4RMIA

Human sirt2 in complex with sirreal1 and ac-lys-otc peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
300
structure length
278
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Selective Sirt2 inhibition by ligand-induced rearrangement of the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inbititor
total genus 91
structure length 278
sequence length 300
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4rmiA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4rmiA01
3JR3A 2AG1A 2NYRA 3U31A 4ZZIA 2JI8A 4IAOA 4K9OA 4RMGA 4F56A 2VK1A 4JU8A 1M2NA 5FYQA 4UTRA 5DGTA 2FSVC 1JSCA 1O97D 5DEIA 5MFZA 2A1UA 4Y6LA 4V1CI 1J8FA 4O8ZA 5K2OA 4JUDX 5EJ6A 4UU8A 1OZGA 1PT9A 4K9LA 1M2HA 4GM1A 2Q5OA 4BVBA 5EJ8A 2H2HA 4QQ8A 3F6EX 1ICIA 2Q5JA 4QPZA 2Q28A 1POXA 5MGNA 2H59A 1Q1AA 1OZFA 4HDAA 4JUAA 2H2IA 1YTLA 2QQGA 5D7NA 2Q27A 3EA4A 5EJMA 4JUCA 2OORC 4KGDA 1PNQA 4K9PA 4V1CA 4RMJA 1POWA 1SZCA 1YC5A 2DJIA 1PI3A 4R8MA 2WVHA 1Y9DA 2EZTA 3EYAA 2H2DA 2JI9A 4JT8A 4RMIA 2JI7A 3PDHA 4JT9A 4J16C 1S5PA 3CLRD 4BVHA 1M2GA 3HWWA 4FEEA 4MQ5A 2WVAA 3JWPA 1T9AA 3RIYA 4JUBA 5MF6A 2C31A 5AHKA 3FLMA 2H4HA 1U2DC 1QPBA 4UTNA 3CLUD 3GLRA 3GLSA 2JLAA 1OVMA 1MCZA 4K9MA 4BN5A 3ZG6A 4GG1A 4BVFA 4FEGA 4MPJA 4J1TC 4FZ3A 2JI6A 4RMHA 3U3DA 4K9KA 2VBFA 4GM0A 3PKJA 4RJIA 3ZGVA 5MFPA 2VK8A 4BV3A 1DJLA 2IHVA 4RJKA 4QELA 3HWX1 3D81A 3ZGOA 1XLTC 5K3SA 1T9CA 4UTVA 4BN4A 1PO7A 1E3TA 5K6TA 5FEMA 2FWNA 1M2KA 2W93A 4IF6A 1UPCA 2VBIA 2VBGA 1U2GC 1N0HA 2PGNA 5BWOA 2OD7A 4C78A 5EJ7A 5K6RA 4L2IA 4C7BA 1PYDA 1YI1A 1PTJC 4Q9DA 1MA3A 1U31A 2BRUC 3D7KA 4GPEA 4V1CB 2JLCA 1UPBA 2FRDC 2PGOA 5EJ4A 5EJAA 4FVTA 1YBHA 5EJ5A 2OD2A 2H4JA 1U28C 1HZZC 4Y6OA 4GM4A 4HD8A 4MZXA 3CLSD 2QQFA 2UZ1A 2FR8C 1D4OA 3D4BA 4UUBA 2Q5LA 4BV2A 3LQ1A 5EJ9A 2JIBA 3IAEA 2H2GA 5BWLA 2AG0A 4G1CA 3PKIA 1SZDA 3FZNA 4UTXA 2V3WA 4MPRA 2H2FA 2IHTA 3OE1A 4L3OA 2EZUA 1YNOA 4UU7A 3F6BX 4COKA 4BVEA 4RJJA 3IAFA 3GLTA 4X3PA 2VK4A 1EFPA 3GLUA 1PVDA 2EZ4A 4JU9A 3RIGA 5BWNA 3EY9A 1PNOA 2Q29A 4JUFA 4KXQA 4ZP1A 2HJHA 2A1TR 2B4YA 4JSRA 2X7JA 4BVGA 1T9BA 2IHUA 1YC2A 4KPUA 2OO5C 4I5IA 2H4FA 4MPPA 4BUZA 2EZ9A 2VJYA 1O96B 4X3OA 1T9DA 1BFDA 1Z8NA 1NM5C 4UUAA 2PANA 4D5GA 4Y6QA 4GP9A 1V5EA 3CF4G 2FN3A 1YI0A 1YHYA 2WVGA 4K9NA 1Q14A 1S7GA 1YHZA 1ZPDA 4D5EA 4TWJA 1EFVA 3K35A 1V5FA 1V5GA 5DGDA 1Q17A 1UPAA 1OZHA 2NXWA 4F4UA 1Q6ZA 4K9QA 3CLTD 4UTZA 2Q5QA 2UZ1B 5IMSA 3FSJX 4IG9A 4JD5A 2EZ8A 2OD9A 1M2JA 3E9YA 4TWIA
chains in the Genus database with same CATH superfamily
4MWCA 1P5JA 2BLNA 2HPAA 3NHPA 3VTZA 4KVFA 1I13A 3MK31 1R10A 2AXQA 2NQ8A 4NBNA 5TGZA 4LF7B 3MFYA 3ZWVA 1VPVA 5SYAA 1DJQA 3NWOA 4DLVA 1KZHA 3EHEA 3AI7A 2XITA 4GYKA 2ZSDA 3GAFA 3TQQA 1YWGO 2IX9A 2MMCA 3EASA 4I9FA 5AW0A 3R8FA 5FTNA 2A57A 1Q57A 2ZRBA 2H5IA 4GIBA 4Q16A 2GRUA 4BEJA 4BQRA 4CMCA 3W6NA 2BHTA 2J0UA 2WV9A 4EH1A 1UDCA 1X7XA 3OFJA 2FFHA 4I1RA 3WSVA 2WU4A 3LW8A 3KQSA 3NOVA 3QM1A 1QF6A 1F0KA 5P21A 3RAJA 1JA1A 4HWOA 1NWCA 3F8TA 2H1LA 2WYIA 2BP7B 1O95C 3OUZA 3EEBA 5HCNA 3SF8B 1HFEL 4Y6LA 1ZD4A 3IOYA 4AO7A 1QOZA 4D9NA 5KWIA 1C0PA 2BELA 5ALZA 4EHFA 5JCJD 2PO7A 4OI2A 4U02A 5IAOA 4NCAA 5IVHA 1TO2E 3TTVA 5FORA 5EUMA 1OR8A 4L0QA 2OO3A 3VU1A 1KI4A 1KH1A 3QPDA 2CNWD 1P2GA 2BM8A 2J9FB 5IG2A 1B4DA 2VA9A 4E7OA 3IJPA 2LKCA 3BB1A 1IK4A 1E4EB 3F6RA 3WMFA 2GCGA 1G8GA 4WW0A 1PJAA 3GPBA 1NATA 1PFGA 1TVKB 1JFFA 3DT6A 4ZCLA 4GI3A 4YMVA 4R69A 2VI5A 3EARA 4E6PA 3OIGA 1SA0B 4CIVA 3F0TA 3GGGA 4LNUA 3NB0A 1CVIA 4KWCA 4CF3A 1O94D 1Z2OX 2HMVA 1HDIA 3GG9A 1N5LA 4UC0A 4UM7A 5ENZA 5LYJA 4DWVA 5AVJA 5FL7A 2H59A 2XMQA 1WWKA 3A6KA 5GJVC 5ANRB 3IEVA 2CMHA 3PEFA 3ZW8A 3IC5A 1GCGA 1KAQA 3EVAA 4EHLA 3DVRX 1ZAYA 4C7VA 5K6RA 1QG2A 3V8MA 1BG6A 4CV2A 4CJXA 1KY5A 3CNNA 1E8NA 1BMDA 8MHTA 1DAGA 3DWIA 3COVA 3P0HA 1GOTA 1EHCA 3DO5A 4ND7A 4PG7A 3G9ZA 4RLQA 1TCAA 3BK1A 4UDXX 4CI0B 4EZEA 2ZBRA 3FCAA 1HGXA 2VNKA 4IINA 5CLJA 1CRQA 4LNAA 2X9QA 2REQB 1IN8A 2F8LA 5LMNB 3IDSA 1PFYA 1YJAA 3UT6A 4YV0A 3TG2A 3FSRA 2A33A 1ZNZA 2BGLA 3DBLB 3Q8XB 1PNQA 5CGZA 4B17A 2HWXA 3BRSA 4NAUA 4V1CA 3P9CA 4EL0A 1JG2A 3VHLB 4Q3OA 3EZ9A 1KOFA 4UFNA 1Z12A 3K2IA 3W3ZB 3KX2A 1KDPA 1D7AA 3RG2A 2QSJA 4C0XA 4D6XA 3EYAA 4NK5A 1R50A 4DIKA 4O2RA 4C0WA 1P9LA 2RARA 4H15A 1A8HA 4Y2UA 3RC8A 1FY2A 2OFOA 3T4EA 4U7FA 2A0KA 3I2KA 4CM8A 1G7SA 1Z0DA 4FDUA 3ROGA 4CMEC 5TR9A 1Q3HA 2WB2A 3DULA 2IS4A 4RVSA 3TZ6A 2QRMA 2GNAA 4DB2A 4Z2AA 4XCQA 4Y9SA 4GL4A 5L7WA 4GT1A 5I01A 4HPJB 4V0SA 2Q2VA 5CJPA 5K01A 4GYYA 1MUUA 1Z3CA 2JCBA 3RSOA 1S9DA 5LA6B 3ABZA 4JGIA 4RQAA 2EL7A 3CZ4A 3UGJA 1AO3A 1KBZA 1T8WA 5K8CA 1G5PA 5EMLA 1QHEA 4TT3D 3U6KA 1E96A 2AOWA 4J16A 4Q15A 3NHMA 3A2LA 1AKYA 1ATIA 2FE4A 4JT4A 4B3TB 1EXVA 5KNBA 3RCBA 3QUBA 2NVWA 3KKQA 3N70A 3SQNA 1ZLXA 4YRQA 5JAQA 4JP1A 5D3QA 4QQFA 2UVPB 3L77A 3MTEA 4IVRA 3TSWA 2O1XA 3ZIAD 1IH8A 1S2IA 1VDMA 3CNOA 5B6PA 1CV2A 1XVAA 2WSMA 4M1TA 5G1PA 1FIUA 4MP3A 4A36A 1KO8A 3VSAA 1JJBA 3Q85A 1P61B 2QBYA 4I6JA 1GQSA 3PC4A 4HNAB 4KE8A 4BX8A 4DE5A 2FMHA 3WE7A 4DV7B 4NZNA 4FUTA 4P7KA 3I6BA 1AN0A 3PNYA 1O0SA 1U0EA 1G20A 4OFZA 5B4UA 2HK9A 2VOEA 2P62A 3IODA 2O8CB 5EZ6B 2I4OA 3KJXA 3IT3A 3LYLA 1MIOB 2IXBA 3NWBA 3GRPA 4OH1A 3T7JA 3AWIA 1N33B 2R86A 5JO9A 2X8AA 2ZIZA 2ZULA 3U4DA 3MTIA 2GZRA 3STUA 4QVKA 4RTLA 1F8UA 4PZYA 1UMBA 1WIWA 1B6GA 2GEUA 3HHEA 4R1MA 2ZR8A 2G1KA 1R8JA 1RHRA 1PLLA 3BE5A 1EU1A 4IV0A 1NR5A 1YQDA 8GPBA 1HDOA 4PSAA 2X2EA 3WBFA 3PGJA 4MVJF 4FKZA 3SJAA 1NXVA 5EZQA 2F8MA 3ZYZA 5L3RA 4JI8B 2IODA 3NYQA 1JYEA 3RYCB 1RRKA 1Z2NX 1DV1A 4Q1BA 5E7IA 4NX2A 4UVIA 1MB9A 3DFZA 3L1JA 1MX5A 5G0WA 4WZBA 2WG2A 2WILA 1IEVA 3GGDA 1UAGA 2XJ4A 3GLHA 4BV3A 2ZTLA 2FN7A 4TLCA 4XFJA 4A0RA 1KI9A 2ZIEA 5KNDD 1WB9A 1NQXA 2NVBA 3VPBA 2F8SA 2K5UA 2Y1LA 4HNGA 4JB2A 4DA9A 3KFLA 4N3NA 2X0DA 4HUTA 4PGGA 2VJBA 3TNDA 4WXMA 1FX0B 4D80A 4QELA 3PXEA 2VR1A 3PHCA 4O29A 3IUBA 1XMOB 2JVKA 4LVNA 4YRRA 2L19A 1DG1G 1LW7A 1YGPA 5E95A 3D2CA 3C8MA 3VGJA 4CYMA 3EW7A 3RTAA 4WLUA 3SG0A 1SBZA 2QMOA 3KXDA 1SHTX 3GFGA 3QEKA 4J1QA 1S8OA 4ND8B 2GKGA 1SOAA 3FOAA 3I9OA 4LGMA 5JYDA 4ML3A 3JATB 3KNZA 3LC7O 3PJGA 1F4PA 4O3FA 5J2TF 2UXBB 3VR4A 1XMJA 1Z62A 1DG3A 1MEEA 1GCIA 4TV9B 4RA6A 4WL0A 4DYVA 5A4IS 1U0JA 1UPCA 1YBFA 3VRHA 5F7XA 5LP1A 4JXZA 1KMHB 5EESA 1E1QA 2B1IA 2P9BA 1DKUA 4QM7A 2ZBFA 4O0LA 4G1MB 2Z0MA 3OQJA 4PC6A 1VYTA 4U5QA 2X7HA 4GR9A 2HU2A 2F1RA 2RJ3A 1ZVVA 3ESYA 1SCDA 1C2YA 1N6OA 1V9LA 2AEMA 4PXSA 2NPFA 2VT2A 4IEIA 3U9LA 2B69A 3VNSA 5HDBB 3HPRA 2GBLC 2IH4A 3D4IA 1B8PA 2VPIA 3N86A 1CUWA 3S8EA 2DFDA 4K0KB 3BTVA 4MKRA 4ALLA 1AQ6A 5AJXA 3DLPX 1QHHA 1VL2A 3EIXA 4KQHA 1VRVA 1LFAA 4FEYA 4PLCA 4Q9HA 1IJFA 4H4CA 5LQKA 4ZCSA 2IW3A 2X22A 4AP5A 5JH7B 4YJKA 3AKCA 1FTQA 4EKEA 1XMSA 3MJVA 2JLWA 1NTRA 1N5MA 2XTZA 1GZSA 2JLCA 2P11A 1K8RA 2PEYA 4E5SA 5B12A 5K0FA 4X66B 2C8KA 1GVNB 1FFSA 1R1DA 3B3JA 1WB6A 3L0IB 1YBHA 5EJIA 2N47A 3VZQA 4X64B 3QWFA 4ZV9A 1RI2A 1DARA 2D1QA 4JJAA 1ZKMA 2XYGA 4D56A 5KUTA 5DX8A 2QVGA 4MUBA 1BQEA 4ZDJA 3W7VA 4M0LA 2AGVA 1ZK1A 2JGNA 2Q7XA 4AM8A 1N1GA 2MT9A 2EOAA 4Z51A 1F5NA 1KJNA 3DFFA 2FI1A 3LVRE 6LDHA 1MJGM 3H7IA 3DXZA 2I54A 3S28A 1W5BA 3UWPA 2CFOA 1E20A 2DOKA 2PWPA 4KPGA 5A7GA 3IUPA 2WQ7A 3UZUA 3X2EA 4QEKA 3K9LA 3LCJA 1I2DA 1Q2XA 3CRVA 2D4AA 2I1WA 3CIOA 3BHJA 4QU9A 4TPKA 2RD2A 2WSBA 1YJCA 2QSYA 4K1LA 3VNVA 3D3NA 3VVBA 1ZD8A 3GLGB 1ODLA 2EBWA 3CWQA 3SE7A 1LQTA 4PV7A 4LGCA 5H81A 3DDZX 4KHPB 2WHEA 2FZWA 3MJEA 4HGRA 1VKZA 1LBEA 1NTOA 1QAMA 1SD5A 1XZBA 2PU7A 5EOVA 2PDAA 1UEIA 2WJZB 1G4HA 3FUCA 1W76A 4KYTA 2QB5A 1H3FA 1JBKA 1LWNA 1XD2A 2QU7A 3JYHA 2HYDA 4TM7A 3WNCA 1SY7A 1H69A 2MSWA 2PH3A 4ASUA 1YZVA 2V7BA 3KQOA 4PLTA 1TMGE 1ZRSA 1DB3A 1QQ7A 4H59A 3G1WA 4FFPA 4RVFA 4W7SA 3VNRA 1NRIA 1WHTB 4M98A 2PAFA 3SZLA 3AKDA 2F9MA 3RBZA 4HJXA 4RHTA 5DLDA 4MV3A 2AI3A 5L3ZA 3RUAA 3IPRA 3KB6A 1EA7A 1NBWB 1RM5A 3KJQA 4BLQA 1LTKA 5F35A 5HK9A 4BMDA 3O9ZA 2BP7A 3SF8A 1L3IA 4X8MA 5HMLA 1XZKA 2XX3A 1YZTA 1JX6A 1U6IA 3II6X 4NZYA 4B3CA 4DZZA 4OUDB 1Z0ZA 3K2QA 4B6PA 4HH0A 3DTVD 5FWDA 3LQFA 4DR7B 1U7HA 4YVFA 5EEGA 5FI1B 1IDOA 4IJUA 2J9FA 2PS3A 1ILWA 3GGPA 4L4UA 5K3CA 3D4OA 1SC6A 1Y9AA 3COZA 2C2OA 3EISA 5PNTA 1CPYA 3AR7A 4ED9A 2VNIA 3ZZMA 5EPEA 5I5GA 2Y0PA 1EFHA 4F45A 1R3UA 5BOVA 1TVKA 3O2JA 3PD0A 3OZCA 4M0UA 3DZBA 2UUOA 4N0DA 1H2BA 2PSFA 3W9YA 1P8AA 1QQ5A 2QE7A 4YAKA 5C1PA 1SA0A 3V1UA 3Q6NA 3H18A 1NVVR 3TWOA 2B21A 3DPIA 1EH5A 1P9RA 1L5QA 2CDBA 4ER6A 3PWKA 5BP7A 4S1PA 1DOHA 1G3RA 3NLLA 3C45A 4L4SA 3RDPA 1ZSNA 1B26A 3RS5A 2P6OA 3WGTA 2FFQA 2FCRA 4EEKA 2FQWA 2VTBB 2FKAA 3HA5A 4MHSA 5KSOA 5LR6A 2IYFA 2CLLB 3AEZA 3FTQA 4FFVA 1V7ZA 4MV6A 4NP6A 1IWOA 4P32A 5BUSA 1EJBA 1JR3E 1J22A 5LIPA 4I4NA 2J67A 4I5IA 2PY6A 2QPOA 2WLSA 3NU1A 2H4FA 2J3LA 4QGHA 4BX2A 1PJRA 3I4FA 1LJLA 3I73A 2R8EA 4JKOA 1GT91 1UQUA 4QUBA 2ADFA 3PBKA 2WG1A 4LE2A 2BFNA 1VE3A 1F3OA 2REQA 1VJ0A 1VMIA 4V2UA 3F6SA 1Z8HA 1RC1A 3OBIA 2IDJA 4BWFB 4D26A 1EVIA 3ANXA 2PH7A 1S01A 2R66A 3LFUA 1R5OA 3LVQE 2YBDA 4R7ZA 5EC8A 2HQBA 1V5EA 3C16C 3ZV7A 4BB9A 1QRAA 1YRQA 5CAEA 1D2MA 5ELLA 2H4WA 3DBLA 4HH4A 1XQXA 3MQ4A 4URYR 3GMSA 4EPYA 1WR8A 2BBOA 2G25A 3NHYA 3F98A 4TL8A 5EJFA 5F33A 1HX7A 3G5AA 4XFDA 5DBGA 3WXMA 1NQOA 1L7OA 5TIIA 3GN1A 2XCLA 5AHOA 1NKVA 3VH1A 4PG6A 3JQEA 4GF5A 2ABWA 4KHZA 1ZPDA 3I9NA 4N49A 3ULKA 1JG6A 2QN2A 2R2GA 3L6OO 1V11B 1NR1A 5ELXA 2FWMX 1LBTA 3MT8A 2JZNA 1FVFA 3MGGA 4AI6A 3CG0A 1AKQA 1JU3A 4QTUB 2QI9C 3K35A 5AM4A 3ISTA 3RSQA 1LSUA 1ZINA 2WJPA 2GF9A 3MWLA 4KQKA 1O6GA 1CUXA 2W0SA 2W6IA 5D85A 3T34A 4RF2A 1UR5A 2A58A 2CJYA 4XAQA 1RJDA 5LA6A 5I51A 5BQ5A 1ZN8A 3OZ7A 4KBGA 1W48A 5B55A 1A8QA 3FJOA 1Y5RA 4F8EA 4FXOA 4F4UA 3LHKA 1E1KA 1PGNA 2R7MA 3BJEA 4WDQA 5DCLA 1IM8A 4DA6A 1SU8A 2PXXA 1Z8FA 2XVMA 2Z5GA 4AVYA 4LMBA 3RVDA 1YZFA 5CPFA 2QM8A 4MH0R 2VSXA 2ID4A 5BSMA 2XT6A 1ENYA 1TM4E 1VSBA 4RY0A 2N1MA 3HCBA 4H0NA 4MV0A 3SS7X 3RASA 2G04A 2UZ1B 2UVPA 4HWGA 4DADA 3OIUA 5BORA 1ESCA 5CURA 2Z04A 5CLQA 4YRIA 3TR6A 4GRIA 4KIWA 4C08A 2GQ0A 4JWTA 3QYJA 2QLJA 1MKYA 2WDPA 3W1EA 2D7CA 2HTEA 2XMRA 3AVPA 4MKHA 5EWLB 16PKA 1DKRA 4W9NC 1U94A 5A04A 2FMXA 4HNAA 2D59A 4YIKA 3L0DA 4DCCA 1MO3A 3KQVA 5I47A 13PKA 5CYGA 2FPPB 4OMCA 4HLUC 1O77A 3F71A 3P9ZA 4LRWA 1HRKA 4OFBA 3ZNQA 3HJUA 4TLLB 1PS0A 5M5BA 3OTHA 4E94A 3OCWA 4MSUA 1OHHA 4ZQEA 1MIOA 2Y27A 3A6EA 1KWGA 4U7DA 1RLMA 5K05A 5JSKA 1G0NA 1L5LA 4WNCA 4M3NA 4ABYA 1O5OA 2EV9A 4KSYA 1RYYA 4MW5A 4C0JA 4NBVA 2F90A 1ZRMA 1JSLA 1KU0A 1M2NA 2PCLA 4IQGA 4OY3A 2H5LA 2IPOA 3QWAA 1F1JA 1RBQA 2YRWA 3V2HA 1XX6A 3ZY6A 4GUDA 4D43A 2NZWA 4QXAA 4A1OA 4TWRA 1JA0A 1FF9A 4LKRA 3WRXC 1T8UA 4FBMA 3KUUA 3CZCA 2BZGA 2UYQA 3AG5A 5HE8A 1WEHA 2HD4A 1W4CA 3RYCA 1J2UA 1B1CA 2V7GA 3T9AA 5GTDA 5CVVA 1QX4A 4XQ0A 1QKKA 3N6RA 4M1ZA 2X0RA 1OH8A 2ZZKA 3PP8A 3KZ1E 4XTRA 3UAXA 5KTYA 3O21A 3Q6MA 3ZJ5A 3KZOA 2WKRA 5IAEA 1NVVQ 1T3SA 3FGZA 4I66A 1PJBA 3T7SA 1N3YA 4HQNA 1FX0A 1OC2A 1F17A 1E6KA 1CZOA 3OC6A 4QTZA 1RXVA 4GM1A 2ES4A 2Q3HA 2EDAA 2RH8A 3VR4H 4XRGA 4B82A 1CUGA 5KKCA 3O3OB 3O1IC 4UTOA 1T3HA 4HDCA 1T15A 1UWLA 4ZO6A 2IU0A 3HYNA 3BREA 4IRXA 4ZOAA 5LLSA 4AC9A 1UBRS 3QV2A 5K03A 2HEGA 5EJ8A 4S0XA 5JXHA 3ZU6A 1EDOA 1UIMA 3N75A 4GEGA 1YT5A 2VDNB 3JATA 4Z1MD 2XY4A 5JW6A 3LVFO 4XSHA 4YJDA 1ECJA 2O52A 2L69A 2O2IA 2P4EA 1SHLA 3QKTA 4LCBA 4MR8B 4ZYYA 2Q4RA 3D6AA 4TV9A 4C01A 4DRXB 4B4KA 2XXAB 4XR9A 1WMSA 2R6FA 1MB0A 3TLAA 5HPYB 2O1WA 1C3OB 1BHSA 1Q1AA 1KMHA 2G8NA 5G4KB 2QVYX 3HDHA 4WZZA 3SQMA 1AXGA 3L6RA 1AIPA 1WRBA 2BLLA 3ZK7A 5JFGA 1ABEA 5ICEA 3X1WA 3SBOA 2CHGA 2O5EA 3WB0A 4Y2SA 4HX5A 2EQ5A 3VZRA 4G89A 3ZE7A 4XX1A 4V0NA 1TFUA 4B9EA 1CUHA 4PSDA 2GVDC 3O1HB 3QKIA 5DN9A 2MSLA 5CVEA 3VDXA 2R84A 3N0RA 5G41A 4B3SB 1LBQA 1JI0A 3NBZC 4LK3A 4XWAA 3TTUA 2C8VA 1GDDA 3N39C 1ZNXA 1MO5A 3OM0A 5J5CA 5KCMA 1XVTA 4D8WA 1YIDA 4WOJA 3MWGA 1JIQA 2CJFA 3CRQA 3N6XA 2QT9A 5CVTA 4M87A 5FWYB 4MS4B 3SS8A 2YHAA 2W7TA 4D6YA 5JH7A 4PAGA 1LPSA 2JD1A 4JB3A 3TVDA 1H8HD 1G8MA 1JMYA 4FYYA 3E4DA 1BEUB 5CCXA 2OORA 3FF4A 4F4CA 3H7AA 1ZA2A 1TW3A 3PQ2A 4HDMB 1I01A 3PKZA 2V4MA 1Q83A 2QRJA 1C3EA 3UCXA 3BXEA 2JC3A 3LSYA 1X92A 3PYLA 4ZJPA 3DPSA 1OXTA 4GOND 4HEA6 5DIFA 1L8LA 3CSSA 2VWGA 1T9HA 4G1BA 1Z38A 2GBIA 4HLQB 2VQEB 2WZCA 3KJZA 4QPJC 4EMBA 1KIFA 1EFVB 3FG9A 5IZCC 3ADKA 5T3UA 1IVYA 1ZM2A 4QG7A 1AM4D 3PWZA 2ZXEA 4PLFA 5KSWB 5JG7A 4XYMA 3FETA 1GQRA 3HBAA 1SRQA 1PR3A 2CFRA 1H6CA 1DPGA 1E9FA 2GNOA 3IESA 3GLGA 1XTTA 1QDEA 2VYNA 1QGAA 3FVTA 1X2EA 2F3SA 2JLZA 5AXAA 5JCPA 3K0EA 1HYGA 3FMIA 4Y2GA 4YUYA 2PLAA 3PR1A 1TLTA 2C1EA 4G0YA 4WE3A 5LZ5A 4H7DA 1FSSA 1X7DA 2W00A 3ONVA 1R9NA 1HKUA 3C4QA 2FETA 3QYAA 1NKSA 3IQHX 3T7CA 3FLMA 1NBME 3CFYA 3LYUA 1TQ2A 1G5FA 1WHTA 1GSAA 3FM9A 3T94A 3WKBA 3K70B 3C98A 2FKNA 3IBCA 1ZK2A 1A9ZA 5ALTA 1PWXA 2DKNA 4UMFA 1FE8A 2YV2A 4LHWA 5KQMA 2P6NA 1VZ2A 1UBNA 3NM4A 4D3ZA 1UFOA 5ER6A 4E3WA 1K68A 3IT0A 1GQ2A 1SMKA 4K9MA 4HS4A 3WR5A 3HU5A 5HNKA 5I9NA 4BPBA 1ULUA 2Y0DA 3OHPA 4DXHA 4FYHA 4GGOA 2AEJA 2JA2A 5IWAB 2RHCA 3D31A 3NEYA 2A94A 2AQHA 4Y9DA 2JLUA 4L5YA 4MQFB 1AKNA 3WSTA 2JEYA 4OHUA 4OUDA 2AZDA 2O14A 1JB1A 1KERA 1TTHA 4ZJYA 2YY5A 3NC0C 3EF1A 4K9DA 2PX5A 5EJEA 2OQIA 1RAAA 2AXNA 4K9KA 3ELBA 1MX3A 3QG5A 4U2EA 1AS0A 3N2IA 1J5PA 2Q45A 2F3UA 4MMYB 3VNUA 1Z5ZA 3U6BA 4PC2A 1FZTA 1PT5A 1Q77A 3CM0A 4J1TA 3Q4GA 1G8PA 2P2ZA 2VDRB 4FNAA 1R00A 2W37A 1SVUA 2PA3A 5EP4A 3IX7A 4NU8X 1PV2A 2VK8A 3H97A 3QRWA 1WUIS 1ZH4A 5IANA 2O2YA 3NX4A 9LDTA 4AUMA 1PG0A 1OZ0A 4IUBS 4C6SA 2XKJE 4BWVA 1UMKA 2VTBA 2RGXA 3A4MA 4FYIA 4GMFA 1ONOA 4U39A 3UM9A 4GX1A 4B2LA 5I7SA 3BB3A 3IH5A 4LDZA 1YQXA 1HG0A 3S44A 1PWYE 3LFHA 3AM5A 1E1YA 1W47A 3MLBA 4XSVA 1BKYA 3NIGB 1STOA 3C14C 4PZAA 5IM4F 5CLGA 2PT5A 2PWZA 1R6VA 1V39A 5DLQC 3H5IA 3SX0A 3CT6A 3MMSA 4F1KA 3KDSE 3WMXA 2BI8A 4O6VA 3RGGA 3CR7A 5DRYA 2VJKA 3MLEA 4R0MA 3NHWA 1T6BY 1W34A 4V0KA 4XR4A 4JROA 4BC0A 5J2TB 2WICA 1INLA 5AFSA 1XLTA 2PSHA 3OG9A 1LPMA 2PKEA 1FU7A 1UDAA 4JZYA 2W93A 1IHDA 3FYCA 4POAA 1XUOA 2AJBA 2PM8A 3KK0A 1T2EA 2VBIA 4J7CA 4QDUA 3RVBA 3UCFA 1KVUA 4BLSA 3AJ8A 5FA6A 4CLEA 4DQUA 4YT8A 3VMMA 3A4IA 3PC3A 1XRJA 2JW5A 4G07A 4ZQIA 3VC2A 5DM70 4LY6A 2PZFA 1RVV1 3Q3CA 4C78A 4I9HA 4M4SA 3GB9A 4CG3A 4N76A 1UP4A 2QR3A 1H2YA 5IBRA 4DQKA 3IVXA 5JFOA 1M1ZA 3M9LA 5EXPA 1V11A 2XAAA 1GTSA 3OEHA 4EB6B 3W4JA 1JFVA 5I4CA 5TQ2B 4ZRDA 4L50A 4RNCA 4TKLA 3PXGA 1F8GA 3DXYA 4OQPA 3KS9A 1NJSA 3RT7A 4FTWA 3NHAA 3ADPA 5AJYA 3KAPA 5IP5A 2W5UA 3PGLA 5FBRB 4BFXA 2XGMA 5G1NA 3RABA 4JBWA 1THZA 2RGGA 3EVZA 5H4GA 1Y81A 4E07A 3QVXA 2UZ3A 4II7A 1E3IA 1E0DA 2PX3A 5AQEA 3RU9A 5E7MA 1HR0B 3DMDA 5JD5A 3H1FA 3ZTWA 1T34A 3PGKA 4XH9B 4YFYA 3V4FA 4R71A 1CUIA 3ORFA 4LOAA 4O1MA 5GWXA 5TMDA 1YA6A 1JZSA 2P27A 4Y6OA 3A1FA 5CVCA 3RV4A 4E5VA 1Q0RA 3HKEB 3OQNA 2MR5A 5KNBH 2UZ1A 2NU7B 2YS6A 4ETIA 2B36A 3K9BA 2CWWA 1VPDA 4INAA 2BUCA 4LTMA 2XCSB 3DEAA 2YJNA 1NUPA 4K8RB 1J99A 4ARZA 2FPKA 4GKBA 5MN6A 2VF4X 3RYIB 5EWLA 4HX9A 2AXEA 2GESA 5KTOA 2QYSA 3T7IA 1HTTA 1R4MB 3LKVA 4LJ7A 1SD1A 4DV1B 5L53A 2WFZA 4K6KA 3ZHXA 2JIBA 4OTZA 2JFWA 5BWLA 2G28A 3A6ZA 4LDAA 1X3LA 4LRSB 4EJSB 2ZAIA 4ZOBA 3I2IA 3PE3A 4AJHA 3QEBZ 4EYSA 1YASA 4YX9A 2BTEA 1PL0A 3RLFA 2ALJA 1XRRA 3OCCA 4RH3A 2FMTA 1GKKA 2O5CA 1A9TA 3B1FA 4ZIRB 4EY6A 1K88A 3Q87B 4ZO8A 4LC0A 3TBFA 4AMYA 2C57A 4B6QA 3DT9A 3AJDA 3VR6H 4BQQA 1J5XA 4PSCA 1OBOA 5KWSA 2P1DA 3MTJA 3IJ5A 1T0HB 5F2EA 4Z2YA 3C8UA 4UU7A 3GGCA 4KI0A 3NDRA 4IMPA 3THOA 2WSLA 3I53A 1G3UA 1T2AA 2J8ZA 3AY7A 3UFXB 1OW3B 3EAGA 4X20B 1PK7A 2BV3A 2HC9A 4TXNA 4LYEA 3UENA 3BF7A 3W8EA 4ZGBA 3DV9A 3HR4A 2QTCA 5LKAA 4F12A 4PZCA 4O5AA 3F7MA 3NG1A 1RPAA 3O5AA 4B75A 1JVNA 2VK4A 1SQSA 3C7AA 4BWGA 1L5NA 2WF6A 1N5DA 4PBTA 5I9LA 4QIHA 4IR7A 3LWNA 4DR5B 3FF1A 2NTNA 2PWYA 3AW9A 2J9GA 3B6IA 4LJLA 2O57A 5ALDA 5HBGA 2H2AA 2VDOB 3C3MA 3S2EA 1Z7EA 3DXXA 5IEBA 4UW9A 3EIQA 2ZB7A 3VVCA 4CNQA 3IE0A 5KAPA 4BMCA 4CN9A 1R0CA 2B30A 3TW0A 4EY7A 4YN3A 3PI7A 3RUIA 3K9GA 4YECA 3MJ4A 2HRDA 3CVVA 3SR0A 4HNUA 1U7WA 1O08A 2VPTA 4O59O 4ZAVA 4ZP1A 4F86A 5TJ9A 2ZAGA 2QW0X 4UOQA 1EWTA 5C18A 1XF1A 5ICFA 3VDNB 4LHYA 4JI6B 3RANA 2NPOA 1GYPA 4MR8A 3Q8MA 3RIHA 2VHCA 2IA5A 4FINA 4MKFA 5E2IA 5J59A 4DRXA 3SPXA 2XXAA 3EGVA 1PP4A 3STHA 4PYRA 3RIEA 4A8JC 1GZ4A 1C3OA 3QITA 5AK5A 2A1TS 2JIRA 5G4KA 1L7MA 4QBHA 1XZQA 4KC0A 2QL5A 1E2MA 1GAQA 4QA9A 5H3LA 3TXYA 4AQ7A 5ITZB 1PZEA 4XYGA 1G9SA 5IARA 5BQOA 4FFMA 2ZI6A 4V0RA 2OBFA 1K08A 2M32A 1NT2A 2AJLI 5EKUA 2DX7A 2GAFA 2IYWA 3CTPA 2BVNA 4FDMA 3CVWA 1PR6A 2NO1A 1SUAA 3D0KA 4OHOA 5AVKA 2BR5A 1CZUA 5ICMA 3PUYA 4QFCA 1KI2A 5JE8A 3DFUA 3LWDA 1TXGA 1UWKA 1P1RA 2PJDA 3LPNA 4D5GA 5J4LA 4CEHB 5IK2D 2H08A 3LK6A 2VEOA 3OKAA 2DR3A 3C87A 4LECA 3DDCA 2QZ4A 1E32A 1NDHA 4HB2A 5ERYA 5EMJA 1SVOA 4MS4A 4ARAA 5FWYA 2I4MA 1G9XA 1Z0SA 3BZBA 1Y8RB 4PPNA 1KQGA 1DDIA 3GLVA 3ENVA 4XB1A 2B9EA 4HAXA 2DT8A 1M0SA 1M3SA 4HDMA 4E5PA 1Y48E 3PQ4A 3FNFA 5E3IA 1TQ6A 2RJNA 3PICA 2HRCA 1U3GA 1NJGA 2ZSBA 3IV6A 3ONNA 4AXXA 1HTWA 1YHZA 2GPTA 3IPCA 3OU7A 1QO0D 3NRBA 3DXFA 4DV4B 3TNJA 2OGTA 3KEOA 2X4LA 3IO3A 4NLLA 3W8NA 4B3RB 1WDKA 4D5EA 1NVAA 1R64A 1BCRB 4RQTA 3DE2X 3EY4A 3S3TA 2PLRA 1KJQA 1EFVA 1VIMA 3WIBA 3U61B 2Q21A 4N18A 2AW3A 5C8DA 3R0IA 3CMCO 1E6MA 1L5MA 3U4QB 2P78A 2H16A 4AS2A 1EWVA 1U0TA 4C2AA 4UXIA 1DIGA 2FEOA 1Q17A 5AK6A 4RDXA 3HJBA 3CZRA 4R6WA 5DBIA 2W2LA 2YYSA 1D2AA 2XQIA 2GX6A 3BGDA 4EBFA 1ZM7A 5KNCD 2PZGA 1Q6ZA 2Z6UA 1NF8A 3Q15C 4IW3B 1BCSB 4QBTA 5B64A 2Y1WA 2XVXA 2Q1XA 4DCGA 1IZYA 2G08A 3GDFA 1P9OA 2PXCA 2E1PA 2G0NA 1KI6B 3LI2A 3QLJA 4ZU6X 4ARIA 2W90A 1JXAA 2G36A 2GHQA 3AT1A 1RYBA 3LQ4A 3QY9A 3BMNB 1TF2A 3R3UA 4XD7A 1TUIA 2QHXA 4YIHA 1WA5A 4QJ3A 1U04A 1VFPA 3GUCA 1S02A 3L79A 3OQIB 4DTIA 1E2IA 1NOIA 2K87A 1H9BA 2Q7DA 4DNPA 5IULC 1XA3A 1S3SA 3G88A 4PRKA 4ARCA 3S4YA 1C3JA 3CKKA 5EMHA 4DUPA 3MD9A 1EZ1A 5K0GA 1IPEA 1R37A 3ZBTA 1ACMA 2ZRCA 2ODTX 3ETLA 3GD7A 3ZLVA 3FCCA 4BFVA 4CDMA 5BWCA 2AG1A 1G5IA 3DLCA 3HY4A 4RESA 3LKBA 1E2EA 3QVTA 2RB4A 1XQ9A 5H9VA 3RUDA 5EHZA 4ZZIA 1M8FA 3CZPA 5DGHA 3RBXA 1ZESA 3WMEA 3WLAA 4MQFA 3T5GA 1DAEA 2C7OA 1NU8A 3QFHA 5CH8A 2XD9A 2QRGA 1XN1A 3ZCSA 4ZT2A 3EMDA 4YP9A 2REOA 3R74A 4KWTA 1L7AA 3BX1A 2ECOA 5JEEA 4DQLA 3WWOA 1HMYA 1BHO1 4X85A 4CF4A 1T29A 4MVJA 1M5UA 1M8GA 2GYWA 4JBYA 5U1PA 3NIFB 5C81A 2YC4C 1II8B 4LWPA 2LIVA 4UNQA 5CEFA 3C70A 1S7CA 4PNPA 3PA6A 1O97D 2Q3EA 2RGAA 2YQ4A 1KC3A 4PBSA 4B85A 3U3XA 2D06A 5CDTA 2J59A 5C0OE 1EFDN 1ODTC 4L4ZA 3DMPA 1RYMA 3NKVA 2I3GA 4M55A 4FDVA 1GA4A 1L5HB 3ZBQA 4EAQA 5F7OA 6YASA 4J03A 1UZUA 2RIPA 4CIBA 1IN1A 1D0VA 4XSGA 1RHKA 3CVYA 1DAKA 3JZIA 5JDCC 1USGA 2RK3A 1WW8A 2R8XA 3SC2B 5GJWC 4KBYA 3TEMA 4DR3B 4BMPB 3L4SO 1SG0A 1RXCA 3M6LA 4G0PA 1HE4A 4L95C 2QAIA 2PSJA 1Q0SA 5LZ8A 4YCNA 2VPZA 3WB1A 5G3ZA 1HQDA 1PJSA 3FBGA 3LT0A 4I8DA 5DCYA 2B7LA 3E2PA 1T9KA 4CM1A 4BQOA 3IP5A 5A3RA 3TPZA 2IZZA 1GY8A 2XPCA 4RXTA 4IDBA 1Z47A 1Y3FE 4S0ZA 2APJA 2F55A 4AZWA 2XRZA 1TX4B 3SLGA 4NFSA 5J2TA 1SIUA 3AL3A 3BCSA 1P18A 3QY0A 3WMRA 1AKTA 2YJ6A 3GEGA 1NUQA 3M33A 3NBAA 4N03A 4LJ4A 5DGXA 1MFZA 2FOLA 3FBTA 1J00A 3TRIA 3VZDA 4WX2B 3EVTA 1YRLA 1RAIA 2A0WA 2C94A 5KYGA 3GJRA 1T6NA 4IJ6A 1OB2A 2Q5HA 3ASYA 3IIJA 3TW8B 4MGYR 1MN6A 3NFYA 2AJDA 4JLNA 2D62A 1Y82A 4OHVA 5JZMA 2PXAA 4AKEA 2ZUVA 3FTCA 2HWKA 3L0ZA 1WPQA 4DZRA 4BJ5A 1G7TA 1IHUA 3INGA 3BZUA 4DA8A 4JLKA 4L15A 2LUOA 3EA4A 4L8VA 2HU8A 4B4VA 5JZOA 4LI0A 1QX3A 4I5FA 2XWJI 3KVYA 4BFLA 1PJLA 2L2QA 5ALIA 1TZ2A 4MS3B 4EB6A 5TQ2A 1X38A 3LO8A 2JGDA 2GPJA 3W8FA 2HU5A 4AWXA 4CMAA 3OZBA 2AH5A 2X8WA 1SQ0A 3K8QA 2IVZA 2R5FA 4TRJA 4AYWA 4GWGA 4KGDA 3NHSA 3KHUA 3CX8A 3G5TA 1XCOA 2PZKA 1I2MA 4CM9D 3L6CA 4X95A 2EWVA 2RI0A 1EWRA 4CMBA 3N9IA 1BRMA 2V4UA 3FDFA 1BA3A 1GT6A 4LHXA 4ACBA 5CDHA 1PBNA 2Q7OE 3TX2A 4KL8S 1A97A 4L6IA 1DDGA 1QZXA 3UQYS 3CWZA 4HGNA 1QCCA 3HKEA 3HXQA 1IFXA 4LPSA 4GC9A 1GZUA 2NU7A 4C43A 1J21A 2NXCA 2WJWA 3RJTA 1URPA 2ZE5A 3RRMA 4ZCTA 2P7IA 2GCPA 3LPLA 1KQ3A 3E3OA 1Y6GA 3ADOA 1T2CA 1X8LA 2YWBA 3RYIA 2YOHA 1ZVMA 3RSHA 1NVKA 1IK6A 1CJSA 1XXHE 3B9RA 1R4MA 3E22B 3F97A 2JJ1A 3H6HA 5C31A 2I5PO 2CSXA 1QSGA 3CY6A 2YXLA 2PR7A 3JWPA 3E18A 5C34B 3IOBA 2CMFA 4S1OA 2YWDA 2QRVB 1HI9A 4EJSA 4K9RA 4U1RA 3I4LA 1ECPA 1ZEMA 1ADBA 3PV0A 3HO1A 4NJOA 3WADA 3WIOA 4LYGA 2DY0A 4CMKA 3NOOA 2PMEA 4DCVA 3PCRB 5C5IA 5F23A 4RSRA 1MX9A 5T7BA 4YTEA 1ZN9A 2HAEA 1VLQA 2HXGA 3F6YA 4ZT4A 2IV3A 4O1HA 4ZIRA 5IF9A 2W8BB 3A32A 4C2UA 1U2DC 3E82A 1KZ4A 4JA2A 5AKXA 2VFAA 4RW0A 1ECBA 3TZCA 3DZJA 2VDUE 3Q2IA 1MG5A 4BAGA 2XWBF 2HR1A 1WS6A 1ZCBA 2FXIA 4U00A 4JJEA 1MCZA 1U2RA 3UFXA 1LX7A 1VCIA 4R84A 3C3JA 4X20A 3IHWA 1LRJA 5JAHA 4EHJA 3A1DA 2EG9A 1KI1A 1Z4MA 2FX2A 5L40A 4J8PA 3L41A 5ADVA 2YXPX 4JBXA 5CR9A 3DF9A 4Z3DA 2P9ZA 4NDAA 3TVYA 1CQXA 1I6KA 3UO8B 3I23A 5EQJB 3MTBA 3AETB 3BFPA 5E6UB 2VHWA 1P4HA 3LQKA 5AW2A 2OZLB 3H9CA 2XB9A 3KWMA 3G9XA 4G1VA 3MRTA 8LDHA 4KACA 1CDZA 3RS2A 2HKIA 1Q0QA 4UZFA 1W1UA 2V9PA 5BN4B 2KSQA 5CP8A 5EKSA 3KHKA 1JUDA 1RS0A 5ALMA 4DW8A 5JSZB 1ZGJA 4LYFA 4J4HA 4NBKA 4MP6A 1XNJA 5DTEA 3VI3B 2Z08A 2X86A 1VM6A 4EX7A 3U7IA 4MDEA 3M2PA 2QXTA 2DC1A 2I8CA 2YYZA 1EQAA 3T0GA 1LDEA 3GA0A 3EZXA 4RK5A 3RSSA 4KQXA 2O59A 4C4OA 4B6OA 4D4HA 1N9GB 4FOOA 4FGLA 2R11A 1DX4A 3TI7A 2OUIA 3KCQA 5CH5A 1OX6A 1G5QA 3G6KA 3WISA 4UZSA 4L4XA 3KOMA 1CHNA 3GJ8A 4C6TB 2I9PA 5KWJA 3NT4A 2OV6A 2ZUCA 3A25A 3W90A 1KY4A 3RSLA 4BVKA 4NCNA 3AM1A 3OLXA 3H75A 1M67A 3N59A 2VDVE 5ITZA 2A4KA 5HUJA 2UU9B 5EIAA 4P4TA 2AFIB 3KETA 5I3CA 1FPMA 4PYMA 2NV0A 4EGFA 1U5BB 3N8HA 3MXOA 1RE1A 3LC0A 4DKXA 1KVTA 2OMEA 521PA 3PDIA 2B3DA 2Y1OA 3MOSA 4DPMA 1RXWA 2AT1A 3QMPA 3ZUGA 5J4KA 4MOWA 4FMCF 1UC8A 4H18A 3WGLA 4EJ0A 1CJMA 4CEHA 1BWQA 1X7ZB 3FYTA 2J5RA 2VCYA 4FE7A 2XLCA 3GRAA 4KQEA 4OBXA 5C37A 1Q44A 5AWFC 3PEVA 4CKYA 5CDSA 2DG2A 4LX0A 2QA5A 1VIVA 3T41A 2OGWA 1Y8RA 1LU9A 4Y9UA 2GBFA 5G0TA 3NALA 3UXYA 4BJ3A 5IKMA 4OMUA 5F9FA 2FPXA 3AHHA 3UH0A 1U2GC 1XL1A 2X3YA 3PUIA 4JOSA 1N36B 4KAXA 1RLTA 1NW7A 1R6TA 1W29A 2CUZA 1L1QA 4QPCA 3RBAA 5LQMA 2CJWB 1KVSA 4L5CA 4AMBA 4MB0A 1AUPA 3ML1A 4LE0A 3E8MA 2F7SA 3BDIA 2AG8A 4J7AA 2ZZNA 5HFNA 2Q9CA 4M0DA 1BCRA 1PYDA 4I6EA 1NZDA 3AIKA 3D5TA 3L4EA 1KRXA 3FE2A 3A1CA 4F3CA 3IBYA 2CB0A 2Q2QA 2FZVA 4IIVA 3U4QA 2C7GA 4PXAA 5CFLA 4AJOA 3QH4A 1ZN2A 2KBFA 3T1TA 1Y9EA 1JEYB 5LD2C 1VLJA 3U4AA 2EJBA 3P5SA 1W4BA 3B1WA 3F5SA 1OAOC 2I6FA 3F4BA 4RZUA 2XNDD 1XNRB 1BCSA 4DLNA 2CXPA 1DOAA 3T3HA 4DZTA 2P1ZA 3OFND 3MJSA 3B9BA 5LDHA 2GD2A 3DQPA 3N2NA 5KOHB 3CLSD 2BSXA 1KI6A 3O3NB 4ZVRA 3WL8A 1YVPA 4JQZA 5THKA 1AUVA 4BMXA 1X0VA 3V2UA 1PE0A 4G8JA 4G0UA 1BS2A 1F6BA 4NI5A 1H9CA 2VNSA 4TYYA 1CR0A 1ZRHA 1DRWA 1Y7HA 3NHFA 4K1XA 4LSMA 4D9IA 3OQIA 3FOEC 1WO8A 2IYTA 4KBFA 3U9TA 4ARVA 3SDZA 2XMGA 4DWJA 4H1WA 2ZRNA 3GCGA 4K6CA 1Q7RA 1BDJA 2JBAB 3R3SA 1V2HE 2D5AA 4G5OA 4H1VA 4MDFA 4MCAA 1XU9A 4QPDA 5KC8A 4NXNB 4LW8A 2Q5FA 1MB3A 3DCYA 4YAUA 1XJQA 4UPVA 4UM9D 3A6PC 1X14A 2FYTA 4R4JA 1LK0A 2HCBA 5BR8B 3PXUA 1A27A 4FJ0A 5A5EA 1T4MA 5ALYA 3A9CA 2GTIA 1NLMA 2MU1A 4K6GA 4TVOA 1WEKA 2NXEA 2P5UA 3PFIA 1D1SA 1WSAA 4KSBA 3OM9A 4TXMA 5L95A 1KOGA 1FDRA 2BMVA 2H2FA 1QIHA 1QVZA 2IKSA 3I5XA 5F77A 4ZT5A 2G40A 2P1RA 2EBUA 3IIKA 4KUEA 3F3MA 2C3PA 2WQZA 3SSMA 3P32A 3AYXB 4JC8A 1SC9A 3VU3A 4LVOA 2BEJA 2AMJA 1II8A 3BILA 3TSZA 4Q7KA 4PR0A 1XTKA 1FFHA 1OI3A 3UCEA 1B8VA 3CT4A 2IS2A 1ZA1A 2D0PB 4RSGA 3FNGA 1ISSA 4M7WA 2X8JA 2I3BA 2RBGA 3DOHA 1I1NA 1L5HA 3WQRA 1KEKA 3S5JA 3L8YA 4C9BA 3DWGA 4R31A 4RZHA 1MW8X 1X2BA 1TECE 3OQVA 3GLUA 1HDZA 1Z4KA 4FX5A 1MOSA 2B7CA 3KQYA 1DGQA 3JZFA 1T3GA 3SC2A 4JU9A 2X6QA 2HIAA 1JPVA 1MO2A 1NPDA 2B92A 3JQ7B 3SK0A 4FIZA 4HH3C 3VDMA 3ZGLA 5JYEA 3L43A 2GA9A 3DBVO 5FWNA 1E0AA 4ISBA 4LGVA 4RGBA 1H4TA 4ZCPA 3L8EA 5JCOC 1BVHA 3E81A 4H31A 4WK6A 4OLFA 3RT9A 1YOVB 1A77A 4TSFD 2HBRA 2G5PA 2CJXA 2NXNA 4JUFA 3DMTA 1Z45A 1BGVA 4GLFA 1N0UA 1A5BB 3GJZA 3R6TA 3WFZA 1AK2A 3OAAD 4UDNA 2BUBA 4J0JA 1GADO 3CH6A 4DLZA 2HCFA 4IO0A 1NJ1A 3DUWA 3H0CA 3WGJA 3H5LA 2WKQA 2PQ0A 3VNBA 4BNFA 3QPBA 1GL6A 1GZ6A 5EL0A 4EO4A 2XEDA 4IDPA 1ZHFA 1N6LA 1SKYE 3P1JA 3UIEA 2WU0A 4FFRA 3TW8A 1MJ5A 3EBLA 1N6RA 2PV0A 4RHXA 1E94E 4RKYA 3Q5DA 3ZWOA 2H4YA 3IP8A 2GEKA 2C2GA 2WFLB 3LIIA 4RJ2A 7ABPA 4OJYA 4U7TB 2VJYA 3DE6X 1CYDA 1XQYA 1RWQA 3ECSA 2XUQA 1QNLA 1BN6A 3HMQA 2DBZA 1N7IA 3A6FA 3SEAA 3IQZA 1U9JA 3Q1LA 2V7QD 3RKUA 4JOQA 3I5YA 3PDJA 1XSEA 3HBNA 3BMCB 2BTQB 4MS3A 1XZMA 3GX1A 3NDIA 1N6KA 1O8CA 1W46A 4KR6A 1AU9A 1WDTA 5JZSA 5DI9A 2PUCA 2XF8A 1ORRA 2IYPA 2ZTMA 1W93A 3HXPA 1IZ7A 3RFXA 2UUPA 4TSRA 1P4JA 4PAMA 2TMYA 3UJ7A 3DKRA 3KDAA 2BDEA 2G4CA 3FCXA 3I45A 3PXXA 4YK7A 3T4PA 3BMOB 3REQB 4LEIA 3WLPA 3U1BA 4TZKA 2KB0A 2XAUA 4EX6A 1DQSA 1HORA 3HA3A 3KSMA 3PC7A 4C4RA 1YHYA 4UVHA 3PFWO 3QE0A 1GQOA 4ZYWA 3EMKA 5E2BA 3W2EA 3DTVB 3Q0IA 1T6XA 3DVSX 4QEZA 1OMOA 1GN9A 2EFHB 4QULA 5EJGA 4RLHA 2EARA 1TEVA 1PKXA 2GH1A 1X1EA 2PL9A 5EFZA 4LSZA 4M0KA 1S2GA 2ZXUA 3HEBA 4L5BA 5E6RB 4AUEA 1WDWB 5G2OA 3F3KA 3R7AA 4MZDA 4BGVA 4QU5A 4HLNA 1X1QA 1NX6A 4S2UA 1K06A 3E22A 2OBMA 3OQBA 3LUJA 1YUMA 1OZHA 1RCFA 1UBEA 3AJEA 2PUAA 1K6JA 1JHAA 2H63A 3P4UA 3ETDA 4R1PA 3KV1A 3ST7A 4DMCA 2RFLA 1M7HA 2QG4A 4EPVA 4N48A 3RO7A 5B7GA 2C59A 3DT8A 4JQSA 2QRVA 1DT3A 4B1FA 1DQYA 1U7DA 3C24A 5AK4A 3W8RA 4B8WA 1B1AA 2GKOA 2I03A 3DEZA 1WJGA 1GFWA 1UF9A 2C96A 2E4ZA 3OETA 3V7FA 3WZ2A 5JQGF 1P39A 3AVOA 3MTQA 1G20E 5FBQB 4CQMA 5HOQA 3PQ3A 4J6EA 2I3ZA 2W8BA 2CSUA 5ALSA 3GZNB 4IGEA 1NX9A 2JAPA 4LYAA 4IVNA 3C48A 5MHTA 4DQXA 5HSGA 5REQB 2HB6A 1H2XA 4X93A 4CUKA 1KP9A 1HLPA 1MV8A 2EXXA 3DAHA 1KI3A 4ZOEA 3FPLA 4KDEA 5C46F 4P82A 4DMRA 5KSPA 3OT4A 2LW7A 1LB1B 3MILA 3QI2A 1UJ6A 1E77A 4IZOA 5DT2A 1KMNA 5IN4A 3Q7SA 4XM2A 2DHEA 2FFRA 2QL9A 2QSUA 3AFNA 3AVXA 3WLRA 3WK7A 1TJNA 4B3FX 3AETA 5E6UA 2ZRQA 2AN9A 2OZLA 3ORYA 4K28A 1ISHA 2GN9A 4BRWA 2WSYB 3E58A 4WZBE 4YMIA 2D1FA 3GLHE 2BL4A 3IPYA 5ALWA 4YRPA 5BN4A 4CMHA 4LXTA 1KSGA 3U19A 4KODA 3V8EA 3NP7A 5JSZA 4M1WA 1DMRA 2H4XA 4CIWA 3P2MA 2VTEA 2MSDB 3HI4A 2UYYA 5BRNA 3TJRA 3GPLA 1EEHA 4MI1A 3TEFA 2G9VA 4OGKA 1UJMA 4G1UC 3RC2A 4BY9E 2OKGA 3AFMA 3MMNA 3R09A 4GBGA 4JUDX 4WOCA 4DSNA 1KFKB 1CR6A 1N9GA 1PT9A 2R8ZA 3KZKA 4WCVA 2PEZA 3TQCA 3DAYA 3VR5D 1V6SA 4MX8A 5KWEA 2HEIA 4YAOA 2P9EA 3CLVA 3NOQA 2MWMA 4LY0A 4C6TA 1NJ2A 2NQTA 4IXDA 5BURA 4MV9A 1AQUA 2K6GA 3PNLA 2P0YA 4DDHA 2VOJA 2ZTSA 4EQ6B 4I3GA 1PK8A 3UXEA 3VYSB 5JJCA 4FXPA 3ILHA 4ZVSA 3U17A 5JXWA 1I4TD 1EJ6A 2AFIA 5IM4A 3FCSB 1RPTA 3BJZA 5L7YA 1NZJA 3D1JA 1U5BA 2C4HA 3N8DA 1FEZA 1Y8CA 2PT6A 4OIFA 2JIDA 2CFSA 4QUIA 4TV8F 3PA8A 4YV7A 2BN4A 2OHIA 1R5NA 3W2FA 3HSYA 2FPUA 4XTCS 2Y9MB 4W4TA 1POXA 1X7ZA 2OV4A 2PUDA 1U0LA 3VOTA 4BEBA 3WL3A 1P8JA 3UWSA 2L17A 3KIPA 4B2YA 4LXIA 4E08A 1AV7A 1WUKS 1XZHA 1DLJA 2VXOA 3GRUA 3IKMB 3QTLA 3GD5A 4BBJA 2CCGA 3PRHA 1QJCA 2YFKA 5CX1B 2G17A 2EX0A 1CIPA 3A1EA 5JEDA 2OFWA 4BEVA 3KL2A 1FS5A 4MICA 4NBWA 2RKOA 1SXJD 6GPBA 2ZUTA 3R9WA 2DSTA 1H8EA 1SWWA 2CJWA 2CFTA 3BHMA 4FK8A 5KDLA 4TLEA 4Z7NB 1L4UA 1QV6A 1AURA 1E9BA 5E8RA 2W48A 4HDOB 2IWHA 1E7YA 1YZKA 2P2YA 2ZS9A 2OLEA 3KT6A 2VUIB 1HDCA 3UPTA 4EPTA 1KEEB 1OTHA 4FWBA 2OXEA 5KYUA 1Y4UA 3V33A 2O4UX 3HNOA 3KSZO 2PWBA 2PSDA 4HGQA 5BV7A 3NTRA 1GZDA 4I9NA 4Y18A 1JEYA 1J56A 2P0EA 1AB5A 1PI3A 4NY1A 5KNDA 4ZQHA 4D0SA 5FFNA 3TE7A 4AK9A 2QPAA 2JGMA 1YL7A 3A1VA 4URVR 2YV5A 3OEYA 5C8YF 2W2TA 1A1SA 1GRRA 1ULTA 2YJ4A 3DKVA 5B1IA 3PT5A 3JD4A 1H3EA 3HP7A 3N07A 4ZU1X 3D2AA 2OZPA 4G0NA 5M7EA 5LQJA 2EFEB 3OZTA 4LY3A 4B84A 5KOHA 1VYHA 2QRLA 2DBQA 3T7RA 3KPJA 1E2BA 2QX8A 4YLGA 5ENDA 4XVCA 3M0EA 4QU0A 2PQ6A 2DWQA 4J16C 1VA4A 1MABB 3CLRD 1MQAA 3IA2A 4ZJUA 3D5EA 4CKEB 4GBJA 4GICA 3WGQA 4R1OA 2J0EA 5GONF 3A11A 2O7VA 4BMYA 1M6WA 1Y1KE 2XHZA 2E7ZA 3CJTA 1GPUA 2II6A 3L1VA 3NM6B 1P80A 4FEEA 5AW3A 3EUFA 2VQFB 1JHOA 2IJGX 2JBAA 3OJFA 3I9JA 4HN4B 2P65A 1B0ZA 1Q7TA 3HG7A 3OCYA 4PIPA 1PQUA 4U7JA 3O03A 3AYZB 4ND1A 2R1VB 1TEXA 5BV2P 2I4LA 1M54A 2GJ9A 4RVNA 4ID3A 1HT0A 2BKEA 4WSOA 1H23A 5FP0A 2O1EA 5EKTA 4E2XA 1KAMA 4GSKA 4OATA 5GOTA 1AVTA 3WFIA 5ADUS 2OT3B 1WZNA 1YR7A 2EVWX 6REQA 1PF7E 2CNNA 2QD5A 3TLYA 3VR1A 2IUTA 2Y4NA 5DM2A 3FVQA 1QYRA 1W0CA 3WMGA 1G60A 1SH7A 1CUCA 5KVSA 2Z9DA 2FW8A 3CSUA 2QD1A 3NDPA 2BC9A 3ZU3A 2W71A 2FWJA 4EHIA 3E3AA 1G41A 1I7LA 2FQQA 2C5LA 3R77A 3CHYA 4P9NA 2D5LA 1IATA 3EZ2A 4JYBA 4WPGA 4X0EA 4XIJA 1PYGA 4Y2VA 3RD5A 1ULBA 2EKDA 3HUUA 4BQFA 1Q2UA 1OXMA 4IXWA 1IQRA 4ONEA 2AG5A 4ALKA 2XNHA 1EE1A 5AXDA 1VJRA 2J9XB 1TLLA 5IFKA 2AVDA 4URZR 3I5AA 4E14A 4UMVA 1YDMA 1ZS9A 2WM8A 1C1DA 3KEQA 1A50B 4OYLA 3VKWA 1AQNA 2WU1A 3UPUA 4C76A 3LNCA 2HHCA 3WA6A 1JIVA 4TVSA 3U3DA 1KGSA 1ARZA 3T5AA 3V9AA 7MDHA 4RCZA 1IOVA 3JQ7A 3VX4A 5AVZA 1AKWA 1NXTA 4M22A 4MRPA 5DYNA 3F7TA 3IDAA 3TINA 2X58A 4RJIA 3KQHA 2BE9A 2GN0A 2NZ2A 4UVGA 5CXSA 4YMHA 1I9GA 3RT1A 3H9UA 2CHQA 1WF3A 3PNOA 1KK1A 3ACCA 1YOVA 1C9JA 1MTOA 3ZGVA 1XYVA 3MWEB 4NMHA 3P9NA 1YMQA 4KO8A 2WFAA 1MXHA 2GYYA 2IPLA 1P7ZA 4L76A 3TLMA 2C0QA 2H85A 3V6MA 1YXMA 4XWWA 3IUNA 3K9CA 4KVAA 5EHGA 2ERXA 2JATA 1SELA 3CH7A 4EGCB 2WT4A 3D6MA 1SBYA 2WJ3A 4GR4A 3UANA 1XZNA 1LV8A 1KYIA 3VR3D 5TDHA 2HADA 3RFFA 4CCSA 2H5JA 5AJHA 2DU8A 2BGKA 2WFLA 5TS2A 5CLLA 1JG1A 1C5KA 3U9SA 4QLAA 4V0OA 5DP2A 5DTMA 3ZHCA 1F7UA 5LN1A 1HQCA 2B7BA 4U2KA 2QTVB 1E3TA 3IXLA 5GOZA 3FWYA 2EFGA 4FMCB 3BMCA 2BTQA 2MOKA 3KR9A 3PUVA 2F67A 5FOTA 3TS1A 3HBJA 4QYMA 1V47A 3IALA 2F4VB 2QAJA 4RPJA 3IQDB 1FNNA 4Q93A 4B5LA 3L7DA 3BD6A 4B46A 5JJ5A 2CDRA 3L7IA 1NUAA 1AH2A 5IBPA 1XN4A 1RFLA 2C4WA 4PFKA 4XARA 4A6DA 3BMOA 4RQBA 3REQA 2DMRA 3OJOA 4BNLA 4L1KA 2RBKA 4RXMA 1J7JA 1RRFA 1UFQA 2Y67A 3GK3A 3MPUA 4ANFA 5HKAA 1MXFA 5BWOA 3ZVRA 4MYDA 5FPHA 4DCTA 2ZI3A 1NURA 4WN9B 5HIJA 3DTVA 3RNLA 2XKKA 2UXCB 1CQPA 2O7QA 3I8OA 4TLBA 1NDUA 2PL3A 2VDKB 4B7XA 3WGIA 1ZVJA 4PPQA 1USVA 2X15A 4HQRA 1NUHA 1P4SA 5BO5A 1LY1A 3HO6A 3VVLA 1T5IA 1YI1A 3TEJA 1VDZA 1C8VB 1AKRA 3CCBA 1F0PA 1EG7A 2RHMA 2I55A 3BICA 5E6RA 2VS1A 5ER9A 1GA6A 1WHSB 3E9CA 3M2TA 1PV4A 3KD3A 4NMLA 2YFYA 1SK8A 1A9OA 2Z3VA 2PMWB 2PGOA 1U2QA 4OF4A 4DFDA 1LUAA 3G5LA 1J5EB 3PGA1 1G8AA 2IK8A 2ZUUA 2HJ9A 4JX8A 4AY4A 4WXRA 3CV3A 1KFJB 3C7KA 3WHPA 4HFMA 1EFAA 4OX9Y 4RETA 4AY2A 2WF5A 3FW1A 1QPZA 2H4JA 1K3FA 1K2WA 1FP2A 2Q9BA 2VP4A 3STWA 4BNMA 5JHHB 1FRQA 5CG2A 1BDIA 4MZXA 3A9TA 1L9KA 1NP3A 2AA3A 4QLOA 1CZNA 2GZ2A 2L0XA 2LV8A 2BEKA 4H7JA 4D6PA 5C35A 2RG1A 1O95D 2QF7A 3ZDDA 4GOXA 3HYLA 5CT4A 3GZNA 5BVGB 4F92B 4C7OA 2DFVA 2AF3C 3F4LA 4B35A 5TF0A 3GFSA 3UGQA 4B6JA 5REQA 4LFCB 4M99A 5DHPA 2H11A 2P4SA 1XNHA 3QNMA 2PRZA 4ILEA 3T38A 1L7VC 2H2GA 3TM4A 2O8EB 3WGKA 4C6RA 4D9CA 3KXLA 4FLMA 1ECCA 2YXNA 1SVSA 3RYFB 3MWFA 4TTIA 4CHGA 5IT4A 4GBMA 3UKOA 1F1BA 5L9AA 2VRCD 1E5VA 3TFOA 1RRVA 1ECLA 2H00A 3ENNA 1CZKA 3ITEA 4MHOA 4TOIA 4WLEA 1XKQA 5IKOA 1CYEA 2A5YB 2Y0EA 2QTWB 1NONA 4YWHA 3BH0A 1E69A 3FNRA 4UZEA 3SXUB 2WWWA 4HAVA 4MROA 4EHHA 5L6MB 1X7YB 5BUQA 4L3OA 1ZIDA 2LCFA 5A1JA 4UNNA 2QD3A 2X23A 2VQDA 3OEWA 2X4GA 3R8CA 1RPJA 3TOVA 3TXAA 4JR2A 2J5XA 4XD2A 2C83A 5I9TA 2J4CA 1PX2A 4B8ZA 5ITVA 5FPPA 1GGFA 3L6UA 3DV2A 4UREA 2QMYA 2JCSA 3K6RA 5ALHA 5BNWA 3Q8LA 1GNRA 1ZLYA 1JVBA 3PS9A 5CFNA 5GVRA 3D7MA 3KC2A 2ENUA 1BH2A 3V8BA 4IY1A 1PUJA 3CURA 3L1KA 3CLHA 4EFLA 2WQ6A 3GH3A 3TKYA 5K0LA 3IO5A 1JTFA 2Y1DA 1JIIA 1QF7A 1OXKB 3TQOA 1PS8A 4DCMA 3U4IA 2M6LA 1UEJA 1AHPA 5F78A 4ESEA 2G63A 3FB4A 4EQ6A 4ND2A 5BWNA 5B2FA 2Z2JA 3GLFB 1GNQA 2G1AA 3AF2A 5FLYA 2C3UA 4JI0B 1SUEA 3RTGA 3ABIA 2BFEA 2R96A 1H6AA 4N9WA 4M7PA 2XWQA 1FSGA 2GUWA 3P96A 4FCCA 2ZWIA 2NTJA 2UAGA 3LXMA 3T3GA 1O89A 2PYDA 4UBMA 3JZAA 2BGUA 4BPRA 4ETMA 4F6RA 2JKYA 3UJNA 2XECA 4J7XA 2UUCB 4D9BA 3G9QA 1JF8A 1ZITA 3S68A 3ADBA 3JYPA 3WO1A 3ROMA 5CX1A 4GMDA 3JQAA 3CTMA 4XYBA 4RA9B 3HNRA 4KCGA 3R3XA 2ZU0C 3SQOA 1AQYA 4INPA 5ECDA 1UQRA 4DR4B 3TIXB 4WNAB 3LKDA 2WF9A 3GUZA 4TYWA 1O96B 1RLUA 3M1IA 4LF9B 1R4AA 1R2QA 2R48A 3IAXA 1V25A 2HJVA 3VHXB 3C43A 1UZNA 3GVXA 3BWMA 1ORWA 1P72A 2HJWA 4HRAA 1MEJA 5HKKD 1ZR2A 1Z5UA 4A16A 1TTQB 2WWRA 4OHPA 4CKXA 1DXHA 1KEEA 2G76A 3H9BA 1Z0IA 4W5TA 4BRSA 2QGNA 4FBGA 4FB4A 5G0SA 1E59A 2QZ9A 1V6CA 1I3NA 4AJNA 2K7ZA 4NPHA 2LDBA 4EJ6A 4JYZA 3RRNA 1VJ5A 5KOJB 2LP4Y 3HDVA 4MAAA 2FHSA 3RV3A 3JW8A 5K5EA 1U7TA 2ZT5A 2ZAYA 4HQ0A 1YB7A 3TKAA 3OLWA 4B6GA 1Q14A 2VWHA 1Z0FA 3PL5A 1V96A 5KPDA 1BQ3A 3DBIA 4BLOA 2JFPA 5E1MA 3CCFA 1QG6A 2QGFA 4DG5A 2GAJA 3R3WA 4J6FA 2C9MA 3A9WA 4J0HA 2UDPA 3T6KA 3UAZA 2OL4A 2P40A 1EM6A 2H18A 2PRJA 3PIRA 2A0XA 1VE9A 3HB0A 4KN5A 1Y3AA 5TMPA 1JL3A 3GLGE 4OV6B 3B82A 4RH1A 2RKBA 1LA2A 1MABA 1XZDA 1YRYE 4U9HS 4CKEA 3U3JA 2VSOA 4KR7A 2CDCA 3RVKA 3RW9A 4P81A 2WJYA 4N65A 4OP3A 4DCNA 4ETNA 4JBNA 4Z1MA 3CRZA 2QTRA 2CMDA 2NNLD 4KXNA 2QEQA 1E79D 3FPFA 4L0MA 1OGJA 3ZJYA 4G4IA 3TX6A 4ZYLA 2R1VA 2IOFK 3GYBA 5KAMA 1V5WA 1HDEA 4G85A 3RAFC 4OLAA 4K46A 2GXQA 4O4JF 4P83A 1T36B 3DTTA 4AULA 2OBYA 2N3ZA 1XJ0A 4BC1A 3AVTA 3NIWA 4JYPA 2Z9BA 3WIEA 4Q34A 5JQGB 1OBHA 2AL7A 2JNWA 3MRVA 4DLYA 3D7NA 2BMFA 3RVLA 1EA5A 4RPLA 1XMQB 3AIIA 1L7BA 4ZTUB 4FJ1A 2WKSA 3GC6A 2I4NA 4CCWA 2HQOA 4DR1B 3D8BA 5INTA 4S24A 3K9HA 2GJSA 3EH2A 1M2JA 2YWHA 3ZCVA 4E5MA 1U90A 1EPUA 4JI4B 4C5BA 2OZVA 3GGOA 3INTA 1U2PA 3WVNA 3UJ8A 1NYQA 1XQWA 4FQ8A 3E53A 3SYRA 1TAQA 3A1NA 4GEKA 5K0BA 2CV1A 1MQ8B 3M5DA 3DDUA 1GRVA 3N5KA 1Z18A 4H4EA 1Z75A 3IULA 3P7MA 4YR9A 1W36D 1G55A 5DZSA 4RMGA 1E62A 4TTPA 1BJRE 1EAMA 2C20A 4QOGA 1KHTA 3UATA 3IKTA 1XZJA 4B2PA 3D64A 4RADA 2F4NA 3A10A 1W6RA 1HM5A 2DTDA 3EZNA 1VLMA 4W8HA 4D41A 2GD1O 3B36A 5L4LA 3KYDB 1RXEA 2AI2A 1VE1A 1EFCA 1H0HA 2QE6A 2ZETA 4YRGA 2X2PA 4O2BF 2VJAA 2NNWB 4N1AA 5AUOB 1M0WA 1U8AA 2F48A 4MWDA 5FBZA 4KDRA 2BISA 2R6AA 2AJ8A 5CK4A 4Q3EA 5EPUA 2I66A 8ATCA 5AW6A 3W6PA 3K53A 5DEIA 5CFRA 5MFZA 3MWEA 4F1JA 3RROA 2O5RA 4Z8XA 5JS6A 3GJ7A 5F3WB 4BQSA 2V45A 3HJGA 5AKLA 5KYWB 3SKXA 2GN6A 2GXSA 2BTOA 3RREA 1A88A 4DMLA 3UTDA 1IM2A 4WLNA 4Z7QB 2CUNA 1OPRA 1T4BA 4BZWA 4D8VA 1UKAA 4ENSA 3IAUA 4LOIA 2Q1YA 5L6LB 2DHRA 4H7PA 3FHTA 5FBLB 5EIOA 2BKXA 4YQFA 5AP9A 3TMYA 4XWTA 1UJBA 2XUDA 3S2GA 1OF1A 3W2IA 1Q0UA 1IOLA 3X1JA 2ONKA 4AKIA 3HCPA 4Y2JA 3F9CA 2KHZA 4TV8B 2QTVA 1XBTA 2GS9A 3WGUA 3PEWA 1XZAA 5TGDA 2QUAA 4M8SA 3UMRA 3W5UA 2P6MA 3NRCA 3V4ZA 2N1BA 1K9SA 2Q28A 1MZVA 1UKZA 3U0BA 3WP0A 4FHCA 3FVVA 4PYQA 4JYAB 4C4XA 5FTMA 4YALA 2WHYA 1H5NA 2C3MA 1OVGA 3G8YA 3QA3E 2VKQA 2BM9A 4G5SA 2JGIA 5GQSA 1IXRC 1QWSA 2GRAA 2ZJ0A 3CUVA 5BW4A 3PEYA 3NWEA 3FR8A 1VXOA 2IUFA 3HUDA 3N6VA 4BTEA 1F8FA 3AP3A 2QY9A 3ZK9A 1YFZA 1OZFA 3A3YA 3M3PA 5A9SA 3P0FA 4I8XA 3G0CA 1OLUB 2OYCA 5CDFA 1XEWX 3ZCUA 5LPNA 5J23A 4WN9A 2F00A 1KIMA 3N2GB 3RFTA 4KIUA 5DHTA 2QQGA 2JLVA 5AKIA 3U3OA 4IKPA 3DAOA 4FS3A 2VHYA 4UEQA 5AW1A 1G8FA 2QP3A 3G2MA 2JASA 5K3EA 5C5DA 3ZE1B 3D59A 4I50B 5AI6A 2VQSA 2OORC 4IDQA 5LZ2A 4WCDA 2XCRB 3VC1A 1TIKA 1A95A 4BE4A 1OREA 1QRTA 3LT2A 1WHSA 4B4DA 4K2HA 3ZCTA 4DXAA 1KDVA 4LQCA 4E15A 5HOEA 4PTZA 1RWWA 2QKYA 4CGYA 3PL1A 1P0CA 3QE9Y 1N2XA 4WJZA 4XUDA 3W5IA 2CLCX 2BSQA 1RRGA 1VE7A 3NYWA 3ZCXA 4U2BA 4D99A 3QE2A 5BOSA 3MXTA 3MG9A 1CJUC 1I1HA 4TKVB 5C1OA 1JPNA 2EF0A 4JT8A 3KB8A 3OD5A 4MVJM 2OQVA 5K45A 1EVKA 2WEKA 3RHFA 2ZBGA 4FHEA 4C88A 1P3JA 4UJ5A 2ORWA 5DRTA 3EA0A 4P3NA 3EAFA 3IGFA 4HY3A 2FZLA 5E38A 3HYTA 3AOGA 4PBRA 2M6RA 1DRUA 3IPAA 3W3AA 1QYIA 3BXPA 1AGPA 1GZ5A 1PIWA 3THXB 3CONA 1OI2A 2XZOA 2ZIUB 5GONB 2ZKIA 4G9GA 5KHAA 1E1NA 4L8GA 3CQ9A 3KKOA 5HS6A 5FFMA 1ODSA 2P91A 2ZSHA 3IP3A 1IUOA 5DW0A 3W2HA 2CT8A 2I6GA 4PCLA 1AGXA 4TXLA 5JSYA 5DFAA 4EMSA 2O8EA 1IY1A 3RHSA 4FSXA 5FB3A 1JH9A 3AKEA 1WXIA 3A27A 2IOHA 4HNQA 4JCOA 3V8PA 3Q5GA 2P9CA 3RYFA 1O9GA 2O8NA 3DOOA 3GJ3A 3HVUA 1R6UA 3PIIA 2X14A 4ER5A 5BW5A 2J0QA 4ZVLA 4JY7A 4G2NA 5E8JA 4TWZA 1OI7A 4QXMA 4XWGA 1AK1A 2B1JA 5AK0A 3SXUA 2HA4A 4NF2A 3UQZA 2CXNA 5AM0A 4I2NA 1X7YA 3RRXA 1Z17A 3BXZA 1Y5IA 3KUDA 1DC8A 5A6SB 3DS8A 2WHPB 1IUNA 2YIDA 4RZIA 3SN6A 4KKXB 1FTGA 2G3YA 3UA4A 4AQYB 2VP0A 2QPLA 1YGYA 2TECE 2XR1A 1OVMA 3LLVA 3SQLA 4YRSA 1M74A 2O5VA 4YQZA 1JWAB 3H4IA 1GR0A 5EWMA 1AD2A 3PVSA 2O0MA 3AR6A 1FFWA 1CEQA 5IC6A 3VQTA 4KH1A 3K0KA 2VDWB 1GKUB 5DBOA 1QQBA 1NIPA 2I3AA 2NWQA 3MLAA 2IXTA 2G70A 3BTUA 1VIDA 4M1KA 4NU5A 4PQGA 1VMKA 3RTEA 3WNQA 3RRJA 2XB2A 4J1TC 3O95A 4J0DA 4XYLA 3ZDXB 4TT8A 1F4LA 1QK4A 4BS9A 3VTKA 5AKHA 4XUGB 5AM3A 1L5YA 2AQ8A 1L7NA 2GUGA 2J6BA 1ZD2P 3ITNA 1BMTA 3F1KA 1Z0JA 1SHZA 1VBFA 2P9JA 4FNMA 4DIFA 3SMVA 4AP6A 1CY7A 3GLFA 1FB5A 3K3PA 4IDCA 2DF8A 4JLBA 1Y42X 4N6OA 3FDZB 3IP6A 4OHRA 3AUSA 2FMIA 3VZBA 3FHJA 3NS7A 4X00A 3VO8A 1LDMA 1QYWA 4ZT6A 4KQ9A 5HX7A 1GQYA 1TPZA 2V6MA 3VSEA 2DUUA 3BORA 4QNNA 3NAGA 4XPIB 5K7SA 1GPWB 4OA8A 4LF5B 2YR0A 2Z6QA 1JQJC 2O7SA 4OM8A 2X6RA 3DNPA 1EINA 1USUA 1N4AA 2VEDA 4C4AA 4URXR 2ZYWX 2B5VA 3IEMA 2HOQA 3OUTA 3B2EA 4CKZA 3Q1KA 4ZHQF 1QMPA 4NHEA 3PPIA 4PC3A 2X2FA 3D81A 3USZA 1I6WA 4OHZA 1WUYA 4RA9A 4DQVA 5CU7A 2CE7A 1XLTC 3A1WA 3A04A 5IC5A 4WNAA 1G4AE 2AX4A 1LDBA 2FEPA 1O96A 5CFZA 1FMFA 1W0JD 1CDOA 2JKZA 3H2BA 5TMEA 4KI7A 3STYA 1R9GA 2NU6B 4PZ9A 4KN6A 2E6UX 3V4SA 1U8YA 4F6RB 2W6PA 3VHXA 1I3CA 1KGDA 5CG1A 4DWWA 3WLHA 1J8VA 3DOUA 2JGJA 3LLMA 2E4WA 3PC8A 4LBYA 2B9VA 4NS4A 1DRKA 2FWNA 5DYYA 3SVZA 3LLCA 5HCIA 4DTCA 5FEUA 4MINA 2E89A 4IF6A 4QGAA 3BJMA 3A6JA 4JUIA 4YFVA 2O2GA 2WWIA 1C0LA 3O73A 3RS4A 2PZ8A 3ZV4A 5JMTA 5FCDA 5HF8A 4DAEA 5KOJA 4IIDA 4BO3A 3DQQA 4YJ2F 1Y7IA 4E09A 4QXPA 4NBRA 1WVMA 3ZQKA 3GRFA 4IJVA 3DJFA 3MJCA 5U4QA 2NU8B 5B1SA 1N92A 1E2FA 4PHGA 1E2QA 1X19A 2I87A 5G0VA 4BTLA 1C14A 3IQWA 4F46A 1WKVA 3S55A 1Z07A 1WX1A 4RIHA 1GARA 4U6SA 1WF6A 3IMFA 1H22A 1NW5A 4YJFB 2JFBA 1FDIA 3O4VA 3AMVA 1F0NA 4BP9A 5JXJA 5LFAA 4CR7A 4YT4A 1U7XA 1T0UA 4KNVA 2N75A 3RRBA 1OWNA 1V9SA 1FMTA 1A2QA 4GVXA 4IIXA 1SPBS 2GO7A 3WYEA 1THGA 3TQSA 2FH5B 1XHLA 2H1VA 3DONA 2VJDA 1PZNA 1QTNA 4E7PA 4Q03A 4CKWA 2J09A 3SIPA 2WJJA 1LH0A 1KK2A 4TZ0A 1Z73A 5AO9A 1V3UA 1Z2EA 1T36A 3QI7A 2P68A 2R25B 3TUIC 4PYIA 821PA 2FR0A 3QUSA 4MKIA 3WGZA 5IPFA 3OOYA 3Q9NA 1ESNA 1P5RA 4L7QA 4DSTA 1YIAA 3AESB 1I4LD 2QTZA 1G291 2J3JA 3OMWA 3N7UA 5KTSA 2AVNA 1A8PA 4O4HF 3W5CA 2G4LA 3R8XA 3RS0A 1KQNA 1B23P 1BOOA 3GEBA 2JFHA 4KLCA 4NAHA 4N40A 1XVVA 3SDSA 5DYIA 1GLNA 4R7TA 1SRRA 1GUBA 2XE6A 5HWSA 1ODFA 2WNIA 4XWOA 2HIGA 2NV6A 2X0FA 3Q11A 3GG2A 3L1HA 1D5CA 2KYRA 1DRVA 4EF6A 1X15A 2BR3A 2OSVA 1W581 3AVQA 3LBAA 4MVJE 1W4LA 2A5FA 2I7DA 3NHZA 4PCAA 2OAP1 2GZ1A 4E1VA 3UJAA 3CW8X 3JD2A 3GWGA 5JTUA 3ZWAA 2CXQA 2OK7A 3PK0A 3S1SA 2QTAA 2WHXA 3QKRB 2C99A 3KYDA 3D8SA 2BJWA 3FWZA 3KKPA 4W5OA 2PVPA 4PHHA 5D6OA 4K6MA 1LX6A 1U4NA 4DVJA 2YVUA 2ZUEA 2Q4DA 3H6GA 3KOOA 4Q12A 3HKBB 2DULA 1PR5A 4FZVA 2C4UA 1VG1A 4UHKA 2Y66A 1P9NA 3FMVA 4C2TA 1FP7A 1B41A 3W6OA 1N78A 1QO9A 3BXHA 5FUQA 3OSZA 3WV4A 1WL8A 3NHLA 4GPIB 1ILEA 2Z4RA 1KMIY 1YQEA 2Z2XA 2OZKA 2RAVA 2ATIA 4DMUB 1T0JB 5KNCA 3NETA 1O5IA 2EZ4A 5AJUA 1H2HA 3FRIA 3WYNA 1QHFA 3ZVKA 5E9WA 3K9QO 4R81A 3SJ7A 1FTYA 3R0ZA 4M0EA 3W9BA 2YVKA 2WP8J 1M6HA 1PNOA 1DTEA 4GECA 1K86A 5IU6A 4J07A 4BMSA 3CEJA 5KJFA 1JDBB 3CRNA 4TV8A 3NHJA 3QXCA 4PO8A 4WQMA 5DNEA 4HDKB 2WT9A 3ZLTA 1P7VA 1UZLA 3FI0A 3MUFA 4JC4A 2ID8A 2Q50A 3FDIA 4OOFA 4YHBA 4BZQA 2A1TR 5D2CA 2B4YA 1T5SA 4Z0PA 1GQQA 4MWZA 5IC4A 2V1UA 4MPDA 3DLBA 1OT5A 3UOWA 3O8NA 2SKDA 3PWSA 1QFSA 4NSNA 1I8TA 4V38A 1YZNA 2I1QA 4UM9B 2NZVG 3BE4A 2QZJA 3TMKA 1D6JA 1RAFA 1Z16A 4DPKA 1EGHA 1G5RA 1G98A 4JJKA 3ORQA 1SXQA 1I0ZA 1OLUA 3ZHUA 5JC1A 1XO1A 1A76A 1Y89A 2GD0A 3N2GA 5DBFA 1OYVA 3JYOA 1EQ2A 4B7UA 1T13A 4KQMA 1AOXA 1WZUA 2IGTA 1UOPA 1BFDA 3RJZA 4F5DA 1II9A 3KB1A 4P38A 5FQOA 2OPHA 3T52A 1WUHS 3CNHA 2IIQA 3IQIX 3L1IA 3M8KA 3PNMA 1K27A 5CGQB 3UB2A 5KJCA 1FFYA 1ZCJA 1JEJA 3UNXA 1GM5A 3I0ZA 2HDOA 1EGVB 1PQ4A 4MV4A 1OJLA 4FU0A 2KLBA 5FKJA 4KQJA 1XT6A 1A72A 3SJZA 4BP8A 1FFDA 2XODA 1YL6A 2E37A 3B5EA 4MULA 4PQRA 3CIFA 1WCYA 1LEHA 1EP1B 4K9NA 5ALPA 5EZYF 3A2NA 4ALIA 1XTPA 1C80A 2VYCA 1NOKA 4QPPA 3WBJA 1L4MA 4E2YA 1F3LA 1T2DA 4TKVA 4QXRA 3TQFA 3T3OA 2NMVA 4UUPA 1GRNA 4CPDA 3GNSA 4RQUA 1CUUA 4LZWA 1ACLA 4D25A 1TAHA 1CRPA 3MJTA 5TEVA 4Q3NA 3L7OA 2I29A 2PK3A 1PT6A 3TCNA 2B1RA 3PPWA 3ID6C 5HKOA 2WR8A 3DH0A 3THXA 1H2EA 3U09A 4TL6A 3GRYA 4AO6A 5GONA 1UWVA 1KAOA 1E61A 1YQTA 4IOJA 4DUGD 5EXXA 4C0HA 1AG9A 4HRXA 1KL7A 1MOQA 1RYEA 3QU5A 4UHDA 1FQWA 2JGAA 4QBKA 3QFRA 4Q4AB 1DKPA 2G7MC 3FKSD 4MV1A 4S1WA 1U7PA 2CFCA 4RZ3A 5FV7A 3X1YA 4O4JB 3OZDA 3K70C 4M46A 5CTAA 2BJHA 3LOPA 3NAQA 3T4XA 1XPRA 3DF7A 3MMXA 2JJ8A 2JVIA 4M0CA 3WYGA 1LNSA 4DREA 4X6YA 2JCGA 1H66A 2GHTA 4ZAXA 4OXRA 4EG0A 3PYXA 3JQPA 4GZLA 4RXUA 5J1TB 4PQYA 3DE4X 1FUYB 1L5WA 1YVEI 2NYUA 2EZ8A 3H8JA 5E3HA 5A6SA 5HJ2A 2VPWA 2AMLA 3CUUA 1VFNA 1AHNA 2WHPA 4KZPA 5A3SA 3DZCA 4HFNA 4N6NA 3ZOZA 4DB4A 2VQ6A 1OLXB 1YUBA 3GDGA 4B44A 1UC9A 3RF6A 3A26A 4IH1A 4BNYA 4PINA 3BK2A 1FMLA 3M6UA 5EERA 4TWIA 1C2TA 2XUIA 2VSNA 3JR3A 1MVOA 1I3MA 2WE8A 4UFOA 1MH1A 1HL7A 3N0XA 1YFKA 3DEFA 4HWRA 3UF0A 5CW2A 3NR2A 1BDBA 1E2UA 2VDWA 3H04A 3TR0A 4BMNA 5A3QA 1NN5A 2CXUA 3F1LA 4K9OA 4DM3A 3PD1A 1RM4A 4GQIA 1CZHA 5EQFA 5LOVA 4WGGA 3DOIA 4OAOA 1P2TA 5JS8A 2Y0CA 1Q91A 3NDBB 1ADCA 2GJKA 3CZMA 1QF9A 1CY6A 1DBWA 4QICA 5CK5A 1QVRA 4HNVA 2JLXA 5T5QA 3C1UA