4RMIA

Human sirt2 in complex with sirreal1 and ac-lys-otc peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
300
structure length
278
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Selective Sirt2 inhibition by ligand-induced rearrangement of the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inbititor
total genus 91
structure length 278
sequence length 300
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4rmiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4rmiA01
4GM0A 1M2KA 2VK4A 4JUDX 4F4UA 5EJ9A 4FVTA 3HWX1 4UU8A 4K9OA 2JI6A 4K9MA 4RMHA 2VK1A 1PT9A 5BWNA 2QQFA 2EZ8A 2IHUA 4BN5A 4JUBA 4F56A 1POWA 1NM5C 1D4OA 1PVDA 2VK8A 3LQ1A 4RMIA 2JIBA 4Y6QA 1OZFA 4MZXA 2AG1A 3ZGOA 1YHYA 3HWWA 3CLUD 5K2OA 1S5PA 4G1CA 5MF6A 2DJIA 2JI7A 4HDAA 5AHKA 1J8FA 1OZGA 2WVAA 5EJ7A 2EZTA 2HJHA 1T9AA 3EYAA 4UU7A 3E9YA 1ZPDA 2AG0A 3OE1A 2H2GA 2FRDC 1YC2A 4RJKA 4BVEA 1S7GA 5EJ8A 1YHZA 4ZP1A 1UPAA 2V3WA 3EA4A 2H4JA 1XLTC 5K6TA 2Q5OA 3IAFA 4JUAA 4JD5A 2VBIA 3GLTA 4COKA 4D5GA 2OORC 4JSRA 3U31A 2X7JA 5D7NA 4UTNA 4IAOA 2EZUA 4BUZA 4MPRA 3ZG6A 4BN4A 2A1UA 2H2FA 1BFDA 2OD9A 4GP9A 3CF4G 5FEMA 4QPZA 1HZZC 4RJJA 4FEGA 1N0HA 1YI1A 5K6RA 2H4FA 3PKJA 2H2DA 4UTVA 4GM4A 3CLRD 1PNOA 1PYDA 5BWLA 2NXWA 2IHVA 4BVGA 4C78A 4K9NA 1EFVA 4L2IA 3PDHA 4GPEA 1M2NA 2Q29A 3F6EX 1QPBA 1U31A 4FEEA 1ICIA 1JSCA 3D81A 4R8MA 3FSJX 1DJLA 1YNOA 1UPCA 1U2GC 4MQ5A 1EFPA 3JWPA 5MGNA 4I5IA 1PNQA 4JT8A 1T9CA 3IAEA 5EJ5A 4RMJA 1U2DC 1UPBA 4KGDA 4Y6OA 2OO5C 4HD8A 5BWOA 4V1CB 5MFZA 2Q5LA 2H2IA 4ZZIA 3ZGVA 2IHTA 2UZ1A 1PI3A 4K9QA 3GLUA 4J16C 2PGOA 4UUBA 4L3OA 5EJAA 4X3PA 4Y6LA 2BRUC 1V5GA 2C31A 3D7KA 5FYQA 5EJ4A 2NYRA 2JLCA 4K9KA 2EZ9A 3PKIA 5DEIA 1M2JA 2WVGA 2WVHA 4FZ3A 3RIYA 2PANA 2UZ1B 4IF6A 1U28C 4BVFA 4V1CI 4JUFA 2H2HA 1YI0A 1YTLA 1PTJC 3RIGA 4K9LA 2Q5JA 4RMGA 2JI8A 4JU9A 2B4YA 1SZDA 2OD7A 4UUAA 2JI9A 4TWJA 4BVHA 3K35A 3F6BX 1MA3A 3GLSA 2H4HA 1T9BA 3EY9A 4KXQA 4V1CA 1Q17A 4UTRA 1Q14A 2VBGA 5MFPA 2QQGA 2PGNA 4UTZA 5DGTA 1YBHA 2EZ4A 1SZCA 4GM1A 4MPPA 2A1TR 4JT9A 2OD2A 5EJ6A 1PO7A 1OZHA 1Z8NA 2Q5QA 2W93A 4TWIA 2Q27A 5DGDA 4BVBA 4BV3A 5EJMA 1M2HA 2FN3A 4K9PA 1MCZA 1Y9DA 4QQ8A 3CLSD 3JR3A 2FSVC 4J1TC 2JLAA 4Q9DA 4IG9A 4D5EA 3U3DA 1E3TA 1Q1AA 4X3OA 4QELA 1V5EA 2FR8C 4JU8A 1Q6ZA 3GLRA 2VBFA 2FWNA 4GG1A 4JUCA 3FZNA 4UTXA 1O96B 4O8ZA 4C7BA 1O97D 1T9DA 1V5FA 5K3SA 3FLMA 4MPJA 5IMSA 1OVMA 4RJIA 1M2GA 2H59A 2Q28A 3CLTD 2VJYA 1YC5A 4BV2A 1POXA 3D4BA 4KPUA
chains in the Genus database with same CATH superfamily
3MSCA 4RV4A 2C7RA 5FWXB 1BX0A 1YFKA 4Q7LA 4LZAA 5ECGC 2BTQB 4PANA 1YB6A 2UYCA 1YE3A 4UPVA 1QP0A 3ZWQA 2C9CA 1XLTA 2PKWA 2OZVA 3DLCA 4YRQA 2HWWA 1RFLA 3O7MA 4MYTA 5E1DA 1H2AS 3JQ7A 1XQVA 2I7TA 2BEJA 4DDUA 3AW8A 4HMOA 1GV1A 1URPA 2QTTA 1XEFA 1JR6A 2ISCA 1OAOA 2NO0A 2VEOA 3NHBA 4G5GA 2DBQA 1VM6A 2ID8A 3WB2A 2AHRA 1OB5A 1JIIA 1X8XA 4D9JA 5IK2D 2WD9A 3TTXA 2HRCA 3I2HA 4LSZA 4QBGB 3UWKA 2XCLA 1FJHA 4QO7A 1XZGA 3E1KA 4JWTA 3HUDA 4FHZA 4JLSA 4RD6A 1JPJA 1GTVA 4J43A 4W9MC 4FHDA 3CVXA 5B1IA 1AKVA 1V8PA 3ESBA 3W2TA 2CB0A 2HWXA 3WA6A 3V8RA 3ZWKA 1S0UA 2BFBA 4M1MA 1AD2A 2Q46A 1QNFA 1DDGA 5K6AA 1Z35A 3EF0A 1A27A 3C0KA 3HKEB 3L8EA 4UAGA 1KE1A 3UGTA 3EG9A 2NUAA 3MC1A 1H23A 1Y9AA 2Q62A 5D3KA 4N0QA 1RZRD 3IOCA 2LPMA 4G36A 3TLJA 3DL0A 2JJ1D 2DFPA 1QDUA 1C3OB 4QUHA 4BNNA 2OXIA 2N1BA 3IBTA 3HGTA 3FSRA 1K0FA 4H4EA 3RREA 1I1QB 1Z2OX 1MR3F 1CY6A 2OCPA 4HZIA 2HDWA 3LUJA 5JVDA 4D3YA 1J8FA 3D31A 4QXPA 4XA8A 3RG2A 3TUZC 1EVEA 4ZJYA 5LU9A 1U5BA 5KB3A 1SQFA 3LF2A 3O4HA 2PAFA 4FFBA 5EFZA 3VVMA 1CZRA 1GPYA 1T5LA 3B51X 2DY0A 2H1LA 3GJRA 1VLHA 2BGIA 3JARA 4DBLC 4XUGB 4QJBA 1Z8FA 2Q7XA 2VYVA 2O7QA 2X9GA 2ZRMA 3I9MA 1AKRA 1Y6QA 4FOSA 3CUYA 1SC9A 1RAFA 1CQIA 4P83A 2C3UA 2QXUA 4RM3A 1Z74A 1FJXA 1H0KA 5TE9A 1DL5A 5E2AA 5FA5A 3UANA 1TK2A 1KPGA 1BCSA 3FY4A 2CMGA 2JCSA 3G17A 3SZLA 4CL0A 3UENA 4ASUA 2IZOA 2VLBA 4O4HB 4S24A 1HLPA 3HO1A 4KIUA 2EF0A 2VAXA 4XI9A 1NFQA 7MDHA 1GPLA 1YJAA 3D6UA 1K86A 3BMNA 3NBXX 1QAMA 1ECGA 2NNWB 3IALA 3QU5A 4KBGA 1U8XX 2H0RA 1BH2A 1WB4A 5DOVA 1E6UA 2A67A 4ZZ0A 1ECJA 1RPAA 4LTMA 3DYIA 1E2KA 2O2SA 4B8ZA 1AKEA 1GP2A 2IWHA 1H9CA 2BTQA 2P6UA 3FPCA 4OQPA 4YJ2B 4YO8A 2B9EA 4I7EA 5LZ8A 4YJDA 1SQ6A 4MKFA 1VG8A 3RVBA 3V4ZA 4DLVA 1CY7A 1AA9A 5SZIA 1NAIA 3RYHB 3WRXC 2HO5A 1CJUC 3HB4X 3W1VA 5EMHA 1XAHA 4TKUB 1RM4A 2GHTA 1DWOA 2BEUA 4RD2A 4ZCQA 4R2XA 3A4LA 4PCAA 4RH3A 2FMFA 4KO1S 3T12A 1RYFA 1SPBS 2IDJA 4OL0A 1MA0A 4J7XA 3ZD6A 1FX0B 2XGOA 4E3ZA 2FFBA 1RI2A 2QW0X 4OGKA 3WGLA 1VJCA 2AC4A 1GEEA 4XVRA 2OB1A 3B8EA 3HZZA 1V96A 3ELUA 4IG4A 3UG7A 4LA4A 5JMWA 3FAZA 2ZI3A 3FFXA 3NRBA 5E8JA 1RE0A 1LF0A 4Q4LA 1KQGA 1K4MA 3ODPA 3LZ6A 4Z4QA 4DEXA 4LVUA 2IE8A 3EQ7A 4RD3A 1GAJA 1NXXA 2N1MA 3RS2A 3CG4A 4EYQA 4LQCA 2QGFA 2QWXA 4KB5A 1HYEA 4CXMA 1JMYA 2FG6C 5BT9A 2CY0A 3VXKA 5CB4B 5LLDA 3MMNA 2G0AA 3AI3A 3PEWA 3WLNA 1XTVA 2ZSKA 3RIEA 1T4MA 1P1CA 1YDFA 1JG2A 1C3OA 3NHUA 4QFBA 1D03A 1CZLA 1O03A 2DWCA 4P31A 1E2MA 2C82A 1JT2A 5LYJB 3DD1A 2VDWA 2Z6AA 2QN8A 2A1IA 4YVFA 5ALKA 1F48A 1C4WA 1QHFA 1VGQA 1SVSA 1WVMA 2IEYA 5FFMA 4JYMA 2PD3A 3L7LA 1TU0A 2FFJA 1BCRA 3AUKA 1P73A 3BRSA 3HNRA 3IUQA 2QTVA 3FTEA 1TM4E 1X1QA 1JKFA 2FQ1A 4K88A 5A9RA 4DRZA 4HWPA 3D9QX 3RSLA 1DXYA 2X3FA 1ORRA 1JGTA 1BX1A 1RRMA 2G4CA 1RACA 1E9SA 4FC6A 4MGZR 5KBYA 3VISA 1DQNA 4LQDA 2XB2A 4GMKA 2VNIA 3X1YA 4NNOA 3EZ9A 2G76A 2VTBB 4E6PA 4CQMB 2EX4A 3HCAA 2IUFA 3ZXUB 4IWNA 1QHXA 3VU1A 1VSTA 1U9YA 3UJDA 5IN4A 5I4KA 4NEGA 4W5NA 4JXXA 4FFWA 4AJOA 5LB4A 2JZCA 4ZOAA 1ZJ6A 3BVPA 1Z9BA 4XB1A 1KDVA 1OVGA 4BIMA 1N33B 1Q0LA 5AXCA 1JYFA 2F43B 2P2NA 2J3DA 3TQFA 4YYEA 4BB0A 7YASA 1FCJA 2DZDA 3I6YA 4L3WA 1NC1A 1EDZA 1J1UA 2EKLA 2F9LA 3G5TA 1JR3A 2R62A 4QRHA 2VHUA 3DXFA 3DXYA 3W6ZA 5CLFA 5A62A 1QBKC 4P7KA 4R6XA 4WKBA 4WOPA 3IURA 1SUPA 1PYGA 2WWTA 2Q21A 3Q9SA 8LDHA 3IV7A 1JEOA 2XNJA 3JQQA 2FW0A 3BIXA 5SZJA 1AT1A 5F1KA 4GOND 5CIWA 1OFIA 2HLHA 2X15A 3GBVA 4BHTA 2ZI9A 3BH7A 3DJFA 4TROA 5B64A 5CFNA 4ZCPA 1N92A 1Z6AA 2BFCB 2OBFA 5F77A 1B43A 2GF0A 3RYHA 2N47A 2GLXA 1E9EA 3PDHA 1NRIA 2EW8A 4C4YA 4C22A 3IAUA 2AOXA 3EE6A 3JS5A 5EE1A 2KBFA 3R76A 2WV9A 4R2HA 4LXIA 4O3FA 5C8DA 5DHAA 2J4DA 1M75A 2RGNC 4ENQA 2YKGA 1Y0BA 1UC4B 4LGMA 3FPBA 2G83A 3G79A 3O0TA 5FBQB 3CINA 1UP4A 3DT9A 2W70A 3CLSC 1J0AA 3QYJA 4DS3A 1AO3A 5DBOA 4DUPA 3RKUA 1JSCA 2KYRA 1ZA2A 2OP0A 1EFKA 3JD3A 2E21A 5ILGA 3KPVA 4AAYA 1JAYA 4QDXA 3VPFA 3KHKA 3KB1A 2ZYGA 3LVRE 4F91B 1RZ3A 5ELMA 1W7AA 1KEWA 2ZI7A 1RI3A 2ZRDA 2IEZA 5LQUA 3M0EA 2YV5A 4Z4FA 1LBIA 2GWRA 3UK7A 1NF9A 1RRFA 2H9YA 3G2OA 5GPBA 4EHNA 2HY7A 4MUHA 3HYRA 1USUA 3PDCA 2EJVA 3PI7A 4H6PA 4I5GA 2EL7A 4U4AA 3TKYA 4MPTA 4QHTA 3ZDCA 1E3SA 5EXPA 4QOFA 5HF6A 3NV7A 4JYBA 3DEYX 3DZIA 4P4LA 2DPHA 3N8GA 1UADA 4IZOA 3UG6A 2WK1A 1QZXA 1YJ8A 3D8RA 1NT2A 4FX5A 3QVMA 3WYDA 5AW0A 3QPVA 2FPIB 3SX0A 3TTSA 3AGPA 1OGJA 3IUYA 1USIA 2J33A 2PBFA 3JAKA 1HV8A 3JQAD 5ERXA 3ITDA 4GMHA 3OCUA 1YZHA 4HNSA 2XDQB 1GNTA 2ZVJA 2HK8A 1E7RA 2ZGVA 1I4LD 5K8LA 2AMYA 3TEFA 2JJQA 5FPQA 1WS6A 1ZCJA 3P52A 4GOXA 4B73A 5TX7A 3QYPA 2GCNA 2TYSB 3B5IA 3DHYA 3IAXA 4G1BA 1VFPA 1A8SA 1J9EA 2JD2A 4LOJA 4QUJA 3JQCA 2QTLA 5LBUA 2D7CA 2I03A 4CKWA 2P91A 3F6YA 1SKYE 3T3OA 3AERA 3W5UA 4YALA 2V7EA 2WLSA 2PGLA 2G4VA 3FBTA 4LXGA 1FXSA 3RTBA 1IEXA 3S68A 4LYJA 3RG8A 1REQB 5ILOA 1DB3A 1GL7A 421PA 3U3RA 1HI9A 1TUIA 1F7VA 3E9ZA 4GWKA 3WYNA 1C7ZA 2WT9A 4J2TA 2FDCA 1A9SA 2GN9A 2N42A 1W49A 3ICPA 2Z1NA 5CJJA 1CUIA 5CH5A 4X1YA 2NW6A 3KAKA 5AM4A 4AMZA 4NCHA 3UM9A 4R5HA 1GCIA 2D2EA 3G0GA 3MUOA 5AM0A 4ZYUA 2X76A 4UUBA 2AFVA 2J31A 3RPEA 4RF4A 3AHDA 3L4JA 2KPOA 3OCZA 4IJWA 2PDAA 3WWOA 3U3ZA 4Y6LA 1P9LA 2BEVB 1NSYA 2XVAA 4UFPA 3FRJA 5TQ0A 1A7UA 5THXA 1UBJS 1U2QA 5DO9A 4WQMA 5DV9A 3X2EA 2O7VA 2ZM6B 1HC7A 1PN3A 1THZA 2GCEA 3CZRA 4D02A 5IFKA 1U7DA 5DNCA 4OQXA 2PEYA 2H16A 3K0AA 5C9ZA 3BFVA 4R8KA 5B53A 2QLNA 1KQOA 4DB4A 2FSIA 3TM5A 1N25A 1PIWA 1Y5MA 1N2XA 1Y1TA 3KJIA 3ZLTA 1P6QA 3A3OA 2DLCX 1FLDA 1W581 1EPUA 2MTBA 4ISBA 1H3FA 2I5PO 2X8WA 3QFFA 5ICEA 3DEKA 2ATXA 2RGYA 3MNFA 4D97A 3IDOA 3IIMA 3FGZA 4G2NA 4E22A 4XCVA 2FWIA 4B46A 1KK1A 3KR9A 1D09A 3P2YA 1P4HA 3Q72A 5IF3A 4NOMA 1U3UA 2VRCA 2VCHA 1X1EA 3HH8A 4Y6PA 1CZHA 5IHPA 2H2HA 2XVZA 3NEJA 3F4KA 3V3TA 3NVDA 3WS7A 1C14A 1PF7E 1KYQA 2BFOA 3IMKA 4L9WA 4OG2A 2WJWA 3DE4X 3QHPA 4IL5A 3SF0A 1LBEA 5HKOA 2HU2A 3SNHA 2EF1A 4BQNA 4R7GA 1GPUA 2FW6A 3DEHA 3U7QA 4NESA 5KSYA 1NV9A 1KHTA 2OHGA 2QRPA 3NBUA 4KQWA 3DMHA 2FPIA 4AF7A 2IYFA 3WLQA 3HTXA 5FXMA 3EXIB 2P1ZA 3U48A 2JA2A 2BMJA 5KTPA 3TG8A 1F2DA 4X41A 1WTCA 1VDZA 2AN9A 1XYGA 2EYQA 2K6GA 5FPHA 1X2EA 4I1PA 4OIMA 5I01A 3AVVA 4F92B 3BCRA 4POAA 3V6MA 4B2LA 1PJSA 1KHHA 4Y2UA 4TT3A 4WH0A 4QT0A 3VSCA 3VTAA 4Z1MD 4HN2A 1FDRA 5AW7A 4BP3A 5T67A 2XB6A 4NJEA 1T2FA 4WD3A 3SQOA 3WLMA 4YRIA 5IZ4A 3KCQA 4XVHA 1T8YA 4IUCS 4DJ5X 4U7DA 2BBTA 5A5VA 1EJ6A 2I2DA 3CW8X 4MVJF 3W79A 1R0SA 1UXGA 1UK6A 2D8MA 2ZI6A 2YIDA 3F5DA 3W4JA 5BNWA 2P4QA 5CT9A 5K8UA 3CVJA 3I8SA 3VC2A 2DTEA 1JLRA 1NDHA 2IYRA 3OZWA 1E1CB 4H0CA 4PHCA 4QOSA 4IJMA 4UZFA 3ZZUA 2ZIWB 4C4AA 1CUXA 1HE1C 2A94A 2QVZX 2ZWVA 2P1DA 4NCNA 1WQ3A 2CLMB 3PL1A 1NRXA 2GAOA 3I0MA 4NU0A 1PO7A 1VXRA 3NTUA 4KNWA 4ZJZA 7REQB 3PVSA 7MHTA 1E3WB 3I0ZA 4RPHA 4G4GA 4GRDA 4FKZA 3UUWA 4L51A 3BICA 4OL9A 1C4KA 4WBXC 4BNHA 4F38A 4JLMA 5TF4A 5F1YA 1X92A 2XADA 4BVBA 5JYDA 1DQYA 4KN9S 4D1YA 1M6WA 2BGWA 1K5HA 1QIDA 5MDHA 4PLZA 4PLFA 4M0CA 2CVZA 1NBME 2J3IA 3C3KA 3EIOA 4G6ZA 5EVCA 4B80A 3HJTA 4MVJM 4O4LA 2YBDA 3AHJA 3OEHA 5HMLA 4Q9DA 4LV5B 1HRKA 4GPZA 3LFTA 4DMHA 4TRNA 1MJ5A 3AK4A 1PJ2A 3A04A 3OO1A 5AW4A 1OF1A 4L6IA 1PQPA 3FYDA 4CVNA 4PO3X 3FZYA 3CRW1 4FLMA 2VDJA 1G9XA 4TLAA 1V7CA 1RSZA 4ZVTA 5HF9A 5KVAA 4K05A 1V5EA 3ZDEA 2OSVA 3KKLA 1PZEA 3ICEA 4O1HA 1WHTA 3EFOB 1XP5A 4HH4A 2E18A 2V03A 1GARA 3ZCSA 5I9IA 1Q3HA 2MHCA 1DIBA 1SOAA 2HMTA 2YMQA 3PCXA 4JP8A 4OUDB 4RZHA 4UCXA 3TOSA 3C87A 3NANA 3CNBA 4EVIA 4K6MA 2HAEA 3WLEA 2QVLA 1COWD 4ZIRB 2H00A 3NUQA 3W2EA 2BGKA 3K0FB 4EA8A 2IXEA 1QR2A 1W6UA 2BL4A 1BDMA 5I3ZA 1SIBE 1N0VC 2AS0A 2CLHB 2WG1A 3KKQA 2P67A 4OH1A 4OHKA 4TS3A 4CIDA 1HMPA 2AQHA 2DUWA 1ZH4A 3BZWA 4CKBB 1U0JA 3HKCB 5DGHA 4JASB 4EG6A 3TX2A 1QRRA 2HRBA 4U3JB 3C41J 1MO4A 2VYFA 4DW8A 2EKPA 1XCBA 1JIQA 1ZH6A 1ZQ9A 3DKKA 1D4FA 2RHLA 4EY5A 1NI5A 5LDGA 1KVUA 4QBKA 2V7PA 2H5EA 4HDRB 2EG5A 2C5EA 2FYTA 2Z8YA 3NHPA 2H17A 1SCDA 3G5MA 3GYBA 4BFYA 2V45A 3GP8A 3ZGLA 5I3CA 2GERA 2XODA 4K6HA 4RQAA 4XR9A 3QU9A 2X4LA 4CMJA 4MHTA 1NN3A 2QI9C 4QYMA 1BN7A 2OCYC 3NIFB 3BM5A 3JWGA 3RV3A 3V7YA 4DJDC 3TEMA 1E1CA 4FT2A 2AK3A 3WRXA 5JAPA 2HMWA 4M1OA 1Z0FA 2PCLA 3IP8A 4OSPA 4CIBA 3KQPA 2R4QA 3KT3A 4KFTA 1G8FA 1N5JA 1EX6A 3JCZA 3IX7A 3W5JA 1PW5A 1JXQA 1XE3A 5ER9A 1D2CA 1AS2A 3PT5A 3VKVA 4A92A 1U9ZA 1E3WA 1F3LA 3GUHA 1CNEA 4OY3A 2O23A 3KYDB 4PYMA 5EHNA 3T3PB 1JIVA 3QXHA 1YRWA 1OROA 2DQKA 1QRDA 1ORVA 2HPVA 3QUAA 3TQCA 4ESEA 5JJKA 1Q7EA 5F51A 4NI5A 3L1JA 1XZNA 2YV4A 2PR7A 1QTQA 5KTSA 1JQBA 2XZPA 1GXSA 3FR8A 5TSDA 1UDAA 3EF1A 4WLUA 2F2TA 4OGGA 1FL9A 1FLVA 4P98A 2O1WA 3L43A 2HIAA 4UU1A 3VUEA 1J7KA 1E8MA 3E2MA 3VR5A 4YJ3A 3GFPA 3I9LA 1BC5A 3TZ6A 5K0BA 5DM70 1ZD5A 3JYNA 2VQFB 1UJ4A 4GYWA 4LMPA 3M1IA 5IUJC 1F0PA 1QC5A 2WWYA 2VPPA 1KYZA 1K92A 1VHJA 4ITVA 4JT2A 4TMYA 4LS3A 5LMNB 1QCCA 1FNNA 4EELA 1KKUA 1TLFA 3SCZA 2R4UA 1V37A 1ABFA 2NACA 3L79A 5C80A 1STOA 2GZSA 2ADMA 4C01A 3BXGA 1F14A 5CX1B 4LI0A 1JJAA 4D44A 2ZVDA 3IEKA 1QKKA 1WXFA 3OE4A 4ZU3A 4X6XA 2C4KA 2RONA 3LPDA 3ENVA 4YLGA 5U1PA 4BO2A 1RJWA 2E4YA 2Y4OA 4FFRA 4GMGA 2Q2WA 5F33A 1G8YA 5T4EA 1OA1A 3TFWA 5THKA 3T9CA 5EKXA 4KXMA 3N0RA 3PHJA 4JX8A 1B8VA 5KJ1A 4AU1A 3DPSA 1MEJA 2RHDA 3FF1A 3GDWA 3KTDA 2P40A 4KDRA 4RMNA 1DEKA 3OY7A 4I9HA 3VR6A 3U60B 1ETHA 10MHA 4LE1A 3DXXA 1G41A 3HBJA 5SYMA 3VHRA 3T34A 3M33A 1LPPA 3MJCA 4R84A 5AVVA 4D99A 1O3YA 3MMZA 2R85A 4BNLA 2PKQO 4HTFA 4PYOA 1IHXA 4BEWA 1JDJA 1VIMA 1GG5A 4J6EA 3QW2A 1PUIA 1J22A 2OGTA 3HRHA 4MS1B 4ZP1A 2YJ6A 4CF6A 2BGGA 3ZXSA 1GZ3A 1QX3A 4KYIB 2XKAA 3D1VA 4BUJA 1B23P 4BY9E 3AJDA 3H13A 3RSZA 4NOJA 2ZSAA 1WD7A 3QF7A 3EUEA 1O95D 1M6VB 2X9NA 1F8UA 1ZJYA 5AKXA 1PWXA 1PNRA 4JOBA 4KQIA 3AU9A 5IKMA 2I3ZA 5IPFA 4ZZ2A 3AG6A 2J87A 4DM7A 3GLTA 3FA2A 3O94A 3BWMA 5JZBA 4KQXA 4R6WA 3SY8A 4DA4A 4M37A 1KY2A 4HEQA 3BCSA 4JELA 4IHJF 1SXQA 2CE2X 3EQ2A 4P92A 2IEAA 1FTSA 2WHQA 4EW3A 3TQQA 2ST1A 3B2QA 5AW8A 1P31A 2IH2A 4XEHA 2P6RA 1DWPA 1ZNYA 1QPGA 4UAVA 4RF5A 4JQCA 2RGNA 4HLDA 3WMRA 1U6IA 5DCLA 4M46A 1WCYA 1ZUNB 4EJSB 1XHLA 4QPCA 5KYNA 3U6BA 2AF3C 5CP8A 4GEGA 2HNKA 3TIXB 1DXQA 1PFQA 1L4EA 2O3JA 2W22A 2X8JB 1I3KA 2IPLA 1N7HA 2YIJA 2Z4RA 5EHXA 1V1RA 1IY9A 4E03A 3WKCA 3UGQA 4EH1A 1QV7A 2CSUA 5ES4B 1T36B 2ZR8A 3LPCA 4MYRA 3TMYA 1E3DA 5EIAA 3QVJA 4OU5A 2RAFA 1KP9A 5CJ2A 1QIEA 3C6BA 2Z3ZA 4GFDA 1XVUA 4DEYA 2GFIA 4JT4A 1AMOA 2B6NA 2WTNA 3AB3A 3DKRA 4EENA 3SQNA 1BGXT 1MAWA 3DE3X 4GZ5A 3RTEA 3M6AA 3WXBA 1EIWA 1J56A 2C3OA 2ODNA 2Z98A 1Q16A 1N0HA 1C1YA 3LXUX 3N8NA 2QTHA 2WYOA 2DTXA 5CX1A 5IS2A 5BSHA 4BWVA 1PNTA 4H7DA 1IXYA 2VZ9A 2GM5A 4BLVA 2J48A 3JYQA 1LEHA 1IEWA 1CPYA 1IHPA 1QYCA 3E27A 4D0GA 5FOQA 2WJPA 3R4CA 3AWDA 4NV1A 1L5HB 2BI4A 1QKJA 4WCDA 5GZ6A 5T41A 3TIIA 4N3NA 2M6SA 3BEDA 521PA 4WXHA 4ZO7A 2KE5A 2V65A 4LUCA 3RC3A 4KPGA 4Q3EA 1KF0A 4KXXA 3SZMA 1EUYA 5GMOA 5EVJA 3CRVA 3LUFA 1MVNA 4N8EA 4JLUA 4PAMA 2DFLA 4RFSA 3SEAA 3DL4A 4XRRA 1YVUA 4BVGA 4E5SA 4REMA 3MJVA 4O2RA 1HDOA 4JFAA 1T3ZA 4WINA 3K20A 2ZWIA 1TLLA 4UHEA 5JNRA 1AKQA 3ZDRA 5KSOA 2FQXA 1ZVMA 4M0KA 2QN1A 4LJKA 4N0MA 4MQMA 2OYCA 1Q20A 4IIGA 5TC4A 2QL7A 4MYSA 1XZCA 1N5OX 2X3YA 1AK1A 1TRKA 4PHHA 1EXDA 1RZVA 4G0XA 1NMSA 4I46A 4XKJA 4O63O 3DE0X 1FUIA 2R0QC 1VKOA 4N76A 3RYFA 4F72A 3Q3IA 2ZJ6A 5DF1A 2H07A 1VJRA 5EE9A 4MIYA 3RS5A 4ZZ3A 3K0EA 4HPWA 5FBWB 3TJRA 1Z0JA 3QOYA 1DLJA 5B5SA 1TVEA 4NBRA 4R2LA 2M1XA 5AJZA 1WP4A 1J2EA 1YU9A 1ZK0A 2JFZA 3SJZA 2O8DA 4PF1A 1I51A 1Y37A 1S7CA 3NGXA 1ORWA 1ZX1A 3EHDA 3U3KA 3WHLA 3OM8A 3OZUA 1W5SA 1Y8AA 3A4TA 5ALJA 1HDIA 4DG9A 1KL7A 3VYUB 2JHAA 4RV9A 2AG6A 4Y2VA 1EU1A 3VKWA 1ZUNA 1EP2B 3PCRB 4AT1A 3IMEA 1E6WA 1E1KA 3KUCA 1T0PA 4JYPA 4GR4A 1PR0A 1M1NB 1KH1A 2OBBA 1XKQA 2ZJ4A 5FI1B 4YACA 3BGOS 4F4FA 1TJ4A 2PX8A 1PVVA 3DLIA 3HMKA 4NV3A 4TLMB 1L5OA 1IBMB 1N9ZA 5E2IA 3LO5A 3S7TA 4MQ5A 4RA9A 3RBZA 5AUOB 1EFPA 1UXKA 5GONA 1IN8A 1E1RA 3URMA 1GTRA 1IONA 5DNEA 1VDMA 3R5KA 4WW0A 4BLTA 4ND7A 2G63A 5GOZA 2NUTB 2HSZA 3BD9A 4Q1DA 2BKXA 2D8AA 3VOAA 2CUKA 4MW9A 2O5RA 2VR1A 4HQNA 3L2OB 4ECEA 3UWSA 2NV2B 2ZPUA 1PYOA 2FPWA 5HDBB 1MFZA 2DRIA 4XOUA 4CEHA 5JG7A 3K2BA 1NM5A 2P2ZA 1D4AA 4G07A 3KXPA 1EFRD 1N5RA 1EAYA 1J0BA 5DN6D 2H52A 1JLKA 1M2EA 2FQQA 1XDWA 2G71A 3NWOA 4HP8A 4OHBA 1SG9A 3SJ7A 3TQOA 5AQ1A 1NJFA 1BFUA 1ODLA 1KZ6A 4G5FA 2EGGA 4OA8A 1P1IA 2CLIB 3FSGA 4ND3A 4BMXA 3VNUA 4NBNA 1QH8B 2FP3A 1D0IA 1E3JA 2GN0A 2XY4A 13PKA 1IZ8A 4JVMA 3LPNA 4UM5A 3F6PA 5F5NA 2PUFA 4F12A 5BN4A 1TCBA 2QRJA 2Q99A 1T8TA 2VK2A 4EHHA 5EZ6B 4AKHA 1BN6A 2C5HA 1R0KA 3FB4A 3OX4A 3WK4A 2EGHA 4ES6A 4J16C 5TXGA 4BVAA 5ECWA 4KR0A 3DEZA 4C7VA 1G55A 4DCSA 4EK9A 2B1GA 5T6BA 1IWPB 1G2OA 1F9EA 1SCBA 1ZJJA 3VHXA 4KX3A 1OU0A 3OUZA 4WWHA 4JH0A 4JJZA 2FVYA 2XBMA 1UMDA 1X1BA 3DDZX 3NBYC 1SVKA 1JBKA 4UTPA 4L4YA 1GPJA 1T6ZA 2G7ZA 2YFKA 1HM5A 4Q02A 4WIAA 1VL5A 4OV6B 1YZUA 3EDYA 3HZHA 4YUXA 5KQPA 2QV0A 2ZTLA 4KWCA 5LCXA 4E1VA 1S2NA 2WTAA 3AEYA 4TYQA 3UVEA 1H05A 2ZAOA 3NJ8A 1AVTA 1IXSB 1RAEA 2W2QA 4ARSA 5F7XA 1HT1E 3P71T 1N36B 5JC8A 1XPUA 2OCKA 5EHGA 4LBYA 4BECA 1QQ7A 3VR3D 3O2SB 2D13A 1RP1A 4N7MA 4XUEA 1R7RA 5BW5A 2EZ9A 4L8VA 2A5GA 2W2LA 1CY4A 2CXOA 4DV2B 1MW8X 5JZSA 2GA8A 1G3RA 4HWOA 2ZZNA 1DP4A 1II8A 1M1NA 1Q15A 2DB3A 8AT1A 3AC0A 4XUCA 2DR0A 4IF6A 1P7ZA 3CVVA 1X74A 4JR1A 4BVFA 3F5QA 4W8OA 4J3JA 2TSYB 2PLRA 1TZBA 4JUFA 4LYYA 4Z4GA 3WOVA 1A9ZA 1JR4A 4P36A 2V7WA 1P0MA 3AHGA 1GZDA 1F5SA 1TKAA 1XO1A 2HMSA 2I55A 2H7XA 2IYEA 4IPTA 1TZKA 2WFMA 4NSNA 1H2EA 1RYYA 4HFJA 3L7BA 1T15A 1ZSVA 1WUKS 1Z4QA 2BFPA 3NT4A 4YJHB 3C6XA 1S4QA 3H2SA 3L05A 4BTLA 5LUAA 3UWPA 3FFTA 2Q0HA 1N6OA 1ZRNA 2CVOA 1RADA 3H3JA 3LQQA 2G72A 5G0VA 3HLYA 2Q1SA 4LJ7A 4MWBA 1JHXA 3WVNA 1MQSA 3HM2A 1VLMA 3G0DA 5DW3A 3PPYA 3MBOA 2M6RA 1WCWA 2HXSA 5FBVB 3HBFA 3LBFA 1KNQA 3O3OB 2GASA 3EY9A 5KMGA 2Z6QA 3QTLA 2V5AA 2ARKA 1ULUA 3F8SA 4GS5A 3OC0A 4PRYA 1P61B 1UP6A 4DYHA 3WAKA 1QH8A 1EGAA 3TFOA 5KS2A 1AUVA 1ZIDA 3IOEA 4U7TB 3TPFA 4F4JA 4HATA 3PC4A 2HRQA 3T9BA 5K01A 5KKNB 1IOWA 4IJKA 1P3Y1 1C2YA 4GSLA 4GP7A 3OTOB 2VG8A 4F1KA 2XCTB 2D6FA 4BWYA 4OTZA 5H8WA 2A6PA 1YVEI 3KDSE 2GDZA 1QIMA 1ZISA 5FB3A 3F0TA 1LSUA 4PSKA 1A8UA 2HA7A 3L5OA 4NZNA 5BRJA 5HQTA 1FS4A 3BFKA 1KI6A 4S2UA 3WOHA 1N2BA 1OILA 3RYIB 4Z7OB 1XJQA 1MC5A 3OZVA 1F8XA 2MSKA 1K8RA 1QCZA 4YTEA 4IKEA 4NZMA 1FZTA 3IVCA 5F9MA 1S9DA 3CUEF 4MLDA 5KWJA 4QTTB 1G3QA 1ZIXA 3P0JA 4KMSA 5DHUA 1FMLA 2XUJA 1GQOA 1RCUA 1X38A 2ZYRA 1OV6A 3OD5A 2HA3A 2WB4A 4MRAA 3KLMX 4KH1A 1QANA 4EGAA 3KZKA 1IM2A 3PEFA 4BO7A 1NLMA 3UJBA 1LS6A 4BZQA 2HDHA 2YWCA 5EXEA 1RQ7A 3BREA 1XGKA 4MWGA 1OXXK 4TMZA 3T4XA 5IBPA 1RABA 3VH4A 3DKPA 3ZE9A 1XA4A 4F8EA 1SK9A 5KIAA 4PINA 4IEEA 1NT4A 1YB2A 3QV1A 3TKLA 4D0SA 2IX3A 3LNCA 3HPRA 1MF7A 1MOSA 3PEVA 4I50F 4WACA 4YFYA 5BN1A 4J1SA 4GNRA 3HN7A 4QOHA 4XWKA 4X3OA 1H4SA 3Q0TA 4PXYA 1I7SB 1EQ2A 1NMZA 1Q3TA 3B2NA 2GNPA 4K5QA 1K7EB 3OZXA 1SD2A 4UUMA 3ZY2A 4YP5A 4EFKA 1C81A 2CNLA 3OOYA 4RK0A 3EOBI 5BYKA 2FWNA 3PUJA 5CVJA 1MP0A 3GLFB 4GG1A 2OAGA 2PD4A 2JAPA 3IBSA 2F8SA 3A25A 1SXJE 2JFOA 3MWEA 4H27A 5HTKA 2YDYA 1ZVJA 1B93A 3OX3A 1DBVO 4P5DA 5EZYB 4YJHA 4GC9A 4IDFA 1R9NA 4R1SA 1MVOA 2PZAA 2R4TA 4UHJA 5LOVB 5IM4F 5CVDA 1IY8A 4YUYA 3V4OA 1C5KA 4NENB 2JC3A 1ZK1A 2HUPA 4GX2A 3HXOA 1XTPA 3ZH2A 5IXJA 2IKSA 1BD4A 3WGOA 3C3YA 3TCKA 1XMQB 4GR9A 5ALLA 1RWPA 5CU7A 4FHCA 5LJLA 3RNOA 1GUYA 1NN5A 2IZ6A 4YJ2F 5SY9A 2EHDA 1TFUA 1QYVA 1U8FO 3MTEA 4NU5A 4TMTA 4ZT5A 4QPJC 3UJPA 3EK2A 1LBHA 4B5LA 1J2RA 3N2GB 2FR1A 1V71A 4YHBA 1TCVA 1GSOA 4GLJA 3VAYA 3O2NA 3T3DA 1BDBA 2BEWB 3FNHA 4XPIB 2I4MA 4ZFNA 1OWLA 5JPDA 2VRBA 4DM4A 5CLQA 4U9IS 2FG5A 2UUAB 2VP5A 1WCIA 1Z73A 2GNOA 3AIOA 3I2YX 4QUIA 3W06A 1I01A 4BNWA 1VLZA 3AEQA 3P19A 5TMEA 3HABA 1RBZA 1TQHA 4HPXB 3IQDB 4P4SA 3LX8A 4UC0A 2QQFA 2OO5A 4KYTA 3ZDFA 1DI0A 2ZUFA 3NTOA 4V0ME 5EFOA 1FFCA 3DLAA 2P11A 1P4GA 4Q34A 3PDWA 3UV7A 3TZQA 4CMBA 1AQJA 4N5LA 4QEDA 1Z6PA 1L8OA 3M5CA 2VK8A 3GT0A 1KETA 3LVBA 3YASA 821PA 4MUGA 2YWXA 5KTNA 3H2HA 3BWBA 4IICA 4Z9YA 3OZFA 3PA8A 3QBVA 2QSUA 5JYCA 1H1LB 3X1ZA 3RSOA 4YJFB 1U04A 2B3DA 4HZUB 2V4MA 1DZ3A 1ST2A 3HM9A 4ASUD 1SEVA 2DX7A 3ZW8A 2O8VA 2A9OA 3HXKA 2KS6A 2RKBA 3ZUGA 4DCJA 4KMMA 5K2OA 1XCOA 2BBWA 1S5PA 1D6SA 2OUKA 4UD2A 5EMJA 2ZP1A 1Z82A 2V7QA 2PRZA 4LJLA 3SQWA 1SQ5A 5JS6A 1G21E 2FSHA 3EBPA 2ZATA 4IINA 3HGMA 2RSLA 3N76A 4OX9B 1T2AA 3MTJA 2XECA 3E9CA 1UXIA 4F84A 3BBLA 4AUEA 4QBHA 1XZHA 3LCJA 2O0HA 1SY7A 1HQKA 3TL3A 1WZEA 3GLFA 2FMUA 3OAAD 4Q93A 1ML4A 3H99A 4YRSA 6NULA 2I2AA 1TIKA 5CIYA 1Z0ZA 5A71A 2HPZA 4QWWA 4PTZA 1QHHB 3UMVA 3RVJA 3PE6A 1FX1A 3J7TA 3WBBA 2YWRA 3HL0A 3A9UA 5EZYA 4UVDA 1AV6A 4C29A 1FP6A 5DGIA 4Y1FA 5LOVA 2VSXA 4MKGA 4CPDA 2YVUA 3HCRA 1CEQA 4Q1AA 3VKFA 3A0RB 4M86A 4NENA 3FKQA 2MSDB 4J76A 3DZCA 4ZXFA 4IW3B 2HEIA 1I1HA 1TMOA 5AJHA 4ABTA 4FQ7A 3QEOA 2VJBA 3I1IA 3IKVA 3O3CA 4RY2A 2V3WA 5AVTA 1YBAA 4XD7D 2JHFA 1XVIA 3NC0C 3OEWA 3OESA 3GLKA 1UT6A 2XITA 4C2BA 1G21A 1N9GA 4O29A 1T1JA 4EG5A 1EXNA 1UZAA 3A1VA 4DABA 3GFFA 1NULA 2CUTA 3DV0A 3N2GA 2IU4A 3R0IA 2VDLB 3IE1A 1XTQA 1CUSA 1KQPA 3PEEA 4M7OA 5WRFA 3ZQKA 1VLJA 2D1YA 4RD4A 1GL9B 4KIFA 4KOEC 4Z99A 1DRKA 6GPBA 5JI2E 3GRUA 3VSDA 2NN3C 4BC1A 4ETWA 3OIFA 1GTMA 1PUXA 1CP3A 1D5WA 5AVYA 4L9AA 4XGNA 1BWPA 1CDZA 3IJ5A 4COOA 1KVTA 2IRWA 4UATA 3IOBA 3VX3A 4FYVA 2P9YA 4C7JA 3N8HA 4KG7A 2BAGA 4PYJA 3QFRA 4N9QA 3CF0A 3FDZB 3KV3O 2BHRA 5TF0A 5A0FA 1SMKA 4K9SA 4ZV4A 4DWJA 5JSQA 2HA6A 3I5MA 3R9XB 2BKLA 4ILEA 3ZV7A 2CDAA 1YUMA 5G1PA 1XEAA 1HPLA 3W1EA 3NBAA 2ZRFA 3LZDA 5I9BA 4ZKEA 2H51A 3PDIB 2ZIUB 4D0LB 5IH7A 2QLTA 3NM4A 3BWDD 5FNVA 3ROKA 5M2QA 1D9ZA 1YOVB 4O2AB 4XYMA 3B52X 3RVLA 3CUKA 1H1LA 1SIUA 2RC5A 4R16A 5DZSA 4HZUA 4BGDA 1V16B 2RGRA 3FFBA 2ISQA 3LBNA 2C5FA 4HVAA 4MV1A 5SYNA 4BJHB 3T99A 3WLTA 2JI4A 4FDLA 2XA9A 3OLXA 4X8LA 4X97A 2A88A 4F2PA 1C0PA 1WHSA 3AUUA 3BF8A 2PUDA 1PSZA 4WN9A 5AK3A 5KYXB 2X42A 5T57A 1Q84A 5BR7A 4OBEA 2PX4A 4PZ0A 2QBYB 1LFAA 3QJ5A 4C1NA 1P19A 2W5UA 5BVHB 2FWMX 2UUPA 1JEDA 2A7XA 5LBTA 3QUSA 1QIJA 1Z37A 2QJWA 2WM2A 3HYNA 3B9QA 3ZTWA 2GM9A 3IEMA 2QL6A 2VP6A 2GD6A 2B78A 2DR3A 5IKEA 1QLWA 3MERA 4JB3A 2E82A 1EXVA 5IT0A 1GPWB 3QMVA 1LPOA 5AIAA 2QVXX 4RPJA 1F4PA 2FU5C 4ZC1A 3EEBA 4ZAVA 3SBXA 2BZ1A 2JVKA 1ATZA 1KEKA 4ZOLB 3HFSA 4C0LA 1N2CB 1P2SA 3D2CA 3MIZA 4A1FA 4R1UA 3GLHE 3ESCA 3QLEA 3JSAA 4PLTA 4X61A 4HV4A 4M7PA 3U56A 5HQ3A 3H7IA 3RFFA 4C2TA 4U02A 4YQZA 3ABOB 4F21A 1QB7A 4EB0A 4M99A 3CZ9A 4YYZA 1PEKE 5FWAA 5KTRA 2J4CA 4BQPA 4ML3A 1DAPA 1E2LA 1V35A 4FHFA 4US2R 3H4VA 4C78A 4LWZA 3SS8A 3GEDA 3EWNA 3H2BA 4CGZA 4IDNA 2BDTA 3MN1A 4JX9A 2P9TA 1C1HA 4L7QA 2WMOB 3SOPA 5B2FA 1D6NA 3OPMA 1UMBB 5FTJA 4KN8A 2E1RA 1YT5A 1TW2A 4L74A 3PZRA 3LXXA 2G82A 3RIHA 2W6JD 2X2OA 4MGHA 5D3MB 3F6EX 3KL2A 4G0ZA 1U1EA 3H16A 4WZAE 4G8JA 3WGVA 5BSRA 1ICIA 5J2UA 3ACCA 2OHVA 1Y4SA 1SVMA 3KKOA 4P82A 4PZLA 2BFAA 3KUXA 3DAFA 1I1OA 3E23A 3GLHA 2VYND 2BF7A 3CNEA 4N12A 4ZT6A 2BM8A 1TADA 3SYMA 2RD2A 1IZZA 2H65A 3FJ1A 1Z5GA 5EP4A 4RCVA 1ZMRA 3THSA 3ZZMA 4YAGA 1YB5A 4BEJA 1MO2A 1KFCB 2WP8J 3KT8A 4CM4A 4E2FA 3N7TA 2MYPA 2PR2A 4LXQA 5AUQA 5C52B 1QU3A 2VH5R 3K8OE 4FFMA 1BWSA 2HZBA 3C4QA 1KQ3A 2PYDA 4A4DA 4CETA 1KXZA 2FLKA 2OL4A 3QXGA 3AF3A 2B20A 4C0SA 3EPLA 1TNDA 2W11A 4YCSA 3OO0A 1TO6A 1NBIA 5L3ZA 3W9YA 2ZZMA 1BEEA 1XK7A 1IULA 2KLBA 3K0CC 4DLYA 4AZ3B 3I58A 5H83A 3TRKA 2NMVA 4RTNA 3IDSA 3LXRA 1ISJA 3LGAA 4RTOA 3IXMA 3F2IA 5D7BA 1NUPA 1U2DC 3FYUC 4DIFA 1VGRA 3E05A 3CLHA 3EEQA 3ZWDA 1R0BA 2GETA 1GPMA 4L0DA 1QG0A 1UXOA 1BYIA 2OO7A 1Y4AE 1YXMA 5AVQA 1XDDA 4TTTS 3HJUA 4BO0A 5ERYA 2AZDA 3R6DA 1IYZA 4YAJA 5HW0A 2HCTA 4FYXA 1F5NA 3R41A 4JBLA 4BJ1A 3EPKA 3DTVD 2CT8A 3WBFA 2VPYA 4RVCA 4EL0A 2IZ5A 4CYMA 3H5TA 5CBKA 2MT9A 2Z2ZA 5KQMA 1AUOA 1F0YA 2CZCA 5FI3A 1Z7WA 3HO8A 3GRCA 3NZEA 4ZZIA 2GZRA 3MJFA 1N2CA 1QWOA 4S2EA 5E0KB 1XMSA 1T3LA 3NKVA 2XUPA 3HCOA 3HFGA 1V6SA 2CK3A 1DEAA 3GARA 2VHVA 4RK6A 1VQ1A 3IA2A 3UKJA 3ZHVA 4MYCA 4YH1A 4RENA 3G1UA 3CZCA 2JLZA 1U7OA 2PUTA 1ESDA 3WLHA 3BJIC 3PIRA 5JZVA 1X7YA 5K0TA 2H1SA 5JXWA 5KSWB 4LJRA 4DXDA 1QAQA 3A6LA 4DILA 1HTBA 4LC1A 2DUUA 1P1JA 3Q98A 4V2IA 2NZJA 3HJHA 1C1DB 1OLSA 1E98A 1WTAA 3GFOA 3WV5A 4HVLA 1LH0A 2BW0A 4QLBA 3TBHA 3U09A 1QGYA 1Z2NX 1UMBA 2VO1A 3KBBA 3IDZA 2G9ZA 3WLSA 1YFZA 4B85A 5DM2A 2VAWA 4D25A 2QZSA 1HRDA 3F9CA 4AL4A 4LF9B 4QHYA 1E2DA 2CYAA 3TSWA 2YN2A 3L04A 1S1MA 2I76A 4GXTA 2YINC 5IVPA 1CJBA 3WA7A 4MSUA 1FNMA 4MQEA 5KDLA 1N0IA 5IU6A 2PWYA 2YYZA 2RBGA 2JCBA 2HHAA 4UNSA 3KLPX 4PLVA 4TS4A 5IJWA 3DAHA 2BISA 4KW7A 4LV8B 4IXNA 4FZ3A 3BK2A 3A4MA 1EZZA 1HT3A 1OGYA 2XMRA 1U28C 4MRVA 2ZIGA 4N3BA 4DA0A 3GG2A 3GX1A 1KBQA 1H2RS 1KAMA 3RR2A 3ZLVA 1E61A 2GJSA 1J09A 2JGAA 5AW9A 4KUEA 4TQGA 3V8EA 3GQVA 5KWEA 1UPTA 4PGFA 3KEGA 4WOBA 4URVR 4FK8A 3MLBA 5IUNC 5BMVB 3O4JA 3F8TA 5CA1A 1HOXA 2HCRA 2NO1A 4S1OA 1D07A 1EUZA 1QOPB 4P3OA 4PZUA 1NVXQ 5LLTA 4AXXA 4A15A 1X7ZB 2ZG6A 1TAUA 3O8QB 2F1JA 4XCQA 3ANNA 3PQFA 2OD7A 3BJRA 5TPZA 2BGLA 3X2SA 2FTKE 1WP9A 2Y4NA 3OU2A 3QVOA 1Z5NA 4NS4A 1SD1A 1KDOA 4PIVA 5BUQA 1E20A 1QYIA 4RH1A 1V3UA 2PSFA 3JQEA 3QJYA 2W6IA 1MA3A 4FMPA 4FR0A 5ALNA 4GEKA 4ZGGA 2FPXA 2FRXA 1SB8A 3F47A 3PD0A 1JFLA 2WYUA 1E3IA 3QWIA 1Z0KA 3V4FA 3B1YA 3TVTA 3C1AA 3A9TA 4HN9A 4TTVA 4LXYA 5AM2A 3VPBA 4W1SA 2R7LA 4C4RA 1FRVA 4UUOA 3U4DA 2W6QA 4I3HA 4F2DA 1KVQA 4WA8A 3WY9A 4FE4A 1G42A 2JKZA 4MA5A 5B58C 4MV6A 2R66A 3FMGA 1VCMA 1RZUA 3LLUA 4ZXPA 3W8RA 4NMXB 3S1SA 4ZJUA 4HLNA 1KZ4A 4LOLA 1XWFA 2P9BA 4PGGA 1D6MA 3R75A 1UEIA 2BTEA 5H5JA 1Y1QA 4EI7A 5L7TA 1QU2A 2OM2A 3CJQA 3AV0B 4M0DA 4BZZA 1FYFA 4YO7A 3J81A 4IYRA 2Q49A 3ZNPA 1B6SA 4KIGA 1MH1A 1SCIA 2XMSA 2YBEA 4IGEA 4L8LA 2W93A 3ZE2B 4DLBA 5EIFA 1EEXB 4RH0A 1M8KA 1EVIA 4A6PA 1PDWA 1C9DB 2GK7A 1BAPA 2ZKLA 3K92A 3GJYA 1ZO8A 2J0UB 3LECA 1IBCA 1NPTO 4FD2A 5IUKC 3GRYA 3F5SA 3K15A 3WDSA 1YUBA 2DM6A 5J40A 4U2BA 3Q5DA 5CM9C 2GBCA 2R7MA 3CZPA 3AF1A 1WNFA 3CLTC 4E88A 2WMNB 1NBMD 3ZCUA 3H9BA 4FLFA 3T7TA 4KGVA 5KX5F 2XCRB 4UOZA 3RK0A 5AJWA 1SUEA 2F8MA 2IF2A 1ISPA 2ZRAA 3TLGB 1CDEA 2WUGA 4I14A 1U3FA 2VYCA 3GL9A 3F3MA 3CNOA 2I87A 2JASA 4KR6A 4LIPD 4LNUA 1YFLA 1BMQA 1T9GS 1NU6A 3DPUA 3QK7A 5K3DA 3GLRA 4KQ9A 2HDOA 3U49A 5FUQA 1J1IA 2W6OA 2CCKA 1SCAA 1VE6A 2B4KA 2XGMA 4FNGA 4JC5A 5G02A 1NHGA 4AWAA 4HVCA 2ZIZA 4DC0A 1MGPA 1WW3A 3TNDA 2FW7A 1PR5A 3O8QA 3ONDA 4N03A 2PPVA 4QREA 2W90A 4R71A 3T5GA 4NXMB 2NTYC 3MOGA 4QNMA 3UO8B 3VZBA 2AXPA 3LX4A 4ZK6A 1N6HA 2F1RA 3HSSA 4QT4A 3NHYA 1USWA 2QJRA 2NWQA 3KXDA 3CLTD 4C87A 2VJYA 4I4TF 1S8OA 1I6MA 2B4QA 4EYEA 4WSOA 3UYLA 2XLBA 3KUUA 3BXOA 3Q11A 4UARA 3QLUC 4ND1A 3V8QA 2PGJA 5FOUA 5IARA 3ROGA 5KI6A 2Y6UA 2D5CA 1FDIA 4ZAWA 2OZLA 2Q5EA 1BO6A 1DQPA 5GV7A 2P90A 2PX2A 3ND9A 1GG9A 2I4TA 4UDNA 3ENWA 1P9WA 4FVTA 1FYXA 2DHDA 3CR3C 4HNGA 4XJXA 1NVVQ 3Q7IA 4EEXA 1A2OA 3E22A 2V9ZA 3ER8A 2CKMA 2YIVX 1YSCA 2Y1XA 2QX7A 3LHKA 5IAAA 2WQ6A 1XMIA 3M34A 5DMXA 1CJVC 1U8TA 3T1QA 3C16C 3H1BA 2HA4A 3FYCA 3WRYC 4MQFB 4E2ZA 4LF7B 3V6LA 1WXQA 4F3YA 1YQWA 1JDNA 2ZANA 2OGWA 3G8AA 2P62A 1CS0A 3OOWA 2O7RA 3LW7A 2XTNA 1NBAA 3I05A 1XU4A 3H8VA 4INAA 4LRTB 2GJKA 5B1SA 4C4SA 1FYEA 1PR2A 2AD5A 4JC4A 3QBDA 4F56A 1A9PA 4O2BB 4W99A 2F4VB 5CT4A 3T9AA 3HU5A 1J90A 2JFNA 3H0CA 4A8TA 1JWLA 1AK2A 4RPIA 2RH8A 4XVCA 1WU8A 1QO0D 3V46A 4OI4A 4TKZA 3P8ZA 4B83A 2YMMA 2B9VA 4QX6A 5F35A 1EVJA 1JE1A 1O5OA 4DYDA 2EIXA 3QWHA 3PGA1 2DFDA 1JJIA 2UUBB 4OA5A 2UU9B 4OQFA 1GRNA 3R0ZA 2XUFA 3IUNA 3L0SA 4DG5A 1GR0A 1H2YA 1XRNA 2GEVA 2ZJOA 2LP4Y 3OT4A 4LFCB 2X0FA 3ZLUA 2G6BA 3C5VA 2Y2UA 1Z4JA 2V1XA 3E9DA 3U4CA 3TLGA 4PAQA 2PQ6A 4FCWA 2HFKA 3R5XA 2JJ2D 1ATIA 3LCRA 4M6WA 3ZWXA 4E2YA 1PJRA 1XU9A 1YF3A 2QN9A 3CRNA 5DVZA 3ZQ4A 3LUHA 2ERCA 3P9RA 3GJ3A 4D9GA 1QXSA 2LV8A 1YZ3A 3MRTA 1NP6A 4NP6A 1F1BA 1ZN7A 2ODEA 3EGVA 3FXAA 3BC1A 2D06A 3M6VA 1JG7A 1NXTA 2G8LA 3E3LA 3L7OA 3GMIA 4EW2A 4A73A 3OE1A 1V8ZA 4X60A 4BUCA 3U80A 3IT0A 3CPHA 3F78A 3EXHC 3AW9A 4CQLA 1WY5A 1YC2A 3A0UA 3G59A 4YAEA 1LDGA 2YHSA 4RGVA 3SQMA 1Y81A 4V3CA 1NN0A 4YAUA 3Q5GA 3AYXB 2YXLA 3K0BA 5TPWB 3T4UA 9ABPA 1S01A 1N2IA 3QMWA 5DBGA 4BBZA 1CFJA 1OOEA 4AKEA 2WT8A 1EK0A 1Y6RA 2O9JA 3LC7O 5FL7D 4N0PA 1A77A 1KVSA 1ZSNA 1YBFA 4GQAA 3RS3A 2O6HA 4FIDA 2B1RA 3DUWA 3GO4A 5M7EA 5CMLA 4KVFA 4NHEA 3RHTA 3WKEA 1O2DA 2I99A 1EGVB 2QW1A 1LNQA 5BSVA 2Y0CA 4TV9A 4X5OA 3PYMA 4UNIA 4DSUA 1L7XA 2H9AA 3KG2A 1Y7LA 4TVBA 1OREA 3LIPA 3VPSA 1C9YA 2GEBA 3NI2A 3S2GA 4B3MB 4DDTA 3AONB 3DZGA 3PQ6A 4A0SA 4QLAA 4Z49A 3WTBA 3U1TA 3ZU2A 1U1IA 2I3GA 3GVIA 4BCCA 4QTUB 4ZYXA 1OWNA 5C37A 4TYNA 2AJBA 5GIPE 4ZHQF 2HN9A 2DTDA 1NMYA 1N0WA 3MD0A 3QIAA 2B8TA 3ZDAA 4Q1EA 2D7DA 2C04A 4DR6B 3ETDA 2K2WA 3EMDA 4QUKA 3U9LA 2RE8A 4BUZA 2PZ8A 1CS4C 2FKNA 4ND6A 2VHEA 3JD1A 2Y93A 5K3EA 1MX1A 3OCCA 1UK8A 3MVEA 2H7YA 4D81A 3PC6A 1PGPA 1DKRA 4UVHA 3DQZA 4KQFA 4UBJA 1Q0PA 4ACAA 3IAS1 4BLUA 1CU1A 1F17A 5TMPA 1IL0A 4ZVNA 2P7HA 3HLKA 2TRSB 1TF2A 3OEEA 4RS4A 4KCGA 3T0FA 4BQEA 2QRZA 1RAAA 1WABA 3I1YA 4EJMA 3MJDA 1QUEA 2J7PD 3KZ1E 1CR0A 1G8GA 3I09A 1P8AA 2QSJA 3OFNA 4LPSA 3NUZA 4MRSA 4WLEA 3K96A 1NKSA 1Z4NA 4XPZA 3GIWA 1TZJA 2EFJA 4RULA 3TL2A 3K0CA 4NARA 1QCYA 3SMQA 3MMPA 4Q9JA 2ZBPA 3PI6A 1XF9A 4J07A 3KVNA 2JD1A 4EIWA 3SIWA 5D8DA 1U2DA 4LZJA 2QUZA 3FYUA 3SFVA 3VYVA 1E1MA 4EUEA 4B3SB 3BXZA 1Z6ZA 4MWZA 4TWAA 2GI4A 2C3PA 4N6NA 4II2A 5L4NA 1DIAA 3QXJA 4HB3A 2SKCA 1G0OA 2PSEA 3G0IA 2J0EA 4NATA 4ZI5A 4ZI7F 3D6HA 1CUCA 5BWLA 4OH7A 1M1YB 1ZC3A 1ZK2A 1GFSA 2CWWA 3BGVA 3B3QA 3C3DA 3EN0A 3O4IA 3OFVA 4X1IB 3TW6A 3L82B 2FUG6 5CFRA 4KI7A 3RO7A 4YCBA 1DIHA 1R4AA 2BM0A 5HUJA 3HACA 1YCFA 2YXBA 2JS7A 1B8OA 4HGNA 1MEOA 4BPRA 4CU2A 4EHDA 1L4GA 1VHQA 2BCJQ 1M7GA 5L6LB 2PWZA 1GU0A 5CM8B 4AG5A 2YDXA 3KKEA 3GUUA 1ZUIA 1ZOIA 2C1XA 3VZRA 1GZUA 1L7QA 2OO3A 3REQB 3W5BA 4WHMA 1LPMA 3QPCA 2WV7A 3PSAA 4MXDA 4D7AA 1NONA 2WG2A 5IAGA 1VJDA 4ZT2A 4K9NA 1MO3A 2CE7A 4WFKA 2AI3A 5E95A 4CZ2A 3LVFO 4C6TA 1W44A 4E70A 4J0FA 4YQFA 2WI8A 2AMFA 3RRYA 3BRQA 4GPTA 1YACA 4QXRA 1T2EA 1NVWQ 5BNFA 4YS6A 4R51A 4WECA 4DR3B 3ESYA 1H5UA 4YRDA 2UVPA 1N5MA 2EG9A 2HMVA 4NICA 4ZPXA 5AM3A 4FEEA 5AHWA 2DEUA 2V0GA 3KXKA 1O6ZA 5CCBA 4KAXA 3HA3A 1OH7A 1N2OA 2B34A 2VJKA 1PFUA 4J29A 4E08A 1WZIA 3UF0A 2DR2A 3VHQA 2C54A 2E55A 5C35A 2HCFA 2C7VA 4MK4A 5DX1A 1PR9A 5ADWA 4QJIA 1GZ7A 2F64A 2JL1A 5E7IA 3V7FA 4NECA 4JODA 4PWZA 5TIIA 1R37A 2QTAA 4FOPA 4QXAA 5FA8A 3UPTA 3M3HA 3L0YA 2CHFA 2QE6A 1UZMA 3MBIA 2GD0A 1IBLB 3TEJA 1USGA 1V47A 3X1JA 3ZU4A 4PE5B 3V00A 1SXPA 1U28A 4OM7A 1U2GC 2ZXUA 3H1GA 5ED0A 4RDXA 4NFHA 1TZMA 4J0QA 3JWPA 2PQ2A 1YHNA 5LL6P 4YQEA 5K0EA 4AFNA 4OYRA 2OVFA 1JFVA 5E1OA 5B6JA 2PIAA 2BFMA 4JT8A 1JNXX 4FCVA 1A5SB 1WA5A 4HJXA 4R31A 1CY1A 3DVAB 4RSRA 3HCNA 4CF7A 2G1UA 4XW2A 4F8JA 1Y8CA 4X1KB 1EGHA 4KPYA 3PUXA 1KR5A 4PLPA 3CU5A 4XARA 4WA7A 3ZBQA 1WQ1R 4TV8A 3HV0A 3QNWA 4V0NA 1SVIA 1YGPA 1HLFA 5K3AA 3VR2D 1MPTA 3HVRA 4KGDA 3SEZA 5HZHA 3N8DA 1AUQA 1L4UA 1SVWA 3AOGA 3BILA 3FNIA 4FDTA 4OFWA 5FI5A 2FW8A 1P29A 3CM0A 4A0RA 4OP1A 3VOTA 3U16A 2P0AA 4NYMR 1TO2E 1C7QA 1G5FA 1TM2A 3B70A 4RL6A 3TW0A 5BWOA 2DP4E 3VDRA 4BXOA 2I3DA 3OH8A 3WYCA 2ZLBA 4OAOA 2XGJA 3NAZA 1P0QA 2R5FA 5LSAA 3OMXA 1YQQA 4IJ6A 2UZ1A 4FFPA 2IYQA 4YROA 5HWSA 1VG1A 4UCQA 1GRQA 4QJ4A 4C4XA 1X80A 1ZC4A 2I7XA 3S2SA 1WXHA 3IPAA 4NHOA 3I62A 2GOYA 4FR2A 3ADCA 4DR5B 2G25A 3C6ZA 4A27A 4AS3A 2OEPA 3HC7A 3N6RA 1F0NA 1U1CA 1UJMA 5JFTA 1KO8A 1TRHA 2BELA 2QTZA 1NJSA 3IA7A 4BFLA 4Y9DA 5HGJA 3JALB 5F12A 1IWBB 3JQPA 1XQ6A 2FE1A 3WGYA 3ECAA 1M34A 4QSHA 4JIGA 4KRXA 1WG8A 4EP1A 5C7YA 4QUDA 2NU9A 1TDJA 1EQUA 3R0QA 4R41A 4C4PA 5EJAA 3DZKA 4R8SA 2WLTA 1B3BA 4LC0A 3L0ZA 3WJAA 3D7LA 4XOIA 5JTUA 5AWFC 1UDBA 2DWQA 3BFPA 4IKPA 1UCFA 3KDPA 2B30A 2DG2A 4TLEA 5C0OE 2WHRA 5CXSA 4BJ6A 1XMPA 3AESA 3LOPA 2HF9A 1CJTC 3E84A 1SM4A 2VHZA 3DCJA 2Q2OA 1GTJ1 4BGUA 4Z8YA 2A35A 2BGMA 3OF3A 4C7XA 1DSSG 1KEVA 3KSRA 5F76A 3ETLA 4AN4A 4PVDA 1IAVA 2J9YB 3BWCA 4CE6A 4OBXA 2Q4TA 1CG6A 2HRDA 4CR8A 3PA6A 5CD9A 2JLVA 2BJHA 3GGSA 1C9EA 1KI8A 2G80A 2J4FA 2P4SA 3R6LA 5JQGB 2XWPA 4REQA 4ZQHA 1MOQA 1R1DA 2WAXA 3KB6A 4X44A 4XJTA 4GWGA 2IXTA 2X0DA 4CGYA 4DIUA 2PK3A 5JRDS 3KALA 4IOLA 2WSSA 4Q00A 4Q15A 1JSRA 4BZWA 2ZRHA 1BNCA 4EQ6B 1PDOA 3U81A 1E79D 2ZSHA 1YCHA 4R1OA 1IY0A 1T8UA 2OMEA 4DJAA 3A6HA 4B34A 3FVTA 1ZGCA 2D0OB 4FU0A 3DVAA 4OHFA 3PPIA 4PFSA 2I62A 5K3CA 3IBGA 3DULA 4LDPA 4B7ZA 5K4AA 1IQRA 1K06A 1QQ6A 5JBQA 5JJBA 1G5HA 1G4UR 1M0EA 2VPXA 2Y1CA 1TD9A 4EAAA 2W71A 3EXHB 5L3VA 2ZRKA 3UOAB 1ZJ5A 2XBUA 5ETJA 1RQRA 1T8SA 2PXCA 2IW1A 1XXLA 5ALWA 5F1PA 5IAEA 5LLSA 2SICE 2POCA 1BGVA 4KI0A 4HDMA 2VP4A 2HLDD 1YRHA 5DHSA 3ZJ4A 2WAAA 3STYA 4YRJA 2VSNA 1RQ2A 4Q6BA 2VRNA 3QLUA 5LQKA 5AXBA 1TE2A 5F7OA 2AMJA 4F71A 1G38A 2QAIA 3BE8A 3EH1A 1YA6A 4BFWA 2UYGA 6AT1A 3OWOA 4MICA 4HUTA 1P2TA 4KNYA 3AEKB 5AKJA 2HHHB 3B53X 3T7EA 1KJZA 2DHRA 3VMFA 3PJDA 3QBTA 4M60A 4UEQA 3NB0A 4NDNE 4JQYA 3D8NA 5D87A 2JW5A 2V8BA 4J0IA 4Q0MA 2PGAA 1I3MA 3GUYA 3MJHA 3BK7A 3L7YA 1TJYA 2INGX 1VP9A 4G09A 4EJ6A 1UFQA 1VMDA 2ZK7A 3BSWA 1YFJA 3HCEA 1IZYA 1CKEA 3JALA 3F2VA 4Q16A 1II9A 1AF7A 1KJQA 4L0MA 4IUYA 1RKVA 4TYYA 2OWDA 2FZVA 5EL0A 3WRYA 5CEFA 4F6RB 1SHTX 4MDEA 1DHTA 1MU0A 1RMYA 3QXSA 1Y6JA 1Q44A 1Z8NA 4KLRA 3M3DA 4NVRA 3LOQA 3EQ8A 2DHEA 5T7BA 5KEIA 4M8IA 2Z5FA 1MIOB 5DCYA 2IPNA 3H05A 3R7WA 4I9UA 2QZPA 1M2HA 2YYSA 3MT9A 2ZM5A 4PBSA 5E7MA 4RNCA 3RUHA 4K9PA 1D2MA 5TGZA 3EDOA 3IGFA 3WB1A 4ZVKA 3UIEA 1TM3E 1ZUD1 2FUEA 2VZEA 3ZNOA 3DE7X 4JL6A 4MB6A 2WTXA 2AV6A 1OASA 2F9MA 2PSSA 2P77A 3H1PA 4AD8A 1CNMA 4ALIA 5A05A 2XNHA 2FXIA 4HI0E 4L76A 4DNFA 2B21A 3A6EA 4D41A 5A3QA 4DM3A 1FFSA 4D45A 5AYVA 4IG9A 2OYRA 1BVYF 1VCHA 2VKTA 1W4ZA 3F8WA 4O25A 2C9BA 3ASVA 1UBUS 4FMCB 4LJ9A 1LY1A 2IIPA 3NXSA 1DMRA 5AK4A 5EP3A 4CEJA 3QU4A 1T6XA 3ENNA 4D82A 3EPPA 4YAOA 3SM9A 4B35A 1SUBA 1W29A 3WGNA 3F71A 2CEKA 3DLBA 2PT7A 2VBFA 5JANA 3CX6A 4FMDF 2H1OA 1GKIA 2VWPA 3A28A 5C5CA 2CKDA 3AVWA 1ADYA 3VU9A 1O96B 2P9JA 1R0LA 2DMRA 2OFXA 3PENA 3QRWA 4S1TA 4WI1A 4CLDA 3GBSA 2FPGB 5DWDA 1SXJD 4NCAA 4GZ6A 5EP1A 4E5KA 4ZVVA 1TB4A 4Q21A 3ZCXA 4XAQA 1YVRA 3F1LA 3UBMA 1SBHA 3M1YA 3KE9A 3VOSA 4LFAB 1P5JA 1EAMA 1KIAA 4WKPA 2XEXA 4GKBA 4DAOA 3I92A 4YP0A 4M76B 5REQB 2JLQA 4WXMA 4P3KA 3EVNA 2RI0A 3EXAA 4G84A 5CCXA 2DLNA 4MS4A 1ZD3A 5I8ZA 2HA5A 3CG0A 2GWHA 3UW1A 1WDTA 1NX6A 2MR5A 2CWDA 4BP8A 2BJVA 221PA 1EE1A 3QEMB 4AJIA 4EUNA 2CFOA 4L9RA 3K0SA 1DDOA 1M2KA 2O4UX 2QE7A 4MGIR 4XWTA 4IQ8A 1FXWF 1IN4A 2IYSA 5ALRA 4I8XA 5B2ZA 2HQ1A 1USVA 2CJXA 4Q66C 3DKVA 5FJIA 3AEKA 8OHMA 4FJ0A 1RIFA 3NQ41 4FOTA 1GUFA 2KMLA 3DT6A 3RS8A 5CEJA 1NZJA 2QXYA 1QTNA 1HDZA 3DV2A 2XOXA 3M6MD 1W96A 1T35A 2X8BA 4TMVA 3D59A 4N6GA 4UM7A 4DMKA 3U6KA 1DGQA 5AVJA 2YCBA 1VPEA 2JFHA 1ENYA 3WYGA 3W5AA 5A4JA 2AEMA 3NPMA 4D56A 4YRLA 1KJWA 2BI8A 1QZUA 1SHLA 3ZV4A 3B3GA 1U02A 3FDJA 5DI3B 4BN5A 1M1UA 4R2JA 4F6RA 3FWPA 3B12A 5I8WA 3VAZA 1QQTA 5K09A 4OX9Y 2WWFA 4CTOA 5BSEA 3VDXA 4UPEA 1BE1A 1QG6A 3PFFA 1E4EB 4ESHA 3NRJA 1LS1A 5J2TB 4HWSA 1W48A 1CRPA 1ORIA 2BM1A 4XSHA 4LBVA 3NG1A 5FR2A 1J20A 2QM0A 4KIJA 4UNNA 4MYDA 3WZ2A 2JAQA 2C20A 3KEFA 4LVNA 5JAQA 4BX9A 2VN8A 2WUVA 2VJAA 4GP6A 1RI4A 2DKOA 4RETA 2V97A 3VAAA 4LY3A 3JYOA 4PTLA 4TSRA 4YLEA 3OQNA 2AI2A 2I2BA 1ZOOA 3PFWO 5SICE 4GSKA 2V4UA 2V7UA 2NU7A 2O07A 4MW0A 3C1OA 1DO2A 2E49A 4ON9A 4UCFA 3ZWWA 3BH6A 2A4MA 3INTA 1NVGA 5BRAA 5AK5A 3T7AA 3U37A 1NW7A 1U4OA 4JK3A 4TYWA 1KK2A 4S05A 2X5XA 1QLJA 5H81A 4TN1A 3CKKA 3LO8A 4CQNA 5AHKA 4RTQA 1T2VA 3ESAA 1W4LA 4WAUA 1N1EA 1IVNA 1XDGA 3NDPA 3KD2A 5CA0B 4L73A 2VDVE 2MR6A 3AP2A 3IJEB 3UJCA 3WYAA 4YT5A 2QPOA 3G7NA 2CFIA 1QH9A 4ALLA 4JC8A 1DC3A 3K5IA 2XA1A 4UU7A 4LSWA 4B7CA 4JJ7A 4F97A 1LPAB 1O96A 2FF5A 3HA2A 4X93A 3S40A 4DIEA 3E9YA 3JQBA 3OLYA 4JI7B 1QOQB 1FQJA 3IMFA 1HEUA 3OVMA 4ZVUA 1ISHA 4HQKA 4W5HA 3H04A 2GX6A 4TKMA 1JJVA 3IDFA 4LX0A 2ZXEA 4IH4A 3LLSA 3SF8B 4IGIA 2GBLC 3DTNA 3DFMA 2O8CA 3DP7A 4ZMRA 5EJ8A 3I3OA 2JAWA 2IVZA 5F1OA 5E4YA 2P30A 1OA0A 2PTHA 5DK4A 3ELDA 2H2WA 5K0GA 3WGTA 3BMOB 1BE6A 1JHQA 2OKGA 4I6EA 4XDGA 1W6RA 1VC2A 5F4BA 1QGAA 4BB9A 4MEAA 1PFVA 1ZM3A 2DH5A 2GZ2A 2IKQA 3C5HA 4ZCSA 3W2FA 5GV8A 1YB7A 3UMBA 5K99A 1EKXA 2AJTA 2IYNA 3AFGA 4PS1A 3HDJA 4LGYA 2R6ZA 3U4GA 1BXRA 2AL7A 4JB8A 4KLZA 3AKYA 4N54A 1CUGA 1C30B 3O75A 4YRPA 4LJAA 5HBGA 1O0BA 3GVHA 4TTQA 4COKA 2OORC 3CYFA 1DTSA 2CW5A 4KSYA 1KI9A 2A9VA 2P6NA 4G0OA 4DCVA 2RIRA 4G8CA 1YDEA 4FC7A 4YP9A 5JCJA 1H6DA 3GEHA 4I19A 4IIUA 4JOSA 5JLJA 2XUOA 3SQLA 1N6IA 3OT5A 1SHUX 1GG2A 3IS3A 1L5QA 3IL2A 2J6CA 2UZ0A 3UFXA 1XQYA 1Q57A 2KWIA 3EVZA 4PEVA 1UWVA 3B85A 5DI3A 3UJ8A 3KXIA 3LKDA 4E13A 1VIDA 2H29A 2Q1XA 3GI1A 4NJOA 4Y9TA 5AKLA 1JDBC 1C4OA 2J5QA 5J2TA 5F23A 3ZD9A 4AKSA 5DX0A 1YMVA 4HNHA 5KNCH 4QA9A 2BMFA 3IDAA 3PHCA 1SPXA 1OTYA 3TTWA 4C3OB 3HK2A 4RKQA 1YRBA 5LMZA 1P2BA 4DDMA 2W2NA 3ORQA 4G9GA 1ZBDA 2OHOA 5L7WA 2C9ZA 1K27A 2P2LA 1XQ1A 1ZGHA 1E9BA 4P2BA 1N4AA 2YWGA 2H11A 4YGXB 4EKNB 1M3SA 1TX4B 1U2GA 1QRSA 4DMGA 1PVOA 3A1CA 1TTPB 4HRAA 2UVQA 3DG9A 2I1QA 4TUYF 1L3CA 3E2IA 3MGBA 1LPNA 2IUTA 3KDAA 4MVWA 3RVDA 4L02A 1TVCA 4RLQA 2F7SA 1OD6A 1Q7BA 2ZW9A 1PQYA 1GCUA 2C4TA 1DTWA 5JD3A 2CHGA 2JHGA 3PC7A 2NSJA 1ZWKA 4WZZA 5BYBA 3GJ7A 3ZYCA 3ROFA 1S3FA 3KJEA 1Q7CA 3QA9A 3RFUA 3COJA 4JYZA 5GM2A 5T4HA 3CZAA 2FW9A 3JQ6A 4YMWA 3UGKA 2H2DA 4UTVA 2QHXA 1T3SA 2H1IA 3HMQA 3QNMA 4H16A 1XHEA 3OF2A 3WK5A 4RF2A 1M8FA 3ZTTA 4WVLA 5BOSB 1JWBB 1ST3A 5I7AA 2EQAA 4FHEA 4ZEVA 2W7TA 4HDSB 4JI8B 3H1FA 4P86A 3NP9A 3ZI7A 5H82A 2FFRA 2DPGA 4D9IA 5KYGA 2AX4A 2Z95A 4QO8A 4YP7A 1OY1A 4ZHQB 1CR2A 5DNYB 4FFOA 1QQAA 4QDZA 5DHTA 1BGWA 2VHWA 2W98A 3RW9A 2FXVA 1TFRA 5M3BA 4TQUS 3BMOA 1WZCA 4QXMA 1VKJA 2Y8EA 4D0RA 3B8HA 5LXTA 2PUAA 1ZL0A 2HF2A 5HTOA 3ZDBA 4DA8A 3ET4A 2JRLA 3DL2A 4N40A 3TKAA 4BQFA 1R15A 2QJOA 3LWDA 2YTZA 4NKRA 3OQPA 3T7CA 4E4YA 4G0UA 2GXSA 4PX2A 1HA3A 1E7YA 1I3LA 4NK5A 5LR6A 4Z0PA 1C8KA 1GGHA 1A5TA 1X0XA 2G8NA 4I6GA 3GN2A 1CUBA 1SBNE 1BROA 3N70A 1C30A 2QOEA 3AH8A 1LX6A 1HZJA 2RH4A 3NALA 4HGPA 5CYFA 2XSZA 4CCYA 4D79A 4ROTA 2ZUVA 4FJ2A 3E8SA 3H65A 4TWRA 4BP9A 1I4WA 1EJ2A 2HWUA 3DM9B 2XOKD 4GXNA 4OUKX 3HS3A 4OXYA 2IEGA 1L9XA 3DMFA 2PWBA 3RDPA 3TK1A 3FCOA 4YMTA 5BT8A 1AKWA 1HORA 2AW3A 2D1TA 2XNDA 5CYPA 4Z7JA 4BX8A 3TAUA 3UB3A 3AU8A 5JOQA 3KXLA 2V54A 1DPGA 1FDTA 3G2LA 1FFBA 1GGVA 1R5BA 1DAGA 1DBIA 4L28A 4US0R 4DMRA 4BXOB 1TEHA 2ZIFA 1E0KA 1NNEA 4HOYA 1GNQA 2FE4A 3CX4A 2G88A 3Q8WA 5DLEA 5B4TA 1P9RA 2IHZA 2AFRA 4PFQA 1YJ5A 5HOQA 1BRTA 2AW5A 3FPFA 4EECA 1BE8A 5BVGB 3AKEA 3MRSA 3HKDA 1X1DA 5BMVF 3WKDA 2CNWD 3L6DA 3ZHRA 1EFAA 4BYGA 3Q2OA 2JLUA 3GA5A 1IIBA 2QX9A 5BW6B 5L3SB 1XLWA 2CCJA 3AR8A 3GCXA 2O50A 3TBKA 1G291 1F38A 1I6KA 3G2NA 4GSYA 1Y3BE 5FPPA 3WRWA 3HG7A 2B6HA 2VNAA 3B6IA 4RMJA 4X71A 1TU4A 1EE2A 3RC8A 2NO5A 1IEQA 2AA3A 3CCFA 3JWJA 2BGTA 4NZ9A 1W4CA 2O3TA 1A4XA 4CL8A 4D3DA 1XB2A 4EKEA 1EEHA 2RHTA 4O2LA 3VDQA 1KDRA 4KV7A 3RTAA 2OV1A 4HB0A 1Q6YA 2C88A 2VC2B 5BOSA 4LZNA 4AS2A 1JHRA 3QKWA 1EWQA 3L0BA 5EPOA 3H4TA 4DYVA 2RGUA 4M88A 3I04M 4HJRA 3OBBA 4HDSA 3RLFA 3T6KA 1NUHA 3A4VA 1GHTA 2RGBA 3R2JA 1KEEA 5DIZA 2IW3A 3OPQA 4HFRA 2DF8A 1L3IA 2VSQA 4UVGA 1AKNA 1U9CA 1X7HA 2E7ZA 3JWIA 3W4KA 2CSXA 5DM1A 4RPGA 4J2OA 1Z62A 3ASZA 1GGKA 4BFUA 4D3XA 4OQZA 1I7PA 1QS0B 1BMTA 2GTPA 4O4IB 2ENUA 4YJKA 5CB0A 5B58T 1Q2UA 2EFHB 1RW4A 2I7DA 2E1PA 1D0SA 1HDEA 3UAGA 4Q4JA 4JHXA 4ITUA 5BPFA 3M6IA 1ACLA 4RPCA 1QMGA 1KPHA 4NCKA 2OQIA 5HK8A 3ZHTA 1PW7A 3KQMA 4YMSA 2HJWA 4F2HA 4JYAB 5G3ZA 4P7GA 1ZOPA 3QFSA 3QELB 4DR4B 4CMKA 4HAOA 4IF4A 1Z22A 4RK5A 1UQTA 1LFDB 3JVDA 5EXSA 2X9LA 4OHZA 3CXUA 1QE3A 1R0YA 3FLAA 1XZ8A 5AHRA 1BU8A 1CDDA 4PO1A 4BVJA 1PT7A 3F96A 4E5PA 4H15A 1CEEA 1ZM7A 1T5OA 1SELA 1N5IA 2APJA 1HEYA 1KGDA 5BMOA 1KS2A 3PQDA 2PRKA 3SS7X 3WK8A 2KI5A 2OBXA 3CGWA 4C4TA 4YMHA 1US8B 1VI5A 5JRZA 1YDMA 3AM1A 3MHTA 1EIZA 3LKBA 3RIYA 1E6CA 3UJ6A 2FEWB 2IBMA 4I5EA 3DAGA 4N1AA 2C59A 1P75A 3KOWA 3OHSX 3JRWA 2GR9A 3AY0A 3PIDA 3U9SA 4DJJA 1T4CB 1Z68A 5B3KA 4Q48A 1IDOA 2O2DA 3BDIA 5BVGA 5A0TA 3COVA 3TRIA 1G5IA 2G09A 3FCXA 4E46A 1OXBB 4B3HA 3VJRA 3HB9A 1DJMA 2VDKB 1K5DA 4K9LA 1UM8A 2R8BA 4D6YA 2OHHA 2FA9A 2X0RA 4ZC8A 3RANA 2ZE7A 1T6NA 2HH9A 4QQNA 2JI8A 3F9RA 2XE6A 1QFYA 4K3UA 3CCBA 3V2HA 3DZDA 3PIIA 2B4YA 1AHPA 1IEVA 1Z13A 4RSGA 4H1HA 4BNMA 3FH0A 2JBAB 4HC4A 4H7IA 3O0DA 3SC4A 4AKGA 3HUTA 3K09A 4A2PA 1NE7A 2FN4A 3DFIA 3F6BX 4FN5A 3L8ZA 4LEIA 2ZYSA 2VUIB 1BQ3A 2C92A 2DQZA 3N3AC 4JZKA 2HHJA 1HDGO 4QWMA 2PUVA 4LC9A 4KPFC 4BVKA 1UM9B 4MMYB 4EVRA 3QSYA 3BULA 4Q4HB 3WXMA 2IH4A 4Y2QA 2JZNA 1H85A 2AR9A 2PRYA 3V8PA 1NRJB 1OJ7A 1QVWA 3GNLA 1TAGA 3SXJA 2PGDA 3G7UA 2GO7A 5C51B 4P4UA 3ADOA 4U6SA 4UTZA 3EZGA 4UCWA 2HNAA 4W9RA 2FMTA 1C1XB 3AZPA 4GIBA 5TDHA 4PLYA 2C8VA 1GNLA 1DEHA 4IQGA 3OCJA 2GYUA 5E2BA 3ZZNA 1MO6A 1DBSA 5DFAA 1EXMA 2QKYA 4RIEA 3UOWA 1AURA 4G5OA 1SOMA 3B82A 3C3XA 3V1YA 3KLNA 2GEDA 4GRAA 3NWJA 4MVXA 6Q21A 1J4AA 3I9NA 3F7OA 3H9CA 5SY4A 1Y34E 2OXEA 3WL6A 5KREA 5JNSA 4RGBA 3GK3A 4DWVA 1SKAA 4LSMA 3QUTA 4I1RA 3L1VA 1Z7YA 1YVPA 1Z83A 3BE4A 3COSA 1UDCA 2X0JA 3W3AD 1IVSA 5JBNA 2P2YA 3M70A 3LRTA 1J2TA 3B1XA 1E2JA 2M6LA 2EDCA 3CNQS 3QFCA 1I36A 4R2WA 1EI9A 1OLUA 1QQ5A 2X9VA 3DVLA 4CT0A 2QYTA 4KQKA 3A6ZA 4HQRA 1JDBB 1RJ9A 2HI0A 2HSDA 4Z4EA 3EB9A 3S1AB 5EQTA 5EUQB 3GY0A 4JL8A 3T3HA 4N49A 4D8TA 4WBNB 3H5WA 3WQBA 2FPMA 3UMRA 2EV9A 3TQSA 2H3HA 4EJFA 3QYFA 4UTOA 3ZWOA 5ALUA 1NI4B 3D7RA 2P9ZA 1WX1A 4QHSA 4G4IA 3PU6A 4G37A 4PHGA 3HI6A 1M2OB 3D54D 4XQCA 2PKEA 1US8A 1QOZA 2ZBEA 4FGUA 3ZHQA 4EYSA 3L4KA 3IEVA 1XZQA 2JLSA 1E3TA 2KSQA 1AHHA 1MT0A 1I2CA 3NEPX 1Q83A 4IIHA 2O1EA 1WXGA 2OGSA 4P53A 4JEHA 1YNSA 2HM7A 3H97A 3UA3A 2J3LA 3I12A 1IZ9A 3GJ6A 5TT1A 1ULZA 2ZAYA 2GZDA 5H68A 4M2LA 3JYPA 1M9NA 4ZGWA 1JI3A 3DZHA 3U3XA 1A8PA 4Y67A 1C0EA 2Z4SA 1DV1A 1E1NA 1O97D 3EODA 3ZHYA 1TUBB 4A26A 3JPWA 4LF4B 2C61A 4TGLA 3TW8A 2VSOA 4D8VA 1W36D 1UH5A 3HV2A 2CL5A 5DTIA 4MPJA 1J0XO 1IAQA 3OIGA 5DTRA 5E4JA 2ZB8A 4CR6A 1E3QA 1PX2A 1XTJA 2OXFA 4QAJA 3A9RA 4FSXA 1X9GA 2YXPX 2W2KA 2GBLA 3RHZA 3D4BA 4WEOA 4KACA 1Q7RA 1JFFA 3SXUB 2EW2A 5L4SA 5SV2A 3KB8A 5ITZA 4Q4HA 4RTSA 1PS8A 5L53A 3EGDB 3TLZA 4FB5A 1ADFA 5CFLA 2YXDA 2RI1A 3P9QA 5L8VA 1SCUA 5BR1A 2NPOA 2R6R1 3S3TA 5JC1A 4DV1B 2B37A 4N8DA 4W5WA 4F4UA 2A5JA 2ODPA 2D54A 2WYIA 1N5KA 1R9GA 5EIEA 3ZJVA 2PL1A 2P8SA 2YJZA 1C1XA 1V26A 4PZYA 4Q4AB 3PSHA 4KE7A 4LW8A 4AF8A 2HJRA 1YQGA 1NF3A 2ERXA 3QF4B 1PE0A 4MHOA 5JMPA 4M9QA 3JZDA 1H2WA 4UM9B 1WVIA 5J59A 2OORA 5F73A 1YIOA 3LC2O 1UDRA 3MT7A 2WWRA 2PMDA 3QXXA 2R6DA 3RSHA 3SS9X 4DJFC 4ZRNA 2NU6A 1PDVA 1CW2B 2IHUA 2ZCUA 3BRWD 3ZBUA 4JUBA 1GILA