4RM8A

Crystal structure of human ezrin in space group p21
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
586
structure length
368
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 130
structure length 368
sequence length 586
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00769 ERM Ezrin/radixin/moesin family
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rm8A01
4HK2A 2C7MB 4LJPB 4E71A 2DAJA 4TKNA 1QZEA 3ZRFA 3IHPC 3SU8X 1JRUA 5G55A 4K7WA 3VH4B 3ENEA 3UGBB 2FAZA 4BOSC 2FCSA 4HCNB 2DHZA 3DBHI 2Y5BB 1E7VA 2AL6A 2LVOA 2Z59B 4JQWC 3A1QB 1XD3B 3PHXB 3UF8A 2GBNA 3CMMB 3NHEB 1LXDA 2MBEA 1P98A 2MBBB 3VUWA 3R7QA 5LXHA 2GBKA 1GG3A 2KOXA 4W9CA 2K8BA 3R7RA 2V1YA 1I35A 4KDLB 4OVUA 2K39A 2KWCA 3BINA 1NBFC 2CHWA 1WMHB 1E90A 4XZ4A 3CF6E 4AUQC 4EZKA 2KWUB 2BPSA 3CSFA 2FCMA 2KTRA 4A3PA 5EDSA 1E8ZA 1V80A 2JRHA 2C7NB 5JHBA 1LM8B 3RZFA 3B08A 4WJQA 2NBWB 2WX1A 4BBNC 1V9JA 4HXDA 2ZCCA 4IWQA 3DVNV 1Z2MA 4M8NA 1YX6B 2A5UA 2AYOB 4MGKE 2D2QA 3WAPA 3N32A 4WWOA 4ICVA 3C0RB 3UINB 1P9DU 3GZNI 5LXIB 4GDKB 1WE6A 3DCGA 2KJHB 1V6EA 5KHOA 5D2MB 4MELA 1V2YA 4ZRKA 2O6VA 1YJ1A 2W9NA 3ML9A 3UQAA 1VCBA 1V49A 2CR5A 2DENB 2KDBA 3DBLI 2IZVB 3LJ3A 3ZNID 4PYUA 4MEMA 3VFKA 4HDOA 1WE7A 2N9XA 1WY8A 4EUTA 4HVBA 2CHXA 3L10B 2L05A 3A4RA 1TBEA 3DDCB 4EZLA 1V5OA 3TMPB 1SGHA 2D3GA 4FBJB 2JUOA 4W9DA 2QHOA 2ZPNA 2GMIC 4LDTD 2C9WB 2KZRA 1KOTA 5BO4B 4ANXA 3EECA 3ZIMA 2KMAA 2ZVNA 3VTUA 4EKUA 2KFKA 2KQSA 1CMXB 2ZZPB 3Q3JA 2MW5A 3H7PA 1Y8RC 2KO3A 4GOCA 4I6NB 1GJZA 2BGFA 4A20A 4GDLB 4G11A 4GU2A 4G3XB 1WGYA 2MBQA 4NY0A 3D32A 3WAMA 3RD2A 3VXWA 2KJ6A 1EUVB 3PPAA 4G50A 1WJ6A 2HTHA 2IY0B 3DBSA 3IVFA 1Z5SB 2FCQA 2K6QA 2JY6A 1SE9A 2YLMA 1GNUA 2O6VB 4RM9A 2LXCA 3H6NA 4BOZB 4KZCA 5CHFA 1WZ0A 2DZMA 3NS8A 3H9DA 2C60A 3M95A 4GB9A 4KIKA 2G45B 2WX0A 2C7HA 3IBEA 2DZJA 2FIDA 2EMSA 4WWNA 1E8YA 3HIZA 3U7DA 2BF8B 2LVPA 1RFAA 4JIOU 1FXTB 2IO1B 3V62A 1WIAA 3DVGY 2ZVOA 2B3AA 3KYDD 3MHSD 4MGZE 2L8JA 3L08A 2KFKB 3IFWB 2Z0DB 3H7PB 4FJYA 3ONSA 4LJOB 4ICUA 3WALA 3MJWA 3ZKJC 4FADA 3M3JA 3K9OB 5AZGA 3AI5A 1WYWB 4DHJD 2KHWB 2JVCA 2ASQA 5J18A 2DZIA 3V60A 2DX5B 2MCNB 1OTRB 2KFJA 3ZLZA 3OAWA 3ZTDA 2PEAA 1U4AA 3A9KA 3JSVA 1P3QU 3M63B 2BYFA 2FNJB 2NVUI 3OJ3A 3K9PB 4KVGB 3TBLD 4F8CB 1UELA 3WANA 2XEWA 3IG3A 2JRIB 2LZ6A 2G4SA 3A9JA 3DBRI 4JL9A 4KIKB 5IAAC 4AOFA 2L0TA 1WFYA 4IWPA 2DYMA 3GOEA 3RZWC 3AU5A 2IY1B 4BKSA 1YIWA 2XK5B 3WAOA 4XX5A 1WR1A 2KJRA 3PREA 3W1SA 4GSWA 4GN1A 3VTVA 1WM2A 5E6NA 4WJPA 3RULA 4MGIE 2MA9B 2BKFA 2KDIA 1EO6A 4ZYNA 2HJ8A 2LUEA 2NPTB 4EZJA 1UZXB 3EC8A 4ZRJA 2RSUA 1R4MI 5KHQA 4OVVA 1GC7A 2ZNVC 1XQQA 4FJZA 4GMVA 3QX1A 2UWQA 4K81A 5CHVC 1AARA 3A9KB 2BWES 2M4NA 3APCA 3JSVB 2LWPA 1PQSA 2WYQA 3WA0A 4CO7A 4FA6A 4WAAA 4EFOA 4DK5A 2EMTA 5G2NA 2JWZA 2K8CA 1OEYA 1J8CA 4IW0A 3ZDTA 4AJWA 2KD0A 4IM2A 3VQIA 4DHZB 2G3QB 2L7RA 3DPDA 3OJ4B 2MP2A 1Q0WB 3A9JB 3AULA 4ASWC 4EEWA 2DAFA 3V6EB 3VVWB 4IM0A 1J19A 4FN2A 1E8WA 4X57B 3L0WB 3B0AA 2DZKA 4K7SA 4MDKE 2LJ5A 3QCAA 1IP9A 2LRWA 4DDID 5D94A 2VRRB 4DWFA 4F1SA 4HJKA 1ISNA 4W9EA 3ZDMC 2BYVE 5E6OA 4NQKE 3W1YA 4AJYB 2KXJA 2LGDA 2D07B 1WJ4A 5AZFA 3SHQA 2LXAA 5DPSA 4YL8A 1UGMA 3NZUA 4LCDE 3W1SC 1WF9A 3ALBA 3ZTCA 1C3TA 4II3B 2PE6B 1L7YA 2KTRB 3TL5A 1WX9A 4F7ZA 3PHWB 2JT4B 4NPNA 3ZVVA 2LRUA 4WJNA 4HCPB 4DDGD 2KMCA 3KUDB 3VAWA 1D3ZA 2AL3A 3O65B 1WGGA 2KX3A 3PSEB 2J7QB 1VD2A 2CS4A 3QC8B 4A3OA 3UIOB 3U30A 4E3CA 4N9F4 1KM7A 4NJ7A 4PS3A 3PRMB 4W9IA 3NY5A 2ZCBA 1WGRA 1EF5A 3QIJA 3VHTC 1E5WA 1S1QB 2CKHB 1IYFA 4CYEA 3VUYA 2PPHA 1J0GA 2KC2A 2LD9A 3L54A 3QARA 2KVRA 4ZRIA 2JZZA 3KUCB 4TQ0A 2HE7A 4GXBA 4EOYA 2O2VA 5C1ZA 1WXVA 3AXCA 3AU4A 2ZEQA 4AP4C 2KNBA 1RRBA 4W9GA 3S2AA 2DYOA 4JGHB 4NNJB 2UYZB 3RCZA 3ZRCA 3R66C 4W9KA 3ZW3A 4K1RB 3DVNU 1UD7A 1KJTA 2FCNA 4TUUA 2KTFA 4AWJA 5D7GA 4FJVB 1WR6E 3QWZB 4TQ1A 4E74A 2GBJA 2NBUA 1P1AA 2R2QA 1GUAB 2KX0A 2MBOA 3ML8A 5DCNA 4ANVA 2N9PC 3M62B 1H4RA 3APDA 2LI5A 2IYDB 4IWOA 1WGHA 2M17A 1IPGA 2EKEC 2LASA 2XBBC 2K25A 4BKGA 2JPHA 2RD0A 3QQ8B 4HWIB 3Q3FA 4MGYE 4NQLB 1YQBA 4B9KA 3T8MA 4WWPA 1H8CA 5TR5A 3TJPA 5CX3A 3UQBA 4M8MA 4GIVA 2KLCA 1RAXA 4TV3A 2JXXA 4KSLC 4IG7B 3ZUNA 2KQ7A 1T0YA 4J6IA 2WDTB 2Z0EB 2KN5A 2PE9A 3ECIA 5DPWA 1UBQA 3QJZA 3T9LA 5GMVA 4KSKC 3HHMA 1MG8A 3TCAA 4I6LB 3PGEA 4I6PA 4HPMB 4WQOB 2WWZA 1BT0A 4RMAA 2L76A 1P0RA 3BY4B 4G0NB 3PT2B 5JHAA 1Q5WB 1OGWA 4LDTB 5DPTA 2M1MA 2JZ3B 4ZDVA 2IO3B 3V61A 2BYEA 2O6VD 2G4DB 2L3ZA 4GDKA 1TZ1A 4HLEA 4M0WB 3PRZA 4PS8A 2NBVB 3ZNGC 1RLFA 3JW0X 3VDZA 2CU1A 1WX7A 5C23A 3HM6X 3PLVA 3NZSA 3P2BA 4B6WA 5L95C 5IA7A 4PYZA 3U8ZA 3ZNZB 3PS6A 3WIMA 1WXMA 3OLMD 3QHTA 1OQYA 3L17A 2KC1A 3I3TB 1E7UA 1E8XA 4BVUC 2GBRA 3UIPB 1WRDB 4FULA 2OJRA 4DHZE 3EHVA 1A5RA 4FHJA 4W9FA 4KDIC 2CHZA 3RUIB 4ANUA 4BFRA 1WZ3A 5DPRA 1ZW7A 2IBIB 3TIXA 1WM3A 1WXSA 4MM3A 4GGQA 3JYUA 1I42A 4RM8A 4P7IA 4GDLA 2IO0B 2MWSB 2NS5A 5FR6A 3DVGX 3VH3B 2MSED 3VTWA 1C1YB 2N7EA 2AWTA 2J0MA 2RPQA 2J0JA 4B95A 2YVCA 4URKA 3MTNB 1WX8A 3X0WA 2N9EB 4MSMB 3PVLA 4MJSA 4DHJB 4W9LA 1V81A 2LVQA 2N7DA 3DQVA 3JVZX 3N3KB 3HM3A 1HE8A 1YD8U 4DXAB 2K6DB 2LGXA 2MBHA 3X23A 2D11A 1WH3A 3KYCD 2GOWA 3RT3B 1TGZB 1UBIA 2OOBB 3PRPB 2V4LA 4JLCA 4CHKA 2MP2B 5HKHA 2KKCA 3H1UA 4NAWA 4W9HA 4PS7A 2K1FA 2FUHB 3QK0A 3HK0A 5J2RA 2KLGA 3V6CB 2A4ZA 1M94A 2MRPA 2NR2A 2RGFA 2RR9A 3A4SC 3APFA 2BKRB 3KH0A 3KUZA 5L83A 5AEKB 2AEHA 4WJOA 4BBNF 5CHWA 4K7UA 1TTNA 2KWVB 2R2OA 4XC2A 1NDDA 2J0KA 2KANA 1EF1A 4BKTA 3ZNHB 3QAQA 3SD5A 3L13A 2GBMA 1NI2A 4DBGA 2ZPYA 1WJNA 2FIFA 1KLVA 2M8SA 1LFDA 2K8HA 1WGDA 2ZJDA 4MJSB 1F9JA 1OEYJ 3PZDA 2L0FA 1LQBA 2M0XA 3N30A 1X1MA 1G6JA 3A33B 3NOBA 2BWFA 1V5TA 1UH6A 4BKSD 2D10A 4KZ0A 1WJUA 2KDEB 4MSQB 1S3SG 3KW5B 2I1KA 5E6PA 2I1JA 3R3MA 1WI0A 2L00B 2N4FA 3QA8A 2XK5A 5JZEB 4IM3A 5LLIA 2KK8A 5CTRC 4NAWB 4MH0E 3H7SA 1ZKHA 1L2NA 4W9JA 1SIFA 3A1QA 2DYBA 2LGYA 1XT9B 2MQJA 1K8RB 2NCNA 3KVFB 2IO2B 2PJHA 3CSTA 2MLBA 4HPLB 3SDLC 2O2VB 4HDQA 2MX2A 1R4NI 2NPTA 2ZNVB 1V86A 1WMHA 1WXAA 1YX5B 1ZGUB 2REXA 4FLHA 5JH5C 2KDFB 3RYTA 3B1LX 3PLUA 3PV1A 3LDZE 1Q1OA 2N1WA 5D6JB 4IUMB 3DOWA 4IC7B 3PTFC 3L16A 4II2B 4FHKA 4ANWA 2N1VA 4KV2A 2V3SA 5J17A 1GC6A 2HD5B 2C5LC 3EFUA 5AZHA 2JF5A 3ZO5B 4NJ6A 3VUXA
chains in the Genus database with same CATH superfamily
3MC9A 1JCKB 4XDDA 1JRUA 3ENEA 4BOSC 4HCNB 3EA6A 2DHZA 2ICIA 3DBHI 2Y5BB 2LVOA 4JQWC 2Z59B 2BYTA 3VUWA 1LXDA 2MBBB 1XLPA 1RWSA 5LXHA 1GG3A 3R7RA 2V1YA 2KVZA 2K39A 2CHWA 3P4QB 1STEA 3E56A 4ZRPA 4EZKA 2PMVA 2JRHA 1LM8B 2NTTA 4WJQA 2WX1A 4HXDA 4LNOA 2PVOD 2ZCCA 2Y3AA 1Z2MA 1YX6B 3WAPA 3N32A 4WWOA 2WDVB 4EE2A 1C77A 2V9HA 4MELA 1YJ1A 2W9NA 3ML9A 3BWUD 2DENB 1KRHA 2J42A 4PYUA 4LNNA 4HDOA 1WE7A 1WY8A 4HEA1 4HVBA 3W2DA 1LO5D 2D3GA 4FBJB 4ZHPA 2JUOA 2ZPNA 1KOTA 4OZCA 2WDRB 1F2RI 4ANXA 3EECA 3ZIMA 3BYTB 2KFKA 2KQSA 3H7PA 2WS3B 3IAS1 1I4QA 4G3XB 4NY0A 1WJ6A 2IY0B 3DBSA 2MJEA 1FXAA 2FCQA 4US8A 2JY6A 1SE9A 2D3BA 4BOZB 2V0GA 1WZ0A 1OQQA 3M95A 3OG5A 4M00A 3IBEA 2FIDA 4YSYB 4WWNA 3HIZA 3U7DA 2VZKB 3V05A 2ACZB 2IO1B 3VR8B 3GB1A 3KYDD 1N63A 3KWLA 2KMMA 1ZXIA 3W9CB 4JWUC 4FJYA 1XEEA 1YQ3B 3M3JA 1C79A 3K9OB 3AI5A 4DHJD 3IT4B 2KHWB 3RNBC 2WLBA 5AUIA 1J7BA 2DZIA 3LXFA 1IGCA 4M0WA 4B0EA 3OAWA 4KGSA 2PEAA 2D3AA 1U4AA 3JSVA 1TKYA 3Q8FA 3AEGB 3OJ3A 3Q8AA 4JE3B 1XXGA 2K3UA 3IG3A 3DBRI 4JL9A 4KIKB 2L0TA 3AU5A 2ON8A 3U7ZA 2KAJA 3WAOA 1WR1A 2KJRA 2LUMA 4GN1A 2RDGA 1QQRA 4WH4A 1ZE3D 1XCQL 4MGIE 4C7ZA 2BBCA 3EC8A 2ZNVC 1XQQA 2UWQA 2GRIA 4K81A 3A9KB 3APCA 1PQSA 2I2YA 3WA0A 2EMTA 1IGDA 1V1PB 4XGAB 1C4PA 4C00A 3AE8B 4DHZB 1SE3A 2MP2A 3Q3NC 4ASWC 1QOGA 2K22A 3KLSX 2L32A 1E10A 1J19A 4FN2A 1E8WA 1ESFA 3SR6A 2LRWA 2W3SA 4W9EA 3W1YA 1I4GA 5AZFA 2LXAA 2WQYB 4Q2JA 3BYYB 1ENFA 1UGMA 4LCDE 2BS3B 3ALBA 4II3B 4K3CA 3TL5A 4F7ZA 1AYFA 2XN9C 1ACCA 1ZPSA 1D4BA 1D3ZA 2AL3A 2GI9A 1T0QC 4NJ7A 4PS3A 3NY5A 1E5WA 2CKHB 3NJTA 1IYFA 3VUYA 2N0SB 3L54A 2KVRA 4ZRIA 4KKIA 4TQ0A 4GXBA 1CQVA 1WXVA 4AP4C 1D5MC 2KNBA 1AWDA 4JGHB 3N20C 2JX5A 3R66C 3DVNU 2FCNA 4TUUA 1Y56A 5BMGA 4HKQA 4FJVB 1NYRA 1H4RA 2HTME 5T8IA 2IYDB 2E3TA 3AECB 1E0ZA 2LASA 2WXNA 3QQ8B 3H8HA 4MGYE 1YQBA 3BVZA 3UQBA 1C76A 1HQRD 3ZUNA 4J6IA 1XCTL 3HHMA 3PGEA 3DBLB 1BT0A 1ET9A 5JHAA 3DHGC 1PDXA 3GS2A 4RGOS 5DPTA 2JZ3B 3AN1A 3SEBA 2IO3B 3V61A 1D6EC 1TJEA 4M0WB 4PS8A 2NBVB 5IKCM 3PLVA 3NZSA 3P2BA 4B0MA 3ZNZB 2D3CA 1WXMA 3OLMD 1OQYA 3AE1B 2RPVA 4BVUC 1WYGA 4DHZE 1JRPA 4FHJA 4KDIC 4RGTA 1LGRA 1MI0A 2N7JA 5DPRA 2IBIB 2WXKA 1WXSA 1I42A 3JYUA 1N60A 4LNFA 4GDLA 1UWXA 5FR6A 3DVGX 3VH3B 1YOVB 3P1MA 1C1YB 2J0MA 2YVCA 3NZ3A 2PVGC 1AN8A 2MJ3A 4MJSA 3AM9A 2BVCA 3DQVA 2AQ3B 1YD8U 1GAQB 4TMAB 1V97A 2LGXA 3X23A 2GOWA 4JLCA 4CHKA 2MP2B 3V3XA 1Q10A 2KKCA 1HEZE 4K3BA 4NAWA 1TS3A 4W9HA 4PS7A 2K1FA 3GE8C 4J3OD 1QF6A 3V6CB 4G0NB 2NR2A 3APFA 3HRDD 3U52E 5AEKB 4BBNF 5CHWA 3W1SC 3ZJTA 1NDDA 3RMKC 3TEZA 3EGRA 3ZNHB 2GBMA 3SFEB 4DBGA 1SXTA 1FD6A 2M8SA 1TYGB 1ZDXA 2XNAC 2ZJDA 3PZDA 1SF0A 1PYWD 1SSNA 3AE7B 4C80A 1V5TA 1UH6A 2D10A 2KDEB 4ARIA 1S3SG 1BMLC 5E6PA 1RFKA 1UWMA 1E7PB 3AV8A 1VZ8A 1UUPA 2XK5A 1FO4A 5CTRC 4W9JA 1SIFA 4NZLB 2MQJA 1JWUD 2BW2A 3CSTA 3SDLC 3N1YC 2ZNVB 2REXA 3AB5A 2Q5WD 5JH5C 2KDFB 4RCOA 3PLUA 1D5XC 4IUMB 4IC7B 2N1VA 4KV2A 2HD5B 2INNE 5AZHA 1ZXHA 3VUXA 4HK2A 2DAJA 1QZEA 3ZRFA 5IO9A 3IHPC 4K7WA 2M0AA 2L52A 4XYCA 3AEBB 1VZ7A 3AE4B 1E7VA 2AL6A 1XLQA 3UF8A 3BZDB 2GBNA 2MBEA 2GLSA 2YEPB 2GBKA 3FKYA 4S0RA 1I35A 1C4AA 4KDLB 3BINA 1NBFC 1WMHB 2KWUB 3CSFA 2FCMA 4AQ7A 2QCZA 4C7YA 4NAMA 4ZHOA 3EFCA 2AYOB 4MGKE 2D2QA 2L1AA 5LXIB 1V6EA 2R61A 3UQAA 1VCBA 1V49A 5H8YE 4BZAA 3LJ3A 1C9FA 1XF5L 4MEMA 3VFKA 2N9XA 1VRAB 2CHXA 3A4RA 3DDCB 4EZLA 1SGHA 1KFYB 2GMIC 2C9WB 5HI1A 1DOYA 2H88B 3I57A 5BO4B 3VTUA 2ZZPB 1GJZA 3MC8A 2RDBC 1FRDA 2BQQA 4GDLB 4GU2A 4WWMA 1WGYA 2MBQA 3D32A 1EUVB 1L5PA 2HTHA 1VLBA 3AH7A 2K6QA 1GNUA 4HROA 5CHFA 2DZMA 3C19A 3B2GA 2LFIA 4GB9A 4KIKA 2WX0A 1R4MB 1TS5A 3MHZA 2BF8B 2K0PA 3MC0B 1WXQA 1L6VA 1WIAA 3DVGY 4MGZE 2B3AA 2BS4B 3J9CA 1K52A 3Q2AC 2WU5B 4LJOB 4ICUA 3ZKJC 1L0XB 3NG0A 1EU3A 3V60A 2MCNB 1JWBD 3A9KA 2WXIA 3M63B 2X8XX 2KWDA 2TSSA 1V1PA 3K9PB 4F8CB 2KN4A 2BS2B 2JRIB 2G4SA 2RMMA 5IAAC 1WFYA 4IWPA 2ZW0A 3O13A 3GOEA 3NVYA 1YIWA 2XK5B 4XX5A 3AE3B 5E6NA 4WJPA 3RULA 2B76B 2MA9B 1F77A 2KDIA 1EO6A 3P42A 3DHIC 2JYTA 1GC7A 4FJZA 4GMVA 4FA6A 4RFBA 2WYQA 3P4PB 5G5HA 4EFOA 1J7CA 3NRZA 5IP4D 1L0YB 1SE4A 4IW0A 3BVMA 4AJWA 2G3QB 2L7RA 3A9JB 1Q0WB 1QOAA 3TSSA 1JWSD 3L0WB 4K7SA 1NENB 4MDKE 3WCQA 3QCAA 1JALA 1FRRA 1IP9A 5D94A 3ZDMC 1ISNA 4AJYB 1P7EA 2LGDA 1TKGA 3SHQA 5DPSA 4YL8A 1MPEA 3NZUA 3ZTCA 2PE6B 5BYQA 3SFDB 3ZVVA 2LRUA 2BTEA 1ZUD2 2KX3A 3PSEB 2J7QB 3RI7C 4E3CA 4N9F4 1KM7A 3RNAC 1EF5A 4CYEA 2HE7A 4M02A 5C1ZA 4A8XC 5G5GA 2ZEQA 4LLGM 5EE3A 2QILA 3B9JA 3RCZA 2UYZB 1PGXA 1KJTA 3BK1A 1WGKA 1WR6E 2NBUA 2W82A 2R2QA 5EE0A 4ANVA 4JPSA 2LI5A 1M4VA 2EKEC 3ZQ4A 1PUTA 2WXQA 1FFUA 3T8MA 5TR5A 4M8MA 2KLCA 4WURA 2INDC 1T0YA 1GOZA 3ECIA 3QJZA 5GMVA 2IGGA 4KSKC 1VZ6A 1MG8A 5BYRA 4I6LB 4I6PA 5I4DA 4XWTA 2L76A 1P0RA 3BY4B 3PT2B 3RNFC 2ZW1A 1OGWA 4LDTB 2M1MA 3LB8C 2WP9B 1TIFA 1TY0A 3BVGA 3AEAB 3PRZA 1ROEA 1RLFA 3JW0X 2OHFA 2VZKD 1CZPA 4ZYSA 3QHTA 2KC1A 1E8XA 2J4XA 2J52A 3ABVB 1FNUA 3KQ4A 2PW9A 2SAKA 3RUIB 4ANUA 1FEHA 3NVWA 1HZ6A 2RDHA 5EE1A 3RNCC 2IO0B 4A55A 2MWSB 2NS5A 3ZJVA 3VTWA 3RNGC 2J0JA 2AQ2B 1WX8A 3X0WA 2LGSA 2N9EB 4MSMB 1HTOA 1FCLA 2LVQA 3JVZX 3N3KB 4C4VB 4ITKA 1MG4A 4JX1C 1HTQA 3KYCD 2Y5PA 1JROA 3H1UA 4OHJA 3ZJUA 2FUHB 3URYA 1MVKA 5J2RA 4M01A 5BYSA 2A4ZA 2MRPA 3DBRB 2RR9A 3KUZA 4MM3B 1KLUD 4WJOA 2J0KA 4HKZE 2JZPA 2L0FA 1LQBA 3N30A 1GPXA 1FXIA 1X1MA 3NOBA 2INPE 1WJUA 2QIEB 3CIRB 2IGHA 4HJGE 2L00B 1NVID 4YTNB 5BMHA 1KF6B 3NS1A 2AQ1B 2LGYA 1B9RA 1YJJA 2J53A 2PJHA 4HPLB 3GZNB 4N59A 2MX2A 2NPTA 1WXAA 1WMHA 3RYTA 3LDZE 5D6JB 3TEYA 3R2IA 3DOWA 3PTFC 5J17A 1K51A 1GC6A 2C5LC 1E6EB 3EFUA 2X38A 1TKEA 4RGNA 4E71A 3SU8X 3NVVA 5G55A 3DHHC 3UGBB 2FCSA 3GP7A 1QILA 2MEKA 4ZRQA 3PHXB 1P98A 1J7AA 2DBYA 2KOXA 2K8BA 1IBXB 1XLOA 4AUQC 2BPSA 3HVDA 2KTRA 1JW9D 4A3PA 1E8ZA 2JYEA 4BBNC 2M56B 4IWQA 3AE9B 5JXVA 4IKGA 4M8NA 4N6EB 1UGJA 3UINB 3C0RB 3DCGA 3Q8EA 5C3JB 5KHOA 2LEKA 4YSXB 2OEDA 3FILB 2IZVB 3ZNID 4A90A 3BK2A 2IDYA 2FUG1 3IXSA 3L10B 2L05A 1TBEA 1QT9A 3TMPB 4W9DA 1YQ4B 2QHOA 2PLPA 4EKUA 2ZVNA 1CMXB 3Q3JA 2KYWA 1GB4A 4WAFA 1EWYC 1Y8RC 2KO3A 4GOCA 2JWUA 1L4DB 1YN5A 4G11A 4L2YA 4AS1A 2KACA 2KJ6A 4G50A 1Z5SB 1P7FA 2YLMA 1FFVA 2O6VB 4RM9A 4USAA 3E9SA 3NS8A 4YXDB 3H9DA 2C60A 2BB5A 2G9HD 3N9YC 2G45B 2C7HA 1I4XA 1MJDA 2QC8A 4KX6B 2LVPA 1IUEA 1VJKA 2WXHA 4JIOU 1RFAA 1FXTB 4LNKA 3V62A 1L6UA 3MHSD 5GXGB 2Z0DB 3WALA 3MJWA 4FADA 4BAXA 5AZGA 2JVCA 1HZ5A 5HG2A 1OTRB 2KFJA 3ZLZA 1DYQA 2INCC 4KVGB 3TBLD 4D2KA 2NTSA 3A9JA 4AOFA 2JQRB 1L4ZB 2DYMA 1N61A 2IY1B 4BKSA 5IN7A 4NJCA 3W1SA 4HRSA 2N9KA 2HJ8A 2NPTB 1UZXB 4A6QA 2PIAA 1R4MI 3QX1A 3CWIA 2BT6A 1AARA 2BWES 4WAAA 1QOBA 1OEYA 1J8CA 3ZDTA 2KD0A 4IM2A 3T3NA 3DPDA 4XWWA 4EEWA 3AULA 2DAFA 2WXLA 4IM0A 1F2RC 2QSDA 3B0AA 3PZ7A 2LJ5A 4DDID 2VRRB 4DWFA 3KWVA 4HJKA 1SBBB 2BYVE 1NYQA 2WHIA 2KXJA 2D07B 1WJ4A 4MACA 1E9MA 1PFDA 1WF9A 3TEXA 1C3TA 2LMCA 1L7YA 2KTRB 3HVZA 3PHWB 4NPNA 4WJNA 4HCPB 2WDQB 2KMCA 3KUDB 3O65B 2CS4A 4A3OA 3UIOB 1SE2A 3U30A 3PRMB 3FAHA 2QMTA 2ZCBA 1WGRA 1ZP0B 2WXMA 3QIJA 4L1BA 2PPHA 3IAM1 3N1XC 2KC2A 3QARA 5LNK1 2MH7A 2JZZA 1N62A 2AX5A 3AXCA 4ACFA 3U4EG 1PGAA 1RRBA 3P4RB 3Q3MC 4NNJB 2WXFA 4S17A 4W9KA 3ZW3A 1UD7A 5D7GA 1RYJA 3QWZB 3TUOA 4TQ1A 1OQRA 2I38A 2CJNA 1P1AA 1GUAB 4MH8A 3EUB2 4IWOA 1WGHA 1IPGA 2XBBC 4OW0A 1KTKA 2M19A 2RD0A 4HWIB 4NQLB 3MFGA 1I7HA 3TJPA 5CX3A 2WXRA 4GIVA 2ONQA 3MP9A 2JXXA 2KQ7A 2PE9A 5DPWA 3T9LA 2NMQA 2KQ4X 4YWGG 4HPMB 1Q5WB 2CJOA 2HJ1A 2EKIA 4LTUA 2BYEA 3ETRA 4GDKA 2WXJA 4HLEA 3R8BA 4A9AA 3VDZA 3OWEB 1WX7A 4B6WA 3HM6X 4P1CC 4C4VA 5HFYA 5L95C 3NVZA 4PYZA 3U8ZA 3WIMA 1F0ZA 1T6BX 3UIPB 4FULA 2OJRA 3EHVA 1KLGD 4W9FA 3AMZA 1WZ3A 1ZW7A 3TIXA 1WM3A 4MM3A 4RM8A 1CJEA 4DQOC 2MSED 2JXTA 2AWTA 2RPQA 3MTNB 5FKAC 3I9V1 3Q69A 4DHJB 1V81A 4WIPA 1R4NB 2HDEA 2D11A 3Q8BA 4PK1A 1EU4A 3RT3B 1UBIA 2OOBB 3PRPB 2V4LA 1SIJA 5D3IB 5MPOA 3Q6BA 3HK0A 4ARCA 2RGFA 3A4SC 2BKRB 3KH0A 1QKZA 5L83A 4K7UA 1TTNA 2KWVB 2R2OA 4XC2A 4BKTA 1EF1A 3QAQA 1V1OA 4R3DA 3SD5A 5FR3A 3L13A 1JMLA 2ZPYA 3DBHB 1GB1A 2FIFA 1LFDA 2K8HA 1OEYJ 2M0XA 3VRBB 3A33B 3L4PA 1I4PA 4BKSD 4KZ0A 2OJWA 4MSQB 4WQMA 4C56C 1TT5B 2N4FA 3Q3OC 5LLIA 2Z8LA 1WRIA 3W5VB 1XT9B 3KVFB 2IO2B 4REZA 4US9A 1V86A 1YX5B 1ZGUB 1IBXA 1HXYD 1EWCA 2QJLA 3B1LX 2DLBA 4L23A 3PV1A 1ET6A 4RF1A 1YN4A 4II2B 4FHKA 2V3SA 1CK1A 2LJIA 2QDFA 1WSPA 2JF5A 5EE9A 1T5XD 4NJ6A 4OZBA 2C7MB 4LJPB 4TKNA 1SJED 1YJIA 3VH4B 2FAZA 3AE2B 2MJDA 3FILA 4QAYA 3TEWA 1JQ4A 1K50A 2KT7A 1XD3B 3A1QB 1BUIC 3CMMB 3NHEB 3R7QA 4KGTA 4W9CA 4YTMB 4IOIE 1TZOA 2KWCA 4OVUA 1E90A 4XZ4A 3CF6E 5EDSA 3UI3A 1V80A 5JHBA 2C7NB 3RZFA 3B08A 3ZXVA 2NBWB 1V9JA 1DOIA 2DNFA 4TSSA 3R2TA 3DWGC 2FBWB 2WU2B 3DVNV 1NEKB 1C4CA 1F1HA 2A5UA 2PTLA 2K9XA 4ICVA 1P9DU 3GZNI 4GDKB 1WE6A 2K5PA 2KJHB 1SEBD 5D2MB 1V2YA 4ZRKA 2O6VA 3AEFB 2CR5A 3DBLI 2KDBA 2SEBD 4O1NA 4PT5A 4EUTA 1FIQA 3B2FA 3AEDB 1V5OA 2IPKD 4LDTD 4MT5A 2KZRA 3ZYYX 1FPYA 2KMAA 1QOFA 4RNAA 2MW5A 3RFZB 4I6NB 4ZOHC 3Q8CA 2BGFA 5H92C 3ZGZA 4A20A 5AUKA 4CQNA 5D3DA 3WAMA 3RD2A 3VXWA 1FNVA 3PPAA 3IVFA 2IGDA 2WXOA 2W3RA 4XDCA 2KDMA 3T3OA 3C8YA 2LXCA 3H6NA 4XE0A 4KZCA 2N9LA 3W5UB 1V8CA 2DZJA 2EMSA 3PZ8A 2WXGA 3IT6B 1E8YA 4RH6A 1BXTA 2H89B 3AEEB 2ZVOA 2BB6A 2YEPF 2L8JA 3L08A 2KFKB 2E6XA 2W54A 3IFWB 3H7PB 3ONSA 4LK0M 5FK9C 1WYWB 4GLSC 3ZXRA 2ASQA 5BMIA 5J18A 2DX5B 3ZTDA 1K53A 1TS2A 1P3QU 1MFWA 2BYFA 1ZDVA 1VDVA 2FNJB 2NVUI 1UELA 3WANA 2XEWA 1FCCC 2LZ6A 1DGJA 2WGSA 2LGIA 3RZWC 1I4RA 1L0VB 1JWMD 3PREA 4GSWA 3VTVA 1WM2A 2JU6X 2BKFA 4ZYNA 2LUEA 3I5JC 4EZJA 4ZRJA 2RSUA 2V4IB 5KHQA 1B1ZA 3MJ5A 4OVVA 3I63C 4H2AA 2GB1A 5CHVC 4URKA 2M4NA 4CO7A 3JSVB 2LWPA 2V3PA 4DK5A 3GE3C 2LHEA 5G2NA 2JWZA 2K8CA 1KH0A 3VQIA 4YTPB 3OJ4B 4P6VF 2V3NA 3V6EB 2FE8A 3VVWB 2CU3A 4X57B 3N1ZC 2DZKA 1YN3A 2VH2A 1D5ZC 1FNWA 4F1SA 5E6OA 4NQKE 5TSSA 4DXGA 4OVZA 1OFFA 1WX9A 1PGBA 2JT4B 4DDGD 2D5GA 4JWSC 3VAWA 1N5XA 2DWQA 1WGGA 1A70A 3QC8B 1VD2A 4W9IA 3VHTC 1S1QB 1NI3A 1J0GA 2LD9A 3KUCB 4EOYA 2O2VA 5C2TB 1RM6C 3AU4A 4W9GA 1DOXA 1XLNA 3S2AA 1SB3C 2DYOA 1UF0A 3ZRCA 2WXPA 4K1RB 1WWTA 2UU7A 3FC4A 3P4SB 1AW7A 4N58A 2KTFA 4AWJA 4E74A 2GBJA 1I4HA 2KX0A 2MBOA 3ML8A 5DCNA 2N9PC 3M62B 3APDA 2M17A 2K25A 4BKGA 2JPHA 5HHDG 3Q3FA 4B9KA 4WWPA 2QEJC 4YT0B 3NUHB 1H8CA 4FXCA 1RAXA 4TV3A 3AE5B 4KSLC 4IG7B 4P1BC 2WDTB 2Z0EB 2KN5A 2MHJA 1JWAD 5E6JA 1UBQA 2WNMA 3TCAA 4WQOB 2WWZA 4RMAA 4RGMA 4KGRA 1N5WA 1EM7A 3VRAB 4ZDVA 4IDIA 4DXFA 2O6VD 2G4DB 2L3ZA 2Y5CA 3PO0A 1TZ1A 4LNIA 3ZNGC 2CU1A 1VR9A 5C23A 5IA7A 3PS6A 1F52A 2G1EA 3L17A 5IOIA 3I3TB 1E7UA 2GBRA 1WRDB 3RN9C 1A5RA 1MHXA 1FM0D 2CHZA 4BFRA 2LHDA 4GGQA 4P7IA 1T0SC 4OZAA 1TY2A 3RNEC 1C78A 2N7EA 4B95A 3HUIA 3PVLA 4W9LA 2N7DA 3HM3A 1HE8A 4DXAB 2K6DB 2MBHA 1N6ZA 1WH3A 1TGZB 2JSVX 5HKHA 1MHHE 3Q14C 2EELA 3AE6B 3LYYA 1TS4A 1ZOYB 3QK0A 2KLGA 1M94A 1R7SA 2PKOA 2AEHA 5JZEB 1FMAD 2KANA 1T3QA 1XO3A 1NI2A 4RF0A 1WJNA 1KLVA 1SJHD 1WGDA 4MJSB 1F9JA 2W55A 4P16A 1G6JA 2BWFA 3DWMA 2VH1A 3KW5B 2I1KA 1YNTE 2I1JA 3R3MA 1WI0A 3QA8A 3RPFC 3VR9B 1HA5A 4IM3A 2KK8A 2IJ0A 4NAWB 4YSZB 4MH0E 3H7SA 1ZKHA 3BIID 1L2NA 3A1QA 1YMHE 2DYBA 3U2SC 1K8RB 1UNSA 2NCNA 2MLBA 2O2VB 4UDUC 4HDQA 1R4NI 4HPPA 4FLHA 1T0RC 4KKJA 1QLBB 1Q1OA 2N1WA 3L16A 3P63A 4ANWA 2L83A 3ZO5B
chains in the Genus database with same CATH topology
4HK2A 2C7MB 4LJPB 4E71A 2DAJA 4TKNA 1QZEA 3ZRFA 3IHPC 3SU8X 1JRUA 5G55A 4K7WA 3VH4B 3ENEA 3UGBB 2FAZA 4BOSC 2FCSA 4HCNB 2DHZA 3DBHI 2Y5BB 1E7VA 2AL6A 2LVOA 2Z59B 4JQWC 3A1QB 1XD3B 3PHXB 3UF8A 2GBNA 3CMMB 3NHEB 1LXDA 2MBEA 1P98A 2MBBB 3VUWA 3R7QA 5LXHA 2GBKA 1GG3A 2KOXA 4W9CA 2K8BA 3R7RA 2V1YA 1I35A 4KDLB 4OVUA 2K39A 2KWCA 3BINA 1NBFC 2CHWA 1WMHB 1E90A 4XZ4A 3CF6E 4AUQC 4EZKA 2KWUB 2BPSA 3CSFA 2FCMA 2KTRA 4A3PA 5EDSA 1E8ZA 1V80A 2JRHA 2C7NB 5JHBA 1LM8B 3RZFA 3B08A 4WJQA 2NBWB 2WX1A 4BBNC 1V9JA 4HXDA 2ZCCA 4IWQA 3DVNV 1Z2MA 4M8NA 1YX6B 2A5UA 2AYOB 4MGKE 2D2QA 3WAPA 3N32A 4WWOA 4ICVA 3C0RB 3UINB 1P9DU 3GZNI 5LXIB 4GDKB 1WE6A 3DCGA 2KJHB 1V6EA 5KHOA 5D2MB 4MELA 1V2YA 4ZRKA 2O6VA 1YJ1A 2W9NA 3ML9A 3UQAA 1VCBA 1V49A 2CR5A 2DENB 2KDBA 3DBLI 2IZVB 3LJ3A 3ZNID 4PYUA 4MEMA 3VFKA 4HDOA 1WE7A 2N9XA 1WY8A 4EUTA 4HVBA 2CHXA 3L10B 2L05A 3A4RA 1TBEA 3DDCB 4EZLA 1V5OA 3TMPB 1SGHA 2D3GA 4FBJB 2JUOA 4W9DA 2QHOA 2ZPNA 2GMIC 4LDTD 2C9WB 2KZRA 1KOTA 5BO4B 4ANXA 3EECA 3ZIMA 2KMAA 2ZVNA 3VTUA 4EKUA 2KFKA 2KQSA 1CMXB 2ZZPB 3Q3JA 2MW5A 3H7PA 1Y8RC 2KO3A 4GOCA 4I6NB 1GJZA 2BGFA 4A20A 4GDLB 4G11A 4GU2A 4G3XB 1WGYA 2MBQA 4NY0A 3D32A 3WAMA 3RD2A 3VXWA 2KJ6A 1EUVB 3PPAA 4G50A 1WJ6A 2HTHA 2IY0B 3DBSA 3IVFA 1Z5SB 2FCQA 2K6QA 2JY6A 1SE9A 2YLMA 1GNUA 2O6VB 4RM9A 2LXCA 3H6NA 4BOZB 4KZCA 5CHFA 1WZ0A 2DZMA 3NS8A 3H9DA 2C60A 3M95A 4GB9A 4KIKA 2G45B 2WX0A 2C7HA 3IBEA 2DZJA 2FIDA 2EMSA 4WWNA 1E8YA 3HIZA 3U7DA 2BF8B 2LVPA 1RFAA 4JIOU 1FXTB 2IO1B 3V62A 1WIAA 3DVGY 2ZVOA 2B3AA 3KYDD 3MHSD 4MGZE 2L8JA 3L08A 2KFKB 3IFWB 2Z0DB 3H7PB 4FJYA 3ONSA 4LJOB 4ICUA 3WALA 3MJWA 3ZKJC 4FADA 3M3JA 3K9OB 5AZGA 3AI5A 1WYWB 4DHJD 2KHWB 2JVCA 2ASQA 5J18A 2DZIA 3V60A 2DX5B 2MCNB 1OTRB 2KFJA 3ZLZA 3OAWA 3ZTDA 2PEAA 1U4AA 3A9KA 3JSVA 1P3QU 3M63B 2BYFA 2FNJB 2NVUI 3OJ3A 3K9PB 4KVGB 3TBLD 4F8CB 1UELA 3WANA 2XEWA 3IG3A 2JRIB 2LZ6A 2G4SA 3A9JA 3DBRI 4JL9A 4KIKB 5IAAC 4AOFA 2L0TA 1WFYA 4IWPA 2DYMA 3GOEA 3RZWC 3AU5A 2IY1B 4BKSA 1YIWA 2XK5B 3WAOA 4XX5A 1WR1A 2KJRA 3PREA 3W1SA 4GSWA 4GN1A 3VTVA 1WM2A 5E6NA 4WJPA 3RULA 4MGIE 2MA9B 2BKFA 2KDIA 1EO6A 4ZYNA 2HJ8A 2LUEA 2NPTB 4EZJA 1UZXB 3EC8A 4ZRJA 2RSUA 1R4MI 5KHQA 4OVVA 1GC7A 2ZNVC 1XQQA 4FJZA 4GMVA 3QX1A 2UWQA 4K81A 5CHVC 1AARA 3A9KB 2BWES 2M4NA 3APCA 3JSVB 2LWPA 1PQSA 2WYQA 3WA0A 4CO7A 4FA6A 4WAAA 4EFOA 4DK5A 2EMTA 5G2NA 2JWZA 2K8CA 1OEYA 1J8CA 4IW0A 3ZDTA 4AJWA 2KD0A 4IM2A 3VQIA 4DHZB 2G3QB 2L7RA 3DPDA 3OJ4B 2MP2A 1Q0WB 3A9JB 3AULA 4ASWC 4EEWA 2DAFA 3V6EB 3VVWB 4IM0A 1J19A 4FN2A 1E8WA 4X57B 3L0WB 3B0AA 2DZKA 4K7SA 4MDKE 2LJ5A 3QCAA 1IP9A 2LRWA 4DDID 5D94A 2VRRB 4DWFA 4F1SA 4HJKA 1ISNA 4W9EA 3ZDMC 2BYVE 5E6OA 4NQKE 3W1YA 4AJYB 2KXJA 2LGDA 2D07B 1WJ4A 5AZFA 3SHQA 2LXAA 5DPSA 4YL8A 1UGMA 3NZUA 4LCDE 3W1SC 1WF9A 3ALBA 3ZTCA 1C3TA 4II3B 2PE6B 1L7YA 2KTRB 3TL5A 1WX9A 4F7ZA 3PHWB 2JT4B 4NPNA 3ZVVA 2LRUA 4WJNA 4HCPB 4DDGD 2KMCA 3KUDB 3VAWA 1D3ZA 2AL3A 3O65B 1WGGA 2KX3A 3PSEB 2J7QB 1VD2A 2CS4A 3QC8B 4A3OA 3UIOB 3U30A 4E3CA 4N9F4 1KM7A 4NJ7A 4PS3A 3PRMB 4W9IA 3NY5A 2ZCBA 1WGRA 1EF5A 3QIJA 3VHTC 1E5WA 1S1QB 2CKHB 1IYFA 4CYEA 3VUYA 2PPHA 1J0GA 2KC2A 2LD9A 3L54A 3QARA 2KVRA 4ZRIA 2JZZA 3KUCB 4TQ0A 2HE7A 4GXBA 4EOYA 2O2VA 5C1ZA 1WXVA 3AXCA 3AU4A 2ZEQA 4AP4C 2KNBA 1RRBA 4W9GA 3S2AA 2DYOA 4JGHB 4NNJB 2UYZB 3RCZA 3ZRCA 3R66C 4W9KA 3ZW3A 4K1RB 3DVNU 1UD7A 1KJTA 2FCNA 4TUUA 2KTFA 4AWJA 5D7GA 4FJVB 1WR6E 3QWZB 4TQ1A 4E74A 2GBJA 2NBUA 1P1AA 2R2QA 1GUAB 2KX0A 2MBOA 3ML8A 5DCNA 4ANVA 2N9PC 3M62B 1H4RA 3APDA 2LI5A 2IYDB 4IWOA 1WGHA 2M17A 1IPGA 2EKEC 2LASA 2XBBC 2K25A 4BKGA 2JPHA 2RD0A 3QQ8B 4HWIB 3Q3FA 4MGYE 4NQLB 1YQBA 4B9KA 3T8MA 4WWPA 1H8CA 5TR5A 3TJPA 5CX3A 3UQBA 4M8MA 4GIVA 2KLCA 1RAXA 4TV3A 2JXXA 4KSLC 4IG7B 3ZUNA 2KQ7A 1T0YA 4J6IA 2WDTB 2Z0EB 2KN5A 2PE9A 3ECIA 5DPWA 1UBQA 3QJZA 3T9LA 5GMVA 4KSKC 3HHMA 1MG8A 3TCAA 4I6LB 3PGEA 4I6PA 4HPMB 4WQOB 2WWZA 1BT0A 4RMAA 2L76A 1P0RA 3BY4B 4G0NB 3PT2B 5JHAA 1Q5WB 1OGWA 4LDTB 5DPTA 2M1MA 2JZ3B 4ZDVA 2IO3B 3V61A 2BYEA 2O6VD 2G4DB 2L3ZA 4GDKA 1TZ1A 4HLEA 4M0WB 3PRZA 4PS8A 2NBVB 3ZNGC 1RLFA 3JW0X 3VDZA 2CU1A 1WX7A 5C23A 3HM6X 3PLVA 3NZSA 3P2BA 4B6WA 5L95C 5IA7A 4PYZA 3U8ZA 3ZNZB 3PS6A 3WIMA 1WXMA 3OLMD 3QHTA 1OQYA 3L17A 2KC1A 3I3TB 1E7UA 1E8XA 4BVUC 2GBRA 3UIPB 1WRDB 4FULA 2OJRA 4DHZE 3EHVA 1A5RA 4FHJA 4W9FA 4KDIC 2CHZA 3RUIB 4ANUA 4BFRA 1WZ3A 5DPRA 1ZW7A 2IBIB 3TIXA 1WM3A 1WXSA 4MM3A 4GGQA 3JYUA 1I42A 4RM8A 4P7IA 4GDLA 2IO0B 2MWSB 2NS5A 5FR6A 3DVGX 3VH3B 2MSED 3VTWA 1C1YB 2N7EA 2AWTA 2J0MA 2RPQA 2J0JA 4B95A 2YVCA 4URKA 3MTNB 1WX8A 3X0WA 2N9EB 4MSMB 3PVLA 4MJSA 4DHJB 4W9LA 1V81A 2LVQA 2N7DA 3DQVA 3JVZX 3N3KB 3HM3A 1HE8A 1YD8U 4DXAB 2K6DB 2LGXA 2MBHA 3X23A 2D11A 1WH3A 3KYCD 2GOWA 3RT3B 1TGZB 1UBIA 2OOBB 3PRPB 2V4LA 4JLCA 4CHKA 2MP2B 5HKHA 2KKCA 3H1UA 4NAWA 4W9HA 4PS7A 2K1FA 2FUHB 3QK0A 3HK0A 5J2RA 2KLGA 3V6CB 2A4ZA 1M94A 2MRPA 2NR2A 2RGFA 2RR9A 3A4SC 3APFA 2BKRB 3KH0A 3KUZA 5L83A 5AEKB 2AEHA 4WJOA 4BBNF 5CHWA 4K7UA 1TTNA 2KWVB 2R2OA 4XC2A 1NDDA 2J0KA 2KANA 1EF1A 4BKTA 3ZNHB 3QAQA 3SD5A 3L13A 2GBMA 1NI2A 4DBGA 2ZPYA 1WJNA 2FIFA 1KLVA 2M8SA 1LFDA 2K8HA 1WGDA 2ZJDA 4MJSB 1F9JA 1OEYJ 3PZDA 2L0FA 1LQBA 2M0XA 3N30A 1X1MA 1G6JA 3A33B 3NOBA 2BWFA 1V5TA 1UH6A 4BKSD 2D10A 4KZ0A 1WJUA 2KDEB 4MSQB 1S3SG 3KW5B 2I1KA 5E6PA 2I1JA 3R3MA 1WI0A 2L00B 2N4FA 3QA8A 2XK5A 5JZEB 4IM3A 5LLIA 2KK8A 5CTRC 4NAWB 4MH0E 3H7SA 1ZKHA 1L2NA 4W9JA 1SIFA 3A1QA 2DYBA 2LGYA 1XT9B 2MQJA 1K8RB 2NCNA 3KVFB 2IO2B 2PJHA 3CSTA 2MLBA 4HPLB 3SDLC 2O2VB 4HDQA 2MX2A 1R4NI 2NPTA 2ZNVB 1V86A 1WMHA 1WXAA 1YX5B 1ZGUB 2REXA 4FLHA 5JH5C 2KDFB 3RYTA 3B1LX 3PLUA 3PV1A 3LDZE 1Q1OA 2N1WA 5D6JB 4IUMB 3DOWA 4IC7B 3PTFC 3L16A 4II2B 4FHKA 4ANWA 2N1VA 4KV2A 2V3SA 5J17A 1GC6A 2HD5B 2C5LC 3EFUA 5AZHA 2JF5A 3ZO5B 4NJ6A 3VUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HK2 A;  2C7M B;  4LJP B;  4E71 A;  2DAJ A;  4TKN A;  1QZE A;  3ZRF A;  3IHP C;  3SU8 X;  1JRU A;  5G55 A;  4K7W A;  3VH4 B;  3ENE A;  3UGB B;  2FAZ A;  4BOS C;  2FCS A;  4HCN B;  2DHZ A;  3DBH I;  2Y5B B;  1E7V A;  2AL6 A;  2LVO A;  2Z59 B;  4JQW C;  3A1Q B;  1XD3 B;  3PHX B;  3UF8 A;  2GBN A;  3CMM B;  3NHE B;  1LXD A;  2MBE A;  1P98 A;  2MBB B;  3VUW A;  3R7Q A;  5LXH A;  2GBK A;  1GG3 A;  2KOX A;  4W9C A;  2K8B A;  3R7R A;  2V1Y A;  1I35 A;  4KDL B;  4OVU A;  2K39 A;  2KWC A;  3BIN A;  1NBF C;  2CHW A;  1WMH B;  1E90 A;  4XZ4 A;  3CF6 E;  4AUQ C;  4EZK A;  2KWU B;  2BPS A;  3CSF A;  2FCM A;  2KTR A;  4A3P A;  5EDS A;  1E8Z A;  1V80 A;  2JRH A;  2C7N B;  5JHB A;  1LM8 B;  3RZF A;  3B08 A;  4WJQ A;  2NBW B;  2WX1 A;  4BBN C;  1V9J A;  4HXD A;  2ZCC A;  4IWQ A;  3DVN V;  1Z2M A;  4M8N A;  1YX6 B;  2A5U A;  2AYO B;  4MGK E;  2D2Q A;  3WAP A;  3N32 A;  4WWO A;  4ICV A;  3C0R B;  3UIN B;  1P9D U;  3GZN I;  5LXI B;  4GDK B;  1WE6 A;  3DCG A;  2KJH B;  1V6E A;  5KHO A;  5D2M B;  4MEL A;  1V2Y A;  4ZRK A;  2O6V A;  1YJ1 A;  2W9N A;  3ML9 A;  3UQA A;  1VCB A;  1V49 A;  2CR5 A;  2DEN B;  2KDB A;  3DBL I;  2IZV B;  3LJ3 A;  3ZNI D;  4PYU A;  4MEM A;  3VFK A;  4HDO A;  1WE7 A;  2N9X A;  1WY8 A;  4EUT A;  4HVB A;  2CHX A;  3L10 B;  2L05 A;  3A4R A;  1TBE A;  3DDC B;  4EZL A;  1V5O A;  3TMP B;  1SGH A;  2D3G A;  4FBJ B;  2JUO A;  4W9D A;  2QHO A;  2ZPN A;  2GMI C;  4LDT D;  2C9W B;  2KZR A;  1KOT A;  5BO4 B;  4ANX A;  3EEC A;  3ZIM A;  2KMA A;  2ZVN A;  3VTU A;  4EKU A;  2KFK A;  2KQS A;  1CMX B;  2ZZP B;  3Q3J A;  2MW5 A;  3H7P A;  1Y8R C;  2KO3 A;  4GOC A;  4I6N B;  1GJZ A;  2BGF A;  4A20 A;  4GDL B;  4G11 A;  4GU2 A;  4G3X B;  1WGY A;  2MBQ A;  4NY0 A;  3D32 A;  3WAM A;  3RD2 A;  3VXW A;  2KJ6 A;  1EUV B;  3PPA A;  4G50 A;  1WJ6 A;  2HTH A;  2IY0 B;  3DBS A;  3IVF A;  1Z5S B;  2FCQ A;  2K6Q A;  2JY6 A;  1SE9 A;  2YLM A;  1GNU A;  2O6V B;  4RM9 A;  2LXC A;  3H6N A;  4BOZ B;  4KZC A;  5CHF A;  1WZ0 A;  2DZM A;  3NS8 A;  3H9D A;  2C60 A;  3M95 A;  4GB9 A;  4KIK A;  2G45 B;  2WX0 A;  2C7H A;  3IBE A;  2DZJ A;  2FID A;  2EMS A;  4WWN A;  1E8Y A;  3HIZ A;  3U7D A;  2BF8 B;  2LVP A;  1RFA A;  4JIO U;  1FXT B;  2IO1 B;  3V62 A;  1WIA A;  3DVG Y;  2ZVO A;  2B3A A;  3KYD D;  3MHS D;  4MGZ E;  2L8J A;  3L08 A;  2KFK B;  3IFW B;  2Z0D B;  3H7P B;  4FJY A;  3ONS A;  4LJO B;  4ICU A;  3WAL A;  3MJW A;  3ZKJ C;  4FAD A;  3M3J A;  3K9O B;  5AZG A;  3AI5 A;  1WYW B;  4DHJ D;  2KHW B;  2JVC A;  2ASQ A;  5J18 A;  2DZI A;  3V60 A;  2DX5 B;  2MCN B;  1OTR B;  2KFJ A;  3ZLZ A;  3OAW A;  3ZTD A;  2PEA A;  1U4A A;  3A9K A;  3JSV A;  1P3Q U;  3M63 B;  2BYF A;  2FNJ B;  2NVU I;  3OJ3 A;  3K9P B;  4KVG B;  3TBL D;  4F8C B;  1UEL A;  3WAN A;  2XEW A;  3IG3 A;  2JRI B;  2LZ6 A;  2G4S A;  3A9J A;  3DBR I;  4JL9 A;  4KIK B;  5IAA C;  4AOF A;  2L0T A;  1WFY A;  4IWP A;  2DYM A;  3GOE A;  3RZW C;  3AU5 A;  2IY1 B;  4BKS A;  1YIW A;  2XK5 B;  3WAO A;  4XX5 A;  1WR1 A;  2KJR A;  3PRE A;  3W1S A;  4GSW A;  4GN1 A;  3VTV A;  1WM2 A;  5E6N A;  4WJP A;  3RUL A;  4MGI E;  2MA9 B;  2BKF A;  2KDI A;  1EO6 A;  4ZYN A;  2HJ8 A;  2LUE A;  2NPT B;  4EZJ A;  1UZX B;  3EC8 A;  4ZRJ A;  2RSU A;  1R4M I;  5KHQ A;  4OVV A;  1GC7 A;  2ZNV C;  1XQQ A;  4FJZ A;  4GMV A;  3QX1 A;  2UWQ A;  4K81 A;  5CHV C;  1AAR A;  3A9K B;  2BWE S;  2M4N A;  3APC A;  3JSV B;  2LWP A;  1PQS A;  2WYQ A;  3WA0 A;  4CO7 A;  4FA6 A;  4WAA A;  4EFO A;  4DK5 A;  2EMT A;  5G2N A;  2JWZ A;  2K8C A;  1OEY A;  1J8C A;  4IW0 A;  3ZDT A;  4AJW A;  2KD0 A;  4IM2 A;  3VQI A;  4DHZ B;  2G3Q B;  2L7R A;  3DPD A;  3OJ4 B;  2MP2 A;  1Q0W B;  3A9J B;  3AUL A;  4ASW C;  4EEW A;  2DAF A;  3V6E B;  3VVW B;  4IM0 A;  1J19 A;  4FN2 A;  1E8W A;  4X57 B;  3L0W B;  3B0A A;  2DZK A;  4K7S A;  4MDK E;  2LJ5 A;  3QCA A;  1IP9 A;  2LRW A;  4DDI D;  5D94 A;  2VRR B;  4DWF A;  4F1S A;  4HJK A;  1ISN A;  4W9E A;  3ZDM C;  2BYV E;  5E6O A;  4NQK E;  3W1Y A;  4AJY B;  2KXJ A;  2LGD A;  2D07 B;  1WJ4 A;  5AZF A;  3SHQ A;  2LXA A;  5DPS A;  4YL8 A;  1UGM A;  3NZU A;  4LCD E;  3W1S C;  1WF9 A;  3ALB A;  3ZTC A;  1C3T A;  4II3 B;  2PE6 B;  1L7Y A;  2KTR B;  3TL5 A;  1WX9 A;  4F7Z A;  3PHW B;  2JT4 B;  4NPN A;  3ZVV A;  2LRU A;  4WJN A;  4HCP B;  4DDG D;  2KMC A;  3KUD B;  3VAW A;  1D3Z A;  2AL3 A;  3O65 B;  1WGG A;  2KX3 A;  3PSE B;  2J7Q B;  1VD2 A;  2CS4 A;  3QC8 B;  4A3O A;  3UIO B;  3U30 A;  4E3C A;  4N9F 4;  1KM7 A;  4NJ7 A;  4PS3 A;  3PRM B;  4W9I A;  3NY5 A;  2ZCB A;  1WGR A;  1EF5 A;  3QIJ A;  3VHT C;  1E5W A;  1S1Q B;  2CKH B;  1IYF A;  4CYE A;  3VUY A;  2PPH A;  1J0G A;  2KC2 A;  2LD9 A;  3L54 A;  3QAR A;  2KVR A;  4ZRI A;  2JZZ A;  3KUC B;  4TQ0 A;  2HE7 A;  4GXB A;  4EOY A;  2O2V A;  5C1Z A;  1WXV A;  3AXC A;  3AU4 A;  2ZEQ A;  4AP4 C;  2KNB A;  1RRB A;  4W9G A;  3S2A A;  2DYO A;  4JGH B;  4NNJ B;  2UYZ B;  3RCZ A;  3ZRC A;  3R66 C;  4W9K A;  3ZW3 A;  4K1R B;  3DVN U;  1UD7 A;  1KJT A;  2FCN A;  4TUU A;  2KTF A;  4AWJ A;  5D7G A;  4FJV B;  1WR6 E;  3QWZ B;  4TQ1 A;  4E74 A;  2GBJ A;  2NBU A;  1P1A A;  2R2Q A;  1GUA B;  2KX0 A;  2MBO A;  3ML8 A;  5DCN A;  4ANV A;  2N9P C;  3M62 B;  1H4R A;  3APD A;  2LI5 A;  2IYD B;  4IWO A;  1WGH A;  2M17 A;  1IPG A;  2EKE C;  2LAS A;  2XBB C;  2K25 A;  4BKG A;  2JPH A;  2RD0 A;  3QQ8 B;  4HWI B;  3Q3F A;  4MGY E;  4NQL B;  1YQB A;  4B9K A;  3T8M A;  4WWP A;  1H8C A;  5TR5 A;  3TJP A;  5CX3 A;  3UQB A;  4M8M A;  4GIV A;  2KLC A;  1RAX A;  4TV3 A;  2JXX A;  4KSL C;  4IG7 B;  3ZUN A;  2KQ7 A;  1T0Y A;  4J6I A;  2WDT B;  2Z0E B;  2KN5 A;  2PE9 A;  3ECI A;  5DPW A;  1UBQ A;  3QJZ A;  3T9L A;  5GMV A;  4KSK C;  3HHM A;  1MG8 A;  3TCA A;  4I6L B;  3PGE A;  4I6P A;  4HPM B;  4WQO B;  2WWZ A;  1BT0 A;  4RMA A;  2L76 A;  1P0R A;  3BY4 B;  4G0N B;  3PT2 B;  5JHA A;  1Q5W B;  1OGW A;  4LDT B;  5DPT A;  2M1M A;  2JZ3 B;  4ZDV A;  2IO3 B;  3V61 A;  2BYE A;  2O6V D;  2G4D B;  2L3Z A;  4GDK A;  1TZ1 A;  4HLE A;  4M0W B;  3PRZ A;  4PS8 A;  2NBV B;  3ZNG C;  1RLF A;  3JW0 X;  3VDZ A;  2CU1 A;  1WX7 A;  5C23 A;  3HM6 X;  3PLV A;  3NZS A;  3P2B A;  4B6W A;  5L95 C;  5IA7 A;  4PYZ A;  3U8Z A;  3ZNZ B;  3PS6 A;  3WIM A;  1WXM A;  3OLM D;  3QHT A;  1OQY A;  3L17 A;  2KC1 A;  3I3T B;  1E7U A;  1E8X A;  4BVU C;  2GBR A;  3UIP B;  1WRD B;  4FUL A;  2OJR A;  4DHZ E;  3EHV A;  1A5R A;  4FHJ A;  4W9F A;  4KDI C;  2CHZ A;  3RUI B;  4ANU A;  4BFR A;  1WZ3 A;  5DPR A;  1ZW7 A;  2IBI B;  3TIX A;  1WM3 A;  1WXS A;  4MM3 A;  4GGQ A;  3JYU A;  1I42 A;  4RM8 A;  4P7I A;  4GDL A;  2IO0 B;  2MWS B;  2NS5 A;  5FR6 A;  3DVG X;  3VH3 B;  2MSE D;  3VTW A;  1C1Y B;  2N7E A;  2AWT A;  2J0M A;  2RPQ A;  2J0J A;  4B95 A;  2YVC A;  4URK A;  3MTN B;  1WX8 A;  3X0W A;  2N9E B;  4MSM B;  3PVL A;  4MJS A;  4DHJ B;  4W9L A;  1V81 A;  2LVQ A;  2N7D A;  3DQV A;  3JVZ X;  3N3K B;  3HM3 A;  1HE8 A;  1YD8 U;  4DXA B;  2K6D B;  2LGX A;  2MBH A;  3X23 A;  2D11 A;  1WH3 A;  3KYC D;  2GOW A;  3RT3 B;  1TGZ B;  1UBI A;  2OOB B;  3PRP B;  2V4L A;  4JLC A;  4CHK A;  2MP2 B;  5HKH A;  2KKC A;  3H1U A;  4NAW A;  4W9H A;  4PS7 A;  2K1F A;  2FUH B;  3QK0 A;  3HK0 A;  5J2R A;  2KLG A;  3V6C B;  2A4Z A;  1M94 A;  2MRP A;  2NR2 A;  2RGF A;  2RR9 A;  3A4S C;  3APF A;  2BKR B;  3KH0 A;  3KUZ A;  5L83 A;  5AEK B;  2AEH A;  4WJO A;  4BBN F;  5CHW A;  4K7U A;  1TTN A;  2KWV B;  2R2O A;  4XC2 A;  1NDD A;  2J0K A;  2KAN A;  1EF1 A;  4BKT A;  3ZNH B;  3QAQ A;  3SD5 A;  3L13 A;  2GBM A;  1NI2 A;  4DBG A;  2ZPY A;  1WJN A;  2FIF A;  1KLV A;  2M8S A;  1LFD A;  2K8H A;  1WGD A;  2ZJD A;  4MJS B;  1F9J A;  1OEY J;  3PZD A;  2L0F A;  1LQB A;  2M0X A;  3N30 A;  1X1M A;  1G6J A;  3A33 B;  3NOB A;  2BWF A;  1V5T A;  1UH6 A;  4BKS D;  2D10 A;  4KZ0 A;  1WJU A;  2KDE B;  4MSQ B;  1S3S G;  3KW5 B;  2I1K A;  5E6P A;  2I1J A;  3R3M A;  1WI0 A;  2L00 B;  2N4F A;  3QA8 A;  2XK5 A;  5JZE B;  4IM3 A;  5LLI A;  2KK8 A;  5CTR C;  4NAW B;  4MH0 E;  3H7S A;  1ZKH A;  1L2N A;  4W9J A;  1SIF A;  3A1Q A;  2DYB A;  2LGY A;  1XT9 B;  2MQJ A;  1K8R B;  2NCN A;  3KVF B;  2IO2 B;  2PJH A;  3CST A;  2MLB A;  4HPL B;  3SDL C;  2O2V B;  4HDQ A;  2MX2 A;  1R4N I;  2NPT A;  2ZNV B;  1V86 A;  1WMH A;  1WXA A;  1YX5 B;  1ZGU B;  2REX A;  4FLH A;  5JH5 C;  2KDF B;  3RYT A;  3B1L X;  3PLU A;  3PV1 A;  3LDZ E;  1Q1O A;  2N1W A;  5D6J B;  4IUM B;  3DOW A;  4IC7 B;  3PTF C;  3L16 A;  4II2 B;  4FHK A;  4ANW A;  2N1V A;  4KV2 A;  2V3S A;  5J17 A;  1GC6 A;  2HD5 B;  2C5L C;  3EFU A;  5AZH A;  2JF5 A;  3ZO5 B;  4NJ6 A;  3VUX A; 
#chains in the Genus database with same CATH topology
 3MC9 A;  1JCK B;  4XDD A;  1JRU A;  3ENE A;  4BOS C;  4HCN B;  3EA6 A;  2DHZ A;  2ICI A;  3DBH I;  2Y5B B;  2LVO A;  4JQW C;  2Z59 B;  2BYT A;  3VUW A;  1LXD A;  2MBB B;  1XLP A;  1RWS A;  5LXH A;  1GG3 A;  3R7R A;  2V1Y A;  2KVZ A;  2K39 A;  2CHW A;  3P4Q B;  1STE A;  3E56 A;  4ZRP A;  4EZK A;  2PMV A;  2JRH A;  1LM8 B;  2NTT A;  4WJQ A;  2WX1 A;  4HXD A;  4LNO A;  2PVO D;  2ZCC A;  2Y3A A;  1Z2M A;  1YX6 B;  3WAP A;  3N32 A;  4WWO A;  2WDV B;  4EE2 A;  1C77 A;  2V9H A;  4MEL A;  1YJ1 A;  2W9N A;  3ML9 A;  3BWU D;  2DEN B;  1KRH A;  2J42 A;  4PYU A;  4LNN A;  4HDO A;  1WE7 A;  1WY8 A;  4HEA 1;  4HVB A;  3W2D A;  1LO5 D;  2D3G A;  4FBJ B;  4ZHP A;  2JUO A;  2ZPN A;  1KOT A;  4OZC A;  2WDR B;  1F2R I;  4ANX A;  3EEC A;  3ZIM A;  3BYT B;  2KFK A;  2KQS A;  3H7P A;  2WS3 B;  3IAS 1;  1I4Q A;  4G3X B;  4NY0 A;  1WJ6 A;  2IY0 B;  3DBS A;  2MJE A;  1FXA A;  2FCQ A;  4US8 A;  2JY6 A;  1SE9 A;  2D3B A;  4BOZ B;  2V0G A;  1WZ0 A;  1OQQ A;  3M95 A;  3OG5 A;  4M00 A;  3IBE A;  2FID A;  4YSY B;  4WWN A;  3HIZ A;  3U7D A;  2VZK B;  3V05 A;  2ACZ B;  2IO1 B;  3VR8 B;  3GB1 A;  3KYD D;  1N63 A;  3KWL A;  2KMM A;  1ZXI A;  3W9C B;  4JWU C;  4FJY A;  1XEE A;  1YQ3 B;  3M3J A;  1C79 A;  3K9O B;  3AI5 A;  4DHJ D;  3IT4 B;  2KHW B;  3RNB C;  2WLB A;  5AUI A;  1J7B A;  2DZI A;  3LXF A;  1IGC A;  4M0W A;  4B0E A;  3OAW A;  4KGS A;  2PEA A;  2D3A A;  1U4A A;  3JSV A;  1TKY A;  3Q8F A;  3AEG B;  3OJ3 A;  3Q8A A;  4JE3 B;  1XXG A;  2K3U A;  3IG3 A;  3DBR I;  4JL9 A;  4KIK B;  2L0T A;  3AU5 A;  2ON8 A;  3U7Z A;  2KAJ A;  3WAO A;  1WR1 A;  2KJR A;  2LUM A;  4GN1 A;  2RDG A;  1QQR A;  4WH4 A;  1ZE3 D;  1XCQ L;  4MGI E;  4C7Z A;  2BBC A;  3EC8 A;  2ZNV C;  1XQQ A;  2UWQ A;  2GRI A;  4K81 A;  3A9K B;  3APC A;  1PQS A;  2I2Y A;  3WA0 A;  2EMT A;  1IGD A;  1V1P B;  4XGA B;  1C4P A;  4C00 A;  3AE8 B;  4DHZ B;  1SE3 A;  2MP2 A;  3Q3N C;  4ASW C;  1QOG A;  2K22 A;  3KLS X;  2L32 A;  1E10 A;  1J19 A;  4FN2 A;  1E8W A;  1ESF A;  3SR6 A;  2LRW A;  2W3S A;  4W9E A;  3W1Y A;  1I4G A;  5AZF A;  2LXA A;  2WQY B;  4Q2J A;  3BYY B;  1ENF A;  1UGM A;  4LCD E;  2BS3 B;  3ALB A;  4II3 B;  4K3C A;  3TL5 A;  4F7Z A;  1AYF A;  2XN9 C;  1ACC A;  1ZPS A;  1D4B A;  1D3Z A;  2AL3 A;  2GI9 A;  1T0Q C;  4NJ7 A;  4PS3 A;  3NY5 A;  1E5W A;  2CKH B;  3NJT A;  1IYF A;  3VUY A;  2N0S B;  3L54 A;  2KVR A;  4ZRI A;  4KKI A;  4TQ0 A;  4GXB A;  1CQV A;  1WXV A;  4AP4 C;  1D5M C;  2KNB A;  1AWD A;  4JGH B;  3N20 C;  2JX5 A;  3R66 C;  3DVN U;  2FCN A;  4TUU A;  1Y56 A;  5BMG A;  4HKQ A;  4FJV B;  1NYR A;  1H4R A;  2HTM E;  5T8I A;  2IYD B;  2E3T A;  3AEC B;  1E0Z A;  2LAS A;  2WXN A;  3QQ8 B;  3H8H A;  4MGY E;  1YQB A;  3BVZ A;  3UQB A;  1C76 A;  1HQR D;  3ZUN A;  4J6I A;  1XCT L;  3HHM A;  3PGE A;  3DBL B;  1BT0 A;  1ET9 A;  5JHA A;  3DHG C;  1PDX A;  3GS2 A;  4RGO S;  5DPT A;  2JZ3 B;  3AN1 A;  3SEB A;  2IO3 B;  3V61 A;  1D6E C;  1TJE A;  4M0W B;  4PS8 A;  2NBV B;  5IKC M;  3PLV A;  3NZS A;  3P2B A;  4B0M A;  3ZNZ B;  2D3C A;  1WXM A;  3OLM D;  1OQY A;  3AE1 B;  2RPV A;  4BVU C;  1WYG A;  4DHZ E;  1JRP A;  4FHJ A;  4KDI C;  4RGT A;  1LGR A;  1MI0 A;  2N7J A;  5DPR A;  2IBI B;  2WXK A;  1WXS A;  1I42 A;  3JYU A;  1N60 A;  4LNF A;  4GDL A;  1UWX A;  5FR6 A;  3DVG X;  3VH3 B;  1YOV B;  3P1M A;  1C1Y B;  2J0M A;  2YVC A;  3NZ3 A;  2PVG C;  1AN8 A;  2MJ3 A;  4MJS A;  3AM9 A;  2BVC A;  3DQV A;  2AQ3 B;  1YD8 U;  1GAQ B;  4TMA B;  1V97 A;  2LGX A;  3X23 A;  2GOW A;  4JLC A;  4CHK A;  2MP2 B;  3V3X A;  1Q10 A;  2KKC A;  1HEZ E;  4K3B A;  4NAW A;  1TS3 A;  4W9H A;  4PS7 A;  2K1F A;  3GE8 C;  4J3O D;  1QF6 A;  3V6C B;  4G0N B;  2NR2 A;  3APF A;  3HRD D;  3U52 E;  5AEK B;  4BBN F;  5CHW A;  3W1S C;  3ZJT A;  1NDD A;  3RMK C;  3TEZ A;  3EGR A;  3ZNH B;  2GBM A;  3SFE B;  4DBG A;  1SXT A;  1FD6 A;  2M8S A;  1TYG B;  1ZDX A;  2XNA C;  2ZJD A;  3PZD A;  1SF0 A;  1PYW D;  1SSN A;  3AE7 B;  4C80 A;  1V5T A;  1UH6 A;  2D10 A;  2KDE B;  4ARI A;  1S3S G;  1BML C;  5E6P A;  1RFK A;  1UWM A;  1E7P B;  3AV8 A;  1VZ8 A;  1UUP A;  2XK5 A;  1FO4 A;  5CTR C;  4W9J A;  1SIF A;  4NZL B;  2MQJ A;  1JWU D;  2BW2 A;  3CST A;  3SDL C;  3N1Y C;  2ZNV B;  2REX A;  3AB5 A;  2Q5W D;  5JH5 C;  2KDF B;  4RCO A;  3PLU A;  1D5X C;  4IUM B;  4IC7 B;  2N1V A;  4KV2 A;  2HD5 B;  2INN E;  5AZH A;  1ZXH A;  3VUX A;  4HK2 A;  2DAJ A;  1QZE A;  3ZRF A;  5IO9 A;  3IHP C;  4K7W A;  2M0A A;  2L52 A;  4XYC A;  3AEB B;  1VZ7 A;  3AE4 B;  1E7V A;  2AL6 A;  1XLQ A;  3UF8 A;  3BZD B;  2GBN A;  2MBE A;  2GLS A;  2YEP B;  2GBK A;  3FKY A;  4S0R A;  1I35 A;  1C4A A;  4KDL B;  3BIN A;  1NBF C;  1WMH B;  2KWU B;  3CSF A;  2FCM A;  4AQ7 A;  2QCZ A;  4C7Y A;  4NAM A;  4ZHO A;  3EFC A;  2AYO B;  4MGK E;  2D2Q A;  2L1A A;  5LXI B;  1V6E A;  2R61 A;  3UQA A;  1VCB A;  1V49 A;  5H8Y E;  4BZA A;  3LJ3 A;  1C9F A;  1XF5 L;  4MEM A;  3VFK A;  2N9X A;  1VRA B;  2CHX A;  3A4R A;  3DDC B;  4EZL A;  1SGH A;  1KFY B;  2GMI C;  2C9W B;  5HI1 A;  1DOY A;  2H88 B;  3I57 A;  5BO4 B;  3VTU A;  2ZZP B;  1GJZ A;  3MC8 A;  2RDB C;  1FRD A;  2BQQ A;  4GDL B;  4GU2 A;  4WWM A;  1WGY A;  2MBQ A;  3D32 A;  1EUV B;  1L5P A;  2HTH A;  1VLB A;  3AH7 A;  2K6Q A;  1GNU A;  4HRO A;  5CHF A;  2DZM A;  3C19 A;  3B2G A;  2LFI A;  4GB9 A;  4KIK A;  2WX0 A;  1R4M B;  1TS5 A;  3MHZ A;  2BF8 B;  2K0P A;  3MC0 B;  1WXQ A;  1L6V A;  1WIA A;  3DVG Y;  4MGZ E;  2B3A A;  2BS4 B;  3J9C A;  1K52 A;  3Q2A C;  2WU5 B;  4LJO B;  4ICU A;  3ZKJ C;  1L0X B;  3NG0 A;  1EU3 A;  3V60 A;  2MCN B;  1JWB D;  3A9K A;  2WXI A;  3M63 B;  2X8X X;  2KWD A;  2TSS A;  1V1P A;  3K9P B;  4F8C B;  2KN4 A;  2BS2 B;  2JRI B;  2G4S A;  2RMM A;  5IAA C;  1WFY A;  4IWP A;  2ZW0 A;  3O13 A;  3GOE A;  3NVY A;  1YIW A;  2XK5 B;  4XX5 A;  3AE3 B;  5E6N A;  4WJP A;  3RUL A;  2B76 B;  2MA9 B;  1F77 A;  2KDI A;  1EO6 A;  3P42 A;  3DHI C;  2JYT A;  1GC7 A;  4FJZ A;  4GMV A;  4FA6 A;  4RFB A;  2WYQ A;  3P4P B;  5G5H A;  4EFO A;  1J7C A;  3NRZ A;  5IP4 D;  1L0Y B;  1SE4 A;  4IW0 A;  3BVM A;  4AJW A;  2G3Q B;  2L7R A;  3A9J B;  1Q0W B;  1QOA A;  3TSS A;  1JWS D;  3L0W B;  4K7S A;  1NEN B;  4MDK E;  3WCQ A;  3QCA A;  1JAL A;  1FRR A;  1IP9 A;  5D94 A;  3ZDM C;  1ISN A;  4AJY B;  1P7E A;  2LGD A;  1TKG A;  3SHQ A;  5DPS A;  4YL8 A;  1MPE A;  3NZU A;  3ZTC A;  2PE6 B;  5BYQ A;  3SFD B;  3ZVV A;  2LRU A;  2BTE A;  1ZUD 2;  2KX3 A;  3PSE B;  2J7Q B;  3RI7 C;  4E3C A;  4N9F 4;  1KM7 A;  3RNA C;  1EF5 A;  4CYE A;  2HE7 A;  4M02 A;  5C1Z A;  4A8X C;  5G5G A;  2ZEQ A;  4LLG M;  5EE3 A;  2QIL A;  3B9J A;  3RCZ A;  2UYZ B;  1PGX A;  1KJT A;  3BK1 A;  1WGK A;  1WR6 E;  2NBU A;  2W82 A;  2R2Q A;  5EE0 A;  4ANV A;  4JPS A;  2LI5 A;  1M4V A;  2EKE C;  3ZQ4 A;  1PUT A;  2WXQ A;  1FFU A;  3T8M A;  5TR5 A;  4M8M A;  2KLC A;  4WUR A;  2IND C;  1T0Y A;  1GOZ A;  3ECI A;  3QJZ A;  5GMV A;  2IGG A;  4KSK C;  1VZ6 A;  1MG8 A;  5BYR A;  4I6L B;  4I6P A;  5I4D A;  4XWT A;  2L76 A;  1P0R A;  3BY4 B;  3PT2 B;  3RNF C;  2ZW1 A;  1OGW A;  4LDT B;  2M1M A;  3LB8 C;  2WP9 B;  1TIF A;  1TY0 A;  3BVG A;  3AEA B;  3PRZ A;  1ROE A;  1RLF A;  3JW0 X;  2OHF A;  2VZK D;  1CZP A;  4ZYS A;  3QHT A;  2KC1 A;  1E8X A;  2J4X A;  2J52 A;  3ABV B;  1FNU A;  3KQ4 A;  2PW9 A;  2SAK A;  3RUI B;  4ANU A;  1FEH A;  3NVW A;  1HZ6 A;  2RDH A;  5EE1 A;  3RNC C;  2IO0 B;  4A55 A;  2MWS B;  2NS5 A;  3ZJV A;  3VTW A;  3RNG C;  2J0J A;  2AQ2 B;  1WX8 A;  3X0W A;  2LGS A;  2N9E B;  4MSM B;  1HTO A;  1FCL A;  2LVQ A;  3JVZ X;  3N3K B;  4C4V B;  4ITK A;  1MG4 A;  4JX1 C;  1HTQ A;  3KYC D;  2Y5P A;  1JRO A;  3H1U A;  4OHJ A;  3ZJU A;  2FUH B;  3URY A;  1MVK A;  5J2R A;  4M01 A;  5BYS A;  2A4Z A;  2MRP A;  3DBR B;  2RR9 A;  3KUZ A;  4MM3 B;  1KLU D;  4WJO A;  2J0K A;  4HKZ E;  2JZP A;  2L0F A;  1LQB A;  3N30 A;  1GPX A;  1FXI A;  1X1M A;  3NOB A;  2INP E;  1WJU A;  2QIE B;  3CIR B;  2IGH A;  4HJG E;  2L00 B;  1NVI D;  4YTN B;  5BMH A;  1KF6 B;  3NS1 A;  2AQ1 B;  2LGY A;  1B9R A;  1YJJ A;  2J53 A;  2PJH A;  4HPL B;  3GZN B;  4N59 A;  2MX2 A;  2NPT A;  1WXA A;  1WMH A;  3RYT A;  3LDZ E;  5D6J B;  3TEY A;  3R2I A;  3DOW A;  3PTF C;  5J17 A;  1K51 A;  1GC6 A;  2C5L C;  1E6E B;  3EFU A;  2X38 A;  1TKE A;  4RGN A;  4E71 A;  3SU8 X;  3NVV A;  5G55 A;  3DHH C;  3UGB B;  2FCS A;  3GP7 A;  1QIL A;  2MEK A;  4ZRQ A;  3PHX B;  1P98 A;  1J7A A;  2DBY A;  2KOX A;  2K8B A;  1IBX B;  1XLO A;  4AUQ C;  2BPS A;  3HVD A;  2KTR A;  1JW9 D;  4A3P A;  1E8Z A;  2JYE A;  4BBN C;  2M56 B;  4IWQ A;  3AE9 B;  5JXV A;  4IKG A;  4M8N A;  4N6E B;  1UGJ A;  3UIN B;  3C0R B;  3DCG A;  3Q8E A;  5C3J B;  5KHO A;  2LEK A;  4YSX B;  2OED A;  3FIL B;  2IZV B;  3ZNI D;  4A90 A;  3BK2 A;  2IDY A;  2FUG 1;  3IXS A;  3L10 B;  2L05 A;  1TBE A;  1QT9 A;  3TMP B;  4W9D A;  1YQ4 B;  2QHO A;  2PLP A;  4EKU A;  2ZVN A;  1CMX B;  3Q3J A;  2KYW A;  1GB4 A;  4WAF A;  1EWY C;  1Y8R C;  2KO3 A;  4GOC A;  2JWU A;  1L4D B;  1YN5 A;  4G11 A;  4L2Y A;  4AS1 A;  2KAC A;  2KJ6 A;  4G50 A;  1Z5S B;  1P7F A;  2YLM A;  1FFV A;  2O6V B;  4RM9 A;  4USA A;  3E9S A;  3NS8 A;  4YXD B;  3H9D A;  2C60 A;  2BB5 A;  2G9H D;  3N9Y C;  2G45 B;  2C7H A;  1I4X A;  1MJD A;  2QC8 A;  4KX6 B;  2LVP A;  1IUE A;  1VJK A;  2WXH A;  4JIO U;  1RFA A;  1FXT B;  4LNK A;  3V62 A;  1L6U A;  3MHS D;  5GXG B;  2Z0D B;  3WAL A;  3MJW A;  4FAD A;  4BAX A;  5AZG A;  2JVC A;  1HZ5 A;  5HG2 A;  1OTR B;  2KFJ A;  3ZLZ A;  1DYQ A;  2INC C;  4KVG B;  3TBL D;  4D2K A;  2NTS A;  3A9J A;  4AOF A;  2JQR B;  1L4Z B;  2DYM A;  1N61 A;  2IY1 B;  4BKS A;  5IN7 A;  4NJC A;  3W1S A;  4HRS A;  2N9K A;  2HJ8 A;  2NPT B;  1UZX B;  4A6Q A;  2PIA A;  1R4M I;  3QX1 A;  3CWI A;  2BT6 A;  1AAR A;  2BWE S;  4WAA A;  1QOB A;  1OEY A;  1J8C A;  3ZDT A;  2KD0 A;  4IM2 A;  3T3N A;  3DPD A;  4XWW A;  4EEW A;  3AUL A;  2DAF A;  2WXL A;  4IM0 A;  1F2R C;  2QSD A;  3B0A A;  3PZ7 A;  2LJ5 A;  4DDI D;  2VRR B;  4DWF A;  3KWV A;  4HJK A;  1SBB B;  2BYV E;  1NYQ A;  2WHI A;  2KXJ A;  2D07 B;  1WJ4 A;  4MAC A;  1E9M A;  1PFD A;  1WF9 A;  3TEX A;  1C3T A;  2LMC A;  1L7Y A;  2KTR B;  3HVZ A;  3PHW B;  4NPN A;  4WJN A;  4HCP B;  2WDQ B;  2KMC A;  3KUD B;  3O65 B;  2CS4 A;  4A3O A;  3UIO B;  1SE2 A;  3U30 A;  3PRM B;  3FAH A;  2QMT A;  2ZCB A;  1WGR A;  1ZP0 B;  2WXM A;  3QIJ A;  4L1B A;  2PPH A;  3IAM 1;  3N1X C;  2KC2 A;  3QAR A;  5LNK 1;  2MH7 A;  2JZZ A;  1N62 A;  2AX5 A;  3AXC A;  4ACF A;  3U4E G;  1PGA A;  1RRB A;  3P4R B;  3Q3M C;  4NNJ B;  2WXF A;  4S17 A;  4W9K A;  3ZW3 A;  1UD7 A;  5D7G A;  1RYJ A;  3QWZ B;  3TUO A;  4TQ1 A;  1OQR A;  2I38 A;  2CJN A;  1P1A A;  1GUA B;  4MH8 A;  3EUB 2;  4IWO A;  1WGH A;  1IPG A;  2XBB C;  4OW0 A;  1KTK A;  2M19 A;  2RD0 A;  4HWI B;  4NQL B;  3MFG A;  1I7H A;  3TJP A;  5CX3 A;  2WXR A;  4GIV A;  2ONQ A;  3MP9 A;  2JXX A;  2KQ7 A;  2PE9 A;  5DPW A;  3T9L A;  2NMQ A;  2KQ4 X;  4YWG G;  4HPM B;  1Q5W B;  2CJO A;  2HJ1 A;  2EKI A;  4LTU A;  2BYE A;  3ETR A;  4GDK A;  2WXJ A;  4HLE A;  3R8B A;  4A9A A;  3VDZ A;  3OWE B;  1WX7 A;  4B6W A;  3HM6 X;  4P1C C;  4C4V A;  5HFY A;  5L95 C;  3NVZ A;  4PYZ A;  3U8Z A;  3WIM A;  1F0Z A;  1T6B X;  3UIP B;  4FUL A;  2OJR A;  3EHV A;  1KLG D;  4W9F A;  3AMZ A;  1WZ3 A;  1ZW7 A;  3TIX A;  1WM3 A;  4MM3 A;  4RM8 A;  1CJE A;  4DQO C;  2MSE D;  2JXT A;  2AWT A;  2RPQ A;  3MTN B;  5FKA C;  3I9V 1;  3Q69 A;  4DHJ B;  1V81 A;  4WIP A;  1R4N B;  2HDE A;  2D11 A;  3Q8B A;  4PK1 A;  1EU4 A;  3RT3 B;  1UBI A;  2OOB B;  3PRP B;  2V4L A;  1SIJ A;  5D3I B;  5MPO A;  3Q6B A;  3HK0 A;  4ARC A;  2RGF A;  3A4S C;  2BKR B;  3KH0 A;  1QKZ A;  5L83 A;  4K7U A;  1TTN A;  2KWV B;  2R2O A;  4XC2 A;  4BKT A;  1EF1 A;  3QAQ A;  1V1O A;  4R3D A;  3SD5 A;  5FR3 A;  3L13 A;  1JML A;  2ZPY A;  3DBH B;  1GB1 A;  2FIF A;  1LFD A;  2K8H A;  1OEY J;  2M0X A;  3VRB B;  3A33 B;  3L4P A;  1I4P A;  4BKS D;  4KZ0 A;  2OJW A;  4MSQ B;  4WQM A;  4C56 C;  1TT5 B;  2N4F A;  3Q3O C;  5LLI A;  2Z8L A;  1WRI A;  3W5V B;  1XT9 B;  3KVF B;  2IO2 B;  4REZ A;  4US9 A;  1V86 A;  1YX5 B;  1ZGU B;  1IBX A;  1HXY D;  1EWC A;  2QJL A;  3B1L X;  2DLB A;  4L23 A;  3PV1 A;  1ET6 A;  4RF1 A;  1YN4 A;  4II2 B;  4FHK A;  2V3S A;  1CK1 A;  2LJI A;  2QDF A;  1WSP A;  2JF5 A;  5EE9 A;  1T5X D;  4NJ6 A;  4OZB A;  2C7M B;  4LJP B;  4TKN A;  1SJE D;  1YJI A;  3VH4 B;  2FAZ A;  3AE2 B;  2MJD A;  3FIL A;  4QAY A;  3TEW A;  1JQ4 A;  1K50 A;  2KT7 A;  1XD3 B;  3A1Q B;  1BUI C;  3CMM B;  3NHE B;  3R7Q A;  4KGT A;  4W9C A;  4YTM B;  4IOI E;  1TZO A;  2KWC A;  4OVU A;  1E90 A;  4XZ4 A;  3CF6 E;  5EDS A;  3UI3 A;  1V80 A;  5JHB A;  2C7N B;  3RZF A;  3B08 A;  3ZXV A;  2NBW B;  1V9J A;  1DOI A;  2DNF A;  4TSS A;  3R2T A;  3DWG C;  2FBW B;  2WU2 B;  3DVN V;  1NEK B;  1C4C A;  1F1H A;  2A5U A;  2PTL A;  2K9X A;  4ICV A;  1P9D U;  3GZN I;  4GDK B;  1WE6 A;  2K5P A;  2KJH B;  1SEB D;  5D2M B;  1V2Y A;  4ZRK A;  2O6V A;  3AEF B;  2CR5 A;  3DBL I;  2KDB A;  2SEB D;  4O1N A;  4PT5 A;  4EUT A;  1FIQ A;  3B2F A;  3AED B;  1V5O A;  2IPK D;  4LDT D;  4MT5 A;  2KZR A;  3ZYY X;  1FPY A;  2KMA A;  1QOF A;  4RNA A;  2MW5 A;  3RFZ B;  4I6N B;  4ZOH C;  3Q8C A;  2BGF A;  5H92 C;  3ZGZ A;  4A20 A;  5AUK A;  4CQN A;  5D3D A;  3WAM A;  3RD2 A;  3VXW A;  1FNV A;  3PPA A;  3IVF A;  2IGD A;  2WXO A;  2W3R A;  4XDC A;  2KDM A;  3T3O A;  3C8Y A;  2LXC A;  3H6N A;  4XE0 A;  4KZC A;  2N9L A;  3W5U B;  1V8C A;  2DZJ A;  2EMS A;  3PZ8 A;  2WXG A;  3IT6 B;  1E8Y A;  4RH6 A;  1BXT A;  2H89 B;  3AEE B;  2ZVO A;  2BB6 A;  2YEP F;  2L8J A;  3L08 A;  2KFK B;  2E6X A;  2W54 A;  3IFW B;  3H7P B;  3ONS A;  4LK0 M;  5FK9 C;  1WYW B;  4GLS C;  3ZXR A;  2ASQ A;  5BMI A;  5J18 A;  2DX5 B;  3ZTD A;  1K53 A;  1TS2 A;  1P3Q U;  1MFW A;  2BYF A;  1ZDV A;  1VDV A;  2FNJ B;  2NVU I;  1UEL A;  3WAN A;  2XEW A;  1FCC C;  2LZ6 A;  1DGJ A;  2WGS A;  2LGI A;  3RZW C;  1I4R A;  1L0V B;  1JWM D;  3PRE A;  4GSW A;  3VTV A;  1WM2 A;  2JU6 X;  2BKF A;  4ZYN A;  2LUE A;  3I5J C;  4EZJ A;  4ZRJ A;  2RSU A;  2V4I B;  5KHQ A;  1B1Z A;  3MJ5 A;  4OVV A;  3I63 C;  4H2A A;  2GB1 A;  5CHV C;  4URK A;  2M4N A;  4CO7 A;  3JSV B;  2LWP A;  2V3P A;  4DK5 A;  3GE3 C;  2LHE A;  5G2N A;  2JWZ A;  2K8C A;  1KH0 A;  3VQI A;  4YTP B;  3OJ4 B;  4P6V F;  2V3N A;  3V6E B;  2FE8 A;  3VVW B;  2CU3 A;  4X57 B;  3N1Z C;  2DZK A;  1YN3 A;  2VH2 A;  1D5Z C;  1FNW A;  4F1S A;  5E6O A;  4NQK E;  5TSS A;  4DXG A;  4OVZ A;  1OFF A;  1WX9 A;  1PGB A;  2JT4 B;  4DDG D;  2D5G A;  4JWS C;  3VAW A;  1N5X A;  2DWQ A;  1WGG A;  1A70 A;  3QC8 B;  1VD2 A;  4W9I A;  3VHT C;  1S1Q B;  1NI3 A;  1J0G A;  2LD9 A;  3KUC B;  4EOY A;  2O2V A;  5C2T B;  1RM6 C;  3AU4 A;  4W9G A;  1DOX A;  1XLN A;  3S2A A;  1SB3 C;  2DYO A;  1UF0 A;  3ZRC A;  2WXP A;  4K1R B;  1WWT A;  2UU7 A;  3FC4 A;  3P4S B;  1AW7 A;  4N58 A;  2KTF A;  4AWJ A;  4E74 A;  2GBJ A;  1I4H A;  2KX0 A;  2MBO A;  3ML8 A;  5DCN A;  2N9P C;  3M62 B;  3APD A;  2M17 A;  2K25 A;  4BKG A;  2JPH A;  5HHD G;  3Q3F A;  4B9K A;  4WWP A;  2QEJ C;  4YT0 B;  3NUH B;  1H8C A;  4FXC A;  1RAX A;  4TV3 A;  3AE5 B;  4KSL C;  4IG7 B;  4P1B C;  2WDT B;  2Z0E B;  2KN5 A;  2MHJ A;  1JWA D;  5E6J A;  1UBQ A;  2WNM A;  3TCA A;  4WQO B;  2WWZ A;  4RMA A;  4RGM A;  4KGR A;  1N5W A;  1EM7 A;  3VRA B;  4ZDV A;  4IDI A;  4DXF A;  2O6V D;  2G4D B;  2L3Z A;  2Y5C A;  3PO0 A;  1TZ1 A;  4LNI A;  3ZNG C;  2CU1 A;  1VR9 A;  5C23 A;  5IA7 A;  3PS6 A;  1F52 A;  2G1E A;  3L17 A;  5IOI A;  3I3T B;  1E7U A;  2GBR A;  1WRD B;  3RN9 C;  1A5R A;  1MHX A;  1FM0 D;  2CHZ A;  4BFR A;  2LHD A;  4GGQ A;  4P7I A;  1T0S C;  4OZA A;  1TY2 A;  3RNE C;  1C78 A;  2N7E A;  4B95 A;  3HUI A;  3PVL A;  4W9L A;  2N7D A;  3HM3 A;  1HE8 A;  4DXA B;  2K6D B;  2MBH A;  1N6Z A;  1WH3 A;  1TGZ B;  2JSV X;  5HKH A;  1MHH E;  3Q14 C;  2EEL A;  3AE6 B;  3LYY A;  1TS4 A;  1ZOY B;  3QK0 A;  2KLG A;  1M94 A;  1R7S A;  2PKO A;  2AEH A;  5JZE B;  1FMA D;  2KAN A;  1T3Q A;  1XO3 A;  1NI2 A;  4RF0 A;  1WJN A;  1KLV A;  1SJH D;  1WGD A;  4MJS B;  1F9J A;  2W55 A;  4P16 A;  1G6J A;  2BWF A;  3DWM A;  2VH1 A;  3KW5 B;  2I1K A;  1YNT E;  2I1J A;  3R3M A;  1WI0 A;  3QA8 A;  3RPF C;  3VR9 B;  1HA5 A;  4IM3 A;  2KK8 A;  2IJ0 A;  4NAW B;  4YSZ B;  4MH0 E;  3H7S A;  1ZKH A;  3BII D;  1L2N A;  3A1Q A;  1YMH E;  2DYB A;  3U2S C;  1K8R B;  1UNS A;  2NCN A;  2MLB A;  2O2V B;  4UDU C;  4HDQ A;  1R4N I;  4HPP A;  4FLH A;  1T0R C;  4KKJ A;  1QLB B;  1Q1O A;  2N1W A;  3L16 A;  3P63 A;  4ANW A;  2L83 A;  3ZO5 B; 
#chains in the Genus database with same CATH homology
 4HK2 A;  2C7M B;  4LJP B;  4E71 A;  2DAJ A;  4TKN A;  1QZE A;  3ZRF A;  3IHP C;  3SU8 X;  1JRU A;  5G55 A;  4K7W A;  3VH4 B;  3ENE A;  3UGB B;  2FAZ A;  4BOS C;  2FCS A;  4HCN B;  2DHZ A;  3DBH I;  2Y5B B;  1E7V A;  2AL6 A;  2LVO A;  2Z59 B;  4JQW C;  3A1Q B;  1XD3 B;  3PHX B;  3UF8 A;  2GBN A;  3CMM B;  3NHE B;  1LXD A;  2MBE A;  1P98 A;  2MBB B;  3VUW A;  3R7Q A;  5LXH A;  2GBK A;  1GG3 A;  2KOX A;  4W9C A;  2K8B A;  3R7R A;  2V1Y A;  1I35 A;  4KDL B;  4OVU A;  2K39 A;  2KWC A;  3BIN A;  1NBF C;  2CHW A;  1WMH B;  1E90 A;  4XZ4 A;  3CF6 E;  4AUQ C;  4EZK A;  2KWU B;  2BPS A;  3CSF A;  2FCM A;  2KTR A;  4A3P A;  5EDS A;  1E8Z A;  1V80 A;  2JRH A;  2C7N B;  5JHB A;  1LM8 B;  3RZF A;  3B08 A;  4WJQ A;  2NBW B;  2WX1 A;  4BBN C;  1V9J A;  4HXD A;  2ZCC A;  4IWQ A;  3DVN V;  1Z2M A;  4M8N A;  1YX6 B;  2A5U A;  2AYO B;  4MGK E;  2D2Q A;  3WAP A;  3N32 A;  4WWO A;  4ICV A;  3C0R B;  3UIN B;  1P9D U;  3GZN I;  5LXI B;  4GDK B;  1WE6 A;  3DCG A;  2KJH B;  1V6E A;  5KHO A;  5D2M B;  4MEL A;  1V2Y A;  4ZRK A;  2O6V A;  1YJ1 A;  2W9N A;  3ML9 A;  3UQA A;  1VCB A;  1V49 A;  2CR5 A;  2DEN B;  2KDB A;  3DBL I;  2IZV B;  3LJ3 A;  3ZNI D;  4PYU A;  4MEM A;  3VFK A;  4HDO A;  1WE7 A;  2N9X A;  1WY8 A;  4EUT A;  4HVB A;  2CHX A;  3L10 B;  2L05 A;  3A4R A;  1TBE A;  3DDC B;  4EZL A;  1V5O A;  3TMP B;  1SGH A;  2D3G A;  4FBJ B;  2JUO A;  4W9D A;  2QHO A;  2ZPN A;  2GMI C;  4LDT D;  2C9W B;  2KZR A;  1KOT A;  5BO4 B;  4ANX A;  3EEC A;  3ZIM A;  2KMA A;  2ZVN A;  3VTU A;  4EKU A;  2KFK A;  2KQS A;  1CMX B;  2ZZP B;  3Q3J A;  2MW5 A;  3H7P A;  1Y8R C;  2KO3 A;  4GOC A;  4I6N B;  1GJZ A;  2BGF A;  4A20 A;  4GDL B;  4G11 A;  4GU2 A;  4G3X B;  1WGY A;  2MBQ A;  4NY0 A;  3D32 A;  3WAM A;  3RD2 A;  3VXW A;  2KJ6 A;  1EUV B;  3PPA A;  4G50 A;  1WJ6 A;  2HTH A;  2IY0 B;  3DBS A;  3IVF A;  1Z5S B;  2FCQ A;  2K6Q A;  2JY6 A;  1SE9 A;  2YLM A;  1GNU A;  2O6V B;  4RM9 A;  2LXC A;  3H6N A;  4BOZ B;  4KZC A;  5CHF A;  1WZ0 A;  2DZM A;  3NS8 A;  3H9D A;  2C60 A;  3M95 A;  4GB9 A;  4KIK A;  2G45 B;  2WX0 A;  2C7H A;  3IBE A;  2DZJ A;  2FID A;  2EMS A;  4WWN A;  1E8Y A;  3HIZ A;  3U7D A;  2BF8 B;  2LVP A;  1RFA A;  4JIO U;  1FXT B;  2IO1 B;  3V62 A;  1WIA A;  3DVG Y;  2ZVO A;  2B3A A;  3KYD D;  3MHS D;  4MGZ E;  2L8J A;  3L08 A;  2KFK B;  3IFW B;  2Z0D B;  3H7P B;  4FJY A;  3ONS A;  4LJO B;  4ICU A;  3WAL A;  3MJW A;  3ZKJ C;  4FAD A;  3M3J A;  3K9O B;  5AZG A;  3AI5 A;  1WYW B;  4DHJ D;  2KHW B;  2JVC A;  2ASQ A;  5J18 A;  2DZI A;  3V60 A;  2DX5 B;  2MCN B;  1OTR B;  2KFJ A;  3ZLZ A;  3OAW A;  3ZTD A;  2PEA A;  1U4A A;  3A9K A;  3JSV A;  1P3Q U;  3M63 B;  2BYF A;  2FNJ B;  2NVU I;  3OJ3 A;  3K9P B;  4KVG B;  3TBL D;  4F8C B;  1UEL A;  3WAN A;  2XEW A;  3IG3 A;  2JRI B;  2LZ6 A;  2G4S A;  3A9J A;  3DBR I;  4JL9 A;  4KIK B;  5IAA C;  4AOF A;  2L0T A;  1WFY A;  4IWP A;  2DYM A;  3GOE A;  3RZW C;  3AU5 A;  2IY1 B;  4BKS A;  1YIW A;  2XK5 B;  3WAO A;  4XX5 A;  1WR1 A;  2KJR A;  3PRE A;  3W1S A;  4GSW A;  4GN1 A;  3VTV A;  1WM2 A;  5E6N A;  4WJP A;  3RUL A;  4MGI E;  2MA9 B;  2BKF A;  2KDI A;  1EO6 A;  4ZYN A;  2HJ8 A;  2LUE A;  2NPT B;  4EZJ A;  1UZX B;  3EC8 A;  4ZRJ A;  2RSU A;  1R4M I;  5KHQ A;  4OVV A;  1GC7 A;  2ZNV C;  1XQQ A;  4FJZ A;  4GMV A;  3QX1 A;  2UWQ A;  4K81 A;  5CHV C;  1AAR A;  3A9K B;  2BWE S;  2M4N A;  3APC A;  3JSV B;  2LWP A;  1PQS A;  2WYQ A;  3WA0 A;  4CO7 A;  4FA6 A;  4WAA A;  4EFO A;  4DK5 A;  2EMT A;  5G2N A;  2JWZ A;  2K8C A;  1OEY A;  1J8C A;  4IW0 A;  3ZDT A;  4AJW A;  2KD0 A;  4IM2 A;  3VQI A;  4DHZ B;  2G3Q B;  2L7R A;  3DPD A;  3OJ4 B;  2MP2 A;  1Q0W B;  3A9J B;  3AUL A;  4ASW C;  4EEW A;  2DAF A;  3V6E B;  3VVW B;  4IM0 A;  1J19 A;  4FN2 A;  1E8W A;  4X57 B;  3L0W B;  3B0A A;  2DZK A;  4K7S A;  4MDK E;  2LJ5 A;  3QCA A;  1IP9 A;  2LRW A;  4DDI D;  5D94 A;  2VRR B;  4DWF A;  4F1S A;  4HJK A;  1ISN A;  4W9E A;  3ZDM C;  2BYV E;  5E6O A;  4NQK E;  3W1Y A;  4AJY B;  2KXJ A;  2LGD A;  2D07 B;  1WJ4 A;  5AZF A;  3SHQ A;  2LXA A;  5DPS A;  4YL8 A;  1UGM A;  3NZU A;  4LCD E;  3W1S C;  1WF9 A;  3ALB A;  3ZTC A;  1C3T A;  4II3 B;  2PE6 B;  1L7Y A;  2KTR B;  3TL5 A;  1WX9 A;  4F7Z A;  3PHW B;  2JT4 B;  4NPN A;  3ZVV A;  2LRU A;  4WJN A;  4HCP B;  4DDG D;  2KMC A;  3KUD B;  3VAW A;  1D3Z A;  2AL3 A;  3O65 B;  1WGG A;  2KX3 A;  3PSE B;  2J7Q B;  1VD2 A;  2CS4 A;  3QC8 B;  4A3O A;  3UIO B;  3U30 A;  4E3C A;  4N9F 4;  1KM7 A;  4NJ7 A;  4PS3 A;  3PRM B;  4W9I A;  3NY5 A;  2ZCB A;  1WGR A;  1EF5 A;  3QIJ A;  3VHT C;  1E5W A;  1S1Q B;  2CKH B;  1IYF A;  4CYE A;  3VUY A;  2PPH A;  1J0G A;  2KC2 A;  2LD9 A;  3L54 A;  3QAR A;  2KVR A;  4ZRI A;  2JZZ A;  3KUC B;  4TQ0 A;  2HE7 A;  4GXB A;  4EOY A;  2O2V A;  5C1Z A;  1WXV A;  3AXC A;  3AU4 A;  2ZEQ A;  4AP4 C;  2KNB A;  1RRB A;  4W9G A;  3S2A A;  2DYO A;  4JGH B;  4NNJ B;  2UYZ B;  3RCZ A;  3ZRC A;  3R66 C;  4W9K A;  3ZW3 A;  4K1R B;  3DVN U;  1UD7 A;  1KJT A;  2FCN A;  4TUU A;  2KTF A;  4AWJ A;  5D7G A;  4FJV B;  1WR6 E;  3QWZ B;  4TQ1 A;  4E74 A;  2GBJ A;  2NBU A;  1P1A A;  2R2Q A;  1GUA B;  2KX0 A;  2MBO A;  3ML8 A;  5DCN A;  4ANV A;  2N9P C;  3M62 B;  1H4R A;  3APD A;  2LI5 A;  2IYD B;  4IWO A;  1WGH A;  2M17 A;  1IPG A;  2EKE C;  2LAS A;  2XBB C;  2K25 A;  4BKG A;  2JPH A;  2RD0 A;  3QQ8 B;  4HWI B;  3Q3F A;  4MGY E;  4NQL B;  1YQB A;  4B9K A;  3T8M A;  4WWP A;  1H8C A;  5TR5 A;  3TJP A;  5CX3 A;  3UQB A;  4M8M A;  4GIV A;  2KLC A;  1RAX A;  4TV3 A;  2JXX A;  4KSL C;  4IG7 B;  3ZUN A;  2KQ7 A;  1T0Y A;  4J6I A;  2WDT B;  2Z0E B;  2KN5 A;  2PE9 A;  3ECI A;  5DPW A;  1UBQ A;  3QJZ A;  3T9L A;  5GMV A;  4KSK C;  3HHM A;  1MG8 A;  3TCA A;  4I6L B;  3PGE A;  4I6P A;  4HPM B;  4WQO B;  2WWZ A;  1BT0 A;  4RMA A;  2L76 A;  1P0R A;  3BY4 B;  4G0N B;  3PT2 B;  5JHA A;  1Q5W B;  1OGW A;  4LDT B;  5DPT A;  2M1M A;  2JZ3 B;  4ZDV A;  2IO3 B;  3V61 A;  2BYE A;  2O6V D;  2G4D B;  2L3Z A;  4GDK A;  1TZ1 A;  4HLE A;  4M0W B;  3PRZ A;  4PS8 A;  2NBV B;  3ZNG C;  1RLF A;  3JW0 X;  3VDZ A;  2CU1 A;  1WX7 A;  5C23 A;  3HM6 X;  3PLV A;  3NZS A;  3P2B A;  4B6W A;  5L95 C;  5IA7 A;  4PYZ A;  3U8Z A;  3ZNZ B;  3PS6 A;  3WIM A;  1WXM A;  3OLM D;  3QHT A;  1OQY A;  3L17 A;  2KC1 A;  3I3T B;  1E7U A;  1E8X A;  4BVU C;  2GBR A;  3UIP B;  1WRD B;  4FUL A;  2OJR A;  4DHZ E;  3EHV A;  1A5R A;  4FHJ A;  4W9F A;  4KDI C;  2CHZ A;  3RUI B;  4ANU A;  4BFR A;  1WZ3 A;  5DPR A;  1ZW7 A;  2IBI B;  3TIX A;  1WM3 A;  1WXS A;  4MM3 A;  4GGQ A;  3JYU A;  1I42 A;  4RM8 A;  4P7I A;  4GDL A;  2IO0 B;  2MWS B;  2NS5 A;  5FR6 A;  3DVG X;  3VH3 B;  2MSE D;  3VTW A;  1C1Y B;  2N7E A;  2AWT A;  2J0M A;  2RPQ A;  2J0J A;  4B95 A;  2YVC A;  4URK A;  3MTN B;  1WX8 A;  3X0W A;  2N9E B;  4MSM B;  3PVL A;  4MJS A;  4DHJ B;  4W9L A;  1V81 A;  2LVQ A;  2N7D A;  3DQV A;  3JVZ X;  3N3K B;  3HM3 A;  1HE8 A;  1YD8 U;  4DXA B;  2K6D B;  2LGX A;  2MBH A;  3X23 A;  2D11 A;  1WH3 A;  3KYC D;  2GOW A;  3RT3 B;  1TGZ B;  1UBI A;  2OOB B;  3PRP B;  2V4L A;  4JLC A;  4CHK A;  2MP2 B;  5HKH A;  2KKC A;  3H1U A;  4NAW A;  4W9H A;  4PS7 A;  2K1F A;  2FUH B;  3QK0 A;  3HK0 A;  5J2R A;  2KLG A;  3V6C B;  2A4Z A;  1M94 A;  2MRP A;  2NR2 A;  2RGF A;  2RR9 A;  3A4S C;  3APF A;  2BKR B;  3KH0 A;  3KUZ A;  5L83 A;  5AEK B;  2AEH A;  4WJO A;  4BBN F;  5CHW A;  4K7U A;  1TTN A;  2KWV B;  2R2O A;  4XC2 A;  1NDD A;  2J0K A;  2KAN A;  1EF1 A;  4BKT A;  3ZNH B;  3QAQ A;  3SD5 A;  3L13 A;  2GBM A;  1NI2 A;  4DBG A;  2ZPY A;  1WJN A;  2FIF A;  1KLV A;  2M8S A;  1LFD A;  2K8H A;  1WGD A;  2ZJD A;  4MJS B;  1F9J A;  1OEY J;  3PZD A;  2L0F A;  1LQB A;  2M0X A;  3N30 A;  1X1M A;  1G6J A;  3A33 B;  3NOB A;  2BWF A;  1V5T A;  1UH6 A;  4BKS D;  2D10 A;  4KZ0 A;  1WJU A;  2KDE B;  4MSQ B;  1S3S G;  3KW5 B;  2I1K A;  5E6P A;  2I1J A;  3R3M A;  1WI0 A;  2L00 B;  2N4F A;  3QA8 A;  2XK5 A;  5JZE B;  4IM3 A;  5LLI A;  2KK8 A;  5CTR C;  4NAW B;  4MH0 E;  3H7S A;  1ZKH A;  1L2N A;  4W9J A;  1SIF A;  3A1Q A;  2DYB A;  2LGY A;  1XT9 B;  2MQJ A;  1K8R B;  2NCN A;  3KVF B;  2IO2 B;  2PJH A;  3CST A;  2MLB A;  4HPL B;  3SDL C;  2O2V B;  4HDQ A;  2MX2 A;  1R4N I;  2NPT A;  2ZNV B;  1V86 A;  1WMH A;  1WXA A;  1YX5 B;  1ZGU B;  2REX A;  4FLH A;  5JH5 C;  2KDF B;  3RYT A;  3B1L X;  3PLU A;  3PV1 A;  3LDZ E;  1Q1O A;  2N1W A;  5D6J B;  4IUM B;  3DOW A;  4IC7 B;  3PTF C;  3L16 A;  4II2 B;  4FHK A;  4ANW A;  2N1V A;  4KV2 A;  2V3S A;  5J17 A;  1GC6 A;  2HD5 B;  2C5L C;  3EFU A;  5AZH A;  2JF5 A;  3ZO5 B;  4NJ6 A;  3VUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...