 1ZPSA 1SJED 3WAMA 4IOIE 4EE2A 5T8IA 1GB1A 2O6VB 5GMVA 5HKHA 1FCCC 3KUDB 1DYQA 1XQQA 4FJYA 2ACZB 1BXTA 4KIKB 2VZKB 2J0MA 4JPSA 2MCNB 3LXFA 2MP2B 3VUWA 3WALA 3ZIMA 3PO0A 3NJTA 2PTLA 2KDBA 4GXBA 2CU3A 1WXMA 3QARA 2N1WA 1S3SG 1IPGA 4PS8A 1QOGA 1G6JA 3UI3A 4S17A 4A8XC 2DHZA 3L4PA 5AUKA 2IGHA 2FUG1 4DDID 3ABVB 4IM0A 4AJWA 3QCAA 2W55A 4NAMA 3H1UA 3LB8C 5FR3A 1XCTL 4KGTA 3H7PB 1QOAA 1P9DU 3PTFC 4GSWA 2RR9A 2AQ1B 1TY2A 4LNNA 1AN8A 1F2RI 5CHWA 2D5GA 2V3PA 4W9DA 2HDEA 4RGMA 5D3DA 3HK0A 3ML8A 4A3PA 2KN5A 1ZXHA 1E8YA 5J17A 3HM3A 1ZDVA 3MC0B 4EFOA 4W9JA 1F52A 3RT3B 3J9CA 2LFIA 2RMMA 4L1BA 4DQOC 2M0XA 1SGHA 2PMVA 1TS2A 3A9KA 2XBBC 2MBHA 4XWTA 4M01A 2HD5B 1OTRB 2J0JA 4DWFA 2DZJA 2V3SA 3AMZA 4RNAA 1GPXA 1NVID 3RNAC 1TYGB 1PDXA 5E6NA 2LXAA 4WJPA 1GJZA 1L6UA 3ZDTA 2GBRA 4JE3B 1Q5WB 4J3OD 3GZNI 1I35A 4GLSC 3EA6A 3ETRA 2JWZA 1SE9A 3T3NA 3I9V1 2W82A 3IHPC 1V8CA 2I1KA 3KVFB 1QZEA 2NTSA 2LJ5A 3LJ3A 3ZJUA 5C2TB 2H88B 3FILA 4MDKE 1F77A 3CMMB 1UNSA 2ZJDA 3TL5A 4MGKE 5IO9A 1S1QB 3UINB 3AE1B 2K6QA 3IBEA 3V3XA 4REZA 5JXVA 3Q3JA 4G50A 2BS2B 1N62A 3RZWC 2UU7A 3M63B 3V60A 3FAHA 2K0PA 4I6PA 2TSSA 2XN9C 3N3KB 3TEYA 3TUOA 4RGNA 4II3B 2N7DA 2KC2A 2N9XA 2L83A 2YVCA 3UIPB 3BK2A 1OQRA 1WM3A 1RYJA 2WGSA 2RDGA 2KXJA 3L17A 1WE6A 2BB6A 4BKGA 4FHKA 2ONQA 1UWXA 4WJQA 2NPTB 2KX3A 2H89B 1TKGA 2O6VA 5CX3A 1C1YB 2M4NA 2LZ6A 2GBJA 2LRWA 2WDRB 2JZZA 1H4RA 5G5GA 2QHOA 1SE2A 3EC8A 1FM0D 4BKSA 4ITKA 2B76B 3L0WB 4KIKA 4NZLB 1T3QA 3AV8A 1WXQA 1TS5A 1C4PA 2MP2A 1TS4A 2KX0A 3KYCD 1PGXA 5AZGA 1E0ZA 3NS1A 1Q0WB 3Q8CA 2JX5A 2ZVNA 1Q10A 3JSVA 2KMAA 3T3OA 2CHXA 1TIFA 2K25A 4JWUC 5J18A 2WS3B 3P4RB 1NI3A 3VAWA 2MHJA 1R4MB 1P3QU 3BWUD 3P2BA 2G4DB 4B0EA 2JUOA 3KWLA 3A1QB 3H7PA 2Y3AA 4H2AA 2WU2B 4A3OA 1GB4A 1WX8A 4US8A 3P42A 1JWMD 1TS3A 2BB5A 2BKRB 5IKCM 3TEXA 1LFDA 4RMAA 1L0VB 2KD0A 4W9EA 1XF5L 2N9KA 4KGSA 4TUUA 5LLIA 1SE4A 3ALBA 2IY0B 2ZCCA 2V1YA 1SF0A 2WU5B 3OJ3A 3ZQ4A 3OWEB 3IFWB 2CJNA 3URYA 3IAS1 2WX0A 4LK0M 5EE3A 1OEYJ 4XWWA 4WAFA 1JW9D 4FJVB 3KH0A 3DBSA 1WE7A 5J2RA 1E8WA 3CWIA 3IXSA 4DBGA 2GB1A 2GLSA 3I5JC 2XEWA 3P1MA 3QA8A 4GOCA 4NJ6A 1YMHE 2KJHB 3DOWA 2E3TA 3TCAA 3AECB 4XDDA 3PRMB 4YXDB 3AE7B 3QK0A 4G11A 2BPSA 4C4VB 2DAJA 5BYSA 2AQ2B 2WDQB 2NS5A 2OJRA 2D10A 2WXMA 4AWJA 1KJTA 2L05A 3A4RA 1IGDA 2KWVB 1XXGA 2MX2A 4AP4C 5DPTA 4TMAB 1PYWD 1EWYC 3NZUA 1HTOA 2JXXA 4IW0A 2JYTA 1Y8RC 2MBOA 4WURA 2PE6B 3RNCC 5IOIA 2HTME 3PLVA 4BFRA 2X38A 2REXA 4N6EB 4ZRQA 1C77A 2JZ3B 3N9YC 1HZ6A 1R4NI 2NR2A 3AULA 2CHZA 4LJPB 4JGHB 3TBLD 2KDMA 2RD0A 5CTRC 3A9JB 4LDTD 5JZEB 3EUB2 4XE0A 2JF5A 2W3RA 4GN1A 4C56C 3GE8C 2MW5A 2RDHA 1IP9A 3DBHI 4EUTA 2NPTA 1V81A 4HKQA 1V86A 3HRDD 1TTNA 2JZPA 4HCNB 2LUEA 5D2MB 4ZRIA 3Q3FA 2C7NB 5FKAC 2W3SA 3V6EB 3WANA 1OFFA 2RSUA 1R7SA 4HLEA 1SEBD 1JMLA 4KZCA 2VH1A 3V05A 1M94A 1V49A 3ZXVA 1ROEA 2KTFA 1JALA 4K3BA 4BKTA 4CQNA 2BGFA 1N60A 5IA7A 4PS7A 2FCNA 4WWNA 2LUMA 3B9JA 3QQ8B 1T0RC 2NBUA 2JSVX 3R2TA 2WNMA 4IWQA 3AEFB 3OG5A 4EZKA 1ESFA 2ZZPB 1WX9A 2J7QB 3HIZA 3A1QA 2AEHA 4HCPB 1I7HA 3W1YA 2ICIA 1C79A 2LXCA 3DVNU 4B95A 2N9LA 4KKIA 1C3TA 4ZRJA 1FXAA 1PGBA 2WYQA 3W9CB 1XLQA 2KDFB 3APDA 2Z0EB 4WWMA 1RFAA 3TMPB 1IBXA 3V61A 2D3BA 3ONSA 2MRPA 4ICUA 3I3TB 4LJOB 4OZCA 2WXNA 4HDQA 2KK8A 3AE5B 2AL6A 2KAJA 3BVZA 2KO3A 2DAFA 1C9FA 1T5XD 2KLGA 4QAYA 1JCKB 3R3MA 4C7ZA 5D94A 2LVPA 2MEKA 2Y5PA 4BBNF 1JRUA 3RMKC 5DPRA 3L08A 4OVVA 1HTQA 2QDFA 1RAXA 2RPQA 4IM2A 5BMIA 3VXWA 3N1YC 1EO6A 1WM2A 3TSSA 2R61A 2HJ1A 1FEHA 2RDBC 3L13A 1GNUA 1X1MA 4BAXA 4C4VA 3DBRI 5LXHA 4WAAA 4A55A 2CU1A 4C80A 2EKEC 1L4DB 1VCBA 3U7ZA 4ZDVA 2L0FA 3CIRB 2KWCA 4MGIE 1EM7A 2OEDA 2WWZA 2WXPA 3VH4B 4I6LB 5L83A 3IT6B 1PUTA 2AL3A 5I4DA 2L8JA 2QCZA 2SAKA 1E10A 4DHZB 3BVGA 1J7BA 1E6EB 1J0GA 3GE3C 1P0RA 2G4SA 2N9PC 2NBVB 4HWIB 1XLOA 5FK9C 4K81A 2CR5A 1D5ZC 3OJ4B 1V1OA 5C1ZA 2OOBB 3UGBB 2M19A 1HEZE 1GC6A 2ZNVB 4OVZA 4TV3A 2KTRB 1A5RA 4DHJD 3KLSX 1XCQL 1MI0A 3Q8BA 2DYBA 3MJWA 2FBWB 4ASWC 3E56A 2D2QA 2NMQA 1BUIC 3A9JA 2GBKA 1ZP0B 2NBWB 4BBNC 5AZFA 2M8SA 2D07B 4P1CC 1T0SC 4JX1C 4OVUA 3SFEB 1YNTE 4RM9A 4MJSB 3NOBA 1ZKHA 2FIFA 1MVKA 3PT2B 2JWUA 1YN4A 1GUAB 2WXFA 3PZDA 2K6DB 4FN2A 3DHHC 1V80A 3N32A 3Q3OC 2MJDA 2ON8A 3HVDA 4HPLB 1ZE3D 3RN9C 2MA9B 3ZDMC 3Q8AA 3WAPA 1EWCA 2LGIA 1ZDXA 3GS2A 4JIOU 3D32A 2V4LA 3ZNGC 3N1XC 3HUIA 3RNBC 4E71A 1SJHD 2KJRA 4BVUC 1NBFC 4XDCA 4FHJA 3ZNID 1E7VA 3WCQA 2LVQA 1E9MA 2L0TA 2O6VD 4BOZB 1I4QA 3NVVA 4RFBA 4BKSD 2WP9B 2KYWA 2EMTA 4KDLB 2N1VA 2ZW0A 4IDIA 4W9LA 1WGYA 3UQBA 1NI2A 1NENB 1FFVA 1ZGUB 4RGTA 2GBNA 3AXCA 3VHTC 4KSLC 1ET9A 3AE4B 2BS4B 2LWPA 4HJGE 4R3DA 1TZ1A 2GOWA 4N58A 1YQBA 1SE3A 2IYDB 1TGZB 3O65B 5FR6A 2KVRA 1UELA 3BZDB 2G1EA 2L1AA 4MM3B 1UZXB 3ZNHB 2D3CA 2GBMA 4RF0A 2MBQA 1WWTA 1AYFA 4IUMB 1B9RA 2ZPNA 2LI5A 1JWUD 4DK5A 4YSZB 3ENEA 3ZYYX 1K52A 1DOXA 3BK1A 3UIOB 3X23A 3N20C 2DWQA 5AEKB 4PK1A 2O2VB 4EZLA 1XO3A 4W9FA 3AE9B 2KN4A 3RYTA 3W1SA 1CZPA 2WQYB 2INPE 4USAA 4KX6B 2AWTA 1FO4A 4JQWC 3U52E 3Q14C 2UYZB 1FNUA 4MGYE 5BYRA 2BF8B 4HRSA 1WGGA 2K8HA 4HPPA 1E7PB 1V1PB 2CHWA 3VDZA 1QT9A 2MBEA 4YTPB 2B3AA 2ZCBA 4IM3A 3ZUNA 1U4AA 2WXGA 2QC8A 1FRDA 4W9KA 3N30A 3BINA 1LGRA 2KTRA 3DCGA 1Q1OA 1QOBA 2K3UA 2LJIA 2KANA 1RM6C 3O13A 5CHVC 2AX5A 1GG3A 1YQ3B 1TBEA 2L7RA 3VTVA 1FD6A 2BKFA 4K1RB 1H8CA 5D7GA 4X57B 2L00B 4WQMA 4MACA 1VD2A 2DX5B 3AH7A 4YTMB 1SIFA 4FA6A 4GGQA 3Q2AC 4MJSA 4MH0E 4ZYSA 2WHIA 2IY1B 1L5PA 1ZW7A 3ZNZB 1YJ1A 2KDIA 2UWQA 4O1NA 3BYYB 3NVYA 2YLMA 2A5UA 3RCZA 1WGHA 3W5UB 2LASA 3R8BA 3PHWB 2QEJC 4MH8A 1D6EC 3AEAB 1LXDA 1KM7A 4AUQC 5IAAC 4HEA1 3Q6BA 2D3AA 1BMLC 2PKOA 1R4MI 2KZRA 3U7DA 1XT9B 3M3JA 2KKCA 5TR5A 4CYEA 1VLBA 3B0AA 4TQ0A 3P4PB 3SEBA 1WXVA 1K51A 2FNJB 3P4QB 3VTWA 1HA5A 1EU3A 3APCA 3DBLI 1ENFA 1YN3A 2M17A 1PFDA 3Q3NC 1YD8U 4PS3A 1AARA 3R7RA 2GI9A 1L6VA 3SD5A 4W9CA 4LDTB 1FNVA 1GC7A 1SIJA 2EELA 3B08A 2YEPB 2CS4A 1JWSD 2PE9A 3RZFA 2JXTA 4A90A 5DPWA 1Z2MA 1WJ6A 2K39A 2Z8LA 4YT0B 2PVGC 2G9HD 3JYUA 2N7JA 2J0KA 2KDEB 3BYTB 4K3CA 2K9XA 4OZAA 3A33B 3TEWA 1D4BA 1KTKA 3EGRA 1C78A 1ZXIA 1FFUA 1YJIA 1FPYA 4MSQB 1DOIA 2J4XA 1QKZA 1VRAB 1D3ZA 4IC7B 2KLCA 2WDTB 1E5WA 5LNK1 5JHBA 3QAQA 2K8BA 4LLGM 4JL9A 4LNKA 1OQYA 1OEYA 4MELA 3KUCB 1JRPA 4MM3A 2GMIC 1IUEA 1FXIA 4Q2JA 3DWMA 2V0GA 4D2KA 1WJNA 3MJ5A 3FKYA 4P1BC 5MPOA 2KWDA 3JVZX 3ZJTA 3CSFA 1CJEA 2FIDA 2MQJA 3I57A 3MHSD 4S0RA 4AJYB 3H8HA 5E6OA 3EFCA 4NAWB 3IVFA 3C0RB 3EFUA 4GMVA 4TKNA 3PVLA 2O2VA 3DBHB 4WJNA 1TY0A 4CO7A 3APFA 3T8MA 4FULA 4C7YA 1WH3A 4I6NB 3KYDD 5HG2A 4HDOA 2DLBA 2BBCA 3NRZA 1TKEA 2DZIA 2Y5BB 1EUVB 3GOEA 3MC8A 5C23A 1V1PA 2X8XX 3VUXA 2QIEB 1YN5A 4RH6A 1WR6E 1F1HA 1YX5B 3RNFC 4MT5A 4KVGB 3MHZA 3TIXA 4DXAB 4GB9A 4KDIC 3RNGC 1P1AA 2JT4B 3VVWB 3Q69A 2DZMA 4XGAB 2FCSA 1OGWA 1UUPA 1WJUA 1WIAA 1VR9A 3U2SC 3IT4B 1AWDA 2BT6A 1YQ4B 3B2GA 1T0QC 2IO0B 4LCDE 4FXCA 3ECIA 1MHXA 3PPAA 3AE6B 4ANXA 5AUIA 2ZEQA 4KGRA 4BZAA 3R2IA 2KQSA 3ZRFA 1I4GA 4DDGD 5EDSA 1FRRA 1ISNA 2FE8A 1E8XA 4ARCA 4F7ZA 2IGDA 2XK5B 4KV2A 2V4IB 1EF1A 1UBQA 1WY8A 1L7YA 4LNIA 4W9IA 1JWAD 4YL8A 2KACA 1E8ZA 3DDCB 3NHEB 4NQKE 4XYCA 2N4FA 5EE0A 3ZJVA 1SBBB 3SR6A 2KFKB 1ET6A 1UF0A 1VZ8A 2WXRA 3W5VB 5TSSA 2LHEA 4ICVA 3TEZA 4AS1A 1F9JA 4ZRKA 1NYRA 4DXGA 2PVOD 3PV1A 3GB1A 2IPKD 4EOYA 1IGCA 2Q5WD 2BWFA 4WWOA 4HPMB 3JW0X 4KSKC 5GXGB 2K1FA 1BT0A 3QIJA 2Z59B 3DBRB 2BW2A 1N5WA 3VRAB 2JVCA 3ZO5B 1UD7A 4WIPA 2M0AA 3ZW3A 1XD3B 5KHOA 1HE8A 4DHZE 1TT5B 2N9EB 1L0YB 1NYQA 3BIID 1L0XB 3QX1A 1LO5D 4US9A 2J52A 3TJPA 2YEPF 3KQ4A 1QF6A 3DVNV 4E3CA 2BWES 3Q8FA 2AQ3B 4HKZE 3DHGC 3S2AA 5KHQA 3HHMA 1STEA 4M02A 1KLUD 2KMCA 1UH6A 3RFZB 3AE2B 3NVZA 3DVGX 3OAWA 1UGJA 3PRPB 1I4RA 2BTEA 4K7UA 4KKJA 3AN1A 4NAWA 2SEBD 3P4SB 1KLGD 3QHTA 2KMMA 2INDC 4YWGG 3KUZA 2KOXA 4WJOA 1V9JA 1UWMA 4YTNB 2M56B 4B0MA 4DXFA 5BO4B 2C60A 2MJEA 2LMCA 4HVBA 2MJ3A 1MPEA 2HJ8A 2WXKA 3P63A 3ZRCA 1WZ3A 1CK1A 2BYEA 4OHJA 3BVMA 2LGDA 1C4CA 2I1JA 1B1ZA 3JSVB 4LNOA 4A6QA 3NZSA 1VDVA 4ZYNA 4M0WB 3E9SA 5G55A 5DPSA 4F8CB 2LGXA 3VRBB 4A20A 4EEWA 1NEKB 2L52A 2XNAC 2QMTA 3W2DA 2AYOB 3LYYA 1P7EA 1T6BX 1K8RB 2DBYA 1RLFA 2PPHA 5JH5C 1WZ0A 2EKIA 4NJCA 4NQLB 1FNWA 5G2NA 4CHKA 2DENB 1C4AA 1ZOYB 4L23A 3C8YA 3DHIC 3PREA 4ACFA 5HI1A 3MFGA 2C9WB 4L2YA 4G0NB 1K50A 2ZPYA 3VH3B 4MEMA 2QILA 4GDKB 2IDYA 1I4HA 4W9HA 2KHWB 4JWSC 3PLUA 1GAQB 2XK5A 2G45B 3GZNB 2ZVOA 2A4ZA 2MH7A 4II2B 3L54A 2PJHA 2IJ0A 2C7HA 2KNBA 3QC8B 2VZKD 3RI7C 5IN7A 4TQ1A 4P7IA 1KFYB 2LGSA 3ZGZA 1WR1A 1J7AA 3DQVA 3DPDA 2K5PA 1SB3C 4FLHA 1WJ4A 2NTTA 3ML9A 1PQSA 2KFKA 5AZHA 2D11A 1WGDA 3MTNB 4WWPA 4URKA 1V5TA 5E6PA 2VH2A 2I2YA 1UBIA 3CSTA 4ZHOA 1JWBD 3EHVA 2LGYA 5CHFA 2D3GA 3H6NA 1I4PA 2K22A 2KFJA 1QOFA 3V62A 1SSNA 2L32A 1KH0A 4ZRPA 2IZVB 4PT5A 3AU4A 4XC2A 3U4EG 1MG8A 4C00A 4P6VF 5G5HA 2GRIA 4NNJB 1P7FA 2LRUA 2K8CA 2KJ6A
chains in the Genus database with same CATH topology
1Z2MA 1WJ6A 2K39A 4IWQA 4HXDA 2KDBA 4GXBA 1WXMA 3QARA 4EZKA 2N1WA 2VRRB 4EKUA 1S3SG 2ZZPB 3JYUA 5LXIB 1WX9A 2J7QB 4PYUA 2J0KA 2KDEB 3HIZA 3A1QA 1IPGA 1WX7A 4PS8A 4BOSC 1G6JA 2AEHA 4HCPB 2DHZA 2R2OA 3A33B 3W1YA 3RD2A 4DDID 1J8CA 2LXCA 3DVNU 4IM0A 4AJWA 4B95A 2KWUB 2M1MA 3QCAA 3H1UA 4MSQB 1C3TA 4ZRJA 3H7PB 1RRBA 1UGMA 1D3ZA 4IC7B 2WYQA 2KLCA 3NY5A 3M62B 1P9DU 2WDTB 3PTFC 1E5WA 2KDFB 3APDA 2Z0EB 3DVGY 1RFAA 3QAQA 2RR9A 4GSWA 3TMPB 5JHBA 2K8BA 4JL9A 3V61A 1OQYA 1OEYA 4MELA 3KUCB 4MM3A 2GMIC 3ONSA 2MRPA 5CHWA 4ICUA 3I3TB 4LJOB 3R66C 3HM6X 4HDQA 4W9DA 4MSMB 3VFKA 1WGRA 2KK8A 3AI5A 2AL6A 3QWZB 3K9PB 1WJNA 2RGFA 3HK0A 3ML8A 2KO3A 4A3PA 3PGEA 2KN5A 3JVZX 3ZVVA 1E8YA 2DAFA 3CSFA 5J17A 2KLGA 3HM3A 3BY4B 4EFOA 3R3MA 4W9JA 2FIDA 2MQJA 3MHSD 3RT3B 5D94A 3LDZE 2LVPA 4AJYB 1P98A 4BBNF 5E6OA 1JRUA 2M0XA 4NAWB 1SGHA 2HE7A 3C0RB 3IVFA 3L10B 3EFUA 4GMVA 4TKNA 5DPRA 4ANWA 3PVLA 3L08A 2O2VA 3A9KA 4OVVA 2XBBC 4WJNA 4CO7A 4RM8A 2MBHA 1RAXA 2RPQA 3APFA 4N9F4 3T8MA 4IM2A 2HD5B 1OTRB 2J0JA 4FULA 3VXWA 4DWFA 4WQOB 2DZJA 1WH3A 2V3SA 3PS6A 4I6NB 4AOFA 3KYDD 4HDOA 1EO6A 1WM2A 2CKHB 1I42A 2FCQA 5E6NA 2DZIA 2Y5BB 1EUVB 3GOEA 2LXAA 3L13A 4WJPA 1GNUA 1GJZA 1X1MA 2LVOA 5C23A 5JHAA 3VUXA 2MWSB 3DBRI 5LXHA 4G3XB 4WAAA 3ZDTA 1WR6E 2CU1A 2G3QB 1WMHB 1YX5B 2GBRA 3PRZA 2EKEC 1VCBA 4ZDVA 2L0FA 4KVGB 4XX5A 1Q5WB 3TIXA 4DXAB 2IO1B 3GZNI 4GB9A 1E90A 1I35A 2KWCA 4MGIE 4KDIC 1P1AA 2WWZA 3VTUA 2JT4B 4J6IA 4I6LB 3VH4B 5L83A 3VVWB 2JWZA 2AL3A 2ASQA 3KW5B 1SE9A 2L8JA 2DZMA 4DHZB 2FCSA 1J0GA 3IHPC 1P0RA 1WYWB 2G4SA 2N9PC 2I1KA 2NBVB 3KVFB 4HWIB 1OGWA 2FCMA 3W1SC 1QZEA 4K81A 1WJUA 2CR5A 3LJ3A 1WIAA 2LJ5A 3OJ4B 4GDKA 5C1ZA 2OOBB 4MDKE 3UGBB 1CMXB 1GC6A 3CMMB 2ZNVB 4TV3A 2IO0B 2ZJDA 4LCDE 4MGKE 2KTRB 3ECIA 3TL5A 4DHJD 1A5RA 3IG3A 1S1QB 1EF5A 2HTHA 3UINB 2KQ7A 3PPAA 3U8ZA 2DYBA 4NPNA 2W9NA 4NY0A 2K6QA 3MJWA 4ASWC 4ANXA 2ZEQA 2D2QA 3IBEA 3ZTCA 2KQSA 3ZRFA 3A9JA 2GBKA 4DDGD 5EDSA 2NBWB 1ISNA 3Q3JA 4BBNC 4G50A 1YX6B 3RZWC 5AZFA 4GDLB 1E8XA 3M63B 2M8SA 3V60A 2D07B 4I6PA 2ZNVC 4ANVA 4F7ZA 2XK5B 3N3KB 1NDDA 4KV2A 2NCNA 4OVUA 3X0WA 3K9OB 4II3B 1EF1A 1UBQA 2N7DA 1WY8A 1L2NA 2KC2A 2N9XA 4RM9A 1L7YA 2YVCA 4MJSB 4W9IA 3VQIA 4GU2A 4PYZA 3UIPB 2MSED 4YL8A 3NOBA 1ZKHA 1WM3A 2FIFA 3WIMA 2IO3B 4HJKA 3PT2B 2KXJA 3L17A 1WE6A 4BKGA 1E8ZA 4FHKA 3DDCB 3NHEB 4NQKE 1GUAB 2N4FA 2R2QA 4WJQA 3PZDA 2NPTB 2MBBB 2K6DB 2KX3A 3M95A 3PSEB 2O6VA 2KFKB 4FN2A 5CX3A 1C1YB 1V80A 2M4NA 3N32A 2LZ6A 4HPLB 2GBJA 2LRWA 2IBIB 3CF6E 2MLBA 2JZZA 3H9DA 4K7SA 2KC1A 1H4RA 4ICVA 2QHOA 1F9JA 2MA9B 4ZRKA 3EC8A 3ZDMC 3WAPA 3AU5A 4BKSA 3PV1A 3L0WB 4JIOU 3SDLC 3D32A 4KIKA 2V4LA 4EOYA 3ZNGC 3OLMD 1KOTA 2MP2A 3KYCD 2KX0A 2N7EA 4E71A 2BWFA 5AZGA 4WWOA 4HPMB 3JW0X 2KJRA 4NJ7A 4BVUC 4KSKC 1NBFC 5D6JB 1Q0WB 2DZKA 4FHJA 3ZNID 3B1LX 2C5LC 1E7VA 2ZVNA 3NS8A 2LVQA 3JSVA 4K7WA 2K1FA 1BT0A 2KMAA 2L0TA 2Z59B 2CHXA 2K25A 2O6VD 3QIJA 1WRDB 4BOZB 1IYFA 2JVCA 3ZO5B 5J18A 2JRIB 1UD7A 3UF8A 3VAWA 3ZW3A 1XD3B 2LD9A 5KHOA 1HE8A 3ZKJC 4DHZE 2N9EB 1WI0A 1P3QU 3V6CB 3P2BA 2G4DB 4BKSD 2JUOA 2EMTA 3EECA 4KDLB 2N1VA 3QX1A 3T9LA 3A1QB 4B9KA 3H7PA 3TJPA 4W9LA 1WGYA 1KLVA 3DVNV 4E3CA 3UQBA 2BWES 1NI2A 1ZGUB 4MGZE 2GBNA 3AXCA 4A3OA 3VHTC 1WX8A 3L16A 3S2AA 4KSLC 5KHQA 2LWPA 3U30A 1YIWA 2BKRB 2NVUI 4EZJA 3HHMA 1V6EA 1TZ1A 4IWOA 2GOWA 2FUHB 1LFDA 4RMAA 1YQBA 2KMCA 2KD0A 2IYDB 1UH6A 1WFYA 1TGZB 2JY6A 3O65B 3A4SC 4W9EA 5FR6A 2KVRA 4TUUA 1UELA 5LLIA 3DVGX 3OAWA 3ALBA 2IY0B 3PRPB 2ZCCA 3H7SA 2V1YA 1UZXB 3ZNHB 2EMSA 2GBMA 3OJ3A 4K7UA 4E74A 4KZ0A 2IO2B 2MBQA 4NAWA 4B6WA 2JRHA 4IUMB 3IFWB 3PHXB 2ZPNA 3QHTA 1LQBA 2JPHA 2WX0A 2LI5A 3KUZA 4IWPA 2KOXA 4WJOA 1V9JA 1E7UA 1OEYJ 4DK5A 2Z0DB 5BO4B 2L76A 1T0YA 4FJVB 3KH0A 2C60A 3WA0A 3ENEA 2PEAA 4HVBA 3DBSA 1V2YA 1WE7A 3UIOB 1FXTB 2HJ8A 5J2RA 1E8WA 4JLCA 3X23A 3ZRCA 1WZ3A 4DBGA 3SU8X 4F1SA 5AEKB 4EZLA 2BYEA 2O2VB 3A9KB 2C7MB 4W9GA 4W9FA 1WF9A 2LGDA 3RYTA 2XEWA 2I1JA 3W1SA 1WMHA 3JSVB 3QA8A 4GOCA 3NZSA 4NJ6A 2AWTA 4ZYNA 4M0WB 2KJHB 3DOWA 5G55A 3TCAA 4JQWC 5DPSA 2UYZB 2WX1A 4F8CB 2LGXA 4A20A 4EEWA 3PRMB 4FJZA 4M8MA 4MGYE 2BF8B 1WGGA 2K8HA 3QK0A 2AYOB 2BPSA 2DYOA 4G11A 1K8RB 1RLFA 2PPHA 4DHJB 2CHWA 5JH5C 2DAJA 3VDZA 1WZ0A 4NQLB 5G2NA 2MBEA 4CHKA 2B3AA 2DENB 2BYFA 2ZCBA 2NS5A 4IM3A 3ZUNA 1U4AA 2OJRA 2D10A 4W9KA 4AWJA 3N30A 1KJTA 3BINA 2L05A 3A4RA 2KTRA 2KWVB 3DCGA 1Q1OA 2MX2A 3PREA 3RULA 4AP4C 3RUIB 4FADA 5DPTA 1J19A 2C9WB 3R7QA 2KANA 5CHVC 3NZUA 4G0NB 2ZPYA 4IG7B 1GG3A 2JXXA 4ANUA 1TBEA 2L3ZA 2L7RA 1WXSA 4IW0A 3VH3B 3VUYA 3VTVA 4M8NA 4MEMA 4XZ4A 1Y8RC 2MBOA 4GDKB 2PE6B 2BKFA 4K1RB 4W9HA 5L95C 1H8CA 3QJZA 2KHWB 5D7GA 3PLVA 4BFRA 4X57B 2REXA 2L00B 3PLUA 4GDLA 2JZ3B 1R4NI 2NR2A 5DCNA 1VD2A 2DX5B 3AULA 2CHZA 4LJPB 2XK5A 2G45B 1LM8B 1SIFA 2A4ZA 2ZVOA 4GGQA 4FA6A 4JGHB 3TBLD 2FAZA 3L54A 4II2B 2RD0A 2PJHA 4HK2A 5CTRC 4MJSA 4MH0E 2BYVE 3A9JB 2C7HA 2KNBA 3QC8B 4LDTD 2IY1B 5JZEB 4TQ1A 4P7IA 3ZTDA 1ZW7A 3ZNZB 2JF5A 1YJ1A 2KDIA 2UWQA 4GN1A 1WR1A 1V5OA 2MW5A 3DQVA 3DPDA 2YLMA 3ZLZA 2A5UA 3RCZA 1IP9A 1WGHA 2DYMA 4FLHA 3DBHI 4EUTA 2NPTA 1V81A 1WJ4A 2LASA 3ML9A 4GIVA 3PHWB 1V86A 3UQAA 1PQSA 2KFKA 5AZHA 3WAOA 2D11A 1TTNA 1WGDA 3MTNB 4HCNB 1LXDA 2LUEA 4WWPA 1KM7A 1V5TA 4URKA 4AUQC 1Z5SB 5E6PA 5D2MB 3SHQA 4ZRIA 3Q3FA 1WXAA 2C7NB 5IAAC 1UBIA 3CSTA 3V6EB 3WANA 1R4MI 2KZRA 3EHVA 3U7DA 1XT9B 3M3JA 2KKCA 2LGYA 5TR5A 4FBJB 4CYEA 5CHFA 2RSUA 3B0AA 2D3GA 3H6NA 3WAMA 4TQ0A 4HLEA 2O6VB 5GMVA 1WXVA 2KFJA 4KZCA 1M94A 1V49A 5HKHA 3V62A 2FNJB 3VTWA 3KUDB 3APCA 3DBLI 1XQQA 2IZVB 2KTFA 2M17A 3AU4A 4XC2A 1YD8U 4PS3A 4FJYA 4BKTA 1AARA 3R7RA 3SD5A 1MG8A 2BGFA 4KIKB 4W9CA 4LDTB 5IA7A 4PS7A 2J0MA 2FCNA 1GC7A 4NNJB 4WWNA 2MCNB 3QQ8B 2MP2B 3VUWA 3WALA 2NBUA 3B08A 2CS4A 3ZIMA 2PE9A 3RZFA 2LRUA 2K8CA 2KJ6A 5DPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2M A;  1WJ6 A;  2K39 A;  4IWQ A;  4HXD A;  2KDB A;  4GXB A;  1WXM A;  3QAR A;  4EZK A;  2N1W A;  2VRR B;  4EKU A;  1S3S G;  2ZZP B;  3JYU A;  5LXI B;  1WX9 A;  2J7Q B;  4PYU A;  2J0K A;  2KDE B;  3HIZ A;  3A1Q A;  1IPG A;  1WX7 A;  4PS8 A;  4BOS C;  1G6J A;  2AEH A;  4HCP B;  2DHZ A;  2R2O A;  3A33 B;  3W1Y A;  3RD2 A;  4DDI D;  1J8C A;  2LXC A;  3DVN U;  4IM0 A;  4AJW A;  4B95 A;  2KWU B;  2M1M A;  3QCA A;  3H1U A;  4MSQ B;  1C3T A;  4ZRJ A;  3H7P B;  1RRB A;  1UGM A;  1D3Z A;  4IC7 B;  2WYQ A;  2KLC A;  3NY5 A;  3M62 B;  1P9D U;  2WDT B;  3PTF C;  1E5W A;  2KDF B;  3APD A;  2Z0E B;  3DVG Y;  1RFA A;  3QAQ A;  2RR9 A;  4GSW A;  3TMP B;  5JHB A;  2K8B A;  4JL9 A;  3V61 A;  1OQY A;  1OEY A;  4MEL A;  3KUC B;  4MM3 A;  2GMI C;  3ONS A;  2MRP A;  5CHW A;  4ICU A;  3I3T B;  4LJO B;  3R66 C;  3HM6 X;  4HDQ A;  4W9D A;  4MSM B;  3VFK A;  1WGR A;  2KK8 A;  3AI5 A;  2AL6 A;  3QWZ B;  3K9P B;  1WJN A;  2RGF A;  3HK0 A;  3ML8 A;  2KO3 A;  4A3P A;  3PGE A;  2KN5 A;  3JVZ X;  3ZVV A;  1E8Y A;  2DAF A;  3CSF A;  5J17 A;  2KLG A;  3HM3 A;  3BY4 B;  4EFO A;  3R3M A;  4W9J A;  2FID A;  2MQJ A;  3MHS D;  3RT3 B;  5D94 A;  3LDZ E;  2LVP A;  4AJY B;  1P98 A;  4BBN F;  5E6O A;  1JRU A;  2M0X A;  4NAW B;  1SGH A;  2HE7 A;  3C0R B;  3IVF A;  3L10 B;  3EFU A;  4GMV A;  4TKN A;  5DPR A;  4ANW A;  3PVL A;  3L08 A;  2O2V A;  3A9K A;  4OVV A;  2XBB C;  4WJN A;  4CO7 A;  4RM8 A;  2MBH A;  1RAX A;  2RPQ A;  3APF A;  4N9F 4;  3T8M A;  4IM2 A;  2HD5 B;  1OTR B;  2J0J A;  4FUL A;  3VXW A;  4DWF A;  4WQO B;  2DZJ A;  1WH3 A;  2V3S A;  3PS6 A;  4I6N B;  4AOF A;  3KYD D;  4HDO A;  1EO6 A;  1WM2 A;  2CKH B;  1I42 A;  2FCQ A;  5E6N A;  2DZI A;  2Y5B B;  1EUV B;  3GOE A;  2LXA A;  3L13 A;  4WJP A;  1GNU A;  1GJZ A;  1X1M A;  2LVO A;  5C23 A;  5JHA A;  3VUX A;  2MWS B;  3DBR I;  5LXH A;  4G3X B;  4WAA A;  3ZDT A;  1WR6 E;  2CU1 A;  2G3Q B;  1WMH B;  1YX5 B;  2GBR A;  3PRZ A;  2EKE C;  1VCB A;  4ZDV A;  2L0F A;  4KVG B;  4XX5 A;  1Q5W B;  3TIX A;  4DXA B;  2IO1 B;  3GZN I;  4GB9 A;  1E90 A;  1I35 A;  2KWC A;  4MGI E;  4KDI C;  1P1A A;  2WWZ A;  3VTU A;  2JT4 B;  4J6I A;  4I6L B;  3VH4 B;  5L83 A;  3VVW B;  2JWZ A;  2AL3 A;  2ASQ A;  3KW5 B;  1SE9 A;  2L8J A;  2DZM A;  4DHZ B;  2FCS A;  1J0G A;  3IHP C;  1P0R A;  1WYW B;  2G4S A;  2N9P C;  2I1K A;  2NBV B;  3KVF B;  4HWI B;  1OGW A;  2FCM A;  3W1S C;  1QZE A;  4K81 A;  1WJU A;  2CR5 A;  3LJ3 A;  1WIA A;  2LJ5 A;  3OJ4 B;  4GDK A;  5C1Z A;  2OOB B;  4MDK E;  3UGB B;  1CMX B;  1GC6 A;  3CMM B;  2ZNV B;  4TV3 A;  2IO0 B;  2ZJD A;  4LCD E;  4MGK E;  2KTR B;  3ECI A;  3TL5 A;  4DHJ D;  1A5R A;  3IG3 A;  1S1Q B;  1EF5 A;  2HTH A;  3UIN B;  2KQ7 A;  3PPA A;  3U8Z A;  2DYB A;  4NPN A;  2W9N A;  4NY0 A;  2K6Q A;  3MJW A;  4ASW C;  4ANX A;  2ZEQ A;  2D2Q A;  3IBE A;  3ZTC A;  2KQS A;  3ZRF A;  3A9J A;  2GBK A;  4DDG D;  5EDS A;  2NBW B;  1ISN A;  3Q3J A;  4BBN C;  4G50 A;  1YX6 B;  3RZW C;  5AZF A;  4GDL B;  1E8X A;  3M63 B;  2M8S A;  3V60 A;  2D07 B;  4I6P A;  2ZNV C;  4ANV A;  4F7Z A;  2XK5 B;  3N3K B;  1NDD A;  4KV2 A;  2NCN A;  4OVU A;  3X0W A;  3K9O B;  4II3 B;  1EF1 A;  1UBQ A;  2N7D A;  1WY8 A;  1L2N A;  2KC2 A;  2N9X A;  4RM9 A;  1L7Y A;  2YVC A;  4MJS B;  4W9I A;  3VQI A;  4GU2 A;  4PYZ A;  3UIP B;  2MSE D;  4YL8 A;  3NOB A;  1ZKH A;  1WM3 A;  2FIF A;  3WIM A;  2IO3 B;  4HJK A;  3PT2 B;  2KXJ A;  3L17 A;  1WE6 A;  4BKG A;  1E8Z A;  4FHK A;  3DDC B;  3NHE B;  4NQK E;  1GUA B;  2N4F A;  2R2Q A;  4WJQ A;  3PZD A;  2NPT B;  2MBB B;  2K6D B;  2KX3 A;  3M95 A;  3PSE B;  2O6V A;  2KFK B;  4FN2 A;  5CX3 A;  1C1Y B;  1V80 A;  2M4N A;  3N32 A;  2LZ6 A;  4HPL B;  2GBJ A;  2LRW A;  2IBI B;  3CF6 E;  2MLB A;  2JZZ A;  3H9D A;  4K7S A;  2KC1 A;  1H4R A;  4ICV A;  2QHO A;  1F9J A;  2MA9 B;  4ZRK A;  3EC8 A;  3ZDM C;  3WAP A;  3AU5 A;  4BKS A;  3PV1 A;  3L0W B;  4JIO U;  3SDL C;  3D32 A;  4KIK A;  2V4L A;  4EOY A;  3ZNG C;  3OLM D;  1KOT A;  2MP2 A;  3KYC D;  2KX0 A;  2N7E A;  4E71 A;  2BWF A;  5AZG A;  4WWO A;  4HPM B;  3JW0 X;  2KJR A;  4NJ7 A;  4BVU C;  4KSK C;  1NBF C;  5D6J B;  1Q0W B;  2DZK A;  4FHJ A;  3ZNI D;  3B1L X;  2C5L C;  1E7V A;  2ZVN A;  3NS8 A;  2LVQ A;  3JSV A;  4K7W A;  2K1F A;  1BT0 A;  2KMA A;  2L0T A;  2Z59 B;  2CHX A;  2K25 A;  2O6V D;  3QIJ A;  1WRD B;  4BOZ B;  1IYF A;  2JVC A;  3ZO5 B;  5J18 A;  2JRI B;  1UD7 A;  3UF8 A;  3VAW A;  3ZW3 A;  1XD3 B;  2LD9 A;  5KHO A;  1HE8 A;  3ZKJ C;  4DHZ E;  2N9E B;  1WI0 A;  1P3Q U;  3V6C B;  3P2B A;  2G4D B;  4BKS D;  2JUO A;  2EMT A;  3EEC A;  4KDL B;  2N1V A;  3QX1 A;  3T9L A;  3A1Q B;  4B9K A;  3H7P A;  3TJP A;  4W9L A;  1WGY A;  1KLV A;  3DVN V;  4E3C A;  3UQB A;  2BWE S;  1NI2 A;  1ZGU B;  4MGZ E;  2GBN A;  3AXC A;  4A3O A;  3VHT C;  1WX8 A;  3L16 A;  3S2A A;  4KSL C;  5KHQ A;  2LWP A;  3U30 A;  1YIW A;  2BKR B;  2NVU I;  4EZJ A;  3HHM A;  1V6E A;  1TZ1 A;  4IWO A;  2GOW A;  2FUH B;  1LFD A;  4RMA A;  1YQB A;  2KMC A;  2KD0 A;  2IYD B;  1UH6 A;  1WFY A;  1TGZ B;  2JY6 A;  3O65 B;  3A4S C;  4W9E A;  5FR6 A;  2KVR A;  4TUU A;  1UEL A;  5LLI A;  3DVG X;  3OAW A;  3ALB A;  2IY0 B;  3PRP B;  2ZCC A;  3H7S A;  2V1Y A;  1UZX B;  3ZNH B;  2EMS A;  2GBM A;  3OJ3 A;  4K7U A;  4E74 A;  4KZ0 A;  2IO2 B;  2MBQ A;  4NAW A;  4B6W A;  2JRH A;  4IUM B;  3IFW B;  3PHX B;  2ZPN A;  3QHT A;  1LQB A;  2JPH A;  2WX0 A;  2LI5 A;  3KUZ A;  4IWP A;  2KOX A;  4WJO A;  1V9J A;  1E7U A;  1OEY J;  4DK5 A;  2Z0D B;  5BO4 B;  2L76 A;  1T0Y A;  4FJV B;  3KH0 A;  2C60 A;  3WA0 A;  3ENE A;  2PEA A;  4HVB A;  3DBS A;  1V2Y A;  1WE7 A;  3UIO B;  1FXT B;  2HJ8 A;  5J2R A;  1E8W A;  4JLC A;  3X23 A;  3ZRC A;  1WZ3 A;  4DBG A;  3SU8 X;  4F1S A;  5AEK B;  4EZL A;  2BYE A;  2O2V B;  3A9K B;  2C7M B;  4W9G A;  4W9F A;  1WF9 A;  2LGD A;  3RYT A;  2XEW A;  2I1J A;  3W1S A;  1WMH A;  3JSV B;  3QA8 A;  4GOC A;  3NZS A;  4NJ6 A;  2AWT A;  4ZYN A;  4M0W B;  2KJH B;  3DOW A;  5G55 A;  3TCA A;  4JQW C;  5DPS A;  2UYZ B;  2WX1 A;  4F8C B;  2LGX A;  4A20 A;  4EEW A;  3PRM B;  4FJZ A;  4M8M A;  4MGY E;  2BF8 B;  1WGG A;  2K8H A;  3QK0 A;  2AYO B;  2BPS A;  2DYO A;  4G11 A;  1K8R B;  1RLF A;  2PPH A;  4DHJ B;  2CHW A;  5JH5 C;  2DAJ A;  3VDZ A;  1WZ0 A;  4NQL B;  5G2N A;  2MBE A;  4CHK A;  2B3A A;  2DEN B;  2BYF A;  2ZCB A;  2NS5 A;  4IM3 A;  3ZUN A;  1U4A A;  2OJR A;  2D10 A;  4W9K A;  4AWJ A;  3N30 A;  1KJT A;  3BIN A;  2L05 A;  3A4R A;  2KTR A;  2KWV B;  3DCG A;  1Q1O A;  2MX2 A;  3PRE A;  3RUL A;  4AP4 C;  3RUI B;  4FAD A;  5DPT A;  1J19 A;  2C9W B;  3R7Q A;  2KAN A;  5CHV C;  3NZU A;  4G0N B;  2ZPY A;  4IG7 B;  1GG3 A;  2JXX A;  4ANU A;  1TBE A;  2L3Z A;  2L7R A;  1WXS A;  4IW0 A;  3VH3 B;  3VUY A;  3VTV A;  4M8N A;  4MEM A;  4XZ4 A;  1Y8R C;  2MBO A;  4GDK B;  2PE6 B;  2BKF A;  4K1R B;  4W9H A;  5L95 C;  1H8C A;  3QJZ A;  2KHW B;  5D7G A;  3PLV A;  4BFR A;  4X57 B;  2REX A;  2L00 B;  3PLU A;  4GDL A;  2JZ3 B;  1R4N I;  2NR2 A;  5DCN A;  1VD2 A;  2DX5 B;  3AUL A;  2CHZ A;  4LJP B;  2XK5 A;  2G45 B;  1LM8 B;  1SIF A;  2A4Z A;  2ZVO A;  4GGQ A;  4FA6 A;  4JGH B;  3TBL D;  2FAZ A;  3L54 A;  4II2 B;  2RD0 A;  2PJH A;  4HK2 A;  5CTR C;  4MJS A;  4MH0 E;  2BYV E;  3A9J B;  2C7H A;  2KNB A;  3QC8 B;  4LDT D;  2IY1 B;  5JZE B;  4TQ1 A;  4P7I A;  3ZTD A;  1ZW7 A;  3ZNZ B;  2JF5 A;  1YJ1 A;  2KDI A;  2UWQ A;  4GN1 A;  1WR1 A;  1V5O A;  2MW5 A;  3DQV A;  3DPD A;  2YLM A;  3ZLZ A;  2A5U A;  3RCZ A;  1IP9 A;  1WGH A;  2DYM A;  4FLH A;  3DBH I;  4EUT A;  2NPT A;  1V81 A;  1WJ4 A;  2LAS A;  3ML9 A;  4GIV A;  3PHW B;  1V86 A;  3UQA A;  1PQS A;  2KFK A;  5AZH A;  3WAO A;  2D11 A;  1TTN A;  1WGD A;  3MTN B;  4HCN B;  1LXD A;  2LUE A;  4WWP A;  1KM7 A;  1V5T A;  4URK A;  4AUQ C;  1Z5S B;  5E6P A;  5D2M B;  3SHQ A;  4ZRI A;  3Q3F A;  1WXA A;  2C7N B;  5IAA C;  1UBI A;  3CST A;  3V6E B;  3WAN A;  1R4M I;  2KZR A;  3EHV A;  3U7D A;  1XT9 B;  3M3J A;  2KKC A;  2LGY A;  5TR5 A;  4FBJ B;  4CYE A;  5CHF A;  2RSU A;  3B0A A;  2D3G A;  3H6N A;  3WAM A;  4TQ0 A;  4HLE A;  2O6V B;  5GMV A;  1WXV A;  2KFJ A;  4KZC A;  1M94 A;  1V49 A;  5HKH A;  3V62 A;  2FNJ B;  3VTW A;  3KUD B;  3APC A;  3DBL I;  1XQQ A;  2IZV B;  2KTF A;  2M17 A;  3AU4 A;  4XC2 A;  1YD8 U;  4PS3 A;  4FJY A;  4BKT A;  1AAR A;  3R7R A;  3SD5 A;  1MG8 A;  2BGF A;  4KIK B;  4W9C A;  4LDT B;  5IA7 A;  4PS7 A;  2J0M A;  2FCN A;  1GC7 A;  4NNJ B;  4WWN A;  2MCN B;  3QQ8 B;  2MP2 B;  3VUW A;  3WAL A;  2NBU A;  3B08 A;  2CS4 A;  3ZIM A;  2PE9 A;  3RZF A;  2LRU A;  2K8C A;  2KJ6 A;  5DPW A; 
#chains in the Genus database with same CATH topology
 2V9H A;  4HXD A;  2KT7 A;  4WH4 A;  2VRR B;  4EKU A;  5LXI B;  4PYU A;  1WX7 A;  4BOS C;  4YSY B;  3RPF C;  2R2O A;  3RD2 A;  1J8C A;  1GOZ A;  3AEG B;  3PZ7 A;  2KWU B;  2M1M A;  1AW7 A;  2QJL A;  5H92 C;  1RRB A;  1UGM A;  3NY5 A;  3M62 B;  1XEE A;  1PGA A;  1WRI A;  3DVG Y;  3NG0 A;  5H8Y E;  4LTU A;  1QLB B;  5C3J B;  3R66 C;  3HM6 X;  4MSM B;  3VFK A;  1FMA D;  1WGR A;  3AI5 A;  3QWZ B;  3K9P B;  1MJD A;  1D5M C;  2RGF A;  1D5X C;  3PGE A;  3ZVV A;  3BY4 B;  4OW0 A;  1M4V A;  3LDZ E;  1QQR A;  1P98 A;  3AED B;  4OZB A;  1EU4 A;  2HE7 A;  3L10 B;  2N0S B;  3I63 C;  4ANW A;  4RM8 A;  2LHD A;  4N9F 4;  4WQO B;  2BYT A;  4AOF A;  3Q3M C;  3PS6 A;  4M00 A;  4M0W A;  2KVZ A;  3PZ8 A;  2CKH B;  1I42 A;  2FCQ A;  5JHA A;  2LVO A;  2MWS B;  4LNF A;  2QSD A;  4G3X B;  3GP7 A;  2G3Q B;  1WMH B;  1I4X A;  5IP4 D;  3PRZ A;  1CQV A;  4XX5 A;  2IO1 B;  1E90 A;  1WGK A;  1J7C A;  3DBL B;  1DGJ A;  2BS3 B;  3VTU A;  4J6I A;  2OHF A;  2ASQ A;  3KW5 B;  3RNE C;  4N59 A;  1WYW B;  2FCM A;  3W1S C;  4AQ7 A;  1TJE A;  4GDK A;  3VR9 B;  1IBX B;  1CMX B;  2E6X A;  3IG3 A;  1EF5 A;  2HTH A;  2I38 A;  2KQ7 A;  3U8Z A;  4NPN A;  2W9N A;  4NY0 A;  4ZOH C;  4A9A A;  1WYG A;  3KWV A;  3ZTC A;  3C19 A;  4HRO A;  1RWS A;  1YX6 B;  3N1Z C;  4GDL B;  3AEE B;  2WXH A;  2ZNV C;  1TZO A;  4ANV A;  3NUH B;  1NDD A;  2NCN A;  3X0W A;  3K9O B;  1L2N A;  1ACC A;  4RCO A;  3VQI A;  2LEK A;  1TKY A;  4GU2 A;  1HZ5 A;  4PYZ A;  2J42 A;  2WXQ A;  2MSE D;  5BMH A;  3WIM A;  2IO3 B;  4HJK A;  2R2Q A;  2INC C;  2MBB B;  2BVC A;  3M95 A;  3PSE B;  4TSS A;  1MFW A;  1YOV B;  1YJJ A;  1R4N B;  2IBI B;  3CF6 E;  2MLB A;  3H9D A;  4K7S A;  1F2R C;  2KC1 A;  3AE8 B;  2JQR B;  4YSX B;  3AU5 A;  3SDL C;  3SFD B;  1KRH A;  2PLP A;  1VJK A;  3OLM D;  1ZUD 2;  1KOT A;  2N7E A;  3AM9 A;  2JYE A;  1RFK A;  4NJ7 A;  2J53 A;  5D6J B;  2DZK A;  3B1L X;  2WXI A;  2C5L C;  3NS8 A;  4K7W A;  1WSP A;  4RF1 A;  1WRD B;  2WXO A;  1IYF A;  2JRI B;  3UF8 A;  2LD9 A;  3NVW A;  3ZKJ C;  1MHH E;  1HXY D;  1WI0 A;  3V6C B;  1JQ4 A;  5BYQ A;  3EEC A;  2WXL A;  3T9L A;  5HFY A;  4B9K A;  1KLV A;  1Y56 A;  3AB5 A;  2IGG A;  2Y5C A;  4MGZ E;  2BQQ A;  4ZHP A;  1XLN A;  3Q8E A;  3L16 A;  3U30 A;  1YIW A;  2NVU I;  4EZJ A;  1VZ6 A;  1V6E A;  4IWO A;  4P16 A;  2FUH B;  2KQ4 X;  2DNF A;  2PW9 A;  1KF6 B;  2V3N A;  3VR8 B;  1WFY A;  2JY6 A;  3A4S C;  4ARI A;  1K53 A;  3AE3 B;  3H7S A;  1C76 A;  3ZXR A;  1N5X A;  2EMS A;  4E74 A;  1FCL A;  1N61 A;  2RPV A;  2IO2 B;  4KZ0 A;  2WLB A;  3DWG C;  4B6W A;  2JRH A;  2WXJ A;  1JRO A;  3PHX B;  1LQB A;  2JPH A;  4RGO S;  4IWP A;  1E7U A;  2CJO A;  2Z0D B;  2L76 A;  1T0Y A;  3WA0 A;  2PEA A;  1V2Y A;  2ZW1 A;  1FXT B;  3MC9 A;  4JLC A;  3SU8 X;  4F1S A;  3A9K B;  4W9G A;  2C7M B;  1WF9 A;  5EE9 A;  1F0Z A;  1WMH A;  1HQR D;  1FIQ A;  5HHD G;  2WX1 A;  3MP9 A;  4FJZ A;  4M8M A;  3NZ3 A;  2PIA A;  2WDV B;  2DYO A;  4DHJ B;  1L4Z B;  3B2F A;  1V97 A;  3AEB B;  2BYF A;  3FC4 A;  5EE1 A;  1OQQ A;  2JU6 X;  3RUL A;  4FAD A;  1N63 A;  3RUI B;  1XLP A;  3IAM 1;  1J19 A;  3R7Q A;  2INN E;  4IG7 B;  3HVZ A;  4ANU A;  2L3Z A;  1WXS A;  3VUY A;  4M8N A;  4XZ4 A;  3FIL B;  1VZ7 A;  5L95 C;  3QJZ A;  4GDL A;  5DCN A;  1LM8 B;  1QIL A;  2FAZ A;  4HK2 A;  2BYV E;  4IKG A;  4UDU C;  1DOY A;  3ZTD A;  5BMG A;  2OJW A;  1V5O A;  3ZLZ A;  2W54 A;  2DYM A;  4GIV A;  1SXT A;  3UQA A;  3WAO A;  1Z5S B;  3SHQ A;  1N6Z A;  1WXA A;  1A70 A;  5D3I B;  1MG4 A;  5E6J A;  4FBJ B;  1ZPS A;  1SJE D;  3WAM A;  4IOI E;  4EE2 A;  5T8I A;  1GB1 A;  2O6V B;  5GMV A;  5HKH A;  1FCC C;  3KUD B;  1DYQ A;  1XQQ A;  4FJY A;  2ACZ B;  1BXT A;  4KIK B;  2VZK B;  2J0M A;  4JPS A;  2MCN B;  3LXF A;  2MP2 B;  3VUW A;  3WAL A;  3ZIM A;  3PO0 A;  3NJT A;  2PTL A;  2KDB A;  4GXB A;  2CU3 A;  1WXM A;  3QAR A;  2N1W A;  1S3S G;  1IPG A;  4PS8 A;  1QOG A;  1G6J A;  3UI3 A;  4S17 A;  4A8X C;  2DHZ A;  3L4P A;  5AUK A;  2IGH A;  2FUG 1;  4DDI D;  3ABV B;  4IM0 A;  4AJW A;  3QCA A;  2W55 A;  4NAM A;  3H1U A;  3LB8 C;  5FR3 A;  1XCT L;  4KGT A;  3H7P B;  1QOA A;  1P9D U;  3PTF C;  4GSW A;  2RR9 A;  2AQ1 B;  1TY2 A;  4LNN A;  1AN8 A;  1F2R I;  5CHW A;  2D5G A;  2V3P A;  4W9D A;  2HDE A;  4RGM A;  5D3D A;  3HK0 A;  3ML8 A;  4A3P A;  2KN5 A;  1ZXH A;  1E8Y A;  5J17 A;  3HM3 A;  1ZDV A;  3MC0 B;  4EFO A;  4W9J A;  1F52 A;  3RT3 B;  3J9C A;  2LFI A;  2RMM A;  4L1B A;  4DQO C;  2M0X A;  1SGH A;  2PMV A;  1TS2 A;  3A9K A;  2XBB C;  2MBH A;  4XWT A;  4M01 A;  2HD5 B;  1OTR B;  2J0J A;  4DWF A;  2DZJ A;  2V3S A;  3AMZ A;  4RNA A;  1GPX A;  1NVI D;  3RNA C;  1TYG B;  1PDX A;  5E6N A;  2LXA A;  4WJP A;  1GJZ A;  1L6U A;  3ZDT A;  2GBR A;  4JE3 B;  1Q5W B;  4J3O D;  3GZN I;  1I35 A;  4GLS C;  3EA6 A;  3ETR A;  2JWZ A;  1SE9 A;  3T3N A;  3I9V 1;  2W82 A;  3IHP C;  1V8C A;  2I1K A;  3KVF B;  1QZE A;  2NTS A;  2LJ5 A;  3LJ3 A;  3ZJU A;  5C2T B;  2H88 B;  3FIL A;  4MDK E;  1F77 A;  3CMM B;  1UNS A;  2ZJD A;  3TL5 A;  4MGK E;  5IO9 A;  1S1Q B;  3UIN B;  3AE1 B;  2K6Q A;  3IBE A;  3V3X A;  4REZ A;  5JXV A;  3Q3J A;  4G50 A;  2BS2 B;  1N62 A;  3RZW C;  2UU7 A;  3M63 B;  3V60 A;  3FAH A;  2K0P A;  4I6P A;  2TSS A;  2XN9 C;  3N3K B;  3TEY A;  3TUO A;  4RGN A;  4II3 B;  2N7D A;  2KC2 A;  2N9X A;  2L83 A;  2YVC A;  3UIP B;  3BK2 A;  1OQR A;  1WM3 A;  1RYJ A;  2WGS A;  2RDG A;  2KXJ A;  3L17 A;  1WE6 A;  2BB6 A;  4BKG A;  4FHK A;  2ONQ A;  1UWX A;  4WJQ A;  2NPT B;  2KX3 A;  2H89 B;  1TKG A;  2O6V A;  5CX3 A;  1C1Y B;  2M4N A;  2LZ6 A;  2GBJ A;  2LRW A;  2WDR B;  2JZZ A;  1H4R A;  5G5G A;  2QHO A;  1SE2 A;  3EC8 A;  1FM0 D;  4BKS A;  4ITK A;  2B76 B;  3L0W B;  4KIK A;  4NZL B;  1T3Q A;  3AV8 A;  1WXQ A;  1TS5 A;  1C4P A;  2MP2 A;  1TS4 A;  2KX0 A;  3KYC D;  1PGX A;  5AZG A;  1E0Z A;  3NS1 A;  1Q0W B;  3Q8C A;  2JX5 A;  2ZVN A;  1Q10 A;  3JSV A;  2KMA A;  3T3O A;  2CHX A;  1TIF A;  2K25 A;  4JWU C;  5J18 A;  2WS3 B;  3P4R B;  1NI3 A;  3VAW A;  2MHJ A;  1R4M B;  1P3Q U;  3BWU D;  3P2B A;  2G4D B;  4B0E A;  2JUO A;  3KWL A;  3A1Q B;  3H7P A;  2Y3A A;  4H2A A;  2WU2 B;  4A3O A;  1GB4 A;  1WX8 A;  4US8 A;  3P42 A;  1JWM D;  1TS3 A;  2BB5 A;  2BKR B;  5IKC M;  3TEX A;  1LFD A;  4RMA A;  1L0V B;  2KD0 A;  4W9E A;  1XF5 L;  2N9K A;  4KGS A;  4TUU A;  5LLI A;  1SE4 A;  3ALB A;  2IY0 B;  2ZCC A;  2V1Y A;  1SF0 A;  2WU5 B;  3OJ3 A;  3ZQ4 A;  3OWE B;  3IFW B;  2CJN A;  3URY A;  3IAS 1;  2WX0 A;  4LK0 M;  5EE3 A;  1OEY J;  4XWW A;  4WAF A;  1JW9 D;  4FJV B;  3KH0 A;  3DBS A;  1WE7 A;  5J2R A;  1E8W A;  3CWI A;  3IXS A;  4DBG A;  2GB1 A;  2GLS A;  3I5J C;  2XEW A;  3P1M A;  3QA8 A;  4GOC A;  4NJ6 A;  1YMH E;  2KJH B;  3DOW A;  2E3T A;  3TCA A;  3AEC B;  4XDD A;  3PRM B;  4YXD B;  3AE7 B;  3QK0 A;  4G11 A;  2BPS A;  4C4V B;  2DAJ A;  5BYS A;  2AQ2 B;  2WDQ B;  2NS5 A;  2OJR A;  2D10 A;  2WXM A;  4AWJ A;  1KJT A;  2L05 A;  3A4R A;  1IGD A;  2KWV B;  1XXG A;  2MX2 A;  4AP4 C;  5DPT A;  4TMA B;  1PYW D;  1EWY C;  3NZU A;  1HTO A;  2JXX A;  4IW0 A;  2JYT A;  1Y8R C;  2MBO A;  4WUR A;  2PE6 B;  3RNC C;  5IOI A;  2HTM E;  3PLV A;  4BFR A;  2X38 A;  2REX A;  4N6E B;  4ZRQ A;  1C77 A;  2JZ3 B;  3N9Y C;  1HZ6 A;  1R4N I;  2NR2 A;  3AUL A;  2CHZ A;  4LJP B;  4JGH B;  3TBL D;  2KDM A;  2RD0 A;  5CTR C;  3A9J B;  4LDT D;  5JZE B;  3EUB 2;  4XE0 A;  2JF5 A;  2W3R A;  4GN1 A;  4C56 C;  3GE8 C;  2MW5 A;  2RDH A;  1IP9 A;  3DBH I;  4EUT A;  2NPT A;  1V81 A;  4HKQ A;  1V86 A;  3HRD D;  1TTN A;  2JZP A;  4HCN B;  2LUE A;  5D2M B;  4ZRI A;  3Q3F A;  2C7N B;  5FKA C;  2W3S A;  3V6E B;  3WAN A;  1OFF A;  2RSU A;  1R7S A;  4HLE A;  1SEB D;  1JML A;  4KZC A;  2VH1 A;  3V05 A;  1M94 A;  1V49 A;  3ZXV A;  1ROE A;  2KTF A;  1JAL A;  4K3B A;  4BKT A;  4CQN A;  2BGF A;  1N60 A;  5IA7 A;  4PS7 A;  2FCN A;  4WWN A;  2LUM A;  3B9J A;  3QQ8 B;  1T0R C;  2NBU A;  2JSV X;  3R2T A;  2WNM A;  4IWQ A;  3AEF B;  3OG5 A;  4EZK A;  1ESF A;  2ZZP B;  1WX9 A;  2J7Q B;  3HIZ A;  3A1Q A;  2AEH A;  4HCP B;  1I7H A;  3W1Y A;  2ICI A;  1C79 A;  2LXC A;  3DVN U;  4B95 A;  2N9L A;  4KKI A;  1C3T A;  4ZRJ A;  1FXA A;  1PGB A;  2WYQ A;  3W9C B;  1XLQ A;  2KDF B;  3APD A;  2Z0E B;  4WWM A;  1RFA A;  3TMP B;  1IBX A;  3V61 A;  2D3B A;  3ONS A;  2MRP A;  4ICU A;  3I3T B;  4LJO B;  4OZC A;  2WXN A;  4HDQ A;  2KK8 A;  3AE5 B;  2AL6 A;  2KAJ A;  3BVZ A;  2KO3 A;  2DAF A;  1C9F A;  1T5X D;  2KLG A;  4QAY A;  1JCK B;  3R3M A;  4C7Z A;  5D94 A;  2LVP A;  2MEK A;  2Y5P A;  4BBN F;  1JRU A;  3RMK C;  5DPR A;  3L08 A;  4OVV A;  1HTQ A;  2QDF A;  1RAX A;  2RPQ A;  4IM2 A;  5BMI A;  3VXW A;  3N1Y C;  1EO6 A;  1WM2 A;  3TSS A;  2R61 A;  2HJ1 A;  1FEH A;  2RDB C;  3L13 A;  1GNU A;  1X1M A;  4BAX A;  4C4V A;  3DBR I;  5LXH A;  4WAA A;  4A55 A;  2CU1 A;  4C80 A;  2EKE C;  1L4D B;  1VCB A;  3U7Z A;  4ZDV A;  2L0F A;  3CIR B;  2KWC A;  4MGI E;  1EM7 A;  2OED A;  2WWZ A;  2WXP A;  3VH4 B;  4I6L B;  5L83 A;  3IT6 B;  1PUT A;  2AL3 A;  5I4D A;  2L8J A;  2QCZ A;  2SAK A;  1E10 A;  4DHZ B;  3BVG A;  1J7B A;  1E6E B;  1J0G A;  3GE3 C;  1P0R A;  2G4S A;  2N9P C;  2NBV B;  4HWI B;  1XLO A;  5FK9 C;  4K81 A;  2CR5 A;  1D5Z C;  3OJ4 B;  1V1O A;  5C1Z A;  2OOB B;  3UGB B;  2M19 A;  1HEZ E;  1GC6 A;  2ZNV B;  4OVZ A;  4TV3 A;  2KTR B;  1A5R A;  4DHJ D;  3KLS X;  1XCQ L;  1MI0 A;  3Q8B A;  2DYB A;  3MJW A;  2FBW B;  4ASW C;  3E56 A;  2D2Q A;  2NMQ A;  1BUI C;  3A9J A;  2GBK A;  1ZP0 B;  2NBW B;  4BBN C;  5AZF A;  2M8S A;  2D07 B;  4P1C C;  1T0S C;  4JX1 C;  4OVU A;  3SFE B;  1YNT E;  4RM9 A;  4MJS B;  3NOB A;  1ZKH A;  2FIF A;  1MVK A;  3PT2 B;  2JWU A;  1YN4 A;  1GUA B;  2WXF A;  3PZD A;  2K6D B;  4FN2 A;  3DHH C;  1V80 A;  3N32 A;  3Q3O C;  2MJD A;  2ON8 A;  3HVD A;  4HPL B;  1ZE3 D;  3RN9 C;  2MA9 B;  3ZDM C;  3Q8A A;  3WAP A;  1EWC A;  2LGI A;  1ZDX A;  3GS2 A;  4JIO U;  3D32 A;  2V4L A;  3ZNG C;  3N1X C;  3HUI A;  3RNB C;  4E71 A;  1SJH D;  2KJR A;  4BVU C;  1NBF C;  4XDC A;  4FHJ A;  3ZNI D;  1E7V A;  3WCQ A;  2LVQ A;  1E9M A;  2L0T A;  2O6V D;  4BOZ B;  1I4Q A;  3NVV A;  4RFB A;  4BKS D;  2WP9 B;  2KYW A;  2EMT A;  4KDL B;  2N1V A;  2ZW0 A;  4IDI A;  4W9L A;  1WGY A;  3UQB A;  1NI2 A;  1NEN B;  1FFV A;  1ZGU B;  4RGT A;  2GBN A;  3AXC A;  3VHT C;  4KSL C;  1ET9 A;  3AE4 B;  2BS4 B;  2LWP A;  4HJG E;  4R3D A;  1TZ1 A;  2GOW A;  4N58 A;  1YQB A;  1SE3 A;  2IYD B;  1TGZ B;  3O65 B;  5FR6 A;  2KVR A;  1UEL A;  3BZD B;  2G1E A;  2L1A A;  4MM3 B;  1UZX B;  3ZNH B;  2D3C A;  2GBM A;  4RF0 A;  2MBQ A;  1WWT A;  1AYF A;  4IUM B;  1B9R A;  2ZPN A;  2LI5 A;  1JWU D;  4DK5 A;  4YSZ B;  3ENE A;  3ZYY X;  1K52 A;  1DOX A;  3BK1 A;  3UIO B;  3X23 A;  3N20 C;  2DWQ A;  5AEK B;  4PK1 A;  2O2V B;  4EZL A;  1XO3 A;  4W9F A;  3AE9 B;  2KN4 A;  3RYT A;  3W1S A;  1CZP A;  2WQY B;  2INP E;  4USA A;  4KX6 B;  2AWT A;  1FO4 A;  4JQW C;  3U52 E;  3Q14 C;  2UYZ B;  1FNU A;  4MGY E;  5BYR A;  2BF8 B;  4HRS A;  1WGG A;  2K8H A;  4HPP A;  1E7P B;  1V1P B;  2CHW A;  3VDZ A;  1QT9 A;  2MBE A;  4YTP B;  2B3A A;  2ZCB A;  4IM3 A;  3ZUN A;  1U4A A;  2WXG A;  2QC8 A;  1FRD A;  4W9K A;  3N30 A;  3BIN A;  1LGR A;  2KTR A;  3DCG A;  1Q1O A;  1QOB A;  2K3U A;  2LJI A;  2KAN A;  1RM6 C;  3O13 A;  5CHV C;  2AX5 A;  1GG3 A;  1YQ3 B;  1TBE A;  2L7R A;  3VTV A;  1FD6 A;  2BKF A;  4K1R B;  1H8C A;  5D7G A;  4X57 B;  2L00 B;  4WQM A;  4MAC A;  1VD2 A;  2DX5 B;  3AH7 A;  4YTM B;  1SIF A;  4FA6 A;  4GGQ A;  3Q2A C;  4MJS A;  4MH0 E;  4ZYS A;  2WHI A;  2IY1 B;  1L5P A;  1ZW7 A;  3ZNZ B;  1YJ1 A;  2KDI A;  2UWQ A;  4O1N A;  3BYY B;  3NVY A;  2YLM A;  2A5U A;  3RCZ A;  1WGH A;  3W5U B;  2LAS A;  3R8B A;  3PHW B;  2QEJ C;  4MH8 A;  1D6E C;  3AEA B;  1LXD A;  1KM7 A;  4AUQ C;  5IAA C;  4HEA 1;  3Q6B A;  2D3A A;  1BML C;  2PKO A;  1R4M I;  2KZR A;  3U7D A;  1XT9 B;  3M3J A;  2KKC A;  5TR5 A;  4CYE A;  1VLB A;  3B0A A;  4TQ0 A;  3P4P B;  3SEB A;  1WXV A;  1K51 A;  2FNJ B;  3P4Q B;  3VTW A;  1HA5 A;  1EU3 A;  3APC A;  3DBL I;  1ENF A;  1YN3 A;  2M17 A;  1PFD A;  3Q3N C;  1YD8 U;  4PS3 A;  1AAR A;  3R7R A;  2GI9 A;  1L6V A;  3SD5 A;  4W9C A;  4LDT B;  1FNV A;  1GC7 A;  1SIJ A;  2EEL A;  3B08 A;  2YEP B;  2CS4 A;  1JWS D;  2PE9 A;  3RZF A;  2JXT A;  4A90 A;  5DPW A;  1Z2M A;  1WJ6 A;  2K39 A;  2Z8L A;  4YT0 B;  2PVG C;  2G9H D;  3JYU A;  2N7J A;  2J0K A;  2KDE B;  3BYT B;  4K3C A;  2K9X A;  4OZA A;  3A33 B;  3TEW A;  1D4B A;  1KTK A;  3EGR A;  1C78 A;  1ZXI A;  1FFU A;  1YJI A;  1FPY A;  4MSQ B;  1DOI A;  2J4X A;  1QKZ A;  1VRA B;  1D3Z A;  4IC7 B;  2KLC A;  2WDT B;  1E5W A;  5LNK 1;  5JHB A;  3QAQ A;  2K8B A;  4LLG M;  4JL9 A;  4LNK A;  1OQY A;  1OEY A;  4MEL A;  3KUC B;  1JRP A;  4MM3 A;  2GMI C;  1IUE A;  1FXI A;  4Q2J A;  3DWM A;  2V0G A;  4D2K A;  1WJN A;  3MJ5 A;  3FKY A;  4P1B C;  5MPO A;  2KWD A;  3JVZ X;  3ZJT A;  3CSF A;  1CJE A;  2FID A;  2MQJ A;  3I57 A;  3MHS D;  4S0R A;  4AJY B;  3H8H A;  5E6O A;  3EFC A;  4NAW B;  3IVF A;  3C0R B;  3EFU A;  4GMV A;  4TKN A;  3PVL A;  2O2V A;  3DBH B;  4WJN A;  1TY0 A;  4CO7 A;  3APF A;  3T8M A;  4FUL A;  4C7Y A;  1WH3 A;  4I6N B;  3KYD D;  5HG2 A;  4HDO A;  2DLB A;  2BBC A;  3NRZ A;  1TKE A;  2DZI A;  2Y5B B;  1EUV B;  3GOE A;  3MC8 A;  5C23 A;  1V1P A;  2X8X X;  3VUX A;  2QIE B;  1YN5 A;  4RH6 A;  1WR6 E;  1F1H A;  1YX5 B;  3RNF C;  4MT5 A;  4KVG B;  3MHZ A;  3TIX A;  4DXA B;  4GB9 A;  4KDI C;  3RNG C;  1P1A A;  2JT4 B;  3VVW B;  3Q69 A;  2DZM A;  4XGA B;  2FCS A;  1OGW A;  1UUP A;  1WJU A;  1WIA A;  1VR9 A;  3U2S C;  3IT4 B;  1AWD A;  2BT6 A;  1YQ4 B;  3B2G A;  1T0Q C;  2IO0 B;  4LCD E;  4FXC A;  3ECI A;  1MHX A;  3PPA A;  3AE6 B;  4ANX A;  5AUI A;  2ZEQ A;  4KGR A;  4BZA A;  3R2I A;  2KQS A;  3ZRF A;  1I4G A;  4DDG D;  5EDS A;  1FRR A;  1ISN A;  2FE8 A;  1E8X A;  4ARC A;  4F7Z A;  2IGD A;  2XK5 B;  4KV2 A;  2V4I B;  1EF1 A;  1UBQ A;  1WY8 A;  1L7Y A;  4LNI A;  4W9I A;  1JWA D;  4YL8 A;  2KAC A;  1E8Z A;  3DDC B;  3NHE B;  4NQK E;  4XYC A;  2N4F A;  5EE0 A;  3ZJV A;  1SBB B;  3SR6 A;  2KFK B;  1ET6 A;  1UF0 A;  1VZ8 A;  2WXR A;  3W5V B;  5TSS A;  2LHE A;  4ICV A;  3TEZ A;  4AS1 A;  1F9J A;  4ZRK A;  1NYR A;  4DXG A;  2PVO D;  3PV1 A;  3GB1 A;  2IPK D;  4EOY A;  1IGC A;  2Q5W D;  2BWF A;  4WWO A;  4HPM B;  3JW0 X;  4KSK C;  5GXG B;  2K1F A;  1BT0 A;  3QIJ A;  2Z59 B;  3DBR B;  2BW2 A;  1N5W A;  3VRA B;  2JVC A;  3ZO5 B;  1UD7 A;  4WIP A;  2M0A A;  3ZW3 A;  1XD3 B;  5KHO A;  1HE8 A;  4DHZ E;  1TT5 B;  2N9E B;  1L0Y B;  1NYQ A;  3BII D;  1L0X B;  3QX1 A;  1LO5 D;  4US9 A;  2J52 A;  3TJP A;  2YEP F;  3KQ4 A;  1QF6 A;  3DVN V;  4E3C A;  2BWE S;  3Q8F A;  2AQ3 B;  4HKZ E;  3DHG C;  3S2A A;  5KHQ A;  3HHM A;  1STE A;  4M02 A;  1KLU D;  2KMC A;  1UH6 A;  3RFZ B;  3AE2 B;  3NVZ A;  3DVG X;  3OAW A;  1UGJ A;  3PRP B;  1I4R A;  2BTE A;  4K7U A;  4KKJ A;  3AN1 A;  4NAW A;  2SEB D;  3P4S B;  1KLG D;  3QHT A;  2KMM A;  2IND C;  4YWG G;  3KUZ A;  2KOX A;  4WJO A;  1V9J A;  1UWM A;  4YTN B;  2M56 B;  4B0M A;  4DXF A;  5BO4 B;  2C60 A;  2MJE A;  2LMC A;  4HVB A;  2MJ3 A;  1MPE A;  2HJ8 A;  2WXK A;  3P63 A;  3ZRC A;  1WZ3 A;  1CK1 A;  2BYE A;  4OHJ A;  3BVM A;  2LGD A;  1C4C A;  2I1J A;  1B1Z A;  3JSV B;  4LNO A;  4A6Q A;  3NZS A;  1VDV A;  4ZYN A;  4M0W B;  3E9S A;  5G55 A;  5DPS A;  4F8C B;  2LGX A;  3VRB B;  4A20 A;  4EEW A;  1NEK B;  2L52 A;  2XNA C;  2QMT A;  3W2D A;  2AYO B;  3LYY A;  1P7E A;  1T6B X;  1K8R B;  2DBY A;  1RLF A;  2PPH A;  5JH5 C;  1WZ0 A;  2EKI A;  4NJC A;  4NQL B;  1FNW A;  5G2N A;  4CHK A;  2DEN B;  1C4A A;  1ZOY B;  4L23 A;  3C8Y A;  3DHI C;  3PRE A;  4ACF A;  5HI1 A;  3MFG A;  2C9W B;  4L2Y A;  4G0N B;  1K50 A;  2ZPY A;  3VH3 B;  4MEM A;  2QIL A;  4GDK B;  2IDY A;  1I4H A;  4W9H A;  2KHW B;  4JWS C;  3PLU A;  1GAQ B;  2XK5 A;  2G45 B;  3GZN B;  2ZVO A;  2A4Z A;  2MH7 A;  4II2 B;  3L54 A;  2PJH A;  2IJ0 A;  2C7H A;  2KNB A;  3QC8 B;  2VZK D;  3RI7 C;  5IN7 A;  4TQ1 A;  4P7I A;  1KFY B;  2LGS A;  3ZGZ A;  1WR1 A;  1J7A A;  3DQV A;  3DPD A;  2K5P A;  1SB3 C;  4FLH A;  1WJ4 A;  2NTT A;  3ML9 A;  1PQS A;  2KFK A;  5AZH A;  2D11 A;  1WGD A;  3MTN B;  4WWP A;  4URK A;  1V5T A;  5E6P A;  2VH2 A;  2I2Y A;  1UBI A;  3CST A;  4ZHO A;  1JWB D;  3EHV A;  2LGY A;  5CHF A;  2D3G A;  3H6N A;  1I4P A;  2K22 A;  2KFJ A;  1QOF A;  3V62 A;  1SSN A;  2L32 A;  1KH0 A;  4ZRP A;  2IZV B;  4PT5 A;  3AU4 A;  4XC2 A;  3U4E G;  1MG8 A;  4C00 A;  4P6V F;  5G5H A;  2GRI A;  4NNJ B;  1P7F A;  2LRU A;  2K8C A;  2KJ6 A; 
#chains in the Genus database with same CATH homology
 1Z2M A;  1WJ6 A;  2K39 A;  4IWQ A;  4HXD A;  2KDB A;  4GXB A;  1WXM A;  3QAR A;  4EZK A;  2N1W A;  2VRR B;  4EKU A;  1S3S G;  2ZZP B;  3JYU A;  5LXI B;  1WX9 A;  2J7Q B;  4PYU A;  2J0K A;  2KDE B;  3HIZ A;  3A1Q A;  1IPG A;  1WX7 A;  4PS8 A;  4BOS C;  1G6J A;  2AEH A;  4HCP B;  2DHZ A;  2R2O A;  3A33 B;  3W1Y A;  3RD2 A;  4DDI D;  1J8C A;  2LXC A;  3DVN U;  4IM0 A;  4AJW A;  4B95 A;  2KWU B;  2M1M A;  3QCA A;  3H1U A;  4MSQ B;  1C3T A;  4ZRJ A;  3H7P B;  1RRB A;  1UGM A;  1D3Z A;  4IC7 B;  2WYQ A;  2KLC A;  3NY5 A;  3M62 B;  1P9D U;  2WDT B;  3PTF C;  1E5W A;  2KDF B;  3APD A;  2Z0E B;  3DVG Y;  1RFA A;  3QAQ A;  2RR9 A;  4GSW A;  3TMP B;  5JHB A;  2K8B A;  4JL9 A;  3V61 A;  1OQY A;  1OEY A;  4MEL A;  3KUC B;  4MM3 A;  2GMI C;  3ONS A;  2MRP A;  5CHW A;  4ICU A;  3I3T B;  4LJO B;  3R66 C;  3HM6 X;  4HDQ A;  4W9D A;  4MSM B;  3VFK A;  1WGR A;  2KK8 A;  3AI5 A;  2AL6 A;  3QWZ B;  3K9P B;  1WJN A;  2RGF A;  3HK0 A;  3ML8 A;  2KO3 A;  4A3P A;  3PGE A;  2KN5 A;  3JVZ X;  3ZVV A;  1E8Y A;  2DAF A;  3CSF A;  5J17 A;  2KLG A;  3HM3 A;  3BY4 B;  4EFO A;  3R3M A;  4W9J A;  2FID A;  2MQJ A;  3MHS D;  3RT3 B;  5D94 A;  3LDZ E;  2LVP A;  4AJY B;  1P98 A;  4BBN F;  5E6O A;  1JRU A;  2M0X A;  4NAW B;  1SGH A;  2HE7 A;  3C0R B;  3IVF A;  3L10 B;  3EFU A;  4GMV A;  4TKN A;  5DPR A;  4ANW A;  3PVL A;  3L08 A;  2O2V A;  3A9K A;  4OVV A;  2XBB C;  4WJN A;  4CO7 A;  4RM8 A;  2MBH A;  1RAX A;  2RPQ A;  3APF A;  4N9F 4;  3T8M A;  4IM2 A;  2HD5 B;  1OTR B;  2J0J A;  4FUL A;  3VXW A;  4DWF A;  4WQO B;  2DZJ A;  1WH3 A;  2V3S A;  3PS6 A;  4I6N B;  4AOF A;  3KYD D;  4HDO A;  1EO6 A;  1WM2 A;  2CKH B;  1I42 A;  2FCQ A;  5E6N A;  2DZI A;  2Y5B B;  1EUV B;  3GOE A;  2LXA A;  3L13 A;  4WJP A;  1GNU A;  1GJZ A;  1X1M A;  2LVO A;  5C23 A;  5JHA A;  3VUX A;  2MWS B;  3DBR I;  5LXH A;  4G3X B;  4WAA A;  3ZDT A;  1WR6 E;  2CU1 A;  2G3Q B;  1WMH B;  1YX5 B;  2GBR A;  3PRZ A;  2EKE C;  1VCB A;  4ZDV A;  2L0F A;  4KVG B;  4XX5 A;  1Q5W B;  3TIX A;  4DXA B;  2IO1 B;  3GZN I;  4GB9 A;  1E90 A;  1I35 A;  2KWC A;  4MGI E;  4KDI C;  1P1A A;  2WWZ A;  3VTU A;  2JT4 B;  4J6I A;  4I6L B;  3VH4 B;  5L83 A;  3VVW B;  2JWZ A;  2AL3 A;  2ASQ A;  3KW5 B;  1SE9 A;  2L8J A;  2DZM A;  4DHZ B;  2FCS A;  1J0G A;  3IHP C;  1P0R A;  1WYW B;  2G4S A;  2N9P C;  2I1K A;  2NBV B;  3KVF B;  4HWI B;  1OGW A;  2FCM A;  3W1S C;  1QZE A;  4K81 A;  1WJU A;  2CR5 A;  3LJ3 A;  1WIA A;  2LJ5 A;  3OJ4 B;  4GDK A;  5C1Z A;  2OOB B;  4MDK E;  3UGB B;  1CMX B;  1GC6 A;  3CMM B;  2ZNV B;  4TV3 A;  2IO0 B;  2ZJD A;  4LCD E;  4MGK E;  2KTR B;  3ECI A;  3TL5 A;  4DHJ D;  1A5R A;  3IG3 A;  1S1Q B;  1EF5 A;  2HTH A;  3UIN B;  2KQ7 A;  3PPA A;  3U8Z A;  2DYB A;  4NPN A;  2W9N A;  4NY0 A;  2K6Q A;  3MJW A;  4ASW C;  4ANX A;  2ZEQ A;  2D2Q A;  3IBE A;  3ZTC A;  2KQS A;  3ZRF A;  3A9J A;  2GBK A;  4DDG D;  5EDS A;  2NBW B;  1ISN A;  3Q3J A;  4BBN C;  4G50 A;  1YX6 B;  3RZW C;  5AZF A;  4GDL B;  1E8X A;  3M63 B;  2M8S A;  3V60 A;  2D07 B;  4I6P A;  2ZNV C;  4ANV A;  4F7Z A;  2XK5 B;  3N3K B;  1NDD A;  4KV2 A;  2NCN A;  4OVU A;  3X0W A;  3K9O B;  4II3 B;  1EF1 A;  1UBQ A;  2N7D A;  1WY8 A;  1L2N A;  2KC2 A;  2N9X A;  4RM9 A;  1L7Y A;  2YVC A;  4MJS B;  4W9I A;  3VQI A;  4GU2 A;  4PYZ A;  3UIP B;  2MSE D;  4YL8 A;  3NOB A;  1ZKH A;  1WM3 A;  2FIF A;  3WIM A;  2IO3 B;  4HJK A;  3PT2 B;  2KXJ A;  3L17 A;  1WE6 A;  4BKG A;  1E8Z A;  4FHK A;  3DDC B;  3NHE B;  4NQK E;  1GUA B;  2N4F A;  2R2Q A;  4WJQ A;  3PZD A;  2NPT B;  2MBB B;  2K6D B;  2KX3 A;  3M95 A;  3PSE B;  2O6V A;  2KFK B;  4FN2 A;  5CX3 A;  1C1Y B;  1V80 A;  2M4N A;  3N32 A;  2LZ6 A;  4HPL B;  2GBJ A;  2LRW A;  2IBI B;  3CF6 E;  2MLB A;  2JZZ A;  3H9D A;  4K7S A;  2KC1 A;  1H4R A;  4ICV A;  2QHO A;  1F9J A;  2MA9 B;  4ZRK A;  3EC8 A;  3ZDM C;  3WAP A;  3AU5 A;  4BKS A;  3PV1 A;  3L0W B;  4JIO U;  3SDL C;  3D32 A;  4KIK A;  2V4L A;  4EOY A;  3ZNG C;  3OLM D;  1KOT A;  2MP2 A;  3KYC D;  2KX0 A;  2N7E A;  4E71 A;  2BWF A;  5AZG A;  4WWO A;  4HPM B;  3JW0 X;  2KJR A;  4NJ7 A;  4BVU C;  4KSK C;  1NBF C;  5D6J B;  1Q0W B;  2DZK A;  4FHJ A;  3ZNI D;  3B1L X;  2C5L C;  1E7V A;  2ZVN A;  3NS8 A;  2LVQ A;  3JSV A;  4K7W A;  2K1F A;  1BT0 A;  2KMA A;  2L0T A;  2Z59 B;  2CHX A;  2K25 A;  2O6V D;  3QIJ A;  1WRD B;  4BOZ B;  1IYF A;  2JVC A;  3ZO5 B;  5J18 A;  2JRI B;  1UD7 A;  3UF8 A;  3VAW A;  3ZW3 A;  1XD3 B;  2LD9 A;  5KHO A;  1HE8 A;  3ZKJ C;  4DHZ E;  2N9E B;  1WI0 A;  1P3Q U;  3V6C B;  3P2B A;  2G4D B;  4BKS D;  2JUO A;  2EMT A;  3EEC A;  4KDL B;  2N1V A;  3QX1 A;  3T9L A;  3A1Q B;  4B9K A;  3H7P A;  3TJP A;  4W9L A;  1WGY A;  1KLV A;  3DVN V;  4E3C A;  3UQB A;  2BWE S;  1NI2 A;  1ZGU B;  4MGZ E;  2GBN A;  3AXC A;  4A3O A;  3VHT C;  1WX8 A;  3L16 A;  3S2A A;  4KSL C;  5KHQ A;  2LWP A;  3U30 A;  1YIW A;  2BKR B;  2NVU I;  4EZJ A;  3HHM A;  1V6E A;  1TZ1 A;  4IWO A;  2GOW A;  2FUH B;  1LFD A;  4RMA A;  1YQB A;  2KMC A;  2KD0 A;  2IYD B;  1UH6 A;  1WFY A;  1TGZ B;  2JY6 A;  3O65 B;  3A4S C;  4W9E A;  5FR6 A;  2KVR A;  4TUU A;  1UEL A;  5LLI A;  3DVG X;  3OAW A;  3ALB A;  2IY0 B;  3PRP B;  2ZCC A;  3H7S A;  2V1Y A;  1UZX B;  3ZNH B;  2EMS A;  2GBM A;  3OJ3 A;  4K7U A;  4E74 A;  4KZ0 A;  2IO2 B;  2MBQ A;  4NAW A;  4B6W A;  2JRH A;  4IUM B;  3IFW B;  3PHX B;  2ZPN A;  3QHT A;  1LQB A;  2JPH A;  2WX0 A;  2LI5 A;  3KUZ A;  4IWP A;  2KOX A;  4WJO A;  1V9J A;  1E7U A;  1OEY J;  4DK5 A;  2Z0D B;  5BO4 B;  2L76 A;  1T0Y A;  4FJV B;  3KH0 A;  2C60 A;  3WA0 A;  3ENE A;  2PEA A;  4HVB A;  3DBS A;  1V2Y A;  1WE7 A;  3UIO B;  1FXT B;  2HJ8 A;  5J2R A;  1E8W A;  4JLC A;  3X23 A;  3ZRC A;  1WZ3 A;  4DBG A;  3SU8 X;  4F1S A;  5AEK B;  4EZL A;  2BYE A;  2O2V B;  3A9K B;  2C7M B;  4W9G A;  4W9F A;  1WF9 A;  2LGD A;  3RYT A;  2XEW A;  2I1J A;  3W1S A;  1WMH A;  3JSV B;  3QA8 A;  4GOC A;  3NZS A;  4NJ6 A;  2AWT A;  4ZYN A;  4M0W B;  2KJH B;  3DOW A;  5G55 A;  3TCA A;  4JQW C;  5DPS A;  2UYZ B;  2WX1 A;  4F8C B;  2LGX A;  4A20 A;  4EEW A;  3PRM B;  4FJZ A;  4M8M A;  4MGY E;  2BF8 B;  1WGG A;  2K8H A;  3QK0 A;  2AYO B;  2BPS A;  2DYO A;  4G11 A;  1K8R B;  1RLF A;  2PPH A;  4DHJ B;  2CHW A;  5JH5 C;  2DAJ A;  3VDZ A;  1WZ0 A;  4NQL B;  5G2N A;  2MBE A;  4CHK A;  2B3A A;  2DEN B;  2BYF A;  2ZCB A;  2NS5 A;  4IM3 A;  3ZUN A;  1U4A A;  2OJR A;  2D10 A;  4W9K A;  4AWJ A;  3N30 A;  1KJT A;  3BIN A;  2L05 A;  3A4R A;  2KTR A;  2KWV B;  3DCG A;  1Q1O A;  2MX2 A;  3PRE A;  3RUL A;  4AP4 C;  3RUI B;  4FAD A;  5DPT A;  1J19 A;  2C9W B;  3R7Q A;  2KAN A;  5CHV C;  3NZU A;  4G0N B;  2ZPY A;  4IG7 B;  1GG3 A;  2JXX A;  4ANU A;  1TBE A;  2L3Z A;  2L7R A;  1WXS A;  4IW0 A;  3VH3 B;  3VUY A;  3VTV A;  4M8N A;  4MEM A;  4XZ4 A;  1Y8R C;  2MBO A;  4GDK B;  2PE6 B;  2BKF A;  4K1R B;  4W9H A;  5L95 C;  1H8C A;  3QJZ A;  2KHW B;  5D7G A;  3PLV A;  4BFR A;  4X57 B;  2REX A;  2L00 B;  3PLU A;  4GDL A;  2JZ3 B;  1R4N I;  2NR2 A;  5DCN A;  1VD2 A;  2DX5 B;  3AUL A;  2CHZ A;  4LJP B;  2XK5 A;  2G45 B;  1LM8 B;  1SIF A;  2A4Z A;  2ZVO A;  4GGQ A;  4FA6 A;  4JGH B;  3TBL D;  2FAZ A;  3L54 A;  4II2 B;  2RD0 A;  2PJH A;  4HK2 A;  5CTR C;  4MJS A;  4MH0 E;  2BYV E;  3A9J B;  2C7H A;  2KNB A;  3QC8 B;  4LDT D;  2IY1 B;  5JZE B;  4TQ1 A;  4P7I A;  3ZTD A;  1ZW7 A;  3ZNZ B;  2JF5 A;  1YJ1 A;  2KDI A;  2UWQ A;  4GN1 A;  1WR1 A;  1V5O A;  2MW5 A;  3DQV A;  3DPD A;  2YLM A;  3ZLZ A;  2A5U A;  3RCZ A;  1IP9 A;  1WGH A;  2DYM A;  4FLH A;  3DBH I;  4EUT A;  2NPT A;  1V81 A;  1WJ4 A;  2LAS A;  3ML9 A;  4GIV A;  3PHW B;  1V86 A;  3UQA A;  1PQS A;  2KFK A;  5AZH A;  3WAO A;  2D11 A;  1TTN A;  1WGD A;  3MTN B;  4HCN B;  1LXD A;  2LUE A;  4WWP A;  1KM7 A;  1V5T A;  4URK A;  4AUQ C;  1Z5S B;  5E6P A;  5D2M B;  3SHQ A;  4ZRI A;  3Q3F A;  1WXA A;  2C7N B;  5IAA C;  1UBI A;  3CST A;  3V6E B;  3WAN A;  1R4M I;  2KZR A;  3EHV A;  3U7D A;  1XT9 B;  3M3J A;  2KKC A;  2LGY A;  5TR5 A;  4FBJ B;  4CYE A;  5CHF A;  2RSU A;  3B0A A;  2D3G A;  3H6N A;  3WAM A;  4TQ0 A;  4HLE A;  2O6V B;  5GMV A;  1WXV A;  2KFJ A;  4KZC A;  1M94 A;  1V49 A;  5HKH A;  3V62 A;  2FNJ B;  3VTW A;  3KUD B;  3APC A;  3DBL I;  1XQQ A;  2IZV B;  2KTF A;  2M17 A;  3AU4 A;  4XC2 A;  1YD8 U;  4PS3 A;  4FJY A;  4BKT A;  1AAR A;  3R7R A;  3SD5 A;  1MG8 A;  2BGF A;  4KIK B;  4W9C A;  4LDT B;  5IA7 A;  4PS7 A;  2J0M A;  2FCN A;  1GC7 A;  4NNJ B;  4WWN A;  2MCN B;  3QQ8 B;  2MP2 B;  3VUW A;  3WAL A;  2NBU A;  3B08 A;  2CS4 A;  3ZIM A;  2PE9 A;  3RZF A;  2LRU A;  2K8C A;  2KJ6 A;  5DPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...