4RM8A

Crystal structure of human ezrin in space group p21
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
586
structure length
368
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Ezrin
total genus 130
structure length 368
sequence length 586
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm8A01
5LXHA 4DHZE 2LXCA 4GDLB 4FJZA 4KZCA 2LWPA 2FNJB 3Q3JA 3K9OB 4TV3A 4GU2A 3A33B 3ZTDA 3ZUNA 4EZLA 5JZEB 2BYEA 2V1YA 2K8BA 2KFKB 2JRHA 1WI0A 3WA0A 2OOBB 4LDTB 5BO4B 3BY4B 3APFA 3NZSA 5D7GA 4DDID 1G6JA 1LM8B 2KWVB 4FJVB 4W9FA 3NS8A 3EC8A 3PLVA 2MBOA 5AEKB 4W9LA 3AXCA 4KSLC 2L0FA 3IG3A 5G2NA 4DK5A 2KNBA 2BYVE 4II3B 1GUAB 2PEAA 4NJ6A 2O6VA 3QWZB 3B0AA 3A9JA 2JUOA 4GIVA 4GMVA 4LCDE 2JVCA 1ISNA 1GJZA 2JZ3B 4I6PA 1YJ1A 2JWZA 2W9NA 2D2QA 1IPGA 3W1SA 1KJTA 1BT0A 2FUHB 4DHJB 3V6EB 2BKRB 2YVCA 3N30A 2K25A 1WF9A 3EFUA 3TMPB 3ZVVA 4BFRA 3H7PA 3NZUA 1Y8RC 1V86A 2FIFA 2KMCA 5CTRC 1V2YA 1NBFC 2IY0B 5D94A 1V9JA 4NY0A 2Z59B 3ZIMA 2FIDA 2DZIA 1F9JA 1OQYA 1WX7A 2IO0B 3AU4A 4MH0E 1WY8A 1D3ZA 1QZEA 4G11A 1OGWA 4P7IA 3RD2A 1Z5SB 2DX5B 3LJ3A 2O6VB 3VTWA 2M8SA 5DPSA 5KHQA 4PS3A 3N32A 2CHZA 4MDKE 4PS7A 4IG7B 2CKHB 2N9PC 2L8JA 2IO3B 4K1RB 2I1KA 4KDLB 4BKTA 1RFAA 2LD9A 5DPTA 2WX1A 1T0YA 3CF6E 4EZKA 2KTRB 3L13A 3ZNGC 3VVWB 3GOEA 4HWIB 3SDLC 2KJ6A 2RD0A 2HTHA 2RSUA 4GSWA 4W9EA 3HHMA 3H7PB 4GGQA 3QX1A 3A4SC 3DVGY 3OJ3A 2LGDA 1UD7A 5DPRA 3U30A 1V6EA 4J6IA 2VRRB 5LXIB 2RR9A 3IFWB 3DBHI 2LGXA 2LUEA 2Z0EB 4FN2A 4A20A 4URKA 4I6NB 2C7MB 2G4SA 3VUYA 3WAPA 2J0JA 2G4DB 1EF1A 2JPHA 2KLCA 2NBUA 2ZNVB 3HM3A 4ICVA 4MM3A 4HVBA 1YIWA 3CSFA 5AZHA 4EKUA 3VQIA 2CHWA 1J19A 4M0WB 2N7DA 3QQ8B 1E7VA 2KTRA 3SD5A 4DXAB 3A9KB 3ZNHB 4AJWA 3NHEB 5J18A 3AI5A 1UGMA 4NQLB 3HK0A 3RUIB 1WGRA 2IO1B 2L00B 3KYCD 4KDIC 4MELA 5DCNA 1EUVB 2FAZA 3VAWA 1RAXA 3PV1A 5EDSA 1FXTB 1ZW7A 3DCGA 4AP4C 2MBEA 2D10A 2KX0A 1LXDA 1E8YA 4BBNF 2BGFA 1RLFA 4WJOA 2HJ8A 3MHSD 2K8HA 3EECA 4FHKA 1V80A 2KHWB 4IWOA 2K6DB 2KLGA 2UYZB 4F7ZA 5IAAC 4WWPA 4XX5A 5AZFA 5JHBA 2B3AA 3PHWB 4FULA 4HLEA 2MBBB 3C0RB 1V5TA 2K8CA 4E74A 3A9KA 4XC2A 3R3MA 2L76A 3PS6A 3DPDA 2MLBA 4A3PA 3DVNV 2KFJA 2GBNA 4G3XB 4HDQA 1WM2A 2R2OA 3QA8A 4MJSB 1J0GA 4OVUA 3BINA 2NBWB 3QK0A 4HPLB 2KWCA 3RYTA 4M8MA 3KYDD 1SIFA 4IWPA 4N9F4 1WJ6A 5LLIA 1WH3A 4ANUA 2KN5A 5GMVA 3H9DA 5CHFA 2XK5B 2M0XA 1EF5A 4GOCA 3W1YA 3V6CB 1WR1A 2C5LC 3ZO5B 2MW5A 2NR2A 1V81A 1WFYA 3QIJA 3VFKA 3PSEB 1WMHB 4TKNA 3VHTC 2R2QA 4NJ7A 4PS8A 2V4LA 3U8ZA 2RGFA 3RZWC 3M3JA 4KZ0A 3X0WA 4NPNA 2MBHA 4IM3A 2CS4A 3WAOA 2DZKA 3QHTA 1WXAA 4DHJD 2PPHA 3DBSA 1AARA 2ZVOA 2GBRA 2G45B 2DYOA 3ZLZA 3ZTCA 1WYWB 4GDKB 4IUMB 1VCBA 3PLUA 4DBGA 1J8CA 4DWFA 1U4AA 4MJSA 1WRDB 1K8RB 2O2VB 2KZRA 4ANWA 3QJZA 4K81A 2DZMA 3TJPA 2LGYA 4E71A 3UIOB 1TGZB 4EOYA 4RM8A 3KH0A 1UBQA 2FCSA 4BBNC 2N7EA 4BKSA 2RPQA 2XK5A 3WANA 2REXA 2LVQA 3I3TB 5AZGA 2BWES 2O6VD 2C9WB 3UIPB 1H4RA 2LJ5A 3PT2B 3ONSA 1WMHA 2GBKA 3B1LX 2N1VA 1Q1OA 1WJ4A 1WR6E 3UQBA 1CMXB 2XBBC 2J7QB 4GXBA 4M8NA 3H7SA 1Q5WB 4EUTA 4WJPA 3OLMD 3QCAA 3OAWA 4EEWA 3RT3B 4GDKA 3A4RA 1X1MA 2DAFA 3VUWA 3PGEA 3WIMA 3EHVA 1GC6A 2M4NA 3P2BA 2O2VA 2KMAA 4TQ1A 3W1SC 3PTFC 2EMTA 3UF8A 5FR6A 2AYOB 1Q0WB 4MEMA 2I1JA 2J0KA 2LRUA 4A3OA 4IW0A 3ALBA 2KWUB 4II2B 1WGGA 3QAQA 2AEHA 2MSED 3IBEA 3MTNB 4JGHB 2NPTB 4KSKC 4AWJA 2A5UA 1I35A 2DZJA 3V60A 3DOWA 3TL5A 1E8XA 2BKFA 4F1SA 3CSTA 5KHOA 3ZRCA 3DDCB 4JQWC 1GNUA 2PE6B 4XZ4A 3PREA 1E90A 1S3SG 4W9HA 1WGYA 2GBJA 3SU8X 2D11A 3NOBA 2HE7A 5CX3A 2PE9A 1WZ3A 4JLCA 1XT9B 3WALA 2KD0A 3A1QB 3APDA 2EKEC 4K7UA 2KQ7A 4IM0A 4IC7B 1WZ0A 1LQBA 2GMIC 2CU1A 3DQVA 3O65B 4MGIE 2KQSA 5L95C 4DHZB 2J0MA 2D07B 4RM9A 3RULA 2L0TA 4ANVA 4ZDVA 1WM3A 2NPTA 4X57B 3KW5B 5J17A 4HCNB 2WDTB 3HIZA 1OEYJ 2ZNVC 2ZZPB 3DVGX 1YX5B 2MX2A 3PRZA 3X23A 2IBIB 1E8ZA 2NS5A 3GZNI 3ZNID 2M1MA 2NCNA 2OJRA 3VDZA 5D2MB 2KO3A 4ZRJA 3RZFA 2BPSA 1TZ1A 2KOXA 1WE6A 2ZCBA 4W9GA 3R7QA 1C1YB 1R4NI 3M95A 4PYUA 3V62A 4WJNA 4MSQB 3L54A 1WJNA 1TBEA 1OEYA 3A1QA 1KLVA 2LVPA 1HE8A 4LDTD 2KKCA 2GOWA 1GG3A 1UH6A 1YQBA 3ZDTA 1WIAA 4W9JA 4BOSC 1WGHA 2GBMA 3H1UA 3AULA 3B08A 5JH5C 3N3KB 3VH4B 1VD2A 3UQAA 1P0RA 3RCZA 1MG8A 2M17A 2NVUI 2L7RA 2ZPYA 2N1WA 1E8WA 2WYQA 2BWFA 5TR5A 3TBLD 4IM2A 3TIXA 1A5RA 2ZCCA 2JZZA 5E6PA 4E3CA 3L16A 4G50A 2HD5B 4ANXA 3T8MA 1KOTA 3JW0X 2FCMA 2JY6A 4FJYA 4WAAA 3UINB 3UGBB 3ZDMC 4BVUC 4TUUA 4ICUA 2KDEB 4DDGD 2IO2B 2KVRA 2KX3A 3QC8B 4KIKA 2Z0DB 1WXMA 1WXVA 3DVNU 1NDDA 5J2RA 4NQKE 1YD8U 1YX6B 4CYEA 4EFOA 1S1QB 2LXAA 4GB9A 4F8CB 4NAWA 1PQSA 2C7HA 4HPMB 5JHAA 4PYZA 3L17A 3VTUA 3ZKJC 2DAJA 2PJHA 3VH3B 3SHQA 4FHJA 4MGZE 2JT4B 3TCAA 4HDOA 1XD3B 5C23A 4WQOB 1WE7A 4AOFA 2BF8B 1R4MI 2AWTA 3PPAA 1ZGUB 2AL6A 2G3QB 2D3GA 2IY1B 3LDZE 3NY5A 4HCPB 2LZ6A 1H8CA 3ML9A 4B9KA 3ENEA 2CR5A 1V49A 3L0WB 2KK8A 4BOZB 3VUXA 4FA6A 2UWQA 1I42A 2KC2A 3KUDB 4KIKB 2DYMA 1RRBA 3MJWA 4MGYE 1UZXB 4NNJB 4AJYB 1P98A 1TTNA 3L08A 1IP9A 2K1FA 3ECIA 3R7RA 3S2AA 2MRPA 4NAWB 5D6JB 5G55A 2IZVB 3H6NA 3V61A 1WJUA 1V5OA 1SE9A 2JF5A 2N4FA 3D32A 3ML8A 1KM7A 3ZRFA 2CHXA 2JXXA 2Y5BB 3PRPB 4ASWC 1IYFA 1P1AA 3WAMA 2XEWA 4B6WA 3ZW3A 2MQJA 4KV2A 3K9PB 1LFDA 2ASQA 2LRWA 3PVLA 3L10B 4CO7A 2NBVB 3APCA 2K39A 4FADA 2WX0A 3IHPC 5HKHA 1GC7A 2V3SA 1UELA 4ZRIA 3M62B 3CMMB 3JYUA 4CHKA 4AUQC 4MSMB 3JSVB 3KUCB 3QARA 2K6QA 4W9IA 2MP2A 2MBQA 1ZKHA 3IVFA 2KANA 1OTRB 1P9DU 2KDFB 4JL9A 1E7UA 4WWOA 4GN1A 2FCNA 2LVOA 3R66C 5CHWA 2A4ZA 3T9LA 2KTFA 2DENB 4FLHA 2N9EB 5E6NA 3KUZA 4K7WA 2MA9B 4YL8A 1M94A 2LASA 4MGKE 4OVVA 5CHVC 4B95A 1L2NA 4EZJA 5IA7A 3OJ4B 1WGDA 4K7SA 2AL3A 4W9KA 1UBIA 3PZDA 3U7DA 2KDIA 1WX8A 3VTVA 2ZEQA 2BYFA 2MWSB 2LI5A 1EO6A 2KDBA 3JVZX 1WXSA 4GDLA 2L05A 3VXWA 3ZNZB 2KJHB 3Q3FA 1E5WA 2ZJDA 2MCNB 1C3TA 4LJOB 4W9DA 4WJQA 2N9XA 1NI2A 1L7YA 2C7NB 3PHXB 3M63B 4RMAA 3JSVA 2KFKA 3AU5A 2FCQA 2IYDB 3DBRI 4HJKA 4HK2A 2MP2B 2YLMA 2C60A 4JIOU 4WWNA 2EMSA 2DHZA 1JRUA 4HXDA 4I6LB 2KJRA 2ZPNA 2DYBA 4FBJB 1XQQA 3PRMB 5C1ZA 5L83A 2WWZA 4KVGB 1WX9A 3HM6X 4LJPB 4ZRKA 4BKSD 2KC1A 1SGHA 4IWQA 4BKGA 2L3ZA 2JRIB 2ZVNA 1Z2MA 4G0NB 5DPWA 2QHOA 1P3QU 3KVFB 4TQ0A 3A9JB 4W9CA 5E6OA 4ZYNA 3DBLI 2KXJA
chains in the Genus database with same CATH superfamily
4C7ZA 3ZJTA 3K9OB 3Q3MC 5D3DA 1TY2A 2JRHA 2W55A 2D3CA 1UWMA 3NZSA 1LM8B 2MBOA 4KSLC 2BYVE 1GB4A 4YXDB 3A9JA 4GMVA 1GJZA 4ZOHC 1ISNA 3NVYA 2JZ3B 3EGRA 1YJ1A 2JWZA 2W9NA 4L1BA 1KJTA 2WU2B 1AWDA 2WXGA 3V6EB 2YVCA 3N30A 2K25A 3EFUA 3H7PA 2KMCA 1NBFC 1HA5A 4RF0A 2L52A 4USAA 4MH0E 1N60A 1D3ZA 4G11A 1OGWA 2XN9C 4P7IA 3LJ3A 2DX5B 1T0SC 5DPSA 4PS3A 3BK2A 4IG7B 3AV8A 4KDLB 1RFAA 5DPTA 2WX1A 1T0YA 4C56C 2KTRB 1D4BA 3GOEA 4HWIB 4W9EA 3HHMA 1TKGA 4WIPA 1NVID 4H2AA 3NG0A 3R2TA 1B9RA 2MJDA 3OJ3A 4WURA 1IUEA 1V6EA 4J6IA 1CQVA 2BT6A 2LUEA 4URKA 4RH6A 4I6NB 2K9XA 2KLCA 3VQIA 3DBHB 4A9AA 3P63A 1FNVA 5J18A 3T3NA 2ONQA 1FMAD 3HK0A 2L00B 1EUVB 1RAXA 2CJOA 3DCGA 2KX0A 4LNKA 1RLFA 2HJ8A 4KKIA 4KGRA 4IWOA 2K6DB 2UYZB 4XX5A 2WXIA 5AZFA 5JHBA 4FULA 3RPFC 1XCQL 3A9KA 2L76A 3FC4A 3Q6BA 2MLBA 3DVNV 2R2OA 1MVKA 1TT5B 3QA8A 2JXTA 3ZGZA 1QLBB 2NMQA 1F77A 4IWPA 2D3BA 1WH3A 2XK5B 2M0XA 3N1ZC 1FCLA 1JROA 1WR1A 1V81A 2ZW1A 4MH8A 5H8YE 1WMHB 4OZBA 2R2QA 2V4LA 3U8ZA 3RZWC 4NPNA 2MBHA 1WXAA 2AQ1B 2ZVOA 4ARCA 4IUMB 4DWFA 1U4AA 2K3UA 4K81A 3TJPA 1AW7A 2J52A 3KH0A 1TZOA 1I4GA 2RPQA 1ZE3D 3UIPB 5AZGA 1H4RA 2LJ5A 3PT2B 2IGDA 2JSVX 2GBKA 1WJ4A 1CMXB 2J7QB 5HFYA 1Q5WB 4WJPA 3OAWA 4OZCA 5E6JA 3AE9B 3A4RA 3VUWA 2KT7A 1GC6A 3EA6A 3PTFC 1YOVB 4MEMA 2ZW0A 2J0KA 1UGJA 1VZ7A 4C7YA 2WQYB 2KWUB 1WGGA 3IBEA 4KSKC 4YSYB 3V3XA 3TL5A 4RF1A 1KFYB 1TYGB 3AEBB 2N9LA 1EWYC 4GLSC 1GNUA 1N63A 4M00A 3PREA 1E90A 1ENFA 3T3OA 2D11A 1V1OA 1JCKB 2PE9A 1WZ3A 2FE8A 2JYTA 3A1QB 2KMMA 3FAHA 4J3OD 3TSSA 2D07B 4ZRQA 2CU3A 3KW5B 3HIZA 3OWEB 2MX2A 1E8ZA 2NS5A 5HI1A 1YN4A 2MEKA 4S0RA 3RZFA 2VH1A 3RNEC 1WE6A 2WU5B 2ZCBA 3AE5B 3RNAC 1KTKA 3V62A 4KX6B 3E9SA 3A1QA 2KKCA 1YQBA 2L32A 1ACCA 2GBMA 3B08A 5JH5C 3UQAA 4C4VA 4A6QA 1FD6A 2L7RA 1E9MA 5TR5A 2BWFA 2IGHA 3TIXA 2BQQA 3I9V1 3T8MA 1KOTA 1N5XA 1JQ4A 2LGIA 4TUUA 2PTLA 2IGGA 2KVRA 4KIKA 2Z0DB 4JE3B 3RMKC 4NQKE 1PUTA 1C76A 1FEHA 4EFOA 4F8CB 4XYCA 4HPMB 1J7CA 3ZKJC 3VH3B 4YT0B 3TCAA 4C4VB 2BS4B 4WQOB 4AOFA 2WLBA 1R4MI 4US9A 2IY1B 1SEBD 3Q8AA 4B9KA 3ENEA 1V49A 1I42A 4NNJB 1P98A 1TTNA 3L08A 3I57A 4XWTA 3R7RA 3BYTB 2GB1A 5G55A 1OQQA 1HZ5A 2IZVB 4C00A 1SXTA 3V61A 1SE9A 1KM7A 1IYFA 1P1AA 3WAMA 1J7AA 1LFDA 2BS2B 4WWMA 1I4RA 1KF6B 2K39A 3W5UB 4DXFA 1UELA 2OJWA 3M62B 3R8BA 3CMMB 2Y3AA 3JSVB 4DXGA 4W9IA 1IGCA 2KDFB 1YJIA 2FCNA 3T9LA 2KTFA 3Q2AC 1M94A 1JW9D 4B95A 3BVMA 1NENB 4EZJA 3OJ4B 1F2RI 4RGOS 3JVZX 1EO6A 3Q3FA 1E5WA 4LJOB 1E10A 2N9XA 1L7YA 2QDFA 3PHXB 3RNCC 3RD2A 4P16A 2LEKA 4HJKA 2WDQB 1L4ZB 4FXCA 4I6LB 1XLOA 2ZPNA 2DYBA 3BYYB 3SFEB 4KVGB 2UU7A 4LJPB 5H92C 4IWQA 5DPWA 2QHOA 4TQ0A 2WDRB 4ZYNA 2YEPB 3IAS1 2KXJA 3MP9A 5LXHA 4DHZE 2LXCA 3MC0B 4FJZA 2LWPA 3AE7B 1FXIA 4GU2A 2RDHA 3ZUNA 4EZLA 1VZ8A 4KGSA 1FRDA 1WI0A 4LDTB 5BO4B 3APFA 1G6JA 1XCTL 1TY0A 2KWVB 3PLVA 3C8YA 4NAMA 4W9LA 4P1CC 5AEKB 2ICIA 5G2NA 1YJJA 3AM9A 2MH7A 2O6VA 3B0AA 2JUOA 4GIVA 4XDDA 4RGNA 4DHJB 1WF9A 4BFRA 3NZUA 1Y8RC 2WHIA 5I4DA 3HUIA 5BMHA 2FIDA 1F9JA 3AU4A 1QZEA 2D3AA 2M8SA 3AEDB 5HG2A 4MM3B 3N32A 2CHZA 4K3BA 4PS7A 3KLSX 1IBXA 2KAJA 2L8JA 4K1RB 2I1KA 3MFGA 2LD9A 4M0WA 4EZKA 2JX5A 3ZNGC 3VVWB 1N6ZA 4GSWA 2HTHA 2RSUA 4GGQA 1QKZA 5EE9A 2VRRB 5LXIB 3J9CA 4ZRPA 5GXGB 2QILA 4FN2A 1N61A 4A8XC 3VUYA 3IXSA 1EF1A 5AZHA 4EKUA 3AH7A 3NRZA 2L1AA 2QMTA 3ZNHB 4AJWA 1PGAA 3DBLB 1I4XA 3AI5A 4NQLB 2IO1B 2FAZA 2M56B 3PV1A 1FXTB 2RDGA 2MBEA 1E8YA 2BGFA 1WSPA 2LFIA 2DNFA 2KLGA 2N9KA 2B3AA 3GB1A 2QC8A 3PHWB 2PMVA 3ZXRA 1SF0A 1EWCA 3C0RB 3DPDA 1EU4A 2GBNA 1ET6A 1D5ZC 4M01A 4MJSB 4NZLB 3QK0A 2KWCA 2JZPA 4M8MA 3KYDD 3RYTA 1MHHE 3P42A 2AQ3B 1C4CA 4ANUA 2KN5A 5GMVA 5CHFA 3ZQ4A 3W1YA 1WRIA 1RFKA 1QOBA 4B0EA 1KLUD 1WFYA 3AEFB 3RNFC 2RGFA 1UUPA 3NVVA 2DBYA 2EKIA 4KZ0A 3DWMA 1C3TA 3QHTA 4DHJD 2PPHA 1AARA 2GBRA 2DYOA 4TSSA 4DBGA 1TJEA 4MJSA 2O2VB 4E71A 3RNGC 1TGZB 3ETRA 4EOYA 4XWWA 3BZDB 2FCSA 2N7EA 2JYEA 3C19A 2REXA 2O6VD 2JWUA 2IPKD 3TEXA 4EUTA 4EEWA 3RT3B 4GDKA 2DAFA 2M4NA 1N5WA 2O2VA 2KMAA 4IOIE 1OQRA 5FR6A 2WXFA 1Q0WB 2LRUA 4A3OA 3ALBA 4ZYSA 2FUG1 3Q8BA 4HPPA 4II2B 1D5XC 4JGHB 2NPTB 2A5UA 1JWUD 3V60A 2BKFA 1FNUA 1CJEA 1HZ6A 2MHJA 3CSTA 3VR9B 3ZRCA 3DDCB 1QQRA 1FIQA 4W9HA 1WGYA 2HE7A 2J53A 5CX3A 1T0QC 4NJCA 3WALA 1QOGA 2EKEC 2GMIC 2KQSA 1EU3A 1K52A 1WGKA 1FM0D 4RM9A 2AX5A 3RULA 3BK1A 4ANVA 1QF6A 1JRPA 5J17A 4X57B 1OEYJ 3PRZA 2PLPA 4ACFA 3GZNI 3VDZA 2KO3A 2X8XX 4Q2JA 1T6BX 1ZDXA 1KRHA 2SEBD 3R7QA 4WJNA 3L54A 1HE8A 1EM7A 2GOWA 1UH6A 3VRAB 4BOSC 1F0ZA 3RCZA 1E8WA 2Y5PA 2WYQA 1ESFA 4E3CA 2HD5B 4ANXA 3JW0X 2FCMA 5FKAC 3RI7C 2WGSA 2IO2B 2LMCA 2AQ2B 3QC8B 3EUB2 1V8CA 1WXVA 2HDEA 3DVNU 1NDDA 2D5GA 5J2RA 2PKOA 1S1QB 1P7EA 5JHAA 3KWVA 3SFDB 4HKQA 1WE7A 1TS5A 4QAYA 2AWTA 3PPAA 3LDZE 2G3QB 2D3GA 3DHHC 3ML9A 2CR5A 2SAKA 2KK8A 5BMGA 3VUXA 4FA6A 3KUDB 2RMMA 1FO4A 4AJYB 1MG4A 1IP9A 2K1FA 1FFUA 3AE4B 3N9YC 5HHDG 1QT9A 3AN1A 2MRPA 1PGXA 1XO3A 1PFDA 3H6NA 2WXMA 1WJUA 1PGBA 2JF5A 3ZRFA 2JXXA 2Y5BB 2XEWA 4B6WA 2ASQA 2LRWA 3PVLA 3VR8B 1ROEA 2OHFA 4WQMA 3KUCB 2MP2A 3IVFA 1L5PA 1OTRB 1P9DU 4JL9A 3RN9C 4S17A 5CHWA 2DENB 3N1YC 2M19A 5E6NA 1K50A 3KUZA 5C2TB 4XE0A 1FCCC 1UNSA 1WGDA 5JXVA 5MPOA 3VTVA 2ZEQA 2MWSB 2KDBA 1WXSA 2L05A 2KJHB 4KGTA 2MCNB 4EE2A 3Q14C 2C7NB 1GPXA 2KFKA 3AU5A 1FFVA 1T3QA 1JRUA 4HXDA 2KJRA 1F1HA 1WWTA 1WX9A 3HM6X 1JWSD 4BKSD 2BB6A 2JU6X 2KC1A 4L2YA 1Z2MA 4G0NB 3U52E 5BYRA 3Q3NC 3AEAB 1BXTA 2FNJB 3U2SC 3Q3JA 3ZTDA 2G1EA 5JZEB 2BYEA 2V1YA 1C4PA 1K53A 3BY4B 2KN4A 5D7GA 4DDID 3PO0A 4W9FA 3EC8A 1T5XD 3AXCA 3OG5A 3IG3A 1ZOYB 2N0SB 4DK5A 2KNBA 4OW0A 1GUAB 2WXOA 4NJ6A 2LHEA 3QWZB 4C80A 2JVCA 2KVZA 2I38A 2D2QA 4TMAB 1RM6C 1IPGA 1F2RC 3W1SA 1FNWA 1BT0A 5IP4D 2BKRB 3I63C 3TMPB 3ZVVA 1MFWA 2FIFA 4RCOA 4RGMA 2MJ3A 5D94A 4NY0A 1LGRA 3ZIMA 4XGAB 3IAM1 2DZIA 1OQYA 2G9HD 1BMLC 2LUMA 2O6VB 3VTWA 5KHQA 3U7ZA 4MDKE 1YQ3B 2HJ1A 1I4PA 2N9PC 4OVZA 3W2DA 3L13A 2KJ6A 1DGJA 3QX1A 2WXPA 3A4SC 3DVGY 2LGDA 1UWXA 5DPRA 2INDC 2RR9A 3DBHI 1TS4A 3DBRB 3Q8EA 3R2IA 1M4VA 2C7MB 2G4SA 4LNIA 3WAPA 2J0JA 2Q5WD 2JPHA 2ZNVB 2NBUA 5IOIA 4ICVA 4HVBA 1YIWA 4YTNB 3FILB 2CHWA 1HTOA 1J19A 4M0WB 3QQ8B 1E7VA 3SD5A 3A9KB 3NHEB 2K0PA 2M0AA 1UGMA 4JX1C 1WGRA 3I5JC 4MT5A 5DCNA 3VAWA 5EDSA 2D10A 3RFZB 4JWSC 1LXDA 4BBNF 3P4PB 2K8HA 4AQ7A 4FHKA 3CIRB 2BYTA 1N62A 2KHWB 1R4NB 4F7ZA 5IAAC 2VH2A 3FILA 2GI9A 2IDYA 4HLEA 2KDMA 1XLPA 1V5TA 4XC2A 3R3MA 3PS6A 3LB8C 2KFJA 4HDQA 1WM2A 1CK1A 1IGDA 3MHZA 2QEJC 4OVUA 4N58A 3BINA 2NBWB 4HPLB 3VRBB 4N9F4 2W3SA 1WJ6A 2V4IB 1C79A 1VRAB 1EF5A 4GOCA 3ZXVA 3V6CB 1SIJA 2DWQA 1K51A 3AE1B 2V3NA 3QIJA 3PSEB 4TKNA 3VHTC 4PS8A 2TSSA 3M3JA 3X0WA 3Q69A 3WAOA 2CS4A 3DBSA 3ZLZA 2G45B 3ZTCA 4GDKB 1VCBA 3PLUA 1J8CA 1WRDB 3QJZA 2HTME 2LGYA 3UIOB 4RM8A 1STEA 3NS1A 4BBNC 1NYQA 1Q10A 4BKSA 2XK5A 4LK0M 4RFBA 3NVWA 4HKZE 1WMHA 1Q1OA 3UQBA 3HRDD 2XBBC 3BIID 4LLGM 1F52A 3OLMD 3SR6A 3QCAA 2B76B 1X1MA 3WIMA 3EHVA 2QCZA 3WCQA 2E3TA 1WXQA 3W1SC 3UF8A 3P4QB 4IW0A 1P7FA 2I2YA 1TKEA 2LHDA 4N59A 3DOWA 1E8XA 1NYRA 1FXAA 4F1SA 2WS3B 2K22A 2PVGC 3Q8CA 3W5VB 4JQWC 1I4QA 3URYA 4A90A 1S3SG 3SU8X 3NOBA 3BVGA 4JLCA 3GZNB 2QIEB 2KD0A 3PZ8A 1HQRD 1L4DB 3APDA 4K7UA 4BZAA 2Y5CA 4IC7B 4IM0A 1WZ0A 3DQVA 3UI3A 4MGIE 2RDBC 4DHZB 4O1NA 2L0TA 4ZDVA 1WM3A 2NPTA 3BVZA 1MPEA 1XF5L 2ZNVC 3X23A 2IBIB 3ZNID 2QSDA 4ZRJA 2BPSA 1TZ1A 2KOXA 4RNAA 4W9GA 1R4NI 3M95A 1UF0A 4YSXB 4MSQB 1TBEA 2BS3B 3BWUD 1KLVA 3B2FA 1WIAA 2H89B 1HXYD 3AULA 3N3KB 3ABVB 1MG8A 2M17A 4JPSA 2NVUI 2ZPYA 2N1WA 3B2GA 3TBLD 1A5RA 2ZCCA 2JZZA 5E6PA 1MHXA 4G50A 1KH0A 4YWGG 2JY6A 3UINB 3UGBB 3ZDMC 4BVUC 5LNK1 4ICUA 2KDEB 1L6VA 4LNFA 1TKYA 1FPYA 1YD8U 1YX6B 2J4XA 1PQSA 2C7HA 1GOZA 1SBBB 3L17A 2PJHA 4MGZE 4OHJA 1L6UA 3HVZA 1XD3B 5C23A 4UDUC 3GE8C 3TUOA 1DOXA 4R3DA 3AE6B 2KYWA 4M02A 3NUHB 1GAQB 3L0WB 1KLGD 3MJWA 2DLBA 4LTUA 1UZXB 4MGYE 5C3JB 5TSSA 4YTPB 4YSZB 4N6EB 3S2AA 3TEZA 2GRIA 4NAWB 3Q3OC 4LNNA 5BYSA 3ML8A 2N4FA 3NJTA 4YTMB 2CHXA 3PRPB 4ASWC 3LXFA 2Z8LA 2MQJA 4D2KA 3K9PB 1JMLA 3P1MA 1DOIA 4CO7A 4JWUC 2NBVB 5FK9C 4FADA 5HKHA 4ZRIA 1HEZE 2BB5A 1VLBA 3QARA 2K6QA 2MBQA 1ZKHA 4WWOA 3SEBA 4GN1A 3R66C 2V0GA 2A4ZA 4FLHA 2N9EB 1AYFA 1L0VB 4K7WA 2MA9B 4YL8A 4OVVA 5IN7A 2K5PA 1E0ZA 2AL3A 2WXNA 3U7DA 2KDIA 4P1BC 2BYFA 2LI5A 1OFFA 3VXWA 3ZNZB 1WYGA 2ZJDA 4W9DA 4WJQA 3M63B 3DBRI 3KWLA 2FCQA 5AUIA 4A20A 2MP2B 2YLMA 1TS2A 4WWNA 2DHZA 1PYWD 4ZHPA 3EFCA 3PRMB 5L83A 4ZRKA 4BKGA 2JRIB 2ZVNA 2EELA 1P3QU 3KVFB 3A9JB 5E6OA 3DBLI 1MJDA 4GDLB 4KZCA 3GE3C 4TV3A 3A33B 1E6EB 2K8BA 5EE0A 2KFKB 3HVDA 3WA0A 2OOBB 2WP9B 4FJVB 3NS8A 4WAFA 5IO9A 2L0FA 4II3B 4AS1A 2PEAA 2R61A 2V3PA 1D6EC 4XDCA 4LCDE 5IKCM 4I6PA 1AN8A 2FUHB 2X38A 3N1XC 1C4AA 1V86A 5CTRC 1SB3C 1V2YA 2IY0B 1V9JA 1LO5D 2Z59B 1WX7A 2IO0B 2PIAA 1WY8A 1Z5SB 3KQ4A 2YEPF 2CKHB 2IO3B 4BKTA 3CF6E 3SDLC 2RD0A 3H7PB 1UD7A 3U30A 1V1PB 4K3CA 2FBWB 3IFWB 3H8HA 4P6VF 2LGXA 4ZHOA 2Z0EB 4KKJA 2NTTA 1YQ4B 3W9CB 2G4DB 3HM3A 4MM3A 3CSFA 3ZJUA 1IBXB 4IKGA 1Y56A 1MI0A 2KWDA 1D5MC 4WH4A 2N7DA 2KTRA 4DXAB 3Q8FA 3RUIB 1JWMD 4MELA 3KYCD 4KDIC 4ITKA 2WNMA 1V1PA 2KQ4X 1ZW7A 4AP4C 1YN3A 4WJOA 2BW2A 3MHSD 3EECA 4HROA 4B0MA 1V80A 1VJKA 4DQOC 1ZDVA 2BVCA 1RWSA 4WWPA 2LGSA 3DHIC 5BYQA 1VZ6A 2H88B 2MBBB 1QILA 2K8CA 4E74A 4BAXA 2LJIA 1VR9A 4A3PA 1I4HA 4G3XB 3V05A 1J0GA 1JWBD 2GLSA 1SIFA 5LLIA 2KACA 3FKYA 3H9DA 2WXJA 5G5HA 2C5LC 3ZO5B 5AUKA 2MW5A 2NR2A 3VFKA 4ARIA 4NJ7A 3AEEB 1JALA 4IM3A 2RPVA 2DZKA 4RGTA 1FRRA 5G5GA 1WYWB 1QOFA 5FR3A 3AE2B 4ANWA 1K8RB 2KZRA 1R4MB 1CZPA 2DZMA 2W3RA 3NZ3A 3P4RB 5EE1A 1VDVA 2BTEA 1UBQA 2VZKD 3WANA 2LVQA 3AECB 3I3TB 2BWES 4OZAA 2C9WB 4US8A 1SE3A 1JWAD 1YN5A 3NVZA 3ONSA 3B1LX 2N1VA 2IJ0A 1WR6E 1BUIC 4GXBA 4M8NA 3H7SA 1SJED 2PW9A 1ZP0B 3DWGC 3PGEA 3PZ7A 3P2BA 3IT6B 4TQ1A 1ZXHA 2EMTA 2AYOB 2I1JA 4HEA1 3MC9A 2OEDA 3QAQA 2AEHA 2MSED 4AWJA 2INNE 3MTNB 3AE3B 5T8IA 1I35A 2DZJA 1TIFA 5KHOA 2W82A 2PE6B 4XZ4A 1J7BA 2GBJA 1ZXIA 4PK1A 1XT9B 3MC8A 2PVOD 1NI3A 4HJGE 2KQ7A 1TS3A 1LQBA 1C78A 2CU1A 3AE8B 3O65B 5L95C 2J0MA 1B1ZA 3ZYYX 2INPE 2JQRB 4HCNB 2WDTB 2XNAC 2E6XA 2ZZPB 3DVGX 1YX5B 3U4EG 1QOAA 4CQNA 2M1MA 2NCNA 2OJRA 5D2MB 4HRSA 3GS2A 4L23A 3MJ5A 2J42A 1YMHE 1RYJA 2W54A 1C1YB 4PYUA 2ACZB 1PDXA 1WJNA 1R7SA 1OEYA 2LVPA 1ET9A 1A70A 4LDTD 2WXQA 1GG3A 3ZDTA 4W9JA 2NTSA 1WGHA 3H1UA 4REZA 3VH4B 1VD2A 1P0RA 3CWIA 3O13A 3LYYA 1ZPSA 4IM2A 1L0XB 3L16A 4FJYA 4WAAA 2ON8A 1SE4A 4DDGD 1T0RC 2KX3A 3ZJVA 1WXMA 1DYQA 3P4SB 1C77A 4CYEA 2LXAA 4GB9A 4NAWA 1SJHD 3IT4B 2WXLA 1SSNA 4PYZA 2BBCA 3VTUA 2INCC 3N20C 2DAJA 3SHQA 4FHJA 2JT4B 2N7JA 4HDOA 2L83A 2BF8B 1XLQA 3AEGB 1ZGUB 2AL6A 1XEEA 3NY5A 4HCPB 2LZ6A 4PT5A 1H8CA 1L0YB 4BOZB 3E56A 2UWQA 2KC2A 4KIKB 2DYMA 1RRBA 3L4PA 1GB1A 3ECIA 3TEYA 5D6JB 2V9HA 3RNBC 1V5OA 3D32A 1ZUD2 3ZW3A 4KV2A 3TEWA 1V97A 2WXRA 3GP7A 2MJEA 3L10B 3APCA 3AB5A 2CJNA 1YNTE 2WX0A 3IHPC 1E7PB 1GC7A 2V3SA 3JYUA 4CHKA 4AUQC 4MSMB 4IDIA 2QJLA 2KANA 4A55A 1E7UA 3DHGC 5EE3A 2LVOA 1HTQA 1C9FA 2VZKB 4MGKE 2LASA 5CHVC 1L2NA 5IA7A 4K7SA 4MACA 5BMIA 4W9KA 1UBIA 3PZDA 1WX8A 1NEKB 4GDLA 2WXKA 1DOYA 1NI2A 3AMZA 4RMAA 3JSVA 2IYDB 3B9JA 4JIOU 4HK2A 2C60A 2EMSA 1XXGA 4LNOA 1XLNA 1SE2A 1I7HA 4FBJB 1XQQA 5C1ZA 2WWZA 1SGHA 2WDVB 2L3ZA 2WXHA 4W9CA 5D3IB
chains in the Genus database with same CATH topology
5LXHA 4DHZE 2LXCA 4GDLB 4FJZA 4KZCA 2LWPA 2FNJB 3Q3JA 3K9OB 4TV3A 4GU2A 3A33B 3ZTDA 3ZUNA 4EZLA 5JZEB 2BYEA 2V1YA 2K8BA 2KFKB 2JRHA 1WI0A 3WA0A 2OOBB 4LDTB 5BO4B 3BY4B 3APFA 3NZSA 5D7GA 4DDID 1G6JA 1LM8B 2KWVB 4FJVB 4W9FA 3NS8A 3EC8A 3PLVA 2MBOA 5AEKB 4W9LA 3AXCA 4KSLC 2L0FA 3IG3A 5G2NA 4DK5A 2KNBA 2BYVE 4II3B 1GUAB 2PEAA 4NJ6A 2O6VA 3QWZB 3B0AA 3A9JA 2JUOA 4GIVA 4GMVA 4LCDE 2JVCA 1ISNA 1GJZA 2JZ3B 4I6PA 1YJ1A 2JWZA 2W9NA 2D2QA 1IPGA 3W1SA 1KJTA 1BT0A 2FUHB 4DHJB 3V6EB 2BKRB 2YVCA 3N30A 2K25A 1WF9A 3EFUA 3TMPB 3ZVVA 4BFRA 3H7PA 3NZUA 1Y8RC 1V86A 2FIFA 2KMCA 5CTRC 1V2YA 1NBFC 2IY0B 5D94A 1V9JA 4NY0A 2Z59B 3ZIMA 2FIDA 2DZIA 1F9JA 1OQYA 1WX7A 2IO0B 3AU4A 4MH0E 1WY8A 1D3ZA 1QZEA 4G11A 1OGWA 4P7IA 3RD2A 1Z5SB 2DX5B 3LJ3A 2O6VB 3VTWA 2M8SA 5DPSA 5KHQA 4PS3A 3N32A 2CHZA 4MDKE 4PS7A 4IG7B 2CKHB 2N9PC 2L8JA 2IO3B 4K1RB 2I1KA 4KDLB 4BKTA 1RFAA 2LD9A 5DPTA 2WX1A 1T0YA 3CF6E 4EZKA 2KTRB 3L13A 3ZNGC 3VVWB 3GOEA 4HWIB 3SDLC 2KJ6A 2RD0A 2HTHA 2RSUA 4GSWA 4W9EA 3HHMA 3H7PB 4GGQA 3QX1A 3A4SC 3DVGY 3OJ3A 2LGDA 1UD7A 5DPRA 3U30A 1V6EA 4J6IA 2VRRB 5LXIB 2RR9A 3IFWB 3DBHI 2LGXA 2LUEA 2Z0EB 4FN2A 4A20A 4URKA 4I6NB 2C7MB 2G4SA 3VUYA 3WAPA 2J0JA 2G4DB 1EF1A 2JPHA 2KLCA 2NBUA 2ZNVB 3HM3A 4ICVA 4MM3A 4HVBA 1YIWA 3CSFA 5AZHA 4EKUA 3VQIA 2CHWA 1J19A 4M0WB 2N7DA 3QQ8B 1E7VA 2KTRA 3SD5A 4DXAB 3A9KB 3ZNHB 4AJWA 3NHEB 5J18A 3AI5A 1UGMA 4NQLB 3HK0A 3RUIB 1WGRA 2IO1B 2L00B 3KYCD 4KDIC 4MELA 5DCNA 1EUVB 2FAZA 3VAWA 1RAXA 3PV1A 5EDSA 1FXTB 1ZW7A 3DCGA 4AP4C 2MBEA 2D10A 2KX0A 1LXDA 1E8YA 4BBNF 2BGFA 1RLFA 4WJOA 2HJ8A 3MHSD 2K8HA 3EECA 4FHKA 1V80A 2KHWB 4IWOA 2K6DB 2KLGA 2UYZB 4F7ZA 5IAAC 4WWPA 4XX5A 5AZFA 5JHBA 2B3AA 3PHWB 4FULA 4HLEA 2MBBB 3C0RB 1V5TA 2K8CA 4E74A 3A9KA 4XC2A 3R3MA 2L76A 3PS6A 3DPDA 2MLBA 4A3PA 3DVNV 2KFJA 2GBNA 4G3XB 4HDQA 1WM2A 2R2OA 3QA8A 4MJSB 1J0GA 4OVUA 3BINA 2NBWB 3QK0A 4HPLB 2KWCA 3RYTA 4M8MA 3KYDD 1SIFA 4IWPA 4N9F4 1WJ6A 5LLIA 1WH3A 4ANUA 2KN5A 5GMVA 3H9DA 5CHFA 2XK5B 2M0XA 1EF5A 4GOCA 3W1YA 3V6CB 1WR1A 2C5LC 3ZO5B 2MW5A 2NR2A 1V81A 1WFYA 3QIJA 3VFKA 3PSEB 1WMHB 4TKNA 3VHTC 2R2QA 4NJ7A 4PS8A 2V4LA 3U8ZA 2RGFA 3RZWC 3M3JA 4KZ0A 3X0WA 4NPNA 2MBHA 4IM3A 2CS4A 3WAOA 2DZKA 3QHTA 1WXAA 4DHJD 2PPHA 3DBSA 1AARA 2ZVOA 2GBRA 2G45B 2DYOA 3ZLZA 3ZTCA 1WYWB 4GDKB 4IUMB 1VCBA 3PLUA 4DBGA 1J8CA 4DWFA 1U4AA 4MJSA 1WRDB 1K8RB 2O2VB 2KZRA 4ANWA 3QJZA 4K81A 2DZMA 3TJPA 2LGYA 4E71A 3UIOB 1TGZB 4EOYA 4RM8A 3KH0A 1UBQA 2FCSA 4BBNC 2N7EA 4BKSA 2RPQA 2XK5A 3WANA 2REXA 2LVQA 3I3TB 5AZGA 2BWES 2O6VD 2C9WB 3UIPB 1H4RA 2LJ5A 3PT2B 3ONSA 1WMHA 2GBKA 3B1LX 2N1VA 1Q1OA 1WJ4A 1WR6E 3UQBA 1CMXB 2XBBC 2J7QB 4GXBA 4M8NA 3H7SA 1Q5WB 4EUTA 4WJPA 3OLMD 3QCAA 3OAWA 4EEWA 3RT3B 4GDKA 3A4RA 1X1MA 2DAFA 3VUWA 3PGEA 3WIMA 3EHVA 1GC6A 2M4NA 3P2BA 2O2VA 2KMAA 4TQ1A 3W1SC 3PTFC 2EMTA 3UF8A 5FR6A 2AYOB 1Q0WB 4MEMA 2I1JA 2J0KA 2LRUA 4A3OA 4IW0A 3ALBA 2KWUB 4II2B 1WGGA 3QAQA 2AEHA 2MSED 3IBEA 3MTNB 4JGHB 2NPTB 4KSKC 4AWJA 2A5UA 1I35A 2DZJA 3V60A 3DOWA 3TL5A 1E8XA 2BKFA 4F1SA 3CSTA 5KHOA 3ZRCA 3DDCB 4JQWC 1GNUA 2PE6B 4XZ4A 3PREA 1E90A 1S3SG 4W9HA 1WGYA 2GBJA 3SU8X 2D11A 3NOBA 2HE7A 5CX3A 2PE9A 1WZ3A 4JLCA 1XT9B 3WALA 2KD0A 3A1QB 3APDA 2EKEC 4K7UA 2KQ7A 4IM0A 4IC7B 1WZ0A 1LQBA 2GMIC 2CU1A 3DQVA 3O65B 4MGIE 2KQSA 5L95C 4DHZB 2J0MA 2D07B 4RM9A 3RULA 2L0TA 4ANVA 4ZDVA 1WM3A 2NPTA 4X57B 3KW5B 5J17A 4HCNB 2WDTB 3HIZA 1OEYJ 2ZNVC 2ZZPB 3DVGX 1YX5B 2MX2A 3PRZA 3X23A 2IBIB 1E8ZA 2NS5A 3GZNI 3ZNID 2M1MA 2NCNA 2OJRA 3VDZA 5D2MB 2KO3A 4ZRJA 3RZFA 2BPSA 1TZ1A 2KOXA 1WE6A 2ZCBA 4W9GA 3R7QA 1C1YB 1R4NI 3M95A 4PYUA 3V62A 4WJNA 4MSQB 3L54A 1WJNA 1TBEA 1OEYA 3A1QA 1KLVA 2LVPA 1HE8A 4LDTD 2KKCA 2GOWA 1GG3A 1UH6A 1YQBA 3ZDTA 1WIAA 4W9JA 4BOSC 1WGHA 2GBMA 3H1UA 3AULA 3B08A 5JH5C 3N3KB 3VH4B 1VD2A 3UQAA 1P0RA 3RCZA 1MG8A 2M17A 2NVUI 2L7RA 2ZPYA 2N1WA 1E8WA 2WYQA 2BWFA 5TR5A 3TBLD 4IM2A 3TIXA 1A5RA 2ZCCA 2JZZA 5E6PA 4E3CA 3L16A 4G50A 2HD5B 4ANXA 3T8MA 1KOTA 3JW0X 2FCMA 2JY6A 4FJYA 4WAAA 3UINB 3UGBB 3ZDMC 4BVUC 4TUUA 4ICUA 2KDEB 4DDGD 2IO2B 2KVRA 2KX3A 3QC8B 4KIKA 2Z0DB 1WXMA 1WXVA 3DVNU 1NDDA 5J2RA 4NQKE 1YD8U 1YX6B 4CYEA 4EFOA 1S1QB 2LXAA 4GB9A 4F8CB 4NAWA 1PQSA 2C7HA 4HPMB 5JHAA 4PYZA 3L17A 3VTUA 3ZKJC 2DAJA 2PJHA 3VH3B 3SHQA 4FHJA 4MGZE 2JT4B 3TCAA 4HDOA 1XD3B 5C23A 4WQOB 1WE7A 4AOFA 2BF8B 1R4MI 2AWTA 3PPAA 1ZGUB 2AL6A 2G3QB 2D3GA 2IY1B 3LDZE 3NY5A 4HCPB 2LZ6A 1H8CA 3ML9A 4B9KA 3ENEA 2CR5A 1V49A 3L0WB 2KK8A 4BOZB 3VUXA 4FA6A 2UWQA 1I42A 2KC2A 3KUDB 4KIKB 2DYMA 1RRBA 3MJWA 4MGYE 1UZXB 4NNJB 4AJYB 1P98A 1TTNA 3L08A 1IP9A 2K1FA 3ECIA 3R7RA 3S2AA 2MRPA 4NAWB 5D6JB 5G55A 2IZVB 3H6NA 3V61A 1WJUA 1V5OA 1SE9A 2JF5A 2N4FA 3D32A 3ML8A 1KM7A 3ZRFA 2CHXA 2JXXA 2Y5BB 3PRPB 4ASWC 1IYFA 1P1AA 3WAMA 2XEWA 4B6WA 3ZW3A 2MQJA 4KV2A 3K9PB 1LFDA 2ASQA 2LRWA 3PVLA 3L10B 4CO7A 2NBVB 3APCA 2K39A 4FADA 2WX0A 3IHPC 5HKHA 1GC7A 2V3SA 1UELA 4ZRIA 3M62B 3CMMB 3JYUA 4CHKA 4AUQC 4MSMB 3JSVB 3KUCB 3QARA 2K6QA 4W9IA 2MP2A 2MBQA 1ZKHA 3IVFA 2KANA 1OTRB 1P9DU 2KDFB 4JL9A 1E7UA 4WWOA 4GN1A 2FCNA 2LVOA 3R66C 5CHWA 2A4ZA 3T9LA 2KTFA 2DENB 4FLHA 2N9EB 5E6NA 3KUZA 4K7WA 2MA9B 4YL8A 1M94A 2LASA 4MGKE 4OVVA 5CHVC 4B95A 1L2NA 4EZJA 5IA7A 3OJ4B 1WGDA 4K7SA 2AL3A 4W9KA 1UBIA 3PZDA 3U7DA 2KDIA 1WX8A 3VTVA 2ZEQA 2BYFA 2MWSB 2LI5A 1EO6A 2KDBA 3JVZX 1WXSA 4GDLA 2L05A 3VXWA 3ZNZB 2KJHB 3Q3FA 1E5WA 2ZJDA 2MCNB 1C3TA 4LJOB 4W9DA 4WJQA 2N9XA 1NI2A 1L7YA 2C7NB 3PHXB 3M63B 4RMAA 3JSVA 2KFKA 3AU5A 2FCQA 2IYDB 3DBRI 4HJKA 4HK2A 2MP2B 2YLMA 2C60A 4JIOU 4WWNA 2EMSA 2DHZA 1JRUA 4HXDA 4I6LB 2KJRA 2ZPNA 2DYBA 4FBJB 1XQQA 3PRMB 5C1ZA 5L83A 2WWZA 4KVGB 1WX9A 3HM6X 4LJPB 4ZRKA 4BKSD 2KC1A 1SGHA 4IWQA 4BKGA 2L3ZA 2JRIB 2ZVNA 1Z2MA 4G0NB 5DPWA 2QHOA 1P3QU 3KVFB 4TQ0A 3A9JB 4W9CA 5E6OA 4ZYNA 3DBLI 2KXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LXH A;  4DHZ E;  2LXC A;  4GDL B;  4FJZ A;  4KZC A;  2LWP A;  2FNJ B;  3Q3J A;  3K9O B;  4TV3 A;  4GU2 A;  3A33 B;  3ZTD A;  3ZUN A;  4EZL A;  5JZE B;  2BYE A;  2V1Y A;  2K8B A;  2KFK B;  2JRH A;  1WI0 A;  3WA0 A;  2OOB B;  4LDT B;  5BO4 B;  3BY4 B;  3APF A;  3NZS A;  5D7G A;  4DDI D;  1G6J A;  1LM8 B;  2KWV B;  4FJV B;  4W9F A;  3NS8 A;  3EC8 A;  3PLV A;  2MBO A;  5AEK B;  4W9L A;  3AXC A;  4KSL C;  2L0F A;  3IG3 A;  5G2N A;  4DK5 A;  2KNB A;  2BYV E;  4II3 B;  1GUA B;  2PEA A;  4NJ6 A;  2O6V A;  3QWZ B;  3B0A A;  3A9J A;  2JUO A;  4GIV A;  4GMV A;  4LCD E;  2JVC A;  1ISN A;  1GJZ A;  2JZ3 B;  4I6P A;  1YJ1 A;  2JWZ A;  2W9N A;  2D2Q A;  1IPG A;  3W1S A;  1KJT A;  1BT0 A;  2FUH B;  4DHJ B;  3V6E B;  2BKR B;  2YVC A;  3N30 A;  2K25 A;  1WF9 A;  3EFU A;  3TMP B;  3ZVV A;  4BFR A;  3H7P A;  3NZU A;  1Y8R C;  1V86 A;  2FIF A;  2KMC A;  5CTR C;  1V2Y A;  1NBF C;  2IY0 B;  5D94 A;  1V9J A;  4NY0 A;  2Z59 B;  3ZIM A;  2FID A;  2DZI A;  1F9J A;  1OQY A;  1WX7 A;  2IO0 B;  3AU4 A;  4MH0 E;  1WY8 A;  1D3Z A;  1QZE A;  4G11 A;  1OGW A;  4P7I A;  3RD2 A;  1Z5S B;  2DX5 B;  3LJ3 A;  2O6V B;  3VTW A;  2M8S A;  5DPS A;  5KHQ A;  4PS3 A;  3N32 A;  2CHZ A;  4MDK E;  4PS7 A;  4IG7 B;  2CKH B;  2N9P C;  2L8J A;  2IO3 B;  4K1R B;  2I1K A;  4KDL B;  4BKT A;  1RFA A;  2LD9 A;  5DPT A;  2WX1 A;  1T0Y A;  3CF6 E;  4EZK A;  2KTR B;  3L13 A;  3ZNG C;  3VVW B;  3GOE A;  4HWI B;  3SDL C;  2KJ6 A;  2RD0 A;  2HTH A;  2RSU A;  4GSW A;  4W9E A;  3HHM A;  3H7P B;  4GGQ A;  3QX1 A;  3A4S C;  3DVG Y;  3OJ3 A;  2LGD A;  1UD7 A;  5DPR A;  3U30 A;  1V6E A;  4J6I A;  2VRR B;  5LXI B;  2RR9 A;  3IFW B;  3DBH I;  2LGX A;  2LUE A;  2Z0E B;  4FN2 A;  4A20 A;  4URK A;  4I6N B;  2C7M B;  2G4S A;  3VUY A;  3WAP A;  2J0J A;  2G4D B;  1EF1 A;  2JPH A;  2KLC A;  2NBU A;  2ZNV B;  3HM3 A;  4ICV A;  4MM3 A;  4HVB A;  1YIW A;  3CSF A;  5AZH A;  4EKU A;  3VQI A;  2CHW A;  1J19 A;  4M0W B;  2N7D A;  3QQ8 B;  1E7V A;  2KTR A;  3SD5 A;  4DXA B;  3A9K B;  3ZNH B;  4AJW A;  3NHE B;  5J18 A;  3AI5 A;  1UGM A;  4NQL B;  3HK0 A;  3RUI B;  1WGR A;  2IO1 B;  2L00 B;  3KYC D;  4KDI C;  4MEL A;  5DCN A;  1EUV B;  2FAZ A;  3VAW A;  1RAX A;  3PV1 A;  5EDS A;  1FXT B;  1ZW7 A;  3DCG A;  4AP4 C;  2MBE A;  2D10 A;  2KX0 A;  1LXD A;  1E8Y A;  4BBN F;  2BGF A;  1RLF A;  4WJO A;  2HJ8 A;  3MHS D;  2K8H A;  3EEC A;  4FHK A;  1V80 A;  2KHW B;  4IWO A;  2K6D B;  2KLG A;  2UYZ B;  4F7Z A;  5IAA C;  4WWP A;  4XX5 A;  5AZF A;  5JHB A;  2B3A A;  3PHW B;  4FUL A;  4HLE A;  2MBB B;  3C0R B;  1V5T A;  2K8C A;  4E74 A;  3A9K A;  4XC2 A;  3R3M A;  2L76 A;  3PS6 A;  3DPD A;  2MLB A;  4A3P A;  3DVN V;  2KFJ A;  2GBN A;  4G3X B;  4HDQ A;  1WM2 A;  2R2O A;  3QA8 A;  4MJS B;  1J0G A;  4OVU A;  3BIN A;  2NBW B;  3QK0 A;  4HPL B;  2KWC A;  3RYT A;  4M8M A;  3KYD D;  1SIF A;  4IWP A;  4N9F 4;  1WJ6 A;  5LLI A;  1WH3 A;  4ANU A;  2KN5 A;  5GMV A;  3H9D A;  5CHF A;  2XK5 B;  2M0X A;  1EF5 A;  4GOC A;  3W1Y A;  3V6C B;  1WR1 A;  2C5L C;  3ZO5 B;  2MW5 A;  2NR2 A;  1V81 A;  1WFY A;  3QIJ A;  3VFK A;  3PSE B;  1WMH B;  4TKN A;  3VHT C;  2R2Q A;  4NJ7 A;  4PS8 A;  2V4L A;  3U8Z A;  2RGF A;  3RZW C;  3M3J A;  4KZ0 A;  3X0W A;  4NPN A;  2MBH A;  4IM3 A;  2CS4 A;  3WAO A;  2DZK A;  3QHT A;  1WXA A;  4DHJ D;  2PPH A;  3DBS A;  1AAR A;  2ZVO A;  2GBR A;  2G45 B;  2DYO A;  3ZLZ A;  3ZTC A;  1WYW B;  4GDK B;  4IUM B;  1VCB A;  3PLU A;  4DBG A;  1J8C A;  4DWF A;  1U4A A;  4MJS A;  1WRD B;  1K8R B;  2O2V B;  2KZR A;  4ANW A;  3QJZ A;  4K81 A;  2DZM A;  3TJP A;  2LGY A;  4E71 A;  3UIO B;  1TGZ B;  4EOY A;  4RM8 A;  3KH0 A;  1UBQ A;  2FCS A;  4BBN C;  2N7E A;  4BKS A;  2RPQ A;  2XK5 A;  3WAN A;  2REX A;  2LVQ A;  3I3T B;  5AZG A;  2BWE S;  2O6V D;  2C9W B;  3UIP B;  1H4R A;  2LJ5 A;  3PT2 B;  3ONS A;  1WMH A;  2GBK A;  3B1L X;  2N1V A;  1Q1O A;  1WJ4 A;  1WR6 E;  3UQB A;  1CMX B;  2XBB C;  2J7Q B;  4GXB A;  4M8N A;  3H7S A;  1Q5W B;  4EUT A;  4WJP A;  3OLM D;  3QCA A;  3OAW A;  4EEW A;  3RT3 B;  4GDK A;  3A4R A;  1X1M A;  2DAF A;  3VUW A;  3PGE A;  3WIM A;  3EHV A;  1GC6 A;  2M4N A;  3P2B A;  2O2V A;  2KMA A;  4TQ1 A;  3W1S C;  3PTF C;  2EMT A;  3UF8 A;  5FR6 A;  2AYO B;  1Q0W B;  4MEM A;  2I1J A;  2J0K A;  2LRU A;  4A3O A;  4IW0 A;  3ALB A;  2KWU B;  4II2 B;  1WGG A;  3QAQ A;  2AEH A;  2MSE D;  3IBE A;  3MTN B;  4JGH B;  2NPT B;  4KSK C;  4AWJ A;  2A5U A;  1I35 A;  2DZJ A;  3V60 A;  3DOW A;  3TL5 A;  1E8X A;  2BKF A;  4F1S A;  3CST A;  5KHO A;  3ZRC A;  3DDC B;  4JQW C;  1GNU A;  2PE6 B;  4XZ4 A;  3PRE A;  1E90 A;  1S3S G;  4W9H A;  1WGY A;  2GBJ A;  3SU8 X;  2D11 A;  3NOB A;  2HE7 A;  5CX3 A;  2PE9 A;  1WZ3 A;  4JLC A;  1XT9 B;  3WAL A;  2KD0 A;  3A1Q B;  3APD A;  2EKE C;  4K7U A;  2KQ7 A;  4IM0 A;  4IC7 B;  1WZ0 A;  1LQB A;  2GMI C;  2CU1 A;  3DQV A;  3O65 B;  4MGI E;  2KQS A;  5L95 C;  4DHZ B;  2J0M A;  2D07 B;  4RM9 A;  3RUL A;  2L0T A;  4ANV A;  4ZDV A;  1WM3 A;  2NPT A;  4X57 B;  3KW5 B;  5J17 A;  4HCN B;  2WDT B;  3HIZ A;  1OEY J;  2ZNV C;  2ZZP B;  3DVG X;  1YX5 B;  2MX2 A;  3PRZ A;  3X23 A;  2IBI B;  1E8Z A;  2NS5 A;  3GZN I;  3ZNI D;  2M1M A;  2NCN A;  2OJR A;  3VDZ A;  5D2M B;  2KO3 A;  4ZRJ A;  3RZF A;  2BPS A;  1TZ1 A;  2KOX A;  1WE6 A;  2ZCB A;  4W9G A;  3R7Q A;  1C1Y B;  1R4N I;  3M95 A;  4PYU A;  3V62 A;  4WJN A;  4MSQ B;  3L54 A;  1WJN A;  1TBE A;  1OEY A;  3A1Q A;  1KLV A;  2LVP A;  1HE8 A;  4LDT D;  2KKC A;  2GOW A;  1GG3 A;  1UH6 A;  1YQB A;  3ZDT A;  1WIA A;  4W9J A;  4BOS C;  1WGH A;  2GBM A;  3H1U A;  3AUL A;  3B08 A;  5JH5 C;  3N3K B;  3VH4 B;  1VD2 A;  3UQA A;  1P0R A;  3RCZ A;  1MG8 A;  2M17 A;  2NVU I;  2L7R A;  2ZPY A;  2N1W A;  1E8W A;  2WYQ A;  2BWF A;  5TR5 A;  3TBL D;  4IM2 A;  3TIX A;  1A5R A;  2ZCC A;  2JZZ A;  5E6P A;  4E3C A;  3L16 A;  4G50 A;  2HD5 B;  4ANX A;  3T8M A;  1KOT A;  3JW0 X;  2FCM A;  2JY6 A;  4FJY A;  4WAA A;  3UIN B;  3UGB B;  3ZDM C;  4BVU C;  4TUU A;  4ICU A;  2KDE B;  4DDG D;  2IO2 B;  2KVR A;  2KX3 A;  3QC8 B;  4KIK A;  2Z0D B;  1WXM A;  1WXV A;  3DVN U;  1NDD A;  5J2R A;  4NQK E;  1YD8 U;  1YX6 B;  4CYE A;  4EFO A;  1S1Q B;  2LXA A;  4GB9 A;  4F8C B;  4NAW A;  1PQS A;  2C7H A;  4HPM B;  5JHA A;  4PYZ A;  3L17 A;  3VTU A;  3ZKJ C;  2DAJ A;  2PJH A;  3VH3 B;  3SHQ A;  4FHJ A;  4MGZ E;  2JT4 B;  3TCA A;  4HDO A;  1XD3 B;  5C23 A;  4WQO B;  1WE7 A;  4AOF A;  2BF8 B;  1R4M I;  2AWT A;  3PPA A;  1ZGU B;  2AL6 A;  2G3Q B;  2D3G A;  2IY1 B;  3LDZ E;  3NY5 A;  4HCP B;  2LZ6 A;  1H8C A;  3ML9 A;  4B9K A;  3ENE A;  2CR5 A;  1V49 A;  3L0W B;  2KK8 A;  4BOZ B;  3VUX A;  4FA6 A;  2UWQ A;  1I42 A;  2KC2 A;  3KUD B;  4KIK B;  2DYM A;  1RRB A;  3MJW A;  4MGY E;  1UZX B;  4NNJ B;  4AJY B;  1P98 A;  1TTN A;  3L08 A;  1IP9 A;  2K1F A;  3ECI A;  3R7R A;  3S2A A;  2MRP A;  4NAW B;  5D6J B;  5G55 A;  2IZV B;  3H6N A;  3V61 A;  1WJU A;  1V5O A;  1SE9 A;  2JF5 A;  2N4F A;  3D32 A;  3ML8 A;  1KM7 A;  3ZRF A;  2CHX A;  2JXX A;  2Y5B B;  3PRP B;  4ASW C;  1IYF A;  1P1A A;  3WAM A;  2XEW A;  4B6W A;  3ZW3 A;  2MQJ A;  4KV2 A;  3K9P B;  1LFD A;  2ASQ A;  2LRW A;  3PVL A;  3L10 B;  4CO7 A;  2NBV B;  3APC A;  2K39 A;  4FAD A;  2WX0 A;  3IHP C;  5HKH A;  1GC7 A;  2V3S A;  1UEL A;  4ZRI A;  3M62 B;  3CMM B;  3JYU A;  4CHK A;  4AUQ C;  4MSM B;  3JSV B;  3KUC B;  3QAR A;  2K6Q A;  4W9I A;  2MP2 A;  2MBQ A;  1ZKH A;  3IVF A;  2KAN A;  1OTR B;  1P9D U;  2KDF B;  4JL9 A;  1E7U A;  4WWO A;  4GN1 A;  2FCN A;  2LVO A;  3R66 C;  5CHW A;  2A4Z A;  3T9L A;  2KTF A;  2DEN B;  4FLH A;  2N9E B;  5E6N A;  3KUZ A;  4K7W A;  2MA9 B;  4YL8 A;  1M94 A;  2LAS A;  4MGK E;  4OVV A;  5CHV C;  4B95 A;  1L2N A;  4EZJ A;  5IA7 A;  3OJ4 B;  1WGD A;  4K7S A;  2AL3 A;  4W9K A;  1UBI A;  3PZD A;  3U7D A;  2KDI A;  1WX8 A;  3VTV A;  2ZEQ A;  2BYF A;  2MWS B;  2LI5 A;  1EO6 A;  2KDB A;  3JVZ X;  1WXS A;  4GDL A;  2L05 A;  3VXW A;  3ZNZ B;  2KJH B;  3Q3F A;  1E5W A;  2ZJD A;  2MCN B;  1C3T A;  4LJO B;  4W9D A;  4WJQ A;  2N9X A;  1NI2 A;  1L7Y A;  2C7N B;  3PHX B;  3M63 B;  4RMA A;  3JSV A;  2KFK A;  3AU5 A;  2FCQ A;  2IYD B;  3DBR I;  4HJK A;  4HK2 A;  2MP2 B;  2YLM A;  2C60 A;  4JIO U;  4WWN A;  2EMS A;  2DHZ A;  1JRU A;  4HXD A;  4I6L B;  2KJR A;  2ZPN A;  2DYB A;  4FBJ B;  1XQQ A;  3PRM B;  5C1Z A;  5L83 A;  2WWZ A;  4KVG B;  1WX9 A;  3HM6 X;  4LJP B;  4ZRK A;  4BKS D;  2KC1 A;  1SGH A;  4IWQ A;  4BKG A;  2L3Z A;  2JRI B;  2ZVN A;  1Z2M A;  4G0N B;  5DPW A;  2QHO A;  1P3Q U;  3KVF B;  4TQ0 A;  3A9J B;  4W9C A;  5E6O A;  4ZYN A;  3DBL I;  2KXJ A; 
#chains in the Genus database with same CATH topology
 4C7Z A;  3ZJT A;  3K9O B;  3Q3M C;  5D3D A;  1TY2 A;  2JRH A;  2W55 A;  2D3C A;  1UWM A;  3NZS A;  1LM8 B;  2MBO A;  4KSL C;  2BYV E;  1GB4 A;  4YXD B;  3A9J A;  4GMV A;  1GJZ A;  4ZOH C;  1ISN A;  3NVY A;  2JZ3 B;  3EGR A;  1YJ1 A;  2JWZ A;  2W9N A;  4L1B A;  1KJT A;  2WU2 B;  1AWD A;  2WXG A;  3V6E B;  2YVC A;  3N30 A;  2K25 A;  3EFU A;  3H7P A;  2KMC A;  1NBF C;  1HA5 A;  4RF0 A;  2L52 A;  4USA A;  4MH0 E;  1N60 A;  1D3Z A;  4G11 A;  1OGW A;  2XN9 C;  4P7I A;  3LJ3 A;  2DX5 B;  1T0S C;  5DPS A;  4PS3 A;  3BK2 A;  4IG7 B;  3AV8 A;  4KDL B;  1RFA A;  5DPT A;  2WX1 A;  1T0Y A;  4C56 C;  2KTR B;  1D4B A;  3GOE A;  4HWI B;  4W9E A;  3HHM A;  1TKG A;  4WIP A;  1NVI D;  4H2A A;  3NG0 A;  3R2T A;  1B9R A;  2MJD A;  3OJ3 A;  4WUR A;  1IUE A;  1V6E A;  4J6I A;  1CQV A;  2BT6 A;  2LUE A;  4URK A;  4RH6 A;  4I6N B;  2K9X A;  2KLC A;  3VQI A;  3DBH B;  4A9A A;  3P63 A;  1FNV A;  5J18 A;  3T3N A;  2ONQ A;  1FMA D;  3HK0 A;  2L00 B;  1EUV B;  1RAX A;  2CJO A;  3DCG A;  2KX0 A;  4LNK A;  1RLF A;  2HJ8 A;  4KKI A;  4KGR A;  4IWO A;  2K6D B;  2UYZ B;  4XX5 A;  2WXI A;  5AZF A;  5JHB A;  4FUL A;  3RPF C;  1XCQ L;  3A9K A;  2L76 A;  3FC4 A;  3Q6B A;  2MLB A;  3DVN V;  2R2O A;  1MVK A;  1TT5 B;  3QA8 A;  2JXT A;  3ZGZ A;  1QLB B;  2NMQ A;  1F77 A;  4IWP A;  2D3B A;  1WH3 A;  2XK5 B;  2M0X A;  3N1Z C;  1FCL A;  1JRO A;  1WR1 A;  1V81 A;  2ZW1 A;  4MH8 A;  5H8Y E;  1WMH B;  4OZB A;  2R2Q A;  2V4L A;  3U8Z A;  3RZW C;  4NPN A;  2MBH A;  1WXA A;  2AQ1 B;  2ZVO A;  4ARC A;  4IUM B;  4DWF A;  1U4A A;  2K3U A;  4K81 A;  3TJP A;  1AW7 A;  2J52 A;  3KH0 A;  1TZO A;  1I4G A;  2RPQ A;  1ZE3 D;  3UIP B;  5AZG A;  1H4R A;  2LJ5 A;  3PT2 B;  2IGD A;  2JSV X;  2GBK A;  1WJ4 A;  1CMX B;  2J7Q B;  5HFY A;  1Q5W B;  4WJP A;  3OAW A;  4OZC A;  5E6J A;  3AE9 B;  3A4R A;  3VUW A;  2KT7 A;  1GC6 A;  3EA6 A;  3PTF C;  1YOV B;  4MEM A;  2ZW0 A;  2J0K A;  1UGJ A;  1VZ7 A;  4C7Y A;  2WQY B;  2KWU B;  1WGG A;  3IBE A;  4KSK C;  4YSY B;  3V3X A;  3TL5 A;  4RF1 A;  1KFY B;  1TYG B;  3AEB B;  2N9L A;  1EWY C;  4GLS C;  1GNU A;  1N63 A;  4M00 A;  3PRE A;  1E90 A;  1ENF A;  3T3O A;  2D11 A;  1V1O A;  1JCK B;  2PE9 A;  1WZ3 A;  2FE8 A;  2JYT A;  3A1Q B;  2KMM A;  3FAH A;  4J3O D;  3TSS A;  2D07 B;  4ZRQ A;  2CU3 A;  3KW5 B;  3HIZ A;  3OWE B;  2MX2 A;  1E8Z A;  2NS5 A;  5HI1 A;  1YN4 A;  2MEK A;  4S0R A;  3RZF A;  2VH1 A;  3RNE C;  1WE6 A;  2WU5 B;  2ZCB A;  3AE5 B;  3RNA C;  1KTK A;  3V62 A;  4KX6 B;  3E9S A;  3A1Q A;  2KKC A;  1YQB A;  2L32 A;  1ACC A;  2GBM A;  3B08 A;  5JH5 C;  3UQA A;  4C4V A;  4A6Q A;  1FD6 A;  2L7R A;  1E9M A;  5TR5 A;  2BWF A;  2IGH A;  3TIX A;  2BQQ A;  3I9V 1;  3T8M A;  1KOT A;  1N5X A;  1JQ4 A;  2LGI A;  4TUU A;  2PTL A;  2IGG A;  2KVR A;  4KIK A;  2Z0D B;  4JE3 B;  3RMK C;  4NQK E;  1PUT A;  1C76 A;  1FEH A;  4EFO A;  4F8C B;  4XYC A;  4HPM B;  1J7C A;  3ZKJ C;  3VH3 B;  4YT0 B;  3TCA A;  4C4V B;  2BS4 B;  4WQO B;  4AOF A;  2WLB A;  1R4M I;  4US9 A;  2IY1 B;  1SEB D;  3Q8A A;  4B9K A;  3ENE A;  1V49 A;  1I42 A;  4NNJ B;  1P98 A;  1TTN A;  3L08 A;  3I57 A;  4XWT A;  3R7R A;  3BYT B;  2GB1 A;  5G55 A;  1OQQ A;  1HZ5 A;  2IZV B;  4C00 A;  1SXT A;  3V61 A;  1SE9 A;  1KM7 A;  1IYF A;  1P1A A;  3WAM A;  1J7A A;  1LFD A;  2BS2 B;  4WWM A;  1I4R A;  1KF6 B;  2K39 A;  3W5U B;  4DXF A;  1UEL A;  2OJW A;  3M62 B;  3R8B A;  3CMM B;  2Y3A A;  3JSV B;  4DXG A;  4W9I A;  1IGC A;  2KDF B;  1YJI A;  2FCN A;  3T9L A;  2KTF A;  3Q2A C;  1M94 A;  1JW9 D;  4B95 A;  3BVM A;  1NEN B;  4EZJ A;  3OJ4 B;  1F2R I;  4RGO S;  3JVZ X;  1EO6 A;  3Q3F A;  1E5W A;  4LJO B;  1E10 A;  2N9X A;  1L7Y A;  2QDF A;  3PHX B;  3RNC C;  3RD2 A;  4P16 A;  2LEK A;  4HJK A;  2WDQ B;  1L4Z B;  4FXC A;  4I6L B;  1XLO A;  2ZPN A;  2DYB A;  3BYY B;  3SFE B;  4KVG B;  2UU7 A;  4LJP B;  5H92 C;  4IWQ A;  5DPW A;  2QHO A;  4TQ0 A;  2WDR B;  4ZYN A;  2YEP B;  3IAS 1;  2KXJ A;  3MP9 A;  5LXH A;  4DHZ E;  2LXC A;  3MC0 B;  4FJZ A;  2LWP A;  3AE7 B;  1FXI A;  4GU2 A;  2RDH A;  3ZUN A;  4EZL A;  1VZ8 A;  4KGS A;  1FRD A;  1WI0 A;  4LDT B;  5BO4 B;  3APF A;  1G6J A;  1XCT L;  1TY0 A;  2KWV B;  3PLV A;  3C8Y A;  4NAM A;  4W9L A;  4P1C C;  5AEK B;  2ICI A;  5G2N A;  1YJJ A;  3AM9 A;  2MH7 A;  2O6V A;  3B0A A;  2JUO A;  4GIV A;  4XDD A;  4RGN A;  4DHJ B;  1WF9 A;  4BFR A;  3NZU A;  1Y8R C;  2WHI A;  5I4D A;  3HUI A;  5BMH A;  2FID A;  1F9J A;  3AU4 A;  1QZE A;  2D3A A;  2M8S A;  3AED B;  5HG2 A;  4MM3 B;  3N32 A;  2CHZ A;  4K3B A;  4PS7 A;  3KLS X;  1IBX A;  2KAJ A;  2L8J A;  4K1R B;  2I1K A;  3MFG A;  2LD9 A;  4M0W A;  4EZK A;  2JX5 A;  3ZNG C;  3VVW B;  1N6Z A;  4GSW A;  2HTH A;  2RSU A;  4GGQ A;  1QKZ A;  5EE9 A;  2VRR B;  5LXI B;  3J9C A;  4ZRP A;  5GXG B;  2QIL A;  4FN2 A;  1N61 A;  4A8X C;  3VUY A;  3IXS A;  1EF1 A;  5AZH A;  4EKU A;  3AH7 A;  3NRZ A;  2L1A A;  2QMT A;  3ZNH B;  4AJW A;  1PGA A;  3DBL B;  1I4X A;  3AI5 A;  4NQL B;  2IO1 B;  2FAZ A;  2M56 B;  3PV1 A;  1FXT B;  2RDG A;  2MBE A;  1E8Y A;  2BGF A;  1WSP A;  2LFI A;  2DNF A;  2KLG A;  2N9K A;  2B3A A;  3GB1 A;  2QC8 A;  3PHW B;  2PMV A;  3ZXR A;  1SF0 A;  1EWC A;  3C0R B;  3DPD A;  1EU4 A;  2GBN A;  1ET6 A;  1D5Z C;  4M01 A;  4MJS B;  4NZL B;  3QK0 A;  2KWC A;  2JZP A;  4M8M A;  3KYD D;  3RYT A;  1MHH E;  3P42 A;  2AQ3 B;  1C4C A;  4ANU A;  2KN5 A;  5GMV A;  5CHF A;  3ZQ4 A;  3W1Y A;  1WRI A;  1RFK A;  1QOB A;  4B0E A;  1KLU D;  1WFY A;  3AEF B;  3RNF C;  2RGF A;  1UUP A;  3NVV A;  2DBY A;  2EKI A;  4KZ0 A;  3DWM A;  1C3T A;  3QHT A;  4DHJ D;  2PPH A;  1AAR A;  2GBR A;  2DYO A;  4TSS A;  4DBG A;  1TJE A;  4MJS A;  2O2V B;  4E71 A;  3RNG C;  1TGZ B;  3ETR A;  4EOY A;  4XWW A;  3BZD B;  2FCS A;  2N7E A;  2JYE A;  3C19 A;  2REX A;  2O6V D;  2JWU A;  2IPK D;  3TEX A;  4EUT A;  4EEW A;  3RT3 B;  4GDK A;  2DAF A;  2M4N A;  1N5W A;  2O2V A;  2KMA A;  4IOI E;  1OQR A;  5FR6 A;  2WXF A;  1Q0W B;  2LRU A;  4A3O A;  3ALB A;  4ZYS A;  2FUG 1;  3Q8B A;  4HPP A;  4II2 B;  1D5X C;  4JGH B;  2NPT B;  2A5U A;  1JWU D;  3V60 A;  2BKF A;  1FNU A;  1CJE A;  1HZ6 A;  2MHJ A;  3CST A;  3VR9 B;  3ZRC A;  3DDC B;  1QQR A;  1FIQ A;  4W9H A;  1WGY A;  2HE7 A;  2J53 A;  5CX3 A;  1T0Q C;  4NJC A;  3WAL A;  1QOG A;  2EKE C;  2GMI C;  2KQS A;  1EU3 A;  1K52 A;  1WGK A;  1FM0 D;  4RM9 A;  2AX5 A;  3RUL A;  3BK1 A;  4ANV A;  1QF6 A;  1JRP A;  5J17 A;  4X57 B;  1OEY J;  3PRZ A;  2PLP A;  4ACF A;  3GZN I;  3VDZ A;  2KO3 A;  2X8X X;  4Q2J A;  1T6B X;  1ZDX A;  1KRH A;  2SEB D;  3R7Q A;  4WJN A;  3L54 A;  1HE8 A;  1EM7 A;  2GOW A;  1UH6 A;  3VRA B;  4BOS C;  1F0Z A;  3RCZ A;  1E8W A;  2Y5P A;  2WYQ A;  1ESF A;  4E3C A;  2HD5 B;  4ANX A;  3JW0 X;  2FCM A;  5FKA C;  3RI7 C;  2WGS A;  2IO2 B;  2LMC A;  2AQ2 B;  3QC8 B;  3EUB 2;  1V8C A;  1WXV A;  2HDE A;  3DVN U;  1NDD A;  2D5G A;  5J2R A;  2PKO A;  1S1Q B;  1P7E A;  5JHA A;  3KWV A;  3SFD B;  4HKQ A;  1WE7 A;  1TS5 A;  4QAY A;  2AWT A;  3PPA A;  3LDZ E;  2G3Q B;  2D3G A;  3DHH C;  3ML9 A;  2CR5 A;  2SAK A;  2KK8 A;  5BMG A;  3VUX A;  4FA6 A;  3KUD B;  2RMM A;  1FO4 A;  4AJY B;  1MG4 A;  1IP9 A;  2K1F A;  1FFU A;  3AE4 B;  3N9Y C;  5HHD G;  1QT9 A;  3AN1 A;  2MRP A;  1PGX A;  1XO3 A;  1PFD A;  3H6N A;  2WXM A;  1WJU A;  1PGB A;  2JF5 A;  3ZRF A;  2JXX A;  2Y5B B;  2XEW A;  4B6W A;  2ASQ A;  2LRW A;  3PVL A;  3VR8 B;  1ROE A;  2OHF A;  4WQM A;  3KUC B;  2MP2 A;  3IVF A;  1L5P A;  1OTR B;  1P9D U;  4JL9 A;  3RN9 C;  4S17 A;  5CHW A;  2DEN B;  3N1Y C;  2M19 A;  5E6N A;  1K50 A;  3KUZ A;  5C2T B;  4XE0 A;  1FCC C;  1UNS A;  1WGD A;  5JXV A;  5MPO A;  3VTV A;  2ZEQ A;  2MWS B;  2KDB A;  1WXS A;  2L05 A;  2KJH B;  4KGT A;  2MCN B;  4EE2 A;  3Q14 C;  2C7N B;  1GPX A;  2KFK A;  3AU5 A;  1FFV A;  1T3Q A;  1JRU A;  4HXD A;  2KJR A;  1F1H A;  1WWT A;  1WX9 A;  3HM6 X;  1JWS D;  4BKS D;  2BB6 A;  2JU6 X;  2KC1 A;  4L2Y A;  1Z2M A;  4G0N B;  3U52 E;  5BYR A;  3Q3N C;  3AEA B;  1BXT A;  2FNJ B;  3U2S C;  3Q3J A;  3ZTD A;  2G1E A;  5JZE B;  2BYE A;  2V1Y A;  1C4P A;  1K53 A;  3BY4 B;  2KN4 A;  5D7G A;  4DDI D;  3PO0 A;  4W9F A;  3EC8 A;  1T5X D;  3AXC A;  3OG5 A;  3IG3 A;  1ZOY B;  2N0S B;  4DK5 A;  2KNB A;  4OW0 A;  1GUA B;  2WXO A;  4NJ6 A;  2LHE A;  3QWZ B;  4C80 A;  2JVC A;  2KVZ A;  2I38 A;  2D2Q A;  4TMA B;  1RM6 C;  1IPG A;  1F2R C;  3W1S A;  1FNW A;  1BT0 A;  5IP4 D;  2BKR B;  3I63 C;  3TMP B;  3ZVV A;  1MFW A;  2FIF A;  4RCO A;  4RGM A;  2MJ3 A;  5D94 A;  4NY0 A;  1LGR A;  3ZIM A;  4XGA B;  3IAM 1;  2DZI A;  1OQY A;  2G9H D;  1BML C;  2LUM A;  2O6V B;  3VTW A;  5KHQ A;  3U7Z A;  4MDK E;  1YQ3 B;  2HJ1 A;  1I4P A;  2N9P C;  4OVZ A;  3W2D A;  3L13 A;  2KJ6 A;  1DGJ A;  3QX1 A;  2WXP A;  3A4S C;  3DVG Y;  2LGD A;  1UWX A;  5DPR A;  2IND C;  2RR9 A;  3DBH I;  1TS4 A;  3DBR B;  3Q8E A;  3R2I A;  1M4V A;  2C7M B;  2G4S A;  4LNI A;  3WAP A;  2J0J A;  2Q5W D;  2JPH A;  2ZNV B;  2NBU A;  5IOI A;  4ICV A;  4HVB A;  1YIW A;  4YTN B;  3FIL B;  2CHW A;  1HTO A;  1J19 A;  4M0W B;  3QQ8 B;  1E7V A;  3SD5 A;  3A9K B;  3NHE B;  2K0P A;  2M0A A;  1UGM A;  4JX1 C;  1WGR A;  3I5J C;  4MT5 A;  5DCN A;  3VAW A;  5EDS A;  2D10 A;  3RFZ B;  4JWS C;  1LXD A;  4BBN F;  3P4P B;  2K8H A;  4AQ7 A;  4FHK A;  3CIR B;  2BYT A;  1N62 A;  2KHW B;  1R4N B;  4F7Z A;  5IAA C;  2VH2 A;  3FIL A;  2GI9 A;  2IDY A;  4HLE A;  2KDM A;  1XLP A;  1V5T A;  4XC2 A;  3R3M A;  3PS6 A;  3LB8 C;  2KFJ A;  4HDQ A;  1WM2 A;  1CK1 A;  1IGD A;  3MHZ A;  2QEJ C;  4OVU A;  4N58 A;  3BIN A;  2NBW B;  4HPL B;  3VRB B;  4N9F 4;  2W3S A;  1WJ6 A;  2V4I B;  1C79 A;  1VRA B;  1EF5 A;  4GOC A;  3ZXV A;  3V6C B;  1SIJ A;  2DWQ A;  1K51 A;  3AE1 B;  2V3N A;  3QIJ A;  3PSE B;  4TKN A;  3VHT C;  4PS8 A;  2TSS A;  3M3J A;  3X0W A;  3Q69 A;  3WAO A;  2CS4 A;  3DBS A;  3ZLZ A;  2G45 B;  3ZTC A;  4GDK B;  1VCB A;  3PLU A;  1J8C A;  1WRD B;  3QJZ A;  2HTM E;  2LGY A;  3UIO B;  4RM8 A;  1STE A;  3NS1 A;  4BBN C;  1NYQ A;  1Q10 A;  4BKS A;  2XK5 A;  4LK0 M;  4RFB A;  3NVW A;  4HKZ E;  1WMH A;  1Q1O A;  3UQB A;  3HRD D;  2XBB C;  3BII D;  4LLG M;  1F52 A;  3OLM D;  3SR6 A;  3QCA A;  2B76 B;  1X1M A;  3WIM A;  3EHV A;  2QCZ A;  3WCQ A;  2E3T A;  1WXQ A;  3W1S C;  3UF8 A;  3P4Q B;  4IW0 A;  1P7F A;  2I2Y A;  1TKE A;  2LHD A;  4N59 A;  3DOW A;  1E8X A;  1NYR A;  1FXA A;  4F1S A;  2WS3 B;  2K22 A;  2PVG C;  3Q8C A;  3W5V B;  4JQW C;  1I4Q A;  3URY A;  4A90 A;  1S3S G;  3SU8 X;  3NOB A;  3BVG A;  4JLC A;  3GZN B;  2QIE B;  2KD0 A;  3PZ8 A;  1HQR D;  1L4D B;  3APD A;  4K7U A;  4BZA A;  2Y5C A;  4IC7 B;  4IM0 A;  1WZ0 A;  3DQV A;  3UI3 A;  4MGI E;  2RDB C;  4DHZ B;  4O1N A;  2L0T A;  4ZDV A;  1WM3 A;  2NPT A;  3BVZ A;  1MPE A;  1XF5 L;  2ZNV C;  3X23 A;  2IBI B;  3ZNI D;  2QSD A;  4ZRJ A;  2BPS A;  1TZ1 A;  2KOX A;  4RNA A;  4W9G A;  1R4N I;  3M95 A;  1UF0 A;  4YSX B;  4MSQ B;  1TBE A;  2BS3 B;  3BWU D;  1KLV A;  3B2F A;  1WIA A;  2H89 B;  1HXY D;  3AUL A;  3N3K B;  3ABV B;  1MG8 A;  2M17 A;  4JPS A;  2NVU I;  2ZPY A;  2N1W A;  3B2G A;  3TBL D;  1A5R A;  2ZCC A;  2JZZ A;  5E6P A;  1MHX A;  4G50 A;  1KH0 A;  4YWG G;  2JY6 A;  3UIN B;  3UGB B;  3ZDM C;  4BVU C;  5LNK 1;  4ICU A;  2KDE B;  1L6V A;  4LNF A;  1TKY A;  1FPY A;  1YD8 U;  1YX6 B;  2J4X A;  1PQS A;  2C7H A;  1GOZ A;  1SBB B;  3L17 A;  2PJH A;  4MGZ E;  4OHJ A;  1L6U A;  3HVZ A;  1XD3 B;  5C23 A;  4UDU C;  3GE8 C;  3TUO A;  1DOX A;  4R3D A;  3AE6 B;  2KYW A;  4M02 A;  3NUH B;  1GAQ B;  3L0W B;  1KLG D;  3MJW A;  2DLB A;  4LTU A;  1UZX B;  4MGY E;  5C3J B;  5TSS A;  4YTP B;  4YSZ B;  4N6E B;  3S2A A;  3TEZ A;  2GRI A;  4NAW B;  3Q3O C;  4LNN A;  5BYS A;  3ML8 A;  2N4F A;  3NJT A;  4YTM B;  2CHX A;  3PRP B;  4ASW C;  3LXF A;  2Z8L A;  2MQJ A;  4D2K A;  3K9P B;  1JML A;  3P1M A;  1DOI A;  4CO7 A;  4JWU C;  2NBV B;  5FK9 C;  4FAD A;  5HKH A;  4ZRI A;  1HEZ E;  2BB5 A;  1VLB A;  3QAR A;  2K6Q A;  2MBQ A;  1ZKH A;  4WWO A;  3SEB A;  4GN1 A;  3R66 C;  2V0G A;  2A4Z A;  4FLH A;  2N9E B;  1AYF A;  1L0V B;  4K7W A;  2MA9 B;  4YL8 A;  4OVV A;  5IN7 A;  2K5P A;  1E0Z A;  2AL3 A;  2WXN A;  3U7D A;  2KDI A;  4P1B C;  2BYF A;  2LI5 A;  1OFF A;  3VXW A;  3ZNZ B;  1WYG A;  2ZJD A;  4W9D A;  4WJQ A;  3M63 B;  3DBR I;  3KWL A;  2FCQ A;  5AUI A;  4A20 A;  2MP2 B;  2YLM A;  1TS2 A;  4WWN A;  2DHZ A;  1PYW D;  4ZHP A;  3EFC A;  3PRM B;  5L83 A;  4ZRK A;  4BKG A;  2JRI B;  2ZVN A;  2EEL A;  1P3Q U;  3KVF B;  3A9J B;  5E6O A;  3DBL I;  1MJD A;  4GDL B;  4KZC A;  3GE3 C;  4TV3 A;  3A33 B;  1E6E B;  2K8B A;  5EE0 A;  2KFK B;  3HVD A;  3WA0 A;  2OOB B;  2WP9 B;  4FJV B;  3NS8 A;  4WAF A;  5IO9 A;  2L0F A;  4II3 B;  4AS1 A;  2PEA A;  2R61 A;  2V3P A;  1D6E C;  4XDC A;  4LCD E;  5IKC M;  4I6P A;  1AN8 A;  2FUH B;  2X38 A;  3N1X C;  1C4A A;  1V86 A;  5CTR C;  1SB3 C;  1V2Y A;  2IY0 B;  1V9J A;  1LO5 D;  2Z59 B;  1WX7 A;  2IO0 B;  2PIA A;  1WY8 A;  1Z5S B;  3KQ4 A;  2YEP F;  2CKH B;  2IO3 B;  4BKT A;  3CF6 E;  3SDL C;  2RD0 A;  3H7P B;  1UD7 A;  3U30 A;  1V1P B;  4K3C A;  2FBW B;  3IFW B;  3H8H A;  4P6V F;  2LGX A;  4ZHO A;  2Z0E B;  4KKJ A;  2NTT A;  1YQ4 B;  3W9C B;  2G4D B;  3HM3 A;  4MM3 A;  3CSF A;  3ZJU A;  1IBX B;  4IKG A;  1Y56 A;  1MI0 A;  2KWD A;  1D5M C;  4WH4 A;  2N7D A;  2KTR A;  4DXA B;  3Q8F A;  3RUI B;  1JWM D;  4MEL A;  3KYC D;  4KDI C;  4ITK A;  2WNM A;  1V1P A;  2KQ4 X;  1ZW7 A;  4AP4 C;  1YN3 A;  4WJO A;  2BW2 A;  3MHS D;  3EEC A;  4HRO A;  4B0M A;  1V80 A;  1VJK A;  4DQO C;  1ZDV A;  2BVC A;  1RWS A;  4WWP A;  2LGS A;  3DHI C;  5BYQ A;  1VZ6 A;  2H88 B;  2MBB B;  1QIL A;  2K8C A;  4E74 A;  4BAX A;  2LJI A;  1VR9 A;  4A3P A;  1I4H A;  4G3X B;  3V05 A;  1J0G A;  1JWB D;  2GLS A;  1SIF A;  5LLI A;  2KAC A;  3FKY A;  3H9D A;  2WXJ A;  5G5H A;  2C5L C;  3ZO5 B;  5AUK A;  2MW5 A;  2NR2 A;  3VFK A;  4ARI A;  4NJ7 A;  3AEE B;  1JAL A;  4IM3 A;  2RPV A;  2DZK A;  4RGT A;  1FRR A;  5G5G A;  1WYW B;  1QOF A;  5FR3 A;  3AE2 B;  4ANW A;  1K8R B;  2KZR A;  1R4M B;  1CZP A;  2DZM A;  2W3R A;  3NZ3 A;  3P4R B;  5EE1 A;  1VDV A;  2BTE A;  1UBQ A;  2VZK D;  3WAN A;  2LVQ A;  3AEC B;  3I3T B;  2BWE S;  4OZA A;  2C9W B;  4US8 A;  1SE3 A;  1JWA D;  1YN5 A;  3NVZ A;  3ONS A;  3B1L X;  2N1V A;  2IJ0 A;  1WR6 E;  1BUI C;  4GXB A;  4M8N A;  3H7S A;  1SJE D;  2PW9 A;  1ZP0 B;  3DWG C;  3PGE A;  3PZ7 A;  3P2B A;  3IT6 B;  4TQ1 A;  1ZXH A;  2EMT A;  2AYO B;  2I1J A;  4HEA 1;  3MC9 A;  2OED A;  3QAQ A;  2AEH A;  2MSE D;  4AWJ A;  2INN E;  3MTN B;  3AE3 B;  5T8I A;  1I35 A;  2DZJ A;  1TIF A;  5KHO A;  2W82 A;  2PE6 B;  4XZ4 A;  1J7B A;  2GBJ A;  1ZXI A;  4PK1 A;  1XT9 B;  3MC8 A;  2PVO D;  1NI3 A;  4HJG E;  2KQ7 A;  1TS3 A;  1LQB A;  1C78 A;  2CU1 A;  3AE8 B;  3O65 B;  5L95 C;  2J0M A;  1B1Z A;  3ZYY X;  2INP E;  2JQR B;  4HCN B;  2WDT B;  2XNA C;  2E6X A;  2ZZP B;  3DVG X;  1YX5 B;  3U4E G;  1QOA A;  4CQN A;  2M1M A;  2NCN A;  2OJR A;  5D2M B;  4HRS A;  3GS2 A;  4L23 A;  3MJ5 A;  2J42 A;  1YMH E;  1RYJ A;  2W54 A;  1C1Y B;  4PYU A;  2ACZ B;  1PDX A;  1WJN A;  1R7S A;  1OEY A;  2LVP A;  1ET9 A;  1A70 A;  4LDT D;  2WXQ A;  1GG3 A;  3ZDT A;  4W9J A;  2NTS A;  1WGH A;  3H1U A;  4REZ A;  3VH4 B;  1VD2 A;  1P0R A;  3CWI A;  3O13 A;  3LYY A;  1ZPS A;  4IM2 A;  1L0X B;  3L16 A;  4FJY A;  4WAA A;  2ON8 A;  1SE4 A;  4DDG D;  1T0R C;  2KX3 A;  3ZJV A;  1WXM A;  1DYQ A;  3P4S B;  1C77 A;  4CYE A;  2LXA A;  4GB9 A;  4NAW A;  1SJH D;  3IT4 B;  2WXL A;  1SSN A;  4PYZ A;  2BBC A;  3VTU A;  2INC C;  3N20 C;  2DAJ A;  3SHQ A;  4FHJ A;  2JT4 B;  2N7J A;  4HDO A;  2L83 A;  2BF8 B;  1XLQ A;  3AEG B;  1ZGU B;  2AL6 A;  1XEE A;  3NY5 A;  4HCP B;  2LZ6 A;  4PT5 A;  1H8C A;  1L0Y B;  4BOZ B;  3E56 A;  2UWQ A;  2KC2 A;  4KIK B;  2DYM A;  1RRB A;  3L4P A;  1GB1 A;  3ECI A;  3TEY A;  5D6J B;  2V9H A;  3RNB C;  1V5O A;  3D32 A;  1ZUD 2;  3ZW3 A;  4KV2 A;  3TEW A;  1V97 A;  2WXR A;  3GP7 A;  2MJE A;  3L10 B;  3APC A;  3AB5 A;  2CJN A;  1YNT E;  2WX0 A;  3IHP C;  1E7P B;  1GC7 A;  2V3S A;  3JYU A;  4CHK A;  4AUQ C;  4MSM B;  4IDI A;  2QJL A;  2KAN A;  4A55 A;  1E7U A;  3DHG C;  5EE3 A;  2LVO A;  1HTQ A;  1C9F A;  2VZK B;  4MGK E;  2LAS A;  5CHV C;  1L2N A;  5IA7 A;  4K7S A;  4MAC A;  5BMI A;  4W9K A;  1UBI A;  3PZD A;  1WX8 A;  1NEK B;  4GDL A;  2WXK A;  1DOY A;  1NI2 A;  3AMZ A;  4RMA A;  3JSV A;  2IYD B;  3B9J A;  4JIO U;  4HK2 A;  2C60 A;  2EMS A;  1XXG A;  4LNO A;  1XLN A;  1SE2 A;  1I7H A;  4FBJ B;  1XQQ A;  5C1Z A;  2WWZ A;  1SGH A;  2WDV B;  2L3Z A;  2WXH A;  4W9C A;  5D3I B; 
#chains in the Genus database with same CATH homology
 5LXH A;  4DHZ E;  2LXC A;  4GDL B;  4FJZ A;  4KZC A;  2LWP A;  2FNJ B;  3Q3J A;  3K9O B;  4TV3 A;  4GU2 A;  3A33 B;  3ZTD A;  3ZUN A;  4EZL A;  5JZE B;  2BYE A;  2V1Y A;  2K8B A;  2KFK B;  2JRH A;  1WI0 A;  3WA0 A;  2OOB B;  4LDT B;  5BO4 B;  3BY4 B;  3APF A;  3NZS A;  5D7G A;  4DDI D;  1G6J A;  1LM8 B;  2KWV B;  4FJV B;  4W9F A;  3NS8 A;  3EC8 A;  3PLV A;  2MBO A;  5AEK B;  4W9L A;  3AXC A;  4KSL C;  2L0F A;  3IG3 A;  5G2N A;  4DK5 A;  2KNB A;  2BYV E;  4II3 B;  1GUA B;  2PEA A;  4NJ6 A;  2O6V A;  3QWZ B;  3B0A A;  3A9J A;  2JUO A;  4GIV A;  4GMV A;  4LCD E;  2JVC A;  1ISN A;  1GJZ A;  2JZ3 B;  4I6P A;  1YJ1 A;  2JWZ A;  2W9N A;  2D2Q A;  1IPG A;  3W1S A;  1KJT A;  1BT0 A;  2FUH B;  4DHJ B;  3V6E B;  2BKR B;  2YVC A;  3N30 A;  2K25 A;  1WF9 A;  3EFU A;  3TMP B;  3ZVV A;  4BFR A;  3H7P A;  3NZU A;  1Y8R C;  1V86 A;  2FIF A;  2KMC A;  5CTR C;  1V2Y A;  1NBF C;  2IY0 B;  5D94 A;  1V9J A;  4NY0 A;  2Z59 B;  3ZIM A;  2FID A;  2DZI A;  1F9J A;  1OQY A;  1WX7 A;  2IO0 B;  3AU4 A;  4MH0 E;  1WY8 A;  1D3Z A;  1QZE A;  4G11 A;  1OGW A;  4P7I A;  3RD2 A;  1Z5S B;  2DX5 B;  3LJ3 A;  2O6V B;  3VTW A;  2M8S A;  5DPS A;  5KHQ A;  4PS3 A;  3N32 A;  2CHZ A;  4MDK E;  4PS7 A;  4IG7 B;  2CKH B;  2N9P C;  2L8J A;  2IO3 B;  4K1R B;  2I1K A;  4KDL B;  4BKT A;  1RFA A;  2LD9 A;  5DPT A;  2WX1 A;  1T0Y A;  3CF6 E;  4EZK A;  2KTR B;  3L13 A;  3ZNG C;  3VVW B;  3GOE A;  4HWI B;  3SDL C;  2KJ6 A;  2RD0 A;  2HTH A;  2RSU A;  4GSW A;  4W9E A;  3HHM A;  3H7P B;  4GGQ A;  3QX1 A;  3A4S C;  3DVG Y;  3OJ3 A;  2LGD A;  1UD7 A;  5DPR A;  3U30 A;  1V6E A;  4J6I A;  2VRR B;  5LXI B;  2RR9 A;  3IFW B;  3DBH I;  2LGX A;  2LUE A;  2Z0E B;  4FN2 A;  4A20 A;  4URK A;  4I6N B;  2C7M B;  2G4S A;  3VUY A;  3WAP A;  2J0J A;  2G4D B;  1EF1 A;  2JPH A;  2KLC A;  2NBU A;  2ZNV B;  3HM3 A;  4ICV A;  4MM3 A;  4HVB A;  1YIW A;  3CSF A;  5AZH A;  4EKU A;  3VQI A;  2CHW A;  1J19 A;  4M0W B;  2N7D A;  3QQ8 B;  1E7V A;  2KTR A;  3SD5 A;  4DXA B;  3A9K B;  3ZNH B;  4AJW A;  3NHE B;  5J18 A;  3AI5 A;  1UGM A;  4NQL B;  3HK0 A;  3RUI B;  1WGR A;  2IO1 B;  2L00 B;  3KYC D;  4KDI C;  4MEL A;  5DCN A;  1EUV B;  2FAZ A;  3VAW A;  1RAX A;  3PV1 A;  5EDS A;  1FXT B;  1ZW7 A;  3DCG A;  4AP4 C;  2MBE A;  2D10 A;  2KX0 A;  1LXD A;  1E8Y A;  4BBN F;  2BGF A;  1RLF A;  4WJO A;  2HJ8 A;  3MHS D;  2K8H A;  3EEC A;  4FHK A;  1V80 A;  2KHW B;  4IWO A;  2K6D B;  2KLG A;  2UYZ B;  4F7Z A;  5IAA C;  4WWP A;  4XX5 A;  5AZF A;  5JHB A;  2B3A A;  3PHW B;  4FUL A;  4HLE A;  2MBB B;  3C0R B;  1V5T A;  2K8C A;  4E74 A;  3A9K A;  4XC2 A;  3R3M A;  2L76 A;  3PS6 A;  3DPD A;  2MLB A;  4A3P A;  3DVN V;  2KFJ A;  2GBN A;  4G3X B;  4HDQ A;  1WM2 A;  2R2O A;  3QA8 A;  4MJS B;  1J0G A;  4OVU A;  3BIN A;  2NBW B;  3QK0 A;  4HPL B;  2KWC A;  3RYT A;  4M8M A;  3KYD D;  1SIF A;  4IWP A;  4N9F 4;  1WJ6 A;  5LLI A;  1WH3 A;  4ANU A;  2KN5 A;  5GMV A;  3H9D A;  5CHF A;  2XK5 B;  2M0X A;  1EF5 A;  4GOC A;  3W1Y A;  3V6C B;  1WR1 A;  2C5L C;  3ZO5 B;  2MW5 A;  2NR2 A;  1V81 A;  1WFY A;  3QIJ A;  3VFK A;  3PSE B;  1WMH B;  4TKN A;  3VHT C;  2R2Q A;  4NJ7 A;  4PS8 A;  2V4L A;  3U8Z A;  2RGF A;  3RZW C;  3M3J A;  4KZ0 A;  3X0W A;  4NPN A;  2MBH A;  4IM3 A;  2CS4 A;  3WAO A;  2DZK A;  3QHT A;  1WXA A;  4DHJ D;  2PPH A;  3DBS A;  1AAR A;  2ZVO A;  2GBR A;  2G45 B;  2DYO A;  3ZLZ A;  3ZTC A;  1WYW B;  4GDK B;  4IUM B;  1VCB A;  3PLU A;  4DBG A;  1J8C A;  4DWF A;  1U4A A;  4MJS A;  1WRD B;  1K8R B;  2O2V B;  2KZR A;  4ANW A;  3QJZ A;  4K81 A;  2DZM A;  3TJP A;  2LGY A;  4E71 A;  3UIO B;  1TGZ B;  4EOY A;  4RM8 A;  3KH0 A;  1UBQ A;  2FCS A;  4BBN C;  2N7E A;  4BKS A;  2RPQ A;  2XK5 A;  3WAN A;  2REX A;  2LVQ A;  3I3T B;  5AZG A;  2BWE S;  2O6V D;  2C9W B;  3UIP B;  1H4R A;  2LJ5 A;  3PT2 B;  3ONS A;  1WMH A;  2GBK A;  3B1L X;  2N1V A;  1Q1O A;  1WJ4 A;  1WR6 E;  3UQB A;  1CMX B;  2XBB C;  2J7Q B;  4GXB A;  4M8N A;  3H7S A;  1Q5W B;  4EUT A;  4WJP A;  3OLM D;  3QCA A;  3OAW A;  4EEW A;  3RT3 B;  4GDK A;  3A4R A;  1X1M A;  2DAF A;  3VUW A;  3PGE A;  3WIM A;  3EHV A;  1GC6 A;  2M4N A;  3P2B A;  2O2V A;  2KMA A;  4TQ1 A;  3W1S C;  3PTF C;  2EMT A;  3UF8 A;  5FR6 A;  2AYO B;  1Q0W B;  4MEM A;  2I1J A;  2J0K A;  2LRU A;  4A3O A;  4IW0 A;  3ALB A;  2KWU B;  4II2 B;  1WGG A;  3QAQ A;  2AEH A;  2MSE D;  3IBE A;  3MTN B;  4JGH B;  2NPT B;  4KSK C;  4AWJ A;  2A5U A;  1I35 A;  2DZJ A;  3V60 A;  3DOW A;  3TL5 A;  1E8X A;  2BKF A;  4F1S A;  3CST A;  5KHO A;  3ZRC A;  3DDC B;  4JQW C;  1GNU A;  2PE6 B;  4XZ4 A;  3PRE A;  1E90 A;  1S3S G;  4W9H A;  1WGY A;  2GBJ A;  3SU8 X;  2D11 A;  3NOB A;  2HE7 A;  5CX3 A;  2PE9 A;  1WZ3 A;  4JLC A;  1XT9 B;  3WAL A;  2KD0 A;  3A1Q B;  3APD A;  2EKE C;  4K7U A;  2KQ7 A;  4IM0 A;  4IC7 B;  1WZ0 A;  1LQB A;  2GMI C;  2CU1 A;  3DQV A;  3O65 B;  4MGI E;  2KQS A;  5L95 C;  4DHZ B;  2J0M A;  2D07 B;  4RM9 A;  3RUL A;  2L0T A;  4ANV A;  4ZDV A;  1WM3 A;  2NPT A;  4X57 B;  3KW5 B;  5J17 A;  4HCN B;  2WDT B;  3HIZ A;  1OEY J;  2ZNV C;  2ZZP B;  3DVG X;  1YX5 B;  2MX2 A;  3PRZ A;  3X23 A;  2IBI B;  1E8Z A;  2NS5 A;  3GZN I;  3ZNI D;  2M1M A;  2NCN A;  2OJR A;  3VDZ A;  5D2M B;  2KO3 A;  4ZRJ A;  3RZF A;  2BPS A;  1TZ1 A;  2KOX A;  1WE6 A;  2ZCB A;  4W9G A;  3R7Q A;  1C1Y B;  1R4N I;  3M95 A;  4PYU A;  3V62 A;  4WJN A;  4MSQ B;  3L54 A;  1WJN A;  1TBE A;  1OEY A;  3A1Q A;  1KLV A;  2LVP A;  1HE8 A;  4LDT D;  2KKC A;  2GOW A;  1GG3 A;  1UH6 A;  1YQB A;  3ZDT A;  1WIA A;  4W9J A;  4BOS C;  1WGH A;  2GBM A;  3H1U A;  3AUL A;  3B08 A;  5JH5 C;  3N3K B;  3VH4 B;  1VD2 A;  3UQA A;  1P0R A;  3RCZ A;  1MG8 A;  2M17 A;  2NVU I;  2L7R A;  2ZPY A;  2N1W A;  1E8W A;  2WYQ A;  2BWF A;  5TR5 A;  3TBL D;  4IM2 A;  3TIX A;  1A5R A;  2ZCC A;  2JZZ A;  5E6P A;  4E3C A;  3L16 A;  4G50 A;  2HD5 B;  4ANX A;  3T8M A;  1KOT A;  3JW0 X;  2FCM A;  2JY6 A;  4FJY A;  4WAA A;  3UIN B;  3UGB B;  3ZDM C;  4BVU C;  4TUU A;  4ICU A;  2KDE B;  4DDG D;  2IO2 B;  2KVR A;  2KX3 A;  3QC8 B;  4KIK A;  2Z0D B;  1WXM A;  1WXV A;  3DVN U;  1NDD A;  5J2R A;  4NQK E;  1YD8 U;  1YX6 B;  4CYE A;  4EFO A;  1S1Q B;  2LXA A;  4GB9 A;  4F8C B;  4NAW A;  1PQS A;  2C7H A;  4HPM B;  5JHA A;  4PYZ A;  3L17 A;  3VTU A;  3ZKJ C;  2DAJ A;  2PJH A;  3VH3 B;  3SHQ A;  4FHJ A;  4MGZ E;  2JT4 B;  3TCA A;  4HDO A;  1XD3 B;  5C23 A;  4WQO B;  1WE7 A;  4AOF A;  2BF8 B;  1R4M I;  2AWT A;  3PPA A;  1ZGU B;  2AL6 A;  2G3Q B;  2D3G A;  2IY1 B;  3LDZ E;  3NY5 A;  4HCP B;  2LZ6 A;  1H8C A;  3ML9 A;  4B9K A;  3ENE A;  2CR5 A;  1V49 A;  3L0W B;  2KK8 A;  4BOZ B;  3VUX A;  4FA6 A;  2UWQ A;  1I42 A;  2KC2 A;  3KUD B;  4KIK B;  2DYM A;  1RRB A;  3MJW A;  4MGY E;  1UZX B;  4NNJ B;  4AJY B;  1P98 A;  1TTN A;  3L08 A;  1IP9 A;  2K1F A;  3ECI A;  3R7R A;  3S2A A;  2MRP A;  4NAW B;  5D6J B;  5G55 A;  2IZV B;  3H6N A;  3V61 A;  1WJU A;  1V5O A;  1SE9 A;  2JF5 A;  2N4F A;  3D32 A;  3ML8 A;  1KM7 A;  3ZRF A;  2CHX A;  2JXX A;  2Y5B B;  3PRP B;  4ASW C;  1IYF A;  1P1A A;  3WAM A;  2XEW A;  4B6W A;  3ZW3 A;  2MQJ A;  4KV2 A;  3K9P B;  1LFD A;  2ASQ A;  2LRW A;  3PVL A;  3L10 B;  4CO7 A;  2NBV B;  3APC A;  2K39 A;  4FAD A;  2WX0 A;  3IHP C;  5HKH A;  1GC7 A;  2V3S A;  1UEL A;  4ZRI A;  3M62 B;  3CMM B;  3JYU A;  4CHK A;  4AUQ C;  4MSM B;  3JSV B;  3KUC B;  3QAR A;  2K6Q A;  4W9I A;  2MP2 A;  2MBQ A;  1ZKH A;  3IVF A;  2KAN A;  1OTR B;  1P9D U;  2KDF B;  4JL9 A;  1E7U A;  4WWO A;  4GN1 A;  2FCN A;  2LVO A;  3R66 C;  5CHW A;  2A4Z A;  3T9L A;  2KTF A;  2DEN B;  4FLH A;  2N9E B;  5E6N A;  3KUZ A;  4K7W A;  2MA9 B;  4YL8 A;  1M94 A;  2LAS A;  4MGK E;  4OVV A;  5CHV C;  4B95 A;  1L2N A;  4EZJ A;  5IA7 A;  3OJ4 B;  1WGD A;  4K7S A;  2AL3 A;  4W9K A;  1UBI A;  3PZD A;  3U7D A;  2KDI A;  1WX8 A;  3VTV A;  2ZEQ A;  2BYF A;  2MWS B;  2LI5 A;  1EO6 A;  2KDB A;  3JVZ X;  1WXS A;  4GDL A;  2L05 A;  3VXW A;  3ZNZ B;  2KJH B;  3Q3F A;  1E5W A;  2ZJD A;  2MCN B;  1C3T A;  4LJO B;  4W9D A;  4WJQ A;  2N9X A;  1NI2 A;  1L7Y A;  2C7N B;  3PHX B;  3M63 B;  4RMA A;  3JSV A;  2KFK A;  3AU5 A;  2FCQ A;  2IYD B;  3DBR I;  4HJK A;  4HK2 A;  2MP2 B;  2YLM A;  2C60 A;  4JIO U;  4WWN A;  2EMS A;  2DHZ A;  1JRU A;  4HXD A;  4I6L B;  2KJR A;  2ZPN A;  2DYB A;  4FBJ B;  1XQQ A;  3PRM B;  5C1Z A;  5L83 A;  2WWZ A;  4KVG B;  1WX9 A;  3HM6 X;  4LJP B;  4ZRK A;  4BKS D;  2KC1 A;  1SGH A;  4IWQ A;  4BKG A;  2L3Z A;  2JRI B;  2ZVN A;  1Z2M A;  4G0N B;  5DPW A;  2QHO A;  1P3Q U;  3KVF B;  4TQ0 A;  3A9J B;  4W9C A;  5E6O A;  4ZYN A;  3DBL I;  2KXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...