4RM8A

Crystal structure of human ezrin in space group p21
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
586
structure length
368
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 130
structure length 368
sequence length 586
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm8A01
2AEHA 1RRBA 4WJQA 1NI2A 5AZGA 2MLBA 4IWOA 2J0KA 2M8SA 1WXMA 4HPLB 1OTRB 4MSMB 4RMAA 1GC7A 4RM8A 2K8BA 1HE8A 5LXHA 2JRIB 4PYZA 2MBQA 2GBNA 3VH3B 2C7MB 1H8CA 4FJZA 4W9DA 1WZ3A 4TQ1A 5DPWA 1Q5WB 4K1RB 5AZHA 3K9PB 2ASQA 3L16A 1V49A 2JPHA 1S3SG 2ZPYA 3SDLC 2J0JA 2KANA 2OJRA 3O65B 4XZ4A 1GG3A 4DHZB 2BYEA 1WX9A 1WJUA 3JSVA 4W9KA 2NVUI 3DVNV 2CKHB 3MTNB 3B1LX 1TTNA 1WE7A 4YL8A 2IYDB 2KDBA 4M0WB 4GXBA 1WGDA 3V62A 4E74A 2KFKB 3B0AA 1SIFA 2N7EA 3ENEA 3IFWB 2MRPA 4ICUA 3U7DA 4KDLB 4PS7A 1WX7A 2AL6A 5J18A 3UQAA 4NPNA 1RFAA 2LWPA 2LZ6A 3QJZA 5AZFA 3ZNID 2BKFA 4IW0A 2K39A 3L10B 1TBEA 4MGYE 2C60A 4B9KA 2FCNA 4I6NB 3UGBB 2D2QA 1WRDB 2LVOA 3ZVVA 3KYCD 3CSTA 4BOZB 5BO4B 3DBHI 2R2OA 4MGZE 2LUEA 3TL5A 2DYMA 5GMVA 2KOXA 4ZDVA 4ZRIA 3A1QB 4WWNA 4MGIE 3R7QA 1E8YA 1UZXB 1VD2A 2CU1A 2KC2A 2PE9A 2GBMA 3UINB 3A9JA 3WIMA 3RZFA 4DHJB 2G3QB 4BBNC 3GOEA 3NOBA 3ZTDA 4BVUC 3L17A 2FCMA 2NBUA 2DAFA 3L13A 2C9WB 2N9EB 4G3XB 4A3PA 3PZDA 1WXSA 2DHZA 4KIKA 3DBRI 2LGDA 4IM2A 4MM3A 3DPDA 3N32A 4DHJD 4FBJB 5G2NA 2K25A 1ZKHA 3VHTC 3X0WA 2EKEC 4FA6A 2L76A 3QARA 5JHAA 2BWFA 2LVPA 4EFOA 2KC1A 3VXWA 3DVGY 1WGYA 4W9CA 1C1YB 4BKTA 4XX5A 3PVLA 2GBKA 2KHWB 1IPGA 3QQ8B 3V61A 4HCNB 5CHFA 3UQBA 2K1FA 2MBOA 2NS5A 3HM3A 2D07B 2JXXA 2LGYA 5J17A 2KQSA 4K7UA 4IM3A 1VCBA 2FNJB 4NJ6A 2MQJA 3A33B 1LM8B 2QHOA 3WAPA 2XEWA 4IG7B 1P9DU 3MJWA 3APCA 3Q3FA 4DWFA 3VTVA 2M1MA 2FCQA 2KQ7A 3DDCB 4WQOB 3SD5A 2KX3A 2KO3A 2RPQA 2ZCCA 3PTFC 2JVCA 4HJKA 3EECA 1QZEA 4IUMB 3ZKJC 3QX1A 4KSKC 1GJZA 2ZNVC 2BKRB 2AYOB 3APDA 3ZRFA 3ZNZB 1EF1A 4IC7B 3KVFB 3WAMA 3M63B 1UGMA 2A4ZA 1RAXA 2Z0DB 3NZUA 3ZO5B 4AUQC 2CHXA 2DYBA 1J8CA 3VAWA 3DCGA 2DAJA 4FHKA 2I1JA 4G11A 4HPMB 3M3JA 2WYQA 4E3CA 3S2AA 4CYEA 2JZZA 2KMCA 2UYZB 3HHMA 3HM6X 4EZKA 3I3TB 3PRZA 4PYUA 3ML8A 2PJHA 1KLVA 4N9F4 3VQIA 3VUYA 2RD0A 1WZ0A 3IHPC 4B95A 3EFUA 4MSQB 4NAWB 3AXCA 3TBLD 2KKCA 2C7HA 2K6DB 3TMPB 4ANUA 1WR1A 5LLIA 2KMAA 2DENB 3NZSA 3H7PA 2HE7A 2O6VD 4JLCA 3WAOA 4RM9A 4IWQA 3U8ZA 2IY0B 4DBGA 1OEYJ 3RZWC 2G4DB 1E5WA 3QC8B 3RUIB 4JQWC 4BKSD 4W9LA 4AJWA 2KJHB 1UH6A 4LJOB 2KTRA 2JY6A 2PEAA 3A9JB 3UIPB 2KD0A 1WXAA 3W1YA 5LXIB 2BF8B 1WY8A 2WWZA 3WALA 2DZJA 1L7YA 2KTFA 2N1WA 4FULA 5AEKB 3IBEA 3M62B 3OJ4B 2KWUB 4MELA 3PS6A 2KWVB 1GUAB 4KIKB 2IO1B 2JF5A 1E7UA 1J19A 2JZ3B 2MX2A 1OEYA 2O2VB 1E8ZA 1V86A 4W9GA 3K9OB 1UD7A 2ZNVB 4BBNF 2R2QA 3KUZA 4WWOA 2DYOA 4HDQA 4OVUA 3ZRCA 2ZPNA 3W1SA 5G55A 4MJSA 3BINA 1V9JA 1WJ4A 4NQKE 4G50A 2FAZA 2MBHA 2ZCBA 4AJYB 1ISNA 3RULA 4FLHA 3DOWA 4BFRA 5D2MB 3HK0A 3RCZA 3PRPB 2BYVE 4NY0A 1K8RB 1TGZB 4NJ7A 4AP4C 1T0YA 3IG3A 4KVGB 1I42A 3MHSD 3IVFA 5HKHA 4GSWA 2K8CA 4HXDA 5JHBA 3H6NA 3VTUA 2IO0B 3W1SC 4GIVA 5D94A 5E6NA 1XT9B 1WR6E 3RD2A 2JT4B 3PGEA 2KLCA 2CHZA 4FHJA 2LJ5A 3RT3B 2L05A 4W9FA 3PHWB 3CF6E 4GB9A 4W9JA 1WMHA 2XBBC 2IZVB 5J2RA 1SGHA 3PRMB 4DK5A 2M17A 1WE6A 2L0TA 4FADA 3ZW3A 1EF5A 5JH5C 2WX0A 3V6CB 1KM7A 3V6EB 3PHXB 3L0WB 2LRWA 4GDLB 2KN5A 2KJ6A 4URKA 4G0NB 2XK5A 3H7PB 1RLFA 5DPTA 3EC8A 2J7QB 3AULA 3ML9A 4KV2A 4TV3A 1C3TA 1Z2MA 2MSED 4A3OA 3KW5B 1U4AA 4K81A 3EHVA 1NBFC 2D10A 4ANXA 3H9DA 2Y5BB 3R66C 3ZTCA 3JW0X 4W9IA 3VTWA 3KUCB 4II2B 3KUDB 3OAWA 4WJNA 1UELA 2KXJA 2LXCA 2MP2A 2DZMA 3JSVB 3VUWA 2ZZPB 2ZJDA 3QIJA 4E71A 2A5UA 4GOCA 4EOYA 2MWSB 3H7SA 2N7DA 3QCAA 3RYTA 3WANA 4TUUA 2PE6B 3A4SC 3VH4B 1E90A 2V4LA 1XD3B 1WF9A 2PPHA 1WIAA 1V2YA 3NHEB 1WX8A 4KDIC 4EEWA 4ZRJA 4DDID 5CHWA 5IAAC 4HLEA 4DDGD 5D6JB 3DQVA 3UF8A 2REXA 5E6PA 1YX6B 2KJRA 3QA8A 3T9LA 4F1SA 3SU8X 3JYUA 5CTRC 2KWCA 4IM0A 2GBJA 4ZRKA 3NY5A 4F7ZA 1CMXB 2KFJA 4KZCA 1WJNA 5KHOA 1KJTA 1YJ1A 4WJOA 4TQ0A 5L83A 4A20A 1P0RA 3T8MA 3PV1A 4I6LB 2IBIB 4HWIB 2DX5B 2V1YA 2NBWB 2W9NA 3QAQA 4WAAA 4PS8A 5DPSA 3AU5A 3A1QA 5C1ZA 2C5LC 4K7SA 2KNBA 2FUHB 1M94A 1P3QU 2DZIA 1WMHB 3OLMD 3ONSA 2KLGA 4X57B 3PLUA 4KZ0A 1A5RA 1D3ZA 1E7VA 1E8WA 2Z59B 1Q1OA 5C23A 2HD5B 4HK2A 1P1AA 2JWZA 2IO2B 2OOBB 4KSLC 2ZVOA 4EKUA 1WH3A 2FCSA 1SE9A 1ZGUB 4ZYNA 4GGQA 1X1MA 4MEMA 3BY4B 3X23A 3LJ3A 1TZ1A 1Y8RC 3N30A 2NPTA 4CO7A 2HTHA 3C0RB 1UBQA 1WFYA 2HJ8A 1LQBA 2GMIC 3Q3JA 5DPRA 4LDTB 2EMSA 4EUTA 1R4MI 3HIZA 5D7GA 2BPSA 3H1UA 2WX1A 1LFDA 2RGFA 1I35A 3QHTA 2L0FA 3DVNU 3PPAA 3KH0A 3LDZE 4MH0E 3TIXA 3ZUNA 2BYFA 3AU4A 4W9EA 4LDTD 2KDIA 2C7NB 1L2NA 2AWTA 5DCNA 3UIOB 3OJ3A 3PSEB 4GDKA 1WM2A 5FR6A 2D3GA 2FIDA 2KK8A 3ZNHB 2EMTA 4EZLA 2CHWA 4XC2A 1ZW7A 2BGFA 2MP2B 3N3KB 5CHVC 2UWQA 2WDTB 2N9XA 1LXDA 5L95C 1IP9A 3VFKA 1YQBA 2JUOA 5JZEB 1WXVA 2FIFA 2N9PC 3A4RA 1WYWB 2L00B 4FN2A 2Z0EB 4JGHB 3R7RA 2YLMA 1S1QB 3VUXA 2L7RA 3A9KA 2MBEA 3ZLZA 3PREA 2KDFB 1NDDA 2L3ZA 2GOWA 2RR9A 1YD8U 2O6VA 3R3MA 2YVCA 2BWES 2G4SA 4NAWA 1PQSA 1V5TA 4WJPA 4FJYA 2CS4A 1J0GA 1V80A 4BKSA 2MA9B 4P7IA 4MGKE 5KHQA 3L08A 3B08A 3AI5A 1EUVB 2KTRB 1AARA 4NNJB 2LI5A 4B6WA 1GNUA 4M8NA 4II3B 2M0XA 3WA0A 3D32A 4GMVA 1YX5B 4MDKE 4AWJA 1KOTA 1OGWA 2M4NA 1GC6A 3SHQA 2K8HA 4CHKA 3ECIA 1V6EA 2JRHA 1YIWA 4LCDE 1IYFA 4FJVB 2O2VA 3V60A 2LVQA 3ZDMC 1E8XA 2B3AA 4ANWA 1V5OA 2L8JA 2NPTB 3L54A 4ANVA 3JVZX 2LD9A 2NR2A 4DXAB 4LJPB 3NS8A 2KFKA 1BT0A 2AL3A 3DVGX 4I6PA 4MJSB 1WM3A 4PS3A 1MG8A 2K6QA 3ZNGC 2MW5A 2N4FA 2KZRA 3QK0A 1WGRA 4JL9A 1Q0WB 4F8CB 3ALBA 4GDKB 3PT2B 2V3SA 2VRRB 1EO6A 3ZDTA 1WI0A 2RSUA 2NBVB 1P98A 4ICVA 2IY1B 1V81A 4GU2A 1R4NI 4J6IA 1Z5SB 2GBRA 4NQLB 3QWZB 2I1KA 1G6JA 3M95A 2LGXA 3VVWB 2KX0A 4K7WA 4OVVA 2MBBB 2ZVNA 3GZNI 2LASA 4TKNA 3DBSA 5EDSA 2J0MA 1WGHA 3CMMB 3PLVA 4HCPB 2DZKA 3U30A 4JIOU 3VDZA 4ASWC 4GN1A 2CR5A 5CX3A 1XQQA 1H4RA 3TJPA 5IA7A 4HDOA 1JRUA 3A9KB 4M8MA 1WGGA 1WJ6A 5E6OA 3CSFA 4W9HA 4DHZE 2D11A 2O6VB 4AOFA 1FXTB 3KYDD 3DBLI 4IWPA 2KDEB 4EZJA 2KVRA 3APFA 1OQYA 4GDLA 4BOSC 1UBIA 5TR5A 2IO3B 3TCAA 4WWPA 4BKGA 2G45B 2ZEQA 3P2BA 2MCNB 2LXAA 2NCNA 1F9JA 3ZIMA 2XK5B 4HVBA 2LRUA 2N1VA
chains in the Genus database with same CATH superfamily
4WJQA 2M8SA 4HPLB 1OTRB 4RM8A 2BB6A 2YEPB 2JRIB 1SJHD 4PYZA 1PDXA 2C7MB 4ZRQA 5DPWA 1P7EA 1UNSA 1T0QC 1TKYA 3L16A 1V49A 4JX1C 1BUIC 3HRDD 4XZ4A 1GG3A 4DHZB 2BYEA 3MTNB 3B1LX 2LGSA 3AE1B 3BK1A 4M0WB 4GXBA 4E74A 3IFWB 2V4IB 2N9LA 2AL6A 2JWUA 5AZFA 2BW2A 1AWDA 2QSDA 1JQ4A 4ZRPA 4I6NB 2LGIA 2WGSA 1WRDB 2LVOA 1C77A 4BOZB 4AS1A 2LUEA 2DYMA 5GMVA 2LJIA 1I4QA 1E8YA 2PE9A 2GRIA 1N63A 3NVYA 4BBNC 3ZTDA 4BVUC 2FCMA 3LXFA 2C9WB 1EM7A 4MM3A 4AQ7A 4IM2A 2K25A 1ZKHA 3VHTC 2L76A 1J7BA 5JHAA 2LVPA 3VXWA 2K3UA 1C1YB 3QQ8B 3UQBA 4HCNB 5BYRA 3HM3A 1L0VB 2D07B 5EE0A 5J17A 2JU6X 1VCBA 2JSVX 3NJTA 1LM8B 2QHOA 3WAPA 1P9DU 4DWFA 3VTVA 2JYEA 2FCQA 1TS4A 4A90A 2KQ7A 3DDCB 4WQOB 1SEBD 1HTOA 2JVCA 1QZEA 3ZNZB 1A70A 2KACA 2Z0DB 1D4BA 3AE2B 3NZUA 1J8CA 4E3CA 3HHMA 3HM6X 3KLSX 3PRZA 4PYUA 3VUYA 2EELA 1TZOA 5FKAC 4MSQB 4NAWB 3AXCA 2G1EA 3TMPB 1E9MA 4ANUA 5LLIA 2O6VD 2KN4A 1ET6A 3DHIC 2IY0B 4JPSA 3AH7A 4US9A 3RUIB 4JQWC 1JWSD 4BKSD 1D6EC 4LJOB 1ACCA 2KTRA 3UIPB 1NYQA 2I2YA 1WXAA 3W1YA 3RNEC 2BF8B 1WY8A 3HVZA 4MELA 1GOZA 3ZGZA 2KWUB 1T0RC 1L6VA 2MX2A 1OEYA 1NI3A 1V86A 2KDMA 1SF0A 4BBNF 3KUZA 3OG5A 4OVUA 3ZRCA 1QKZA 3W1SA 1C78A 1V9JA 2WXRA 3V05A 4N6EB 4XYCA 4M01A 3TEYA 1ISNA 1OFFA 2WXQA 5D2MB 3HK0A 3RCZA 2PTLA 4NJ7A 3IG3A 4GSWA 2BTEA 1UWMA 2IO0B 2EKIA 5D94A 1WR6E 2KLCA 3EGRA 2CHZA 2LJ5A 3CF6E 2XBBC 2IZVB 1SGHA 3AE7B 2M17A 5G5HA 1EF5A 3PHXB 4L1BA 3H7PB 2JZPA 1RLFA 3RNFC 1ET9A 3ZJUA 4KV2A 4TV3A 1C3TA 1LGRA 3KW5B 2PMVA 3N1ZC 1ZP0B 1CK1A 4QAYA 2INCC 2D3CA 3ZTCA 1DGJA 3LB8C 2K5PA 4KKIA 3Q8BA 2KXJA 2LHEA 4MH8A 4P16A 2ZZPB 2ZJDA 2A5UA 4GOCA 3H7SA 2PE6B 3A4SC 1E90A 1WF9A 2IDYA 1WX8A 5CHWA 5IAAC 3DQVA 2REXA 4F1SA 1YX6B 2KJRA 5CTRC 3NY5A 1FIQA 3AE3B 2V3NA 4WJOA 4A20A 3T8MA 1QOGA 2DX5B 3RI7C 5C1ZA 4S17A 1JROA 2KNBA 3ZJTA 3ONSA 1A5RA 1C76A 1E8WA 3NUHB 1P1AA 3W5UB 3AE4B 3BIID 4N59A 2FCSA 1SE9A 1ZGUB 3AEDB 4ZYNA 4MEMA 3X23A 2NPTA 5HHDG 1C4CA 1CJEA 1LQBA 1L6UA 2VH1A 4LDTB 5D7GA 3H1UA 2RGFA 3PPAA 3LDZE 4MH0E 2JQRB 4OHJA 4P1CC 5I4DA 5G5GA 3AU4A 1ZDVA 3EFCA 4KKJA 1TIFA 5DCNA 3OJ3A 1FM0D 2WXHA 5FR6A 2FIDA 4EZLA 2EMTA 1ZW7A 4HKZE 1N60A 3N3KB 1I4RA 2N9XA 3GB1A 4TSSA 5L95C 1P7FA 1YQBA 2JUOA 1WXVA 3A4RA 1NVID 1HA5A 5T8IA 2MH7A 2MBEA 3PREA 3RFZB 4NAWA 1ZPSA 1V5TA 2V3PA 3Q8EA 1JCKB 1ZDXA 3AI5A 4C80A 3Q3NC 4ZOHC 2LI5A 4M8NA 4AWJA 2JX5A 1I4HA 1JWUD 2RDHA 2M4NA 1N5WA 1IYFA 4FJVB 3ZDMC 2B3AA 1OQQA 1C4AA 4A9AA 1RWSA 4ANVA 3JVZX 4DXAB 4M02A 2KFKA 2J4XA 4MJSB 1V1OA 3TEWA 1JW9D 1MG8A 2K6QA 3ZNGC 1QILA 2N4FA 2KZRA 3AMZA 1Q0WB 4GDKB 3PT2B 2VRRB 2NBVB 4ICVA 2IY1B 1R4NI 3U52E 2I1KA 1G6JA 2V9HA 1C79A 3CMMB 2Y5CA 3PLVA 4A8XC 2Y5PA 1VZ6A 1WXQA 4W9HA 2O6VB 4AOFA 4IWPA 2IJ0A 1OQYA 1UBIA 5E6JA 1HTQA 3ZIMA 1AW7A 2Q5WD 2XK5B 2WXOA 2N1VA 3GE8C 1OQRA 2INNE 4IWOA 3LYYA 2K8BA 2MBQA 2GBNA 4FJZA 1PGAA 2V0GA 4K1RB 2GB1A 5AZHA 4KGSA 1S3SG 4MACA 2ZW0A 1WX9A 3TEXA 2ONQA 2DBYA 1GB1A 2NVUI 3DVNV 3EUB2 2CKHB 1MJDA 1WE7A 2NTSA 2INDC 4YL8A 2INPE 1WGDA 1SIFA 2N7EA 4ICUA 2MRPA 3I5JC 4PS7A 5J18A 1VR9A 2LWPA 2PKOA 2BKFA 2K39A 4DXGA 4MGYE 1WWTA 1WRIA 5AUKA 3CSTA 5BO4B 3Q8AA 1ESFA 3WCQA 4MGZE 1MHXA 4J3OD 4ZRIA 4WWNA 2L83A 1UZXB 1E6EB 1VD2A 2CU1A 1KFYB 1YQ4B 3UINB 3A9JA 3RZFA 4HKQA 3GOEA 3NOBA 3L17A 1KTKA 5IO9A 4DHJD 4FBJB 3N32A 5G2NA 2PLPA 4LLGM 3NS1A 3X0WA 4P1BC 4FA6A 2BWFA 4HEA1 4EFOA 4C4VA 2QILA 2VH2A 1NEKB 1CQVA 1IPGA 2K1FA 2MBOA 1D5XC 3DWMA 2KQSA 4NJ6A 3A33B 2PVGC 4HROA 1FNVA 4IG7B 3Q3FA 3APCA 5H8YE 2KVZA 4KGTA 2KX3A 4IUMB 2QJLA 1IBXB 2AYOB 1EF1A 3KVFB 1K51A 1RAXA 3ZO5B 4AUQC 2DYBA 2DAJA 2QCZA 3M3JA 3MFGA 4EZKA 4NZLB 3ML8A 4RGNA 2N7JA 4JE3B 1SBBB 2C7HA 1WR1A 3U8ZA 4DBGA 4ARCA 2G4DB 1E5WA 3QC8B 2AX5A 1XEEA 1KF6B 2JY6A 2KD0A 3AEAB 1I4XA 5LXIB 1L7YA 2N1WA 2LFIA 3PS6A 2KWVB 1GUAB 4KIKB 3SFEB 2IO1B 2CU3A 1J19A 4LK0M 1VZ8A 1YJJA 2WU2B 3K9OB 2ZNVB 1TS3A 4HDQA 1MHHE 2ZPNA 3BYYB 4MJSA 3BINA 1JMLA 3URYA 4AJYB 1EWYC 4FLHA 1QOBA 4RFBA 4EE2A 4BFRA 2L32A 4XWWA 3PRPB 4NY0A 1TGZB 4AP4C 4KVGB 3MHSD 3IVFA 1V1PB 5HKHA 4HXDA 4S0RA 1HZ6A 5E6NA 2KQ4X 3RD2A 3RT3B 2L05A 4W9JA 1WMHA 2W82A 5J2RA 1K52A 3MJ5A 4FADA 3V6EB 3RNCC 3TSSA 4GDLB 2KJ6A 3HVDA 1ROEA 4G0NB 2XK5A 1GB4A 4XGAB 3CWIA 3AB5A 5IOIA 3EHVA 4BAXA 2D10A 3P4RB 3R66C 2BYTA 3JW0X 4W9IA 3KUDB 4YT0B 1UELA 2HDEA 2LXCA 1FCCC 1FXIA 5EE3A 3JSVB 3AECB 3DBLB 3SFDB 2FE8A 2XNAC 1PYWD 5MPOA 1L5PA 4YTPB 2N7DA 3QCAA 3WANA 3GS2A 3OWEB 3VH4B 1UWXA 3R2IA 3P42A 4DDGD 5D6JB 2BVCA 1WYGA 2RDGA 3UF8A 1J7CA 5E6PA 4YTNB 1AN8A 3T9LA 2XN9C 2WXMA 3JYUA 1XLPA 2KWCA 1QT9A 1CMXB 4KZCA 1WJNA 1T5XD 1KJTA 1YJ1A 2D3BA 4TQ0A 1DOXA 1P0RA 3PV1A 4HWIB 1YN4A 5DPSA 2FUG1 3QAQA 4WAAA 4PS8A 1E7PB 2C5LC 3P1MA 1YJIA 2DZIA 2FUHB 4JWSC 4X57B 3OLMD 1E7VA 3ZQ4A 1PGBA 2IO2B 4KSLC 5HI1A 2PIAA 4YWGG 5FR3A 2N0SB 4GGQA 4XWTA 2HTHA 2OEDA 2HJ8A 3Q3JA 2DLBA 3HIZA 5BMHA 2BPSA 1I35A 2WX1A 2RDBC 4O1NA 2L0FA 1F1HA 3DBHB 2BYFA 1L0YB 2KDIA 2VZKD 3UIOB 1WM2A 3R8BA 2BGFA 2MP2B 3ABVB 2WDTB 1L4ZB 3IAS1 1B1ZA 4FN2A 1QF6A 4JGHB 2HJ1A 3Q3MC 2LMCA 3VUXA 4YSYB 3A9KA 3Q69A 3ZLZA 2KDFB 2RR9A 2L3ZA 2GOWA 3U7ZA 2LHDA 2YVCA 1PQSA 2CS4A 1V80A 3B9JA 4XDCA 3Q2AC 2MA9B 3U4EG 5KHQA 1FMAD 3BVZA 5EE1A 4NNJB 2OHFA 2AQ2B 1GNUA 1PGXA 4II3B 2M0XA 3WA0A 3D32A 4GMVA 1VJKA 1KOTA 3MC8A 1V6EA 5JXVA 2L1AA 5IN7A 5C3JB 1E8XA 4L23A 1V5OA 2L8JA 3W9CB 2BS3B 3UI3A 2LD9A 2X8XX 4M0WA 1BT0A 2AL3A 3I9V1 4PS3A 1IGCA 3QK0A 4F8CB 3VRBB 1D5ZC 1WI0A 2IGHA 1V81A 4GU2A 4RCOA 2WS3B 2LGXA 1V1PA 3VVWB 1KH0A 4K7WA 2PW9A 4OVVA 5D3IB 2LASA 3NRZA 1RM6C 4US8A 4HCPB 3VDZA 4ASWC 4GN1A 3RPFC 5IA7A 2BB5A 4LNIA 1JRUA 1WGGA 1V97A 1FXTB 3SR6A 4GDLA 4BOSC 2IO3B 3TCAA 4WWPA 2G45B 2ZEQA 2NCNA 1VDVA 2LRUA 1J0GA 5AZGA 4EEWA 2MLBA 2GI9A 2J0KA 2UU7A 1WXMA 1SE4A 4MSMB 4RMAA 1HE8A 5LXHA 2N9KA 5EE9A 1FFUA 1K53A 1WZ3A 2B76B 1YN3A 2PVOD 3AEFB 4RF0A 2ASQA 3Q6BA 2JPHA 1JWAD 1RFKA 2KANA 4YTMB 3VR9B 2WU5B 3JSVA 3PZ7A 4C7ZA 2RPVA 1GPXA 4IDIA 3V62A 1XLOA 4M00A 3B0AA 3AN1A 3ENEA 3U7DA 4KDLB 1WX7A 1QLBB 4NPNA 2LZ6A 1FCLA 4IW0A 1SXTA 1HZ5A 3L10B 1TBEA 2C60A 4B9KA 2D2QA 5AUIA 2WLBA 3ZVVA 3DHHC 3KYCD 2R2OA 4WAFA 2JYTA 4ZDVA 3BZDB 4KGRA 2WHIA 2HTME 3WIMA 3GP7A 2W54A 5C2TB 2DAFA 4G3XB 1QQRA 1I7HA 4HJGE 3DPDA 2EKEC 3QARA 2NTTA 2KC1A 3DVGY 1WGYA 4BKTA 3R2TA 2GBKA 3V61A 1TYGB 4IM3A 2FNJB 3ETRA 4LNKA 2XEWA 2M1MA 2IGDA 4D2KA 1KLGD 1SJED 4ZHPA 2ZCCA 3PTFC 3ZKJC 3MC9A 3EECA 1GJZA 1D5MC 1FNUA 2ZNVC 3APDA 3KWVA 1MI0A 3WAMA 2Z8LA 3DCGA 2I1JA 1R4MB 3O13A 4IKGA 3S2AA 2JZZA 3I3TB 5IP4D 3C8YA 4N9F4 2RD0A 4C7YA 1RYJA 1WZ0A 2QEJC 1YOVB 3IHPC 4B95A 3EFUA 2KKCA 2DENB 3H7PA 2HE7A 4JLCA 1YNTE 4IWQA 1KRHA 1OEYJ 3RZWC 1VZ7A 2WQYB 2MJ3A 1FEHA 2KMMA 1TY2A 2PEAA 4XE0A 4A55A 2I38A 4LNOA 3MC0B 2WWZA 2DZJA 2KTFA 5AEKB 2JF5A 4A6QA 1WGKA 1BXTA 4H2AA 1UD7A 2R2QA 4WWOA 2DYOA 4ACFA 2KWDA 4NQKE 1WJ4A 2FAZA 2MBHA 2ZCBA 2IGGA 3DOWA 3P4PB 1Y56A 2YEPF 1T3QA 1K8RB 1T0YA 1PUTA 3ZXRA 3N20C 3VTUA 1TS5A 4GIVA 2WXIA 1ENFA 2JT4B 3FKYA 4W9FA 4YSXB 3W5VB 1FPYA 3PRMB 4WIPA 4DK5A 2WXGA 3L0WB 2BQQA 2KN5A 4URKA 2MHJA 3EC8A 1AYFA 3DHGC 3ML9A 1Z2MA 2MSED 4A3OA 3Q8CA 1U4AA 4OVZA 4K81A 1NBFC 2H88B 3GZNB 4JWUC 4ANXA 2R61A 1VLBA 4KX6B 3VTWA 3KUCB 3OAWA 4WJNA 5D3DA 2WXPA 2DZMA 3N1YC 3VUWA 2SEBD 1E0ZA 3QIJA 1HEZE 4LNNA 4BZAA 3SEBA 2MWSB 3RYTA 3N1XC 2QIEB 2V4LA 3Q8FA 1XXGA 1V2YA 2TSSA 2MJDA 4DDID 1T6BX 4HLEA 1DOIA 3QA8A 1BMLC 3VRAB 4IM0A 1FNWA 2GBJA 4F7ZA 1MG4A 1N61A 5KHOA 3BVMA 5L83A 2IBIB 2ICIA 1KLUD 2NBWB 2V1YA 2W9NA 2BS4B 3AU5A 5HG2A 2WXFA 2BBCA 2J53A 1M94A 1P3QU 3P63A 2RMMA 2KLGA 3GE3C 3PLUA 4KZ0A 1D3ZA 1N62A 4C00A 1Q1OA 5C23A 2HD5B 4HK2A 2OOBB 2ZVOA 4EKUA 2BT6A 2W3SA 4ARIA 3P4SB 2KT7A 1EWCA 3BY4B 1Y8RC 3C0RB 1UBQA 1KLVA 2GMIC 3FILB 5DPRA 4EUTA 1LFDA 1TKGA 3QHTA 3KH0A 1SE2A 3B2FA 4W9EA 4LDTD 2C7NB 4RGMA 4GDKA 2D3GA 1XLQA 3PO0A 3U2SC 3ZNHB 1N6ZA 2CHWA 4XC2A 1YN5A 1FO4A 5CHVC 5H92C 4OZCA 2WDRB 3VFKA 3CIRB 2FIFA 2N9PC 1GAQB 1WYWB 2Z0EB 2E6XA 1TKEA 3R7RA 2YLMA 2AQ1B 1ZUD2 2K0PA 2L7RA 3BWUD 2LEKA 1YD8U 2O6VA 3R3MA 2BWES 4WJPA 4C56C 4FJYA 3W2DA 4BKSA 1FRDA 4B0EA 4WURA 4MGKE 3L08A 3B08A 1AARA 4B6WA 3BVGA 3E9SA 4K3CA 1C9FA 4GLSC 4OW0A 1F77A 1SIJA 1GC6A 2E3TA 4CHKA 2JRHA 2WXLA 2LVQA 4ANWA 3T3NA 2NPTB 3IT4B 3L54A 4USAA 4ITKA 3NS8A 1XLNA 4I6PA 4HRSA 1WM3A 3H8HA 2MW5A 3AEGB 1WGRA 4JL9A 3ALBA 2V3SA 3ZDTA 2CJOA 1P98A 3N9YC 2OJWA 4J6IA 4NQLB 2GBRA 3TUOA 1L4DB 3M95A 2D3AA 2MJEA 3AE6B 2KX0A 4OZAA 2MBBB 4TKNA 2J0MA 3U30A 4JIOU 5CX3A 1XQQA 3TJPA 1QOFA 4HDOA 5E6OA 3DWGC 4DHZE 1NYRA 4R3DA 3KYDD 3DBLI 3Q14C 5TSSA 2KDEB 4EZJA 2KVRA 2ZW1A 3P2BA 2MCNB 4RNAA 4HVBA 3MP9A 2AEHA 1RRBA 4HPPA 1I4PA 1NI2A 1GC7A 3VH3B 1H8CA 2L52A 4W9DA 4TQ1A 1Q5WB 4NJCA 2J52A 4PT5A 3K9PB 2ZPYA 3SDLC 2J0JA 3O65B 2OJRA 3VR8B 1WJUA 4W9KA 5BMGA 1IBXA 1TTNA 4K3BA 2IYDB 2KDBA 3DBRB 1XCTL 2D5GA 2KFKB 3UQAA 3I57A 1RFAA 3QJZA 3ZNID 4CQNA 2FBWB 2FCNA 3UGBB 1J7AA 3NG0A 1R7SA 1YMHE 3DBHI 3AM9A 3TL5A 3KWLA 1M4VA 2KOXA 3A1QB 4RF1A 4MGIE 3R7QA 2KC2A 4PK1A 3P4QB 2GBMA 1NENB 1N5XA 4MT5A 5FK9C 4DHJB 4RGTA 4N58A 1QOAA 2G3QB 2DNFA 1JWMD 2NBUA 3L13A 4A3PA 2N9EB 1DOYA 3PZDA 1WXSA 2DHZA 4KIKA 3DBRI 2LGDA 1IGDA 2WXJA 3FILA 1Q10A 4W9CA 5BYQA 2W3RA 4XX5A 3PVLA 2KHWB 5CHFA 2NS5A 1PFDA 2JXXA 2LUMA 2LGYA 3B2GA 1JWBD 4K7UA 2MQJA 2ACZB 3RN9C 2CJNA 3MJWA 1XO3A 3SD5A 2KO3A 2RPQA 4HJKA 3QX1A 4KSKC 2BKRB 3ZRFA 4IC7B 3EA6A 3M63B 1UGMA 4DXFA 2A4ZA 2CHXA 3VAWA 2NMQA 4FHKA 4HPMB 4G11A 1XCQL 1VRAB 2WYQA 4CYEA 2KMCA 2UYZB 2PJHA 3VQIA 4ZYSA 4IOIE 3RNBC 3KQ4A 1SE3A 3AE8B 3TBLD 2K6DB 2KMAA 3NZSA 3AE5B 3WAOA 4RM9A 2MEKA 1FRRA 2W55A 4W9LA 1MFWA 3AV8A 2KJHB 4AJWA 1UH6A 3A9JB 4FXCA 2X38A 3C19A 3WALA 2SAKA 4FULA 4YXDB 3IBEA 3M62B 3OJ4B 1E7UA 2JZ3B 2ON8A 2O2VB 1E8ZA 3BYTB 2JXTA 4W9GA 5GXGB 3NZ3A 4C4VB 2M56B 5G55A 3T3OA 2WXNA 1JRPA 1HQRD 4G50A 3Q3OC 1TY0A 2QDFA 1TT5B 3RULA 4WWMA 4L2YA 1F2RC 1SSNA 1EU4A 2BYVE 4UDUC 2K9XA 2DWQA 1I42A 4Q2JA 2K8CA 2WDVB 2WDQB 5JHBA 3H6NA 3W1SC 3L4PA 1XT9B 5LNK1 3PGEA 1L0XB 3E56A 4FHJA 3IAM1 3PHWB 4GB9A 1ZXIA 1WE6A 2L0TA 3V3XA 3ZW3A 3HUIA 5JH5C 2WX0A 1C4PA 1KM7A 2K22A 3V6CB 2GLSA 2LRWA 3PZ8A 4ZHOA 5DPTA 2J7QB 3AULA 1R4NB 3NVWA 3RNAC 3BK2A 1E10A 3H9DA 2Y5BB 4OZBA 3FC4A 4II2B 1EU3A 3IT6B 1ZXHA 1DYQA 2MP2A 3FAHA 1CZPA 4TMAB 4E71A 2M0AA 4EOYA 1F0ZA 1JALA 4TUUA 1UF0A 1XD3B 2PPHA 1WIAA 3NHEB 4KDIC 4ZRJA 4NAMA 3I63C 2WP9B 1F52A 3SU8X 4ZRKA 1V8CA 1YQ3B 3RNGC 2KFJA 1IUEA 2IPKD 2BS2B 1TJEA 4I6LB 2KYWA 2Y3AA 3A1QA 4K7SA 1FFVA 1WMHB 3TEZA 3AEEB 3NVVA 2Z59B 3NVZA 1T0SC 2JWZA 1MVKA 1WH3A 4LNFA 4MM3B 4P6VF 1WSPA 1X1MA 3LJ3A 1TZ1A 3N30A 4CO7A 1MPEA 1WFYA 4LTUA 2EMSA 2VZKB 1R4MI 3DVNU 3TIXA 3ZUNA 3J9CA 1UGJA 1L2NA 2AWTA 3PSEB 3AEBB 4DQOC 1FD6A 2KK8A 1STEA 4WQMA 2UWQA 1K50A 3ZJVA 1LXDA 1IP9A 2QMTA 5JZEB 2L00B 3AE9B 1B9RA 1S1QB 4REZA 4WH4A 1LO5D 4XDDA 1NDDA 2G4SA 2H89B 4P7IA 1UUPA 2WXKA 1FXAA 1SB3C 1EUVB 5BYSA 1XF5L 2KTRB 1I4GA 3ZYYX 4RGOS 1YX5B 3IXSA 4MDKE 1OGWA 3SHQA 2K8HA 2AQ3B 3ECIA 1YIWA 4LCDE 2O2VA 3V60A 2KAJA 2G9HD 1ZOYB 2NR2A 4LJPB 5IKCM 3MHZA 3DVGX 1TS2A 2QC8A 1EO6A 2RSUA 2M19A 1Z5SB 3QWZB 2J42A 2ZVNA 3GZNI 3RMKC 5BMIA 2WNMA 3DBSA 5EDSA 1WGHA 4RH6A 2DZKA 1ZE3D 2CR5A 1H4RA 1F2RI 3A9KB 4M8MA 1WJ6A 3CSFA 2D11A 3APFA 5TR5A 4BKGA 5HFYA 2LXAA 3ZXVA 1HXYD 1F9JA 4B0MA 4YSZB
chains in the Genus database with same CATH topology
2AEHA 1RRBA 4WJQA 1NI2A 5AZGA 2MLBA 4IWOA 2J0KA 2M8SA 1WXMA 4HPLB 1OTRB 4MSMB 4RMAA 1GC7A 4RM8A 2K8BA 1HE8A 5LXHA 2JRIB 4PYZA 2MBQA 2GBNA 3VH3B 2C7MB 1H8CA 4FJZA 4W9DA 1WZ3A 4TQ1A 5DPWA 1Q5WB 4K1RB 5AZHA 3K9PB 2ASQA 3L16A 1V49A 2JPHA 1S3SG 2ZPYA 3SDLC 2J0JA 2KANA 2OJRA 3O65B 4XZ4A 1GG3A 4DHZB 2BYEA 1WX9A 1WJUA 3JSVA 4W9KA 2NVUI 3DVNV 2CKHB 3MTNB 3B1LX 1TTNA 1WE7A 4YL8A 2IYDB 2KDBA 4M0WB 4GXBA 1WGDA 3V62A 4E74A 2KFKB 3B0AA 1SIFA 2N7EA 3ENEA 3IFWB 2MRPA 4ICUA 3U7DA 4KDLB 4PS7A 1WX7A 2AL6A 5J18A 3UQAA 4NPNA 1RFAA 2LWPA 2LZ6A 3QJZA 5AZFA 3ZNID 2BKFA 4IW0A 2K39A 3L10B 1TBEA 4MGYE 2C60A 4B9KA 2FCNA 4I6NB 3UGBB 2D2QA 1WRDB 2LVOA 3ZVVA 3KYCD 3CSTA 4BOZB 5BO4B 3DBHI 2R2OA 4MGZE 2LUEA 3TL5A 2DYMA 5GMVA 2KOXA 4ZDVA 4ZRIA 3A1QB 4WWNA 4MGIE 3R7QA 1E8YA 1UZXB 1VD2A 2CU1A 2KC2A 2PE9A 2GBMA 3UINB 3A9JA 3WIMA 3RZFA 4DHJB 2G3QB 4BBNC 3GOEA 3NOBA 3ZTDA 4BVUC 3L17A 2FCMA 2NBUA 2DAFA 3L13A 2C9WB 2N9EB 4G3XB 4A3PA 3PZDA 1WXSA 2DHZA 4KIKA 3DBRI 2LGDA 4IM2A 4MM3A 3DPDA 3N32A 4DHJD 4FBJB 5G2NA 2K25A 1ZKHA 3VHTC 3X0WA 2EKEC 4FA6A 2L76A 3QARA 5JHAA 2BWFA 2LVPA 4EFOA 2KC1A 3VXWA 3DVGY 1WGYA 4W9CA 1C1YB 4BKTA 4XX5A 3PVLA 2GBKA 2KHWB 1IPGA 3QQ8B 3V61A 4HCNB 5CHFA 3UQBA 2K1FA 2MBOA 2NS5A 3HM3A 2D07B 2JXXA 2LGYA 5J17A 2KQSA 4K7UA 4IM3A 1VCBA 2FNJB 4NJ6A 2MQJA 3A33B 1LM8B 2QHOA 3WAPA 2XEWA 4IG7B 1P9DU 3MJWA 3APCA 3Q3FA 4DWFA 3VTVA 2M1MA 2FCQA 2KQ7A 3DDCB 4WQOB 3SD5A 2KX3A 2KO3A 2RPQA 2ZCCA 3PTFC 2JVCA 4HJKA 3EECA 1QZEA 4IUMB 3ZKJC 3QX1A 4KSKC 1GJZA 2ZNVC 2BKRB 2AYOB 3APDA 3ZRFA 3ZNZB 1EF1A 4IC7B 3KVFB 3WAMA 3M63B 1UGMA 2A4ZA 1RAXA 2Z0DB 3NZUA 3ZO5B 4AUQC 2CHXA 2DYBA 1J8CA 3VAWA 3DCGA 2DAJA 4FHKA 2I1JA 4G11A 4HPMB 3M3JA 2WYQA 4E3CA 3S2AA 4CYEA 2JZZA 2KMCA 2UYZB 3HHMA 3HM6X 4EZKA 3I3TB 3PRZA 4PYUA 3ML8A 2PJHA 1KLVA 4N9F4 3VQIA 3VUYA 2RD0A 1WZ0A 3IHPC 4B95A 3EFUA 4MSQB 4NAWB 3AXCA 3TBLD 2KKCA 2C7HA 2K6DB 3TMPB 4ANUA 1WR1A 5LLIA 2KMAA 2DENB 3NZSA 3H7PA 2HE7A 2O6VD 4JLCA 3WAOA 4RM9A 4IWQA 3U8ZA 2IY0B 4DBGA 1OEYJ 3RZWC 2G4DB 1E5WA 3QC8B 3RUIB 4JQWC 4BKSD 4W9LA 4AJWA 2KJHB 1UH6A 4LJOB 2KTRA 2JY6A 2PEAA 3A9JB 3UIPB 2KD0A 1WXAA 3W1YA 5LXIB 2BF8B 1WY8A 2WWZA 3WALA 2DZJA 1L7YA 2KTFA 2N1WA 4FULA 5AEKB 3IBEA 3M62B 3OJ4B 2KWUB 4MELA 3PS6A 2KWVB 1GUAB 4KIKB 2IO1B 2JF5A 1E7UA 1J19A 2JZ3B 2MX2A 1OEYA 2O2VB 1E8ZA 1V86A 4W9GA 3K9OB 1UD7A 2ZNVB 4BBNF 2R2QA 3KUZA 4WWOA 2DYOA 4HDQA 4OVUA 3ZRCA 2ZPNA 3W1SA 5G55A 4MJSA 3BINA 1V9JA 1WJ4A 4NQKE 4G50A 2FAZA 2MBHA 2ZCBA 4AJYB 1ISNA 3RULA 4FLHA 3DOWA 4BFRA 5D2MB 3HK0A 3RCZA 3PRPB 2BYVE 4NY0A 1K8RB 1TGZB 4NJ7A 4AP4C 1T0YA 3IG3A 4KVGB 1I42A 3MHSD 3IVFA 5HKHA 4GSWA 2K8CA 4HXDA 5JHBA 3H6NA 3VTUA 2IO0B 3W1SC 4GIVA 5D94A 5E6NA 1XT9B 1WR6E 3RD2A 2JT4B 3PGEA 2KLCA 2CHZA 4FHJA 2LJ5A 3RT3B 2L05A 4W9FA 3PHWB 3CF6E 4GB9A 4W9JA 1WMHA 2XBBC 2IZVB 5J2RA 1SGHA 3PRMB 4DK5A 2M17A 1WE6A 2L0TA 4FADA 3ZW3A 1EF5A 5JH5C 2WX0A 3V6CB 1KM7A 3V6EB 3PHXB 3L0WB 2LRWA 4GDLB 2KN5A 2KJ6A 4URKA 4G0NB 2XK5A 3H7PB 1RLFA 5DPTA 3EC8A 2J7QB 3AULA 3ML9A 4KV2A 4TV3A 1C3TA 1Z2MA 2MSED 4A3OA 3KW5B 1U4AA 4K81A 3EHVA 1NBFC 2D10A 4ANXA 3H9DA 2Y5BB 3R66C 3ZTCA 3JW0X 4W9IA 3VTWA 3KUCB 4II2B 3KUDB 3OAWA 4WJNA 1UELA 2KXJA 2LXCA 2MP2A 2DZMA 3JSVB 3VUWA 2ZZPB 2ZJDA 3QIJA 4E71A 2A5UA 4GOCA 4EOYA 2MWSB 3H7SA 2N7DA 3QCAA 3RYTA 3WANA 4TUUA 2PE6B 3A4SC 3VH4B 1E90A 2V4LA 1XD3B 1WF9A 2PPHA 1WIAA 1V2YA 3NHEB 1WX8A 4KDIC 4EEWA 4ZRJA 4DDID 5CHWA 5IAAC 4HLEA 4DDGD 5D6JB 3DQVA 3UF8A 2REXA 5E6PA 1YX6B 2KJRA 3QA8A 3T9LA 4F1SA 3SU8X 3JYUA 5CTRC 2KWCA 4IM0A 2GBJA 4ZRKA 3NY5A 4F7ZA 1CMXB 2KFJA 4KZCA 1WJNA 5KHOA 1KJTA 1YJ1A 4WJOA 4TQ0A 5L83A 4A20A 1P0RA 3T8MA 3PV1A 4I6LB 2IBIB 4HWIB 2DX5B 2V1YA 2NBWB 2W9NA 3QAQA 4WAAA 4PS8A 5DPSA 3AU5A 3A1QA 5C1ZA 2C5LC 4K7SA 2KNBA 2FUHB 1M94A 1P3QU 2DZIA 1WMHB 3OLMD 3ONSA 2KLGA 4X57B 3PLUA 4KZ0A 1A5RA 1D3ZA 1E7VA 1E8WA 2Z59B 1Q1OA 5C23A 2HD5B 4HK2A 1P1AA 2JWZA 2IO2B 2OOBB 4KSLC 2ZVOA 4EKUA 1WH3A 2FCSA 1SE9A 1ZGUB 4ZYNA 4GGQA 1X1MA 4MEMA 3BY4B 3X23A 3LJ3A 1TZ1A 1Y8RC 3N30A 2NPTA 4CO7A 2HTHA 3C0RB 1UBQA 1WFYA 2HJ8A 1LQBA 2GMIC 3Q3JA 5DPRA 4LDTB 2EMSA 4EUTA 1R4MI 3HIZA 5D7GA 2BPSA 3H1UA 2WX1A 1LFDA 2RGFA 1I35A 3QHTA 2L0FA 3DVNU 3PPAA 3KH0A 3LDZE 4MH0E 3TIXA 3ZUNA 2BYFA 3AU4A 4W9EA 4LDTD 2KDIA 2C7NB 1L2NA 2AWTA 5DCNA 3UIOB 3OJ3A 3PSEB 4GDKA 1WM2A 5FR6A 2D3GA 2FIDA 2KK8A 3ZNHB 2EMTA 4EZLA 2CHWA 4XC2A 1ZW7A 2BGFA 2MP2B 3N3KB 5CHVC 2UWQA 2WDTB 2N9XA 1LXDA 5L95C 1IP9A 3VFKA 1YQBA 2JUOA 5JZEB 1WXVA 2FIFA 2N9PC 3A4RA 1WYWB 2L00B 4FN2A 2Z0EB 4JGHB 3R7RA 2YLMA 1S1QB 3VUXA 2L7RA 3A9KA 2MBEA 3ZLZA 3PREA 2KDFB 1NDDA 2L3ZA 2GOWA 2RR9A 1YD8U 2O6VA 3R3MA 2YVCA 2BWES 2G4SA 4NAWA 1PQSA 1V5TA 4WJPA 4FJYA 2CS4A 1J0GA 1V80A 4BKSA 2MA9B 4P7IA 4MGKE 5KHQA 3L08A 3B08A 3AI5A 1EUVB 2KTRB 1AARA 4NNJB 2LI5A 4B6WA 1GNUA 4M8NA 4II3B 2M0XA 3WA0A 3D32A 4GMVA 1YX5B 4MDKE 4AWJA 1KOTA 1OGWA 2M4NA 1GC6A 3SHQA 2K8HA 4CHKA 3ECIA 1V6EA 2JRHA 1YIWA 4LCDE 1IYFA 4FJVB 2O2VA 3V60A 2LVQA 3ZDMC 1E8XA 2B3AA 4ANWA 1V5OA 2L8JA 2NPTB 3L54A 4ANVA 3JVZX 2LD9A 2NR2A 4DXAB 4LJPB 3NS8A 2KFKA 1BT0A 2AL3A 3DVGX 4I6PA 4MJSB 1WM3A 4PS3A 1MG8A 2K6QA 3ZNGC 2MW5A 2N4FA 2KZRA 3QK0A 1WGRA 4JL9A 1Q0WB 4F8CB 3ALBA 4GDKB 3PT2B 2V3SA 2VRRB 1EO6A 3ZDTA 1WI0A 2RSUA 2NBVB 1P98A 4ICVA 2IY1B 1V81A 4GU2A 1R4NI 4J6IA 1Z5SB 2GBRA 4NQLB 3QWZB 2I1KA 1G6JA 3M95A 2LGXA 3VVWB 2KX0A 4K7WA 4OVVA 2MBBB 2ZVNA 3GZNI 2LASA 4TKNA 3DBSA 5EDSA 2J0MA 1WGHA 3CMMB 3PLVA 4HCPB 2DZKA 3U30A 4JIOU 3VDZA 4ASWC 4GN1A 2CR5A 5CX3A 1XQQA 1H4RA 3TJPA 5IA7A 4HDOA 1JRUA 3A9KB 4M8MA 1WGGA 1WJ6A 5E6OA 3CSFA 4W9HA 4DHZE 2D11A 2O6VB 4AOFA 1FXTB 3KYDD 3DBLI 4IWPA 2KDEB 4EZJA 2KVRA 3APFA 1OQYA 4GDLA 4BOSC 1UBIA 5TR5A 2IO3B 3TCAA 4WWPA 4BKGA 2G45B 2ZEQA 3P2BA 2MCNB 2LXAA 2NCNA 1F9JA 3ZIMA 2XK5B 4HVBA 2LRUA 2N1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  1RRB A;  4WJQ A;  1NI2 A;  5AZG A;  2MLB A;  4IWO A;  2J0K A;  2M8S A;  1WXM A;  4HPL B;  1OTR B;  4MSM B;  4RMA A;  1GC7 A;  4RM8 A;  2K8B A;  1HE8 A;  5LXH A;  2JRI B;  4PYZ A;  2MBQ A;  2GBN A;  3VH3 B;  2C7M B;  1H8C A;  4FJZ A;  4W9D A;  1WZ3 A;  4TQ1 A;  5DPW A;  1Q5W B;  4K1R B;  5AZH A;  3K9P B;  2ASQ A;  3L16 A;  1V49 A;  2JPH A;  1S3S G;  2ZPY A;  3SDL C;  2J0J A;  2KAN A;  2OJR A;  3O65 B;  4XZ4 A;  1GG3 A;  4DHZ B;  2BYE A;  1WX9 A;  1WJU A;  3JSV A;  4W9K A;  2NVU I;  3DVN V;  2CKH B;  3MTN B;  3B1L X;  1TTN A;  1WE7 A;  4YL8 A;  2IYD B;  2KDB A;  4M0W B;  4GXB A;  1WGD A;  3V62 A;  4E74 A;  2KFK B;  3B0A A;  1SIF A;  2N7E A;  3ENE A;  3IFW B;  2MRP A;  4ICU A;  3U7D A;  4KDL B;  4PS7 A;  1WX7 A;  2AL6 A;  5J18 A;  3UQA A;  4NPN A;  1RFA A;  2LWP A;  2LZ6 A;  3QJZ A;  5AZF A;  3ZNI D;  2BKF A;  4IW0 A;  2K39 A;  3L10 B;  1TBE A;  4MGY E;  2C60 A;  4B9K A;  2FCN A;  4I6N B;  3UGB B;  2D2Q A;  1WRD B;  2LVO A;  3ZVV A;  3KYC D;  3CST A;  4BOZ B;  5BO4 B;  3DBH I;  2R2O A;  4MGZ E;  2LUE A;  3TL5 A;  2DYM A;  5GMV A;  2KOX A;  4ZDV A;  4ZRI A;  3A1Q B;  4WWN A;  4MGI E;  3R7Q A;  1E8Y A;  1UZX B;  1VD2 A;  2CU1 A;  2KC2 A;  2PE9 A;  2GBM A;  3UIN B;  3A9J A;  3WIM A;  3RZF A;  4DHJ B;  2G3Q B;  4BBN C;  3GOE A;  3NOB A;  3ZTD A;  4BVU C;  3L17 A;  2FCM A;  2NBU A;  2DAF A;  3L13 A;  2C9W B;  2N9E B;  4G3X B;  4A3P A;  3PZD A;  1WXS A;  2DHZ A;  4KIK A;  3DBR I;  2LGD A;  4IM2 A;  4MM3 A;  3DPD A;  3N32 A;  4DHJ D;  4FBJ B;  5G2N A;  2K25 A;  1ZKH A;  3VHT C;  3X0W A;  2EKE C;  4FA6 A;  2L76 A;  3QAR A;  5JHA A;  2BWF A;  2LVP A;  4EFO A;  2KC1 A;  3VXW A;  3DVG Y;  1WGY A;  4W9C A;  1C1Y B;  4BKT A;  4XX5 A;  3PVL A;  2GBK A;  2KHW B;  1IPG A;  3QQ8 B;  3V61 A;  4HCN B;  5CHF A;  3UQB A;  2K1F A;  2MBO A;  2NS5 A;  3HM3 A;  2D07 B;  2JXX A;  2LGY A;  5J17 A;  2KQS A;  4K7U A;  4IM3 A;  1VCB A;  2FNJ B;  4NJ6 A;  2MQJ A;  3A33 B;  1LM8 B;  2QHO A;  3WAP A;  2XEW A;  4IG7 B;  1P9D U;  3MJW A;  3APC A;  3Q3F A;  4DWF A;  3VTV A;  2M1M A;  2FCQ A;  2KQ7 A;  3DDC B;  4WQO B;  3SD5 A;  2KX3 A;  2KO3 A;  2RPQ A;  2ZCC A;  3PTF C;  2JVC A;  4HJK A;  3EEC A;  1QZE A;  4IUM B;  3ZKJ C;  3QX1 A;  4KSK C;  1GJZ A;  2ZNV C;  2BKR B;  2AYO B;  3APD A;  3ZRF A;  3ZNZ B;  1EF1 A;  4IC7 B;  3KVF B;  3WAM A;  3M63 B;  1UGM A;  2A4Z A;  1RAX A;  2Z0D B;  3NZU A;  3ZO5 B;  4AUQ C;  2CHX A;  2DYB A;  1J8C A;  3VAW A;  3DCG A;  2DAJ A;  4FHK A;  2I1J A;  4G11 A;  4HPM B;  3M3J A;  2WYQ A;  4E3C A;  3S2A A;  4CYE A;  2JZZ A;  2KMC A;  2UYZ B;  3HHM A;  3HM6 X;  4EZK A;  3I3T B;  3PRZ A;  4PYU A;  3ML8 A;  2PJH A;  1KLV A;  4N9F 4;  3VQI A;  3VUY A;  2RD0 A;  1WZ0 A;  3IHP C;  4B95 A;  3EFU A;  4MSQ B;  4NAW B;  3AXC A;  3TBL D;  2KKC A;  2C7H A;  2K6D B;  3TMP B;  4ANU A;  1WR1 A;  5LLI A;  2KMA A;  2DEN B;  3NZS A;  3H7P A;  2HE7 A;  2O6V D;  4JLC A;  3WAO A;  4RM9 A;  4IWQ A;  3U8Z A;  2IY0 B;  4DBG A;  1OEY J;  3RZW C;  2G4D B;  1E5W A;  3QC8 B;  3RUI B;  4JQW C;  4BKS D;  4W9L A;  4AJW A;  2KJH B;  1UH6 A;  4LJO B;  2KTR A;  2JY6 A;  2PEA A;  3A9J B;  3UIP B;  2KD0 A;  1WXA A;  3W1Y A;  5LXI B;  2BF8 B;  1WY8 A;  2WWZ A;  3WAL A;  2DZJ A;  1L7Y A;  2KTF A;  2N1W A;  4FUL A;  5AEK B;  3IBE A;  3M62 B;  3OJ4 B;  2KWU B;  4MEL A;  3PS6 A;  2KWV B;  1GUA B;  4KIK B;  2IO1 B;  2JF5 A;  1E7U A;  1J19 A;  2JZ3 B;  2MX2 A;  1OEY A;  2O2V B;  1E8Z A;  1V86 A;  4W9G A;  3K9O B;  1UD7 A;  2ZNV B;  4BBN F;  2R2Q A;  3KUZ A;  4WWO A;  2DYO A;  4HDQ A;  4OVU A;  3ZRC A;  2ZPN A;  3W1S A;  5G55 A;  4MJS A;  3BIN A;  1V9J A;  1WJ4 A;  4NQK E;  4G50 A;  2FAZ A;  2MBH A;  2ZCB A;  4AJY B;  1ISN A;  3RUL A;  4FLH A;  3DOW A;  4BFR A;  5D2M B;  3HK0 A;  3RCZ A;  3PRP B;  2BYV E;  4NY0 A;  1K8R B;  1TGZ B;  4NJ7 A;  4AP4 C;  1T0Y A;  3IG3 A;  4KVG B;  1I42 A;  3MHS D;  3IVF A;  5HKH A;  4GSW A;  2K8C A;  4HXD A;  5JHB A;  3H6N A;  3VTU A;  2IO0 B;  3W1S C;  4GIV A;  5D94 A;  5E6N A;  1XT9 B;  1WR6 E;  3RD2 A;  2JT4 B;  3PGE A;  2KLC A;  2CHZ A;  4FHJ A;  2LJ5 A;  3RT3 B;  2L05 A;  4W9F A;  3PHW B;  3CF6 E;  4GB9 A;  4W9J A;  1WMH A;  2XBB C;  2IZV B;  5J2R A;  1SGH A;  3PRM B;  4DK5 A;  2M17 A;  1WE6 A;  2L0T A;  4FAD A;  3ZW3 A;  1EF5 A;  5JH5 C;  2WX0 A;  3V6C B;  1KM7 A;  3V6E B;  3PHX B;  3L0W B;  2LRW A;  4GDL B;  2KN5 A;  2KJ6 A;  4URK A;  4G0N B;  2XK5 A;  3H7P B;  1RLF A;  5DPT A;  3EC8 A;  2J7Q B;  3AUL A;  3ML9 A;  4KV2 A;  4TV3 A;  1C3T A;  1Z2M A;  2MSE D;  4A3O A;  3KW5 B;  1U4A A;  4K81 A;  3EHV A;  1NBF C;  2D10 A;  4ANX A;  3H9D A;  2Y5B B;  3R66 C;  3ZTC A;  3JW0 X;  4W9I A;  3VTW A;  3KUC B;  4II2 B;  3KUD B;  3OAW A;  4WJN A;  1UEL A;  2KXJ A;  2LXC A;  2MP2 A;  2DZM A;  3JSV B;  3VUW A;  2ZZP B;  2ZJD A;  3QIJ A;  4E71 A;  2A5U A;  4GOC A;  4EOY A;  2MWS B;  3H7S A;  2N7D A;  3QCA A;  3RYT A;  3WAN A;  4TUU A;  2PE6 B;  3A4S C;  3VH4 B;  1E90 A;  2V4L A;  1XD3 B;  1WF9 A;  2PPH A;  1WIA A;  1V2Y A;  3NHE B;  1WX8 A;  4KDI C;  4EEW A;  4ZRJ A;  4DDI D;  5CHW A;  5IAA C;  4HLE A;  4DDG D;  5D6J B;  3DQV A;  3UF8 A;  2REX A;  5E6P A;  1YX6 B;  2KJR A;  3QA8 A;  3T9L A;  4F1S A;  3SU8 X;  3JYU A;  5CTR C;  2KWC A;  4IM0 A;  2GBJ A;  4ZRK A;  3NY5 A;  4F7Z A;  1CMX B;  2KFJ A;  4KZC A;  1WJN A;  5KHO A;  1KJT A;  1YJ1 A;  4WJO A;  4TQ0 A;  5L83 A;  4A20 A;  1P0R A;  3T8M A;  3PV1 A;  4I6L B;  2IBI B;  4HWI B;  2DX5 B;  2V1Y A;  2NBW B;  2W9N A;  3QAQ A;  4WAA A;  4PS8 A;  5DPS A;  3AU5 A;  3A1Q A;  5C1Z A;  2C5L C;  4K7S A;  2KNB A;  2FUH B;  1M94 A;  1P3Q U;  2DZI A;  1WMH B;  3OLM D;  3ONS A;  2KLG A;  4X57 B;  3PLU A;  4KZ0 A;  1A5R A;  1D3Z A;  1E7V A;  1E8W A;  2Z59 B;  1Q1O A;  5C23 A;  2HD5 B;  4HK2 A;  1P1A A;  2JWZ A;  2IO2 B;  2OOB B;  4KSL C;  2ZVO A;  4EKU A;  1WH3 A;  2FCS A;  1SE9 A;  1ZGU B;  4ZYN A;  4GGQ A;  1X1M A;  4MEM A;  3BY4 B;  3X23 A;  3LJ3 A;  1TZ1 A;  1Y8R C;  3N30 A;  2NPT A;  4CO7 A;  2HTH A;  3C0R B;  1UBQ A;  1WFY A;  2HJ8 A;  1LQB A;  2GMI C;  3Q3J A;  5DPR A;  4LDT B;  2EMS A;  4EUT A;  1R4M I;  3HIZ A;  5D7G A;  2BPS A;  3H1U A;  2WX1 A;  1LFD A;  2RGF A;  1I35 A;  3QHT A;  2L0F A;  3DVN U;  3PPA A;  3KH0 A;  3LDZ E;  4MH0 E;  3TIX A;  3ZUN A;  2BYF A;  3AU4 A;  4W9E A;  4LDT D;  2KDI A;  2C7N B;  1L2N A;  2AWT A;  5DCN A;  3UIO B;  3OJ3 A;  3PSE B;  4GDK A;  1WM2 A;  5FR6 A;  2D3G A;  2FID A;  2KK8 A;  3ZNH B;  2EMT A;  4EZL A;  2CHW A;  4XC2 A;  1ZW7 A;  2BGF A;  2MP2 B;  3N3K B;  5CHV C;  2UWQ A;  2WDT B;  2N9X A;  1LXD A;  5L95 C;  1IP9 A;  3VFK A;  1YQB A;  2JUO A;  5JZE B;  1WXV A;  2FIF A;  2N9P C;  3A4R A;  1WYW B;  2L00 B;  4FN2 A;  2Z0E B;  4JGH B;  3R7R A;  2YLM A;  1S1Q B;  3VUX A;  2L7R A;  3A9K A;  2MBE A;  3ZLZ A;  3PRE A;  2KDF B;  1NDD A;  2L3Z A;  2GOW A;  2RR9 A;  1YD8 U;  2O6V A;  3R3M A;  2YVC A;  2BWE S;  2G4S A;  4NAW A;  1PQS A;  1V5T A;  4WJP A;  4FJY A;  2CS4 A;  1J0G A;  1V80 A;  4BKS A;  2MA9 B;  4P7I A;  4MGK E;  5KHQ A;  3L08 A;  3B08 A;  3AI5 A;  1EUV B;  2KTR B;  1AAR A;  4NNJ B;  2LI5 A;  4B6W A;  1GNU A;  4M8N A;  4II3 B;  2M0X A;  3WA0 A;  3D32 A;  4GMV A;  1YX5 B;  4MDK E;  4AWJ A;  1KOT A;  1OGW A;  2M4N A;  1GC6 A;  3SHQ A;  2K8H A;  4CHK A;  3ECI A;  1V6E A;  2JRH A;  1YIW A;  4LCD E;  1IYF A;  4FJV B;  2O2V A;  3V60 A;  2LVQ A;  3ZDM C;  1E8X A;  2B3A A;  4ANW A;  1V5O A;  2L8J A;  2NPT B;  3L54 A;  4ANV A;  3JVZ X;  2LD9 A;  2NR2 A;  4DXA B;  4LJP B;  3NS8 A;  2KFK A;  1BT0 A;  2AL3 A;  3DVG X;  4I6P A;  4MJS B;  1WM3 A;  4PS3 A;  1MG8 A;  2K6Q A;  3ZNG C;  2MW5 A;  2N4F A;  2KZR A;  3QK0 A;  1WGR A;  4JL9 A;  1Q0W B;  4F8C B;  3ALB A;  4GDK B;  3PT2 B;  2V3S A;  2VRR B;  1EO6 A;  3ZDT A;  1WI0 A;  2RSU A;  2NBV B;  1P98 A;  4ICV A;  2IY1 B;  1V81 A;  4GU2 A;  1R4N I;  4J6I A;  1Z5S B;  2GBR A;  4NQL B;  3QWZ B;  2I1K A;  1G6J A;  3M95 A;  2LGX A;  3VVW B;  2KX0 A;  4K7W A;  4OVV A;  2MBB B;  2ZVN A;  3GZN I;  2LAS A;  4TKN A;  3DBS A;  5EDS A;  2J0M A;  1WGH A;  3CMM B;  3PLV A;  4HCP B;  2DZK A;  3U30 A;  4JIO U;  3VDZ A;  4ASW C;  4GN1 A;  2CR5 A;  5CX3 A;  1XQQ A;  1H4R A;  3TJP A;  5IA7 A;  4HDO A;  1JRU A;  3A9K B;  4M8M A;  1WGG A;  1WJ6 A;  5E6O A;  3CSF A;  4W9H A;  4DHZ E;  2D11 A;  2O6V B;  4AOF A;  1FXT B;  3KYD D;  3DBL I;  4IWP A;  2KDE B;  4EZJ A;  2KVR A;  3APF A;  1OQY A;  4GDL A;  4BOS C;  1UBI A;  5TR5 A;  2IO3 B;  3TCA A;  4WWP A;  4BKG A;  2G45 B;  2ZEQ A;  3P2B A;  2MCN B;  2LXA A;  2NCN A;  1F9J A;  3ZIM A;  2XK5 B;  4HVB A;  2LRU A;  2N1V A; 
#chains in the Genus database with same CATH topology
 4WJQ A;  2M8S A;  4HPL B;  1OTR B;  4RM8 A;  2BB6 A;  2YEP B;  2JRI B;  1SJH D;  4PYZ A;  1PDX A;  2C7M B;  4ZRQ A;  5DPW A;  1P7E A;  1UNS A;  1T0Q C;  1TKY A;  3L16 A;  1V49 A;  4JX1 C;  1BUI C;  3HRD D;  4XZ4 A;  1GG3 A;  4DHZ B;  2BYE A;  3MTN B;  3B1L X;  2LGS A;  3AE1 B;  3BK1 A;  4M0W B;  4GXB A;  4E74 A;  3IFW B;  2V4I B;  2N9L A;  2AL6 A;  2JWU A;  5AZF A;  2BW2 A;  1AWD A;  2QSD A;  1JQ4 A;  4ZRP A;  4I6N B;  2LGI A;  2WGS A;  1WRD B;  2LVO A;  1C77 A;  4BOZ B;  4AS1 A;  2LUE A;  2DYM A;  5GMV A;  2LJI A;  1I4Q A;  1E8Y A;  2PE9 A;  2GRI A;  1N63 A;  3NVY A;  4BBN C;  3ZTD A;  4BVU C;  2FCM A;  3LXF A;  2C9W B;  1EM7 A;  4MM3 A;  4AQ7 A;  4IM2 A;  2K25 A;  1ZKH A;  3VHT C;  2L76 A;  1J7B A;  5JHA A;  2LVP A;  3VXW A;  2K3U A;  1C1Y B;  3QQ8 B;  3UQB A;  4HCN B;  5BYR A;  3HM3 A;  1L0V B;  2D07 B;  5EE0 A;  5J17 A;  2JU6 X;  1VCB A;  2JSV X;  3NJT A;  1LM8 B;  2QHO A;  3WAP A;  1P9D U;  4DWF A;  3VTV A;  2JYE A;  2FCQ A;  1TS4 A;  4A90 A;  2KQ7 A;  3DDC B;  4WQO B;  1SEB D;  1HTO A;  2JVC A;  1QZE A;  3ZNZ B;  1A70 A;  2KAC A;  2Z0D B;  1D4B A;  3AE2 B;  3NZU A;  1J8C A;  4E3C A;  3HHM A;  3HM6 X;  3KLS X;  3PRZ A;  4PYU A;  3VUY A;  2EEL A;  1TZO A;  5FKA C;  4MSQ B;  4NAW B;  3AXC A;  2G1E A;  3TMP B;  1E9M A;  4ANU A;  5LLI A;  2O6V D;  2KN4 A;  1ET6 A;  3DHI C;  2IY0 B;  4JPS A;  3AH7 A;  4US9 A;  3RUI B;  4JQW C;  1JWS D;  4BKS D;  1D6E C;  4LJO B;  1ACC A;  2KTR A;  3UIP B;  1NYQ A;  2I2Y A;  1WXA A;  3W1Y A;  3RNE C;  2BF8 B;  1WY8 A;  3HVZ A;  4MEL A;  1GOZ A;  3ZGZ A;  2KWU B;  1T0R C;  1L6V A;  2MX2 A;  1OEY A;  1NI3 A;  1V86 A;  2KDM A;  1SF0 A;  4BBN F;  3KUZ A;  3OG5 A;  4OVU A;  3ZRC A;  1QKZ A;  3W1S A;  1C78 A;  1V9J A;  2WXR A;  3V05 A;  4N6E B;  4XYC A;  4M01 A;  3TEY A;  1ISN A;  1OFF A;  2WXQ A;  5D2M B;  3HK0 A;  3RCZ A;  2PTL A;  4NJ7 A;  3IG3 A;  4GSW A;  2BTE A;  1UWM A;  2IO0 B;  2EKI A;  5D94 A;  1WR6 E;  2KLC A;  3EGR A;  2CHZ A;  2LJ5 A;  3CF6 E;  2XBB C;  2IZV B;  1SGH A;  3AE7 B;  2M17 A;  5G5H A;  1EF5 A;  3PHX B;  4L1B A;  3H7P B;  2JZP A;  1RLF A;  3RNF C;  1ET9 A;  3ZJU A;  4KV2 A;  4TV3 A;  1C3T A;  1LGR A;  3KW5 B;  2PMV A;  3N1Z C;  1ZP0 B;  1CK1 A;  4QAY A;  2INC C;  2D3C A;  3ZTC A;  1DGJ A;  3LB8 C;  2K5P A;  4KKI A;  3Q8B A;  2KXJ A;  2LHE A;  4MH8 A;  4P16 A;  2ZZP B;  2ZJD A;  2A5U A;  4GOC A;  3H7S A;  2PE6 B;  3A4S C;  1E90 A;  1WF9 A;  2IDY A;  1WX8 A;  5CHW A;  5IAA C;  3DQV A;  2REX A;  4F1S A;  1YX6 B;  2KJR A;  5CTR C;  3NY5 A;  1FIQ A;  3AE3 B;  2V3N A;  4WJO A;  4A20 A;  3T8M A;  1QOG A;  2DX5 B;  3RI7 C;  5C1Z A;  4S17 A;  1JRO A;  2KNB A;  3ZJT A;  3ONS A;  1A5R A;  1C76 A;  1E8W A;  3NUH B;  1P1A A;  3W5U B;  3AE4 B;  3BII D;  4N59 A;  2FCS A;  1SE9 A;  1ZGU B;  3AED B;  4ZYN A;  4MEM A;  3X23 A;  2NPT A;  5HHD G;  1C4C A;  1CJE A;  1LQB A;  1L6U A;  2VH1 A;  4LDT B;  5D7G A;  3H1U A;  2RGF A;  3PPA A;  3LDZ E;  4MH0 E;  2JQR B;  4OHJ A;  4P1C C;  5I4D A;  5G5G A;  3AU4 A;  1ZDV A;  3EFC A;  4KKJ A;  1TIF A;  5DCN A;  3OJ3 A;  1FM0 D;  2WXH A;  5FR6 A;  2FID A;  4EZL A;  2EMT A;  1ZW7 A;  4HKZ E;  1N60 A;  3N3K B;  1I4R A;  2N9X A;  3GB1 A;  4TSS A;  5L95 C;  1P7F A;  1YQB A;  2JUO A;  1WXV A;  3A4R A;  1NVI D;  1HA5 A;  5T8I A;  2MH7 A;  2MBE A;  3PRE A;  3RFZ B;  4NAW A;  1ZPS A;  1V5T A;  2V3P A;  3Q8E A;  1JCK B;  1ZDX A;  3AI5 A;  4C80 A;  3Q3N C;  4ZOH C;  2LI5 A;  4M8N A;  4AWJ A;  2JX5 A;  1I4H A;  1JWU D;  2RDH A;  2M4N A;  1N5W A;  1IYF A;  4FJV B;  3ZDM C;  2B3A A;  1OQQ A;  1C4A A;  4A9A A;  1RWS A;  4ANV A;  3JVZ X;  4DXA B;  4M02 A;  2KFK A;  2J4X A;  4MJS B;  1V1O A;  3TEW A;  1JW9 D;  1MG8 A;  2K6Q A;  3ZNG C;  1QIL A;  2N4F A;  2KZR A;  3AMZ A;  1Q0W B;  4GDK B;  3PT2 B;  2VRR B;  2NBV B;  4ICV A;  2IY1 B;  1R4N I;  3U52 E;  2I1K A;  1G6J A;  2V9H A;  1C79 A;  3CMM B;  2Y5C A;  3PLV A;  4A8X C;  2Y5P A;  1VZ6 A;  1WXQ A;  4W9H A;  2O6V B;  4AOF A;  4IWP A;  2IJ0 A;  1OQY A;  1UBI A;  5E6J A;  1HTQ A;  3ZIM A;  1AW7 A;  2Q5W D;  2XK5 B;  2WXO A;  2N1V A;  3GE8 C;  1OQR A;  2INN E;  4IWO A;  3LYY A;  2K8B A;  2MBQ A;  2GBN A;  4FJZ A;  1PGA A;  2V0G A;  4K1R B;  2GB1 A;  5AZH A;  4KGS A;  1S3S G;  4MAC A;  2ZW0 A;  1WX9 A;  3TEX A;  2ONQ A;  2DBY A;  1GB1 A;  2NVU I;  3DVN V;  3EUB 2;  2CKH B;  1MJD A;  1WE7 A;  2NTS A;  2IND C;  4YL8 A;  2INP E;  1WGD A;  1SIF A;  2N7E A;  4ICU A;  2MRP A;  3I5J C;  4PS7 A;  5J18 A;  1VR9 A;  2LWP A;  2PKO A;  2BKF A;  2K39 A;  4DXG A;  4MGY E;  1WWT A;  1WRI A;  5AUK A;  3CST A;  5BO4 B;  3Q8A A;  1ESF A;  3WCQ A;  4MGZ E;  1MHX A;  4J3O D;  4ZRI A;  4WWN A;  2L83 A;  1UZX B;  1E6E B;  1VD2 A;  2CU1 A;  1KFY B;  1YQ4 B;  3UIN B;  3A9J A;  3RZF A;  4HKQ A;  3GOE A;  3NOB A;  3L17 A;  1KTK A;  5IO9 A;  4DHJ D;  4FBJ B;  3N32 A;  5G2N A;  2PLP A;  4LLG M;  3NS1 A;  3X0W A;  4P1B C;  4FA6 A;  2BWF A;  4HEA 1;  4EFO A;  4C4V A;  2QIL A;  2VH2 A;  1NEK B;  1CQV A;  1IPG A;  2K1F A;  2MBO A;  1D5X C;  3DWM A;  2KQS A;  4NJ6 A;  3A33 B;  2PVG C;  4HRO A;  1FNV A;  4IG7 B;  3Q3F A;  3APC A;  5H8Y E;  2KVZ A;  4KGT A;  2KX3 A;  4IUM B;  2QJL A;  1IBX B;  2AYO B;  1EF1 A;  3KVF B;  1K51 A;  1RAX A;  3ZO5 B;  4AUQ C;  2DYB A;  2DAJ A;  2QCZ A;  3M3J A;  3MFG A;  4EZK A;  4NZL B;  3ML8 A;  4RGN A;  2N7J A;  4JE3 B;  1SBB B;  2C7H A;  1WR1 A;  3U8Z A;  4DBG A;  4ARC A;  2G4D B;  1E5W A;  3QC8 B;  2AX5 A;  1XEE A;  1KF6 B;  2JY6 A;  2KD0 A;  3AEA B;  1I4X A;  5LXI B;  1L7Y A;  2N1W A;  2LFI A;  3PS6 A;  2KWV B;  1GUA B;  4KIK B;  3SFE B;  2IO1 B;  2CU3 A;  1J19 A;  4LK0 M;  1VZ8 A;  1YJJ A;  2WU2 B;  3K9O B;  2ZNV B;  1TS3 A;  4HDQ A;  1MHH E;  2ZPN A;  3BYY B;  4MJS A;  3BIN A;  1JML A;  3URY A;  4AJY B;  1EWY C;  4FLH A;  1QOB A;  4RFB A;  4EE2 A;  4BFR A;  2L32 A;  4XWW A;  3PRP B;  4NY0 A;  1TGZ B;  4AP4 C;  4KVG B;  3MHS D;  3IVF A;  1V1P B;  5HKH A;  4HXD A;  4S0R A;  1HZ6 A;  5E6N A;  2KQ4 X;  3RD2 A;  3RT3 B;  2L05 A;  4W9J A;  1WMH A;  2W82 A;  5J2R A;  1K52 A;  3MJ5 A;  4FAD A;  3V6E B;  3RNC C;  3TSS A;  4GDL B;  2KJ6 A;  3HVD A;  1ROE A;  4G0N B;  2XK5 A;  1GB4 A;  4XGA B;  3CWI A;  3AB5 A;  5IOI A;  3EHV A;  4BAX A;  2D10 A;  3P4R B;  3R66 C;  2BYT A;  3JW0 X;  4W9I A;  3KUD B;  4YT0 B;  1UEL A;  2HDE A;  2LXC A;  1FCC C;  1FXI A;  5EE3 A;  3JSV B;  3AEC B;  3DBL B;  3SFD B;  2FE8 A;  2XNA C;  1PYW D;  5MPO A;  1L5P A;  4YTP B;  2N7D A;  3QCA A;  3WAN A;  3GS2 A;  3OWE B;  3VH4 B;  1UWX A;  3R2I A;  3P42 A;  4DDG D;  5D6J B;  2BVC A;  1WYG A;  2RDG A;  3UF8 A;  1J7C A;  5E6P A;  4YTN B;  1AN8 A;  3T9L A;  2XN9 C;  2WXM A;  3JYU A;  1XLP A;  2KWC A;  1QT9 A;  1CMX B;  4KZC A;  1WJN A;  1T5X D;  1KJT A;  1YJ1 A;  2D3B A;  4TQ0 A;  1DOX A;  1P0R A;  3PV1 A;  4HWI B;  1YN4 A;  5DPS A;  2FUG 1;  3QAQ A;  4WAA A;  4PS8 A;  1E7P B;  2C5L C;  3P1M A;  1YJI A;  2DZI A;  2FUH B;  4JWS C;  4X57 B;  3OLM D;  1E7V A;  3ZQ4 A;  1PGB A;  2IO2 B;  4KSL C;  5HI1 A;  2PIA A;  4YWG G;  5FR3 A;  2N0S B;  4GGQ A;  4XWT A;  2HTH A;  2OED A;  2HJ8 A;  3Q3J A;  2DLB A;  3HIZ A;  5BMH A;  2BPS A;  1I35 A;  2WX1 A;  2RDB C;  4O1N A;  2L0F A;  1F1H A;  3DBH B;  2BYF A;  1L0Y B;  2KDI A;  2VZK D;  3UIO B;  1WM2 A;  3R8B A;  2BGF A;  2MP2 B;  3ABV B;  2WDT B;  1L4Z B;  3IAS 1;  1B1Z A;  4FN2 A;  1QF6 A;  4JGH B;  2HJ1 A;  3Q3M C;  2LMC A;  3VUX A;  4YSY B;  3A9K A;  3Q69 A;  3ZLZ A;  2KDF B;  2RR9 A;  2L3Z A;  2GOW A;  3U7Z A;  2LHD A;  2YVC A;  1PQS A;  2CS4 A;  1V80 A;  3B9J A;  4XDC A;  3Q2A C;  2MA9 B;  3U4E G;  5KHQ A;  1FMA D;  3BVZ A;  5EE1 A;  4NNJ B;  2OHF A;  2AQ2 B;  1GNU A;  1PGX A;  4II3 B;  2M0X A;  3WA0 A;  3D32 A;  4GMV A;  1VJK A;  1KOT A;  3MC8 A;  1V6E A;  5JXV A;  2L1A A;  5IN7 A;  5C3J B;  1E8X A;  4L23 A;  1V5O A;  2L8J A;  3W9C B;  2BS3 B;  3UI3 A;  2LD9 A;  2X8X X;  4M0W A;  1BT0 A;  2AL3 A;  3I9V 1;  4PS3 A;  1IGC A;  3QK0 A;  4F8C B;  3VRB B;  1D5Z C;  1WI0 A;  2IGH A;  1V81 A;  4GU2 A;  4RCO A;  2WS3 B;  2LGX A;  1V1P A;  3VVW B;  1KH0 A;  4K7W A;  2PW9 A;  4OVV A;  5D3I B;  2LAS A;  3NRZ A;  1RM6 C;  4US8 A;  4HCP B;  3VDZ A;  4ASW C;  4GN1 A;  3RPF C;  5IA7 A;  2BB5 A;  4LNI A;  1JRU A;  1WGG A;  1V97 A;  1FXT B;  3SR6 A;  4GDL A;  4BOS C;  2IO3 B;  3TCA A;  4WWP A;  2G45 B;  2ZEQ A;  2NCN A;  1VDV A;  2LRU A;  1J0G A;  5AZG A;  4EEW A;  2MLB A;  2GI9 A;  2J0K A;  2UU7 A;  1WXM A;  1SE4 A;  4MSM B;  4RMA A;  1HE8 A;  5LXH A;  2N9K A;  5EE9 A;  1FFU A;  1K53 A;  1WZ3 A;  2B76 B;  1YN3 A;  2PVO D;  3AEF B;  4RF0 A;  2ASQ A;  3Q6B A;  2JPH A;  1JWA D;  1RFK A;  2KAN A;  4YTM B;  3VR9 B;  2WU5 B;  3JSV A;  3PZ7 A;  4C7Z A;  2RPV A;  1GPX A;  4IDI A;  3V62 A;  1XLO A;  4M00 A;  3B0A A;  3AN1 A;  3ENE A;  3U7D A;  4KDL B;  1WX7 A;  1QLB B;  4NPN A;  2LZ6 A;  1FCL A;  4IW0 A;  1SXT A;  1HZ5 A;  3L10 B;  1TBE A;  2C60 A;  4B9K A;  2D2Q A;  5AUI A;  2WLB A;  3ZVV A;  3DHH C;  3KYC D;  2R2O A;  4WAF A;  2JYT A;  4ZDV A;  3BZD B;  4KGR A;  2WHI A;  2HTM E;  3WIM A;  3GP7 A;  2W54 A;  5C2T B;  2DAF A;  4G3X B;  1QQR A;  1I7H A;  4HJG E;  3DPD A;  2EKE C;  3QAR A;  2NTT A;  2KC1 A;  3DVG Y;  1WGY A;  4BKT A;  3R2T A;  2GBK A;  3V61 A;  1TYG B;  4IM3 A;  2FNJ B;  3ETR A;  4LNK A;  2XEW A;  2M1M A;  2IGD A;  4D2K A;  1KLG D;  1SJE D;  4ZHP A;  2ZCC A;  3PTF C;  3ZKJ C;  3MC9 A;  3EEC A;  1GJZ A;  1D5M C;  1FNU A;  2ZNV C;  3APD A;  3KWV A;  1MI0 A;  3WAM A;  2Z8L A;  3DCG A;  2I1J A;  1R4M B;  3O13 A;  4IKG A;  3S2A A;  2JZZ A;  3I3T B;  5IP4 D;  3C8Y A;  4N9F 4;  2RD0 A;  4C7Y A;  1RYJ A;  1WZ0 A;  2QEJ C;  1YOV B;  3IHP C;  4B95 A;  3EFU A;  2KKC A;  2DEN B;  3H7P A;  2HE7 A;  4JLC A;  1YNT E;  4IWQ A;  1KRH A;  1OEY J;  3RZW C;  1VZ7 A;  2WQY B;  2MJ3 A;  1FEH A;  2KMM A;  1TY2 A;  2PEA A;  4XE0 A;  4A55 A;  2I38 A;  4LNO A;  3MC0 B;  2WWZ A;  2DZJ A;  2KTF A;  5AEK B;  2JF5 A;  4A6Q A;  1WGK A;  1BXT A;  4H2A A;  1UD7 A;  2R2Q A;  4WWO A;  2DYO A;  4ACF A;  2KWD A;  4NQK E;  1WJ4 A;  2FAZ A;  2MBH A;  2ZCB A;  2IGG A;  3DOW A;  3P4P B;  1Y56 A;  2YEP F;  1T3Q A;  1K8R B;  1T0Y A;  1PUT A;  3ZXR A;  3N20 C;  3VTU A;  1TS5 A;  4GIV A;  2WXI A;  1ENF A;  2JT4 B;  3FKY A;  4W9F A;  4YSX B;  3W5V B;  1FPY A;  3PRM B;  4WIP A;  4DK5 A;  2WXG A;  3L0W B;  2BQQ A;  2KN5 A;  4URK A;  2MHJ A;  3EC8 A;  1AYF A;  3DHG C;  3ML9 A;  1Z2M A;  2MSE D;  4A3O A;  3Q8C A;  1U4A A;  4OVZ A;  4K81 A;  1NBF C;  2H88 B;  3GZN B;  4JWU C;  4ANX A;  2R61 A;  1VLB A;  4KX6 B;  3VTW A;  3KUC B;  3OAW A;  4WJN A;  5D3D A;  2WXP A;  2DZM A;  3N1Y C;  3VUW A;  2SEB D;  1E0Z A;  3QIJ A;  1HEZ E;  4LNN A;  4BZA A;  3SEB A;  2MWS B;  3RYT A;  3N1X C;  2QIE B;  2V4L A;  3Q8F A;  1XXG A;  1V2Y A;  2TSS A;  2MJD A;  4DDI D;  1T6B X;  4HLE A;  1DOI A;  3QA8 A;  1BML C;  3VRA B;  4IM0 A;  1FNW A;  2GBJ A;  4F7Z A;  1MG4 A;  1N61 A;  5KHO A;  3BVM A;  5L83 A;  2IBI B;  2ICI A;  1KLU D;  2NBW B;  2V1Y A;  2W9N A;  2BS4 B;  3AU5 A;  5HG2 A;  2WXF A;  2BBC A;  2J53 A;  1M94 A;  1P3Q U;  3P63 A;  2RMM A;  2KLG A;  3GE3 C;  3PLU A;  4KZ0 A;  1D3Z A;  1N62 A;  4C00 A;  1Q1O A;  5C23 A;  2HD5 B;  4HK2 A;  2OOB B;  2ZVO A;  4EKU A;  2BT6 A;  2W3S A;  4ARI A;  3P4S B;  2KT7 A;  1EWC A;  3BY4 B;  1Y8R C;  3C0R B;  1UBQ A;  1KLV A;  2GMI C;  3FIL B;  5DPR A;  4EUT A;  1LFD A;  1TKG A;  3QHT A;  3KH0 A;  1SE2 A;  3B2F A;  4W9E A;  4LDT D;  2C7N B;  4RGM A;  4GDK A;  2D3G A;  1XLQ A;  3PO0 A;  3U2S C;  3ZNH B;  1N6Z A;  2CHW A;  4XC2 A;  1YN5 A;  1FO4 A;  5CHV C;  5H92 C;  4OZC A;  2WDR B;  3VFK A;  3CIR B;  2FIF A;  2N9P C;  1GAQ B;  1WYW B;  2Z0E B;  2E6X A;  1TKE A;  3R7R A;  2YLM A;  2AQ1 B;  1ZUD 2;  2K0P A;  2L7R A;  3BWU D;  2LEK A;  1YD8 U;  2O6V A;  3R3M A;  2BWE S;  4WJP A;  4C56 C;  4FJY A;  3W2D A;  4BKS A;  1FRD A;  4B0E A;  4WUR A;  4MGK E;  3L08 A;  3B08 A;  1AAR A;  4B6W A;  3BVG A;  3E9S A;  4K3C A;  1C9F A;  4GLS C;  4OW0 A;  1F77 A;  1SIJ A;  1GC6 A;  2E3T A;  4CHK A;  2JRH A;  2WXL A;  2LVQ A;  4ANW A;  3T3N A;  2NPT B;  3IT4 B;  3L54 A;  4USA A;  4ITK A;  3NS8 A;  1XLN A;  4I6P A;  4HRS A;  1WM3 A;  3H8H A;  2MW5 A;  3AEG B;  1WGR A;  4JL9 A;  3ALB A;  2V3S A;  3ZDT A;  2CJO A;  1P98 A;  3N9Y C;  2OJW A;  4J6I A;  4NQL B;  2GBR A;  3TUO A;  1L4D B;  3M95 A;  2D3A A;  2MJE A;  3AE6 B;  2KX0 A;  4OZA A;  2MBB B;  4TKN A;  2J0M A;  3U30 A;  4JIO U;  5CX3 A;  1XQQ A;  3TJP A;  1QOF A;  4HDO A;  5E6O A;  3DWG C;  4DHZ E;  1NYR A;  4R3D A;  3KYD D;  3DBL I;  3Q14 C;  5TSS A;  2KDE B;  4EZJ A;  2KVR A;  2ZW1 A;  3P2B A;  2MCN B;  4RNA A;  4HVB A;  3MP9 A;  2AEH A;  1RRB A;  4HPP A;  1I4P A;  1NI2 A;  1GC7 A;  3VH3 B;  1H8C A;  2L52 A;  4W9D A;  4TQ1 A;  1Q5W B;  4NJC A;  2J52 A;  4PT5 A;  3K9P B;  2ZPY A;  3SDL C;  2J0J A;  3O65 B;  2OJR A;  3VR8 B;  1WJU A;  4W9K A;  5BMG A;  1IBX A;  1TTN A;  4K3B A;  2IYD B;  2KDB A;  3DBR B;  1XCT L;  2D5G A;  2KFK B;  3UQA A;  3I57 A;  1RFA A;  3QJZ A;  3ZNI D;  4CQN A;  2FBW B;  2FCN A;  3UGB B;  1J7A A;  3NG0 A;  1R7S A;  1YMH E;  3DBH I;  3AM9 A;  3TL5 A;  3KWL A;  1M4V A;  2KOX A;  3A1Q B;  4RF1 A;  4MGI E;  3R7Q A;  2KC2 A;  4PK1 A;  3P4Q B;  2GBM A;  1NEN B;  1N5X A;  4MT5 A;  5FK9 C;  4DHJ B;  4RGT A;  4N58 A;  1QOA A;  2G3Q B;  2DNF A;  1JWM D;  2NBU A;  3L13 A;  4A3P A;  2N9E B;  1DOY A;  3PZD A;  1WXS A;  2DHZ A;  4KIK A;  3DBR I;  2LGD A;  1IGD A;  2WXJ A;  3FIL A;  1Q10 A;  4W9C A;  5BYQ A;  2W3R A;  4XX5 A;  3PVL A;  2KHW B;  5CHF A;  2NS5 A;  1PFD A;  2JXX A;  2LUM A;  2LGY A;  3B2G A;  1JWB D;  4K7U A;  2MQJ A;  2ACZ B;  3RN9 C;  2CJN A;  3MJW A;  1XO3 A;  3SD5 A;  2KO3 A;  2RPQ A;  4HJK A;  3QX1 A;  4KSK C;  2BKR B;  3ZRF A;  4IC7 B;  3EA6 A;  3M63 B;  1UGM A;  4DXF A;  2A4Z A;  2CHX A;  3VAW A;  2NMQ A;  4FHK A;  4HPM B;  4G11 A;  1XCQ L;  1VRA B;  2WYQ A;  4CYE A;  2KMC A;  2UYZ B;  2PJH A;  3VQI A;  4ZYS A;  4IOI E;  3RNB C;  3KQ4 A;  1SE3 A;  3AE8 B;  3TBL D;  2K6D B;  2KMA A;  3NZS A;  3AE5 B;  3WAO A;  4RM9 A;  2MEK A;  1FRR A;  2W55 A;  4W9L A;  1MFW A;  3AV8 A;  2KJH B;  4AJW A;  1UH6 A;  3A9J B;  4FXC A;  2X38 A;  3C19 A;  3WAL A;  2SAK A;  4FUL A;  4YXD B;  3IBE A;  3M62 B;  3OJ4 B;  1E7U A;  2JZ3 B;  2ON8 A;  2O2V B;  1E8Z A;  3BYT B;  2JXT A;  4W9G A;  5GXG B;  3NZ3 A;  4C4V B;  2M56 B;  5G55 A;  3T3O A;  2WXN A;  1JRP A;  1HQR D;  4G50 A;  3Q3O C;  1TY0 A;  2QDF A;  1TT5 B;  3RUL A;  4WWM A;  4L2Y A;  1F2R C;  1SSN A;  1EU4 A;  2BYV E;  4UDU C;  2K9X A;  2DWQ A;  1I42 A;  4Q2J A;  2K8C A;  2WDV B;  2WDQ B;  5JHB A;  3H6N A;  3W1S C;  3L4P A;  1XT9 B;  5LNK 1;  3PGE A;  1L0X B;  3E56 A;  4FHJ A;  3IAM 1;  3PHW B;  4GB9 A;  1ZXI A;  1WE6 A;  2L0T A;  3V3X A;  3ZW3 A;  3HUI A;  5JH5 C;  2WX0 A;  1C4P A;  1KM7 A;  2K22 A;  3V6C B;  2GLS A;  2LRW A;  3PZ8 A;  4ZHO A;  5DPT A;  2J7Q B;  3AUL A;  1R4N B;  3NVW A;  3RNA C;  3BK2 A;  1E10 A;  3H9D A;  2Y5B B;  4OZB A;  3FC4 A;  4II2 B;  1EU3 A;  3IT6 B;  1ZXH A;  1DYQ A;  2MP2 A;  3FAH A;  1CZP A;  4TMA B;  4E71 A;  2M0A A;  4EOY A;  1F0Z A;  1JAL A;  4TUU A;  1UF0 A;  1XD3 B;  2PPH A;  1WIA A;  3NHE B;  4KDI C;  4ZRJ A;  4NAM A;  3I63 C;  2WP9 B;  1F52 A;  3SU8 X;  4ZRK A;  1V8C A;  1YQ3 B;  3RNG C;  2KFJ A;  1IUE A;  2IPK D;  2BS2 B;  1TJE A;  4I6L B;  2KYW A;  2Y3A A;  3A1Q A;  4K7S A;  1FFV A;  1WMH B;  3TEZ A;  3AEE B;  3NVV A;  2Z59 B;  3NVZ A;  1T0S C;  2JWZ A;  1MVK A;  1WH3 A;  4LNF A;  4MM3 B;  4P6V F;  1WSP A;  1X1M A;  3LJ3 A;  1TZ1 A;  3N30 A;  4CO7 A;  1MPE A;  1WFY A;  4LTU A;  2EMS A;  2VZK B;  1R4M I;  3DVN U;  3TIX A;  3ZUN A;  3J9C A;  1UGJ A;  1L2N A;  2AWT A;  3PSE B;  3AEB B;  4DQO C;  1FD6 A;  2KK8 A;  1STE A;  4WQM A;  2UWQ A;  1K50 A;  3ZJV A;  1LXD A;  1IP9 A;  2QMT A;  5JZE B;  2L00 B;  3AE9 B;  1B9R A;  1S1Q B;  4REZ A;  4WH4 A;  1LO5 D;  4XDD A;  1NDD A;  2G4S A;  2H89 B;  4P7I A;  1UUP A;  2WXK A;  1FXA A;  1SB3 C;  1EUV B;  5BYS A;  1XF5 L;  2KTR B;  1I4G A;  3ZYY X;  4RGO S;  1YX5 B;  3IXS A;  4MDK E;  1OGW A;  3SHQ A;  2K8H A;  2AQ3 B;  3ECI A;  1YIW A;  4LCD E;  2O2V A;  3V60 A;  2KAJ A;  2G9H D;  1ZOY B;  2NR2 A;  4LJP B;  5IKC M;  3MHZ A;  3DVG X;  1TS2 A;  2QC8 A;  1EO6 A;  2RSU A;  2M19 A;  1Z5S B;  3QWZ B;  2J42 A;  2ZVN A;  3GZN I;  3RMK C;  5BMI A;  2WNM A;  3DBS A;  5EDS A;  1WGH A;  4RH6 A;  2DZK A;  1ZE3 D;  2CR5 A;  1H4R A;  1F2R I;  3A9K B;  4M8M A;  1WJ6 A;  3CSF A;  2D11 A;  3APF A;  5TR5 A;  4BKG A;  5HFY A;  2LXA A;  3ZXV A;  1HXY D;  1F9J A;  4B0M A;  4YSZ B; 
#chains in the Genus database with same CATH homology
 2AEH A;  1RRB A;  4WJQ A;  1NI2 A;  5AZG A;  2MLB A;  4IWO A;  2J0K A;  2M8S A;  1WXM A;  4HPL B;  1OTR B;  4MSM B;  4RMA A;  1GC7 A;  4RM8 A;  2K8B A;  1HE8 A;  5LXH A;  2JRI B;  4PYZ A;  2MBQ A;  2GBN A;  3VH3 B;  2C7M B;  1H8C A;  4FJZ A;  4W9D A;  1WZ3 A;  4TQ1 A;  5DPW A;  1Q5W B;  4K1R B;  5AZH A;  3K9P B;  2ASQ A;  3L16 A;  1V49 A;  2JPH A;  1S3S G;  2ZPY A;  3SDL C;  2J0J A;  2KAN A;  2OJR A;  3O65 B;  4XZ4 A;  1GG3 A;  4DHZ B;  2BYE A;  1WX9 A;  1WJU A;  3JSV A;  4W9K A;  2NVU I;  3DVN V;  2CKH B;  3MTN B;  3B1L X;  1TTN A;  1WE7 A;  4YL8 A;  2IYD B;  2KDB A;  4M0W B;  4GXB A;  1WGD A;  3V62 A;  4E74 A;  2KFK B;  3B0A A;  1SIF A;  2N7E A;  3ENE A;  3IFW B;  2MRP A;  4ICU A;  3U7D A;  4KDL B;  4PS7 A;  1WX7 A;  2AL6 A;  5J18 A;  3UQA A;  4NPN A;  1RFA A;  2LWP A;  2LZ6 A;  3QJZ A;  5AZF A;  3ZNI D;  2BKF A;  4IW0 A;  2K39 A;  3L10 B;  1TBE A;  4MGY E;  2C60 A;  4B9K A;  2FCN A;  4I6N B;  3UGB B;  2D2Q A;  1WRD B;  2LVO A;  3ZVV A;  3KYC D;  3CST A;  4BOZ B;  5BO4 B;  3DBH I;  2R2O A;  4MGZ E;  2LUE A;  3TL5 A;  2DYM A;  5GMV A;  2KOX A;  4ZDV A;  4ZRI A;  3A1Q B;  4WWN A;  4MGI E;  3R7Q A;  1E8Y A;  1UZX B;  1VD2 A;  2CU1 A;  2KC2 A;  2PE9 A;  2GBM A;  3UIN B;  3A9J A;  3WIM A;  3RZF A;  4DHJ B;  2G3Q B;  4BBN C;  3GOE A;  3NOB A;  3ZTD A;  4BVU C;  3L17 A;  2FCM A;  2NBU A;  2DAF A;  3L13 A;  2C9W B;  2N9E B;  4G3X B;  4A3P A;  3PZD A;  1WXS A;  2DHZ A;  4KIK A;  3DBR I;  2LGD A;  4IM2 A;  4MM3 A;  3DPD A;  3N32 A;  4DHJ D;  4FBJ B;  5G2N A;  2K25 A;  1ZKH A;  3VHT C;  3X0W A;  2EKE C;  4FA6 A;  2L76 A;  3QAR A;  5JHA A;  2BWF A;  2LVP A;  4EFO A;  2KC1 A;  3VXW A;  3DVG Y;  1WGY A;  4W9C A;  1C1Y B;  4BKT A;  4XX5 A;  3PVL A;  2GBK A;  2KHW B;  1IPG A;  3QQ8 B;  3V61 A;  4HCN B;  5CHF A;  3UQB A;  2K1F A;  2MBO A;  2NS5 A;  3HM3 A;  2D07 B;  2JXX A;  2LGY A;  5J17 A;  2KQS A;  4K7U A;  4IM3 A;  1VCB A;  2FNJ B;  4NJ6 A;  2MQJ A;  3A33 B;  1LM8 B;  2QHO A;  3WAP A;  2XEW A;  4IG7 B;  1P9D U;  3MJW A;  3APC A;  3Q3F A;  4DWF A;  3VTV A;  2M1M A;  2FCQ A;  2KQ7 A;  3DDC B;  4WQO B;  3SD5 A;  2KX3 A;  2KO3 A;  2RPQ A;  2ZCC A;  3PTF C;  2JVC A;  4HJK A;  3EEC A;  1QZE A;  4IUM B;  3ZKJ C;  3QX1 A;  4KSK C;  1GJZ A;  2ZNV C;  2BKR B;  2AYO B;  3APD A;  3ZRF A;  3ZNZ B;  1EF1 A;  4IC7 B;  3KVF B;  3WAM A;  3M63 B;  1UGM A;  2A4Z A;  1RAX A;  2Z0D B;  3NZU A;  3ZO5 B;  4AUQ C;  2CHX A;  2DYB A;  1J8C A;  3VAW A;  3DCG A;  2DAJ A;  4FHK A;  2I1J A;  4G11 A;  4HPM B;  3M3J A;  2WYQ A;  4E3C A;  3S2A A;  4CYE A;  2JZZ A;  2KMC A;  2UYZ B;  3HHM A;  3HM6 X;  4EZK A;  3I3T B;  3PRZ A;  4PYU A;  3ML8 A;  2PJH A;  1KLV A;  4N9F 4;  3VQI A;  3VUY A;  2RD0 A;  1WZ0 A;  3IHP C;  4B95 A;  3EFU A;  4MSQ B;  4NAW B;  3AXC A;  3TBL D;  2KKC A;  2C7H A;  2K6D B;  3TMP B;  4ANU A;  1WR1 A;  5LLI A;  2KMA A;  2DEN B;  3NZS A;  3H7P A;  2HE7 A;  2O6V D;  4JLC A;  3WAO A;  4RM9 A;  4IWQ A;  3U8Z A;  2IY0 B;  4DBG A;  1OEY J;  3RZW C;  2G4D B;  1E5W A;  3QC8 B;  3RUI B;  4JQW C;  4BKS D;  4W9L A;  4AJW A;  2KJH B;  1UH6 A;  4LJO B;  2KTR A;  2JY6 A;  2PEA A;  3A9J B;  3UIP B;  2KD0 A;  1WXA A;  3W1Y A;  5LXI B;  2BF8 B;  1WY8 A;  2WWZ A;  3WAL A;  2DZJ A;  1L7Y A;  2KTF A;  2N1W A;  4FUL A;  5AEK B;  3IBE A;  3M62 B;  3OJ4 B;  2KWU B;  4MEL A;  3PS6 A;  2KWV B;  1GUA B;  4KIK B;  2IO1 B;  2JF5 A;  1E7U A;  1J19 A;  2JZ3 B;  2MX2 A;  1OEY A;  2O2V B;  1E8Z A;  1V86 A;  4W9G A;  3K9O B;  1UD7 A;  2ZNV B;  4BBN F;  2R2Q A;  3KUZ A;  4WWO A;  2DYO A;  4HDQ A;  4OVU A;  3ZRC A;  2ZPN A;  3W1S A;  5G55 A;  4MJS A;  3BIN A;  1V9J A;  1WJ4 A;  4NQK E;  4G50 A;  2FAZ A;  2MBH A;  2ZCB A;  4AJY B;  1ISN A;  3RUL A;  4FLH A;  3DOW A;  4BFR A;  5D2M B;  3HK0 A;  3RCZ A;  3PRP B;  2BYV E;  4NY0 A;  1K8R B;  1TGZ B;  4NJ7 A;  4AP4 C;  1T0Y A;  3IG3 A;  4KVG B;  1I42 A;  3MHS D;  3IVF A;  5HKH A;  4GSW A;  2K8C A;  4HXD A;  5JHB A;  3H6N A;  3VTU A;  2IO0 B;  3W1S C;  4GIV A;  5D94 A;  5E6N A;  1XT9 B;  1WR6 E;  3RD2 A;  2JT4 B;  3PGE A;  2KLC A;  2CHZ A;  4FHJ A;  2LJ5 A;  3RT3 B;  2L05 A;  4W9F A;  3PHW B;  3CF6 E;  4GB9 A;  4W9J A;  1WMH A;  2XBB C;  2IZV B;  5J2R A;  1SGH A;  3PRM B;  4DK5 A;  2M17 A;  1WE6 A;  2L0T A;  4FAD A;  3ZW3 A;  1EF5 A;  5JH5 C;  2WX0 A;  3V6C B;  1KM7 A;  3V6E B;  3PHX B;  3L0W B;  2LRW A;  4GDL B;  2KN5 A;  2KJ6 A;  4URK A;  4G0N B;  2XK5 A;  3H7P B;  1RLF A;  5DPT A;  3EC8 A;  2J7Q B;  3AUL A;  3ML9 A;  4KV2 A;  4TV3 A;  1C3T A;  1Z2M A;  2MSE D;  4A3O A;  3KW5 B;  1U4A A;  4K81 A;  3EHV A;  1NBF C;  2D10 A;  4ANX A;  3H9D A;  2Y5B B;  3R66 C;  3ZTC A;  3JW0 X;  4W9I A;  3VTW A;  3KUC B;  4II2 B;  3KUD B;  3OAW A;  4WJN A;  1UEL A;  2KXJ A;  2LXC A;  2MP2 A;  2DZM A;  3JSV B;  3VUW A;  2ZZP B;  2ZJD A;  3QIJ A;  4E71 A;  2A5U A;  4GOC A;  4EOY A;  2MWS B;  3H7S A;  2N7D A;  3QCA A;  3RYT A;  3WAN A;  4TUU A;  2PE6 B;  3A4S C;  3VH4 B;  1E90 A;  2V4L A;  1XD3 B;  1WF9 A;  2PPH A;  1WIA A;  1V2Y A;  3NHE B;  1WX8 A;  4KDI C;  4EEW A;  4ZRJ A;  4DDI D;  5CHW A;  5IAA C;  4HLE A;  4DDG D;  5D6J B;  3DQV A;  3UF8 A;  2REX A;  5E6P A;  1YX6 B;  2KJR A;  3QA8 A;  3T9L A;  4F1S A;  3SU8 X;  3JYU A;  5CTR C;  2KWC A;  4IM0 A;  2GBJ A;  4ZRK A;  3NY5 A;  4F7Z A;  1CMX B;  2KFJ A;  4KZC A;  1WJN A;  5KHO A;  1KJT A;  1YJ1 A;  4WJO A;  4TQ0 A;  5L83 A;  4A20 A;  1P0R A;  3T8M A;  3PV1 A;  4I6L B;  2IBI B;  4HWI B;  2DX5 B;  2V1Y A;  2NBW B;  2W9N A;  3QAQ A;  4WAA A;  4PS8 A;  5DPS A;  3AU5 A;  3A1Q A;  5C1Z A;  2C5L C;  4K7S A;  2KNB A;  2FUH B;  1M94 A;  1P3Q U;  2DZI A;  1WMH B;  3OLM D;  3ONS A;  2KLG A;  4X57 B;  3PLU A;  4KZ0 A;  1A5R A;  1D3Z A;  1E7V A;  1E8W A;  2Z59 B;  1Q1O A;  5C23 A;  2HD5 B;  4HK2 A;  1P1A A;  2JWZ A;  2IO2 B;  2OOB B;  4KSL C;  2ZVO A;  4EKU A;  1WH3 A;  2FCS A;  1SE9 A;  1ZGU B;  4ZYN A;  4GGQ A;  1X1M A;  4MEM A;  3BY4 B;  3X23 A;  3LJ3 A;  1TZ1 A;  1Y8R C;  3N30 A;  2NPT A;  4CO7 A;  2HTH A;  3C0R B;  1UBQ A;  1WFY A;  2HJ8 A;  1LQB A;  2GMI C;  3Q3J A;  5DPR A;  4LDT B;  2EMS A;  4EUT A;  1R4M I;  3HIZ A;  5D7G A;  2BPS A;  3H1U A;  2WX1 A;  1LFD A;  2RGF A;  1I35 A;  3QHT A;  2L0F A;  3DVN U;  3PPA A;  3KH0 A;  3LDZ E;  4MH0 E;  3TIX A;  3ZUN A;  2BYF A;  3AU4 A;  4W9E A;  4LDT D;  2KDI A;  2C7N B;  1L2N A;  2AWT A;  5DCN A;  3UIO B;  3OJ3 A;  3PSE B;  4GDK A;  1WM2 A;  5FR6 A;  2D3G A;  2FID A;  2KK8 A;  3ZNH B;  2EMT A;  4EZL A;  2CHW A;  4XC2 A;  1ZW7 A;  2BGF A;  2MP2 B;  3N3K B;  5CHV C;  2UWQ A;  2WDT B;  2N9X A;  1LXD A;  5L95 C;  1IP9 A;  3VFK A;  1YQB A;  2JUO A;  5JZE B;  1WXV A;  2FIF A;  2N9P C;  3A4R A;  1WYW B;  2L00 B;  4FN2 A;  2Z0E B;  4JGH B;  3R7R A;  2YLM A;  1S1Q B;  3VUX A;  2L7R A;  3A9K A;  2MBE A;  3ZLZ A;  3PRE A;  2KDF B;  1NDD A;  2L3Z A;  2GOW A;  2RR9 A;  1YD8 U;  2O6V A;  3R3M A;  2YVC A;  2BWE S;  2G4S A;  4NAW A;  1PQS A;  1V5T A;  4WJP A;  4FJY A;  2CS4 A;  1J0G A;  1V80 A;  4BKS A;  2MA9 B;  4P7I A;  4MGK E;  5KHQ A;  3L08 A;  3B08 A;  3AI5 A;  1EUV B;  2KTR B;  1AAR A;  4NNJ B;  2LI5 A;  4B6W A;  1GNU A;  4M8N A;  4II3 B;  2M0X A;  3WA0 A;  3D32 A;  4GMV A;  1YX5 B;  4MDK E;  4AWJ A;  1KOT A;  1OGW A;  2M4N A;  1GC6 A;  3SHQ A;  2K8H A;  4CHK A;  3ECI A;  1V6E A;  2JRH A;  1YIW A;  4LCD E;  1IYF A;  4FJV B;  2O2V A;  3V60 A;  2LVQ A;  3ZDM C;  1E8X A;  2B3A A;  4ANW A;  1V5O A;  2L8J A;  2NPT B;  3L54 A;  4ANV A;  3JVZ X;  2LD9 A;  2NR2 A;  4DXA B;  4LJP B;  3NS8 A;  2KFK A;  1BT0 A;  2AL3 A;  3DVG X;  4I6P A;  4MJS B;  1WM3 A;  4PS3 A;  1MG8 A;  2K6Q A;  3ZNG C;  2MW5 A;  2N4F A;  2KZR A;  3QK0 A;  1WGR A;  4JL9 A;  1Q0W B;  4F8C B;  3ALB A;  4GDK B;  3PT2 B;  2V3S A;  2VRR B;  1EO6 A;  3ZDT A;  1WI0 A;  2RSU A;  2NBV B;  1P98 A;  4ICV A;  2IY1 B;  1V81 A;  4GU2 A;  1R4N I;  4J6I A;  1Z5S B;  2GBR A;  4NQL B;  3QWZ B;  2I1K A;  1G6J A;  3M95 A;  2LGX A;  3VVW B;  2KX0 A;  4K7W A;  4OVV A;  2MBB B;  2ZVN A;  3GZN I;  2LAS A;  4TKN A;  3DBS A;  5EDS A;  2J0M A;  1WGH A;  3CMM B;  3PLV A;  4HCP B;  2DZK A;  3U30 A;  4JIO U;  3VDZ A;  4ASW C;  4GN1 A;  2CR5 A;  5CX3 A;  1XQQ A;  1H4R A;  3TJP A;  5IA7 A;  4HDO A;  1JRU A;  3A9K B;  4M8M A;  1WGG A;  1WJ6 A;  5E6O A;  3CSF A;  4W9H A;  4DHZ E;  2D11 A;  2O6V B;  4AOF A;  1FXT B;  3KYD D;  3DBL I;  4IWP A;  2KDE B;  4EZJ A;  2KVR A;  3APF A;  1OQY A;  4GDL A;  4BOS C;  1UBI A;  5TR5 A;  2IO3 B;  3TCA A;  4WWP A;  4BKG A;  2G45 B;  2ZEQ A;  3P2B A;  2MCN B;  2LXA A;  2NCN A;  1F9J A;  3ZIM A;  2XK5 B;  4HVB A;  2LRU A;  2N1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...