4RMOA

Crystal structure of the cptin type iii toxin-antitoxin system from eubacterium rectale
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
b'MIRNGFYIIKDRFFSDMSDPYLKGNKKQNRPHYYCFEDSNYNGIYWMIPLSSRIDKYKKIVSKRTGKGRNCDIIHIVKLDDSHESAFLIQDMFPISDKYIEREYTIAGNHLRLTSEHAAKEIEQKARKVLGMLKRGIKFTPTQPDIQKIYERLQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CptN Toxin
publication title Co-evolution of quaternary organization and novel RNA tertiary interactions revealed in the crystal structure of a bacterial protein-RNA toxin-antitoxin system.
pubmed doi rcsb
source organism Eubacterium rectale dsm 17629
molecule tags Toxin/rna
total genus 41
structure length 155
sequence length 155
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rmoA00
4RMOA 2XD0A 2XDBA 4ATOA 2XDDA 4GLKA
chains in the Genus database with same CATH superfamily
4FYWB 4M7AB 2O2OA 4MZMA 1GCPA 4M7DE 2K3YA 3L2RA 1K4US 1WXTA 4OB3B 1LJOA 1VQPQ 2DYIA 2XDPA 5CKEA 4DBFA 2KYMA 2V8KA 2VGMA 3HSBA 4CC4B 3CEYA 1H92A 5FLXE 5D6WA 1S72Q 1ZSZC 1PC0A 4ELYC 4LE9A 3BY7A 1YJWT 2I2LA 2RJDA 1OYXA 3V8JA 1M5Q1 4IIOA 1VQ6A 1IXDA 2ROTA 3CC4Q 1ZSZA 4UC4A 3A8LB 1OPLA 2RK1A 2ZPEB 1RUWA 4BE0A 3CC2T 1KQ2A 4M78C 2E12A 3CCLA 3DB3A 4DEXA 2CS7A 4M75B 3SWNC 3EFOA 4ELZC 2QAZA 3VRZA 2ABLA 4ZGEB 3RMSA 1FXXA 4M78A 3VU3C 4HCBA 5GMKe 3SWNA 4JLIA 2K4YA 3PTAA 4M7DG 4M78E 2RQUA 1CKBA 1MV0B 1VYUA 5GANh 5J26A 1SF9A 1QCFA 3KFVA 3REBB 2RJCA 1D3BB 2JXBA 1RADB 1LVKA 2LMJA 2LC4A 1W2BP 1VQ5T 2DXCA 4FL6A 2AZSA 4LDUA 3OYDA 3MHXA 4F7UF 3OYCA 2LCCA 2HSPA 2X4JA 1VQ4T 1CKAA 1ABOA 3H0IA 2YUQA 3EG9A 2AKKA 2CSQA 3H0HA 3EG3A 1YFNA 4PFPA 2KRMA 3G4SQ 3OS1A 1D1CA 4M78G 4NL2A 1I8FA 4KGVB 4C0DB 2VC8A 4E2FB 2Z0WA 4LD6A 2ECZA 2V8JA 5GAMh 3VS3A 2Y4XA 2NLUA 1W1FA 4KBMB 2V8IA 1M3CA 2E6ZA 3KUFA 2E70A 4OMQA 1KFZA 2CP5A 3R6OA 5IXFA 4X9CA 5CIUA 3LLRA 4E7KA 2QQRA 2DRMA 2LCSA 2PQWA 1QWEA 5A0DA 3L2UA 3PVLA 2RF0A 1MMNA 3X25B 2YWWA 2BZYA 4D6WA 5I21A 4Q5WA 1JJ2A 5GANf 2FB7A 2NUPA 1TXQA 4L59A 4C92D 3VRYA 5GAOp 4FSXA 5HK3A 5KCHA 3HRSA 5LJ3h 4C8QC 5FRMA 2FZCB 1QVPA 4HXJA 1Z9QA 5FRNA 2HBPA 3EH1A 1WLPB 2K6DA 4C8QA 1H3HA 3FJPA 5KYXB 2ZPGB 2FPDA 4A4GA 1AZGB 1TOVA 3CXCP 1VQPT 2K5FA 4C8QE 2W10A 1YN8A 2IIMA 2GGRA 2LT4A 1K1ZA 5GAOl 4WF2A 5LJ5e 1G83A 2W0ZA 1TU0B 3Q1JA 8AT1B 2CZ6B 3JAME 4XAXB 2IG0A 5KYNA 3HL8A 2BZ8A 3C12A 4II1A 4IUPA 3JCMQ 3M0SA 1D09B 2HL5C 5GAN4 2JN0A 3X26B 2DVJA 1NLPC 5GAOr 1QVFS 1UHCA 1YJWA 1YHQT 4DOVA 3CPWS 4JS4A 5GAN3 2CDTA 1X43A 1WJSA 3BDUA 3PVQA 4LDYA 2XMFA 3TCJA 1OULA 2L3QA 4ME7A 4JJDA 3CC2A 1XJWB 3F70A 4F7UB 3CCJT 2J6OA 1UGPB 1GFCA 1PG5B 2RQRA 4EIKA 2DA9A 2VUBA 5GAOq 4DA4A 3HRTA 3CBOA 5L23A 1Q7YR 3NHNA 5CQYA 2DL3A 3M57A 2QA4Q 3TVTA 3VJPA 1QQJA 4PJOD 1RAEB 2CT3A 5LJ3f 2XK0A 1OZ3A 4ZGDB 1X6BA 1YJ9Q 1KSWA 1VYTA 3L2ZA 1UGSB 4TVRA 5CKHA 5A0LA 3ME9A 1O75A 1VQ5A 3I35A 4AFZC 5CCAA 1JEGA 1JRIA 1FMWA 4B9WA 1AWJA 2DRKA 2RJFA 4RTTA 1VQ4A 5HY6A 5A2QE 4C92G 3GP8A 3ER0A 4PJNA 2M02A 3OYLA 2E41A 4O6JA 3G6EQ 2CP3A 3P8BB 4XTWA 2PUOB 3SFMA 4J9BA 1WHJA 3JB9D 1VQOA 3A8OB 3CMAQ 1M1KU 2FPFA 2DBMA 2GFUA 4A4KA 2LJ3A 1RI9A 1WQ7A 2WSFE 2RHZA 2PNIA 1IRXA 1M3BA 2EYWA 1I1JA 1CSKA 4A4HA 3LH5A 2DEUA 2AK5A 2EQJA 1Y0MA 4JS5A 2RMOA 3NPFA 2EJGA 1M1KC 3HHTB 3RKYA 3L2QA 1JU5C 4JRPA 2XDDA 2AZVA 1ZUUA 4KGXB 3VKIA 5GAMg 2PUKB 2O9VA 3QWXX 1VQMQ 5FWCA 3U23A 1I81A 3A98A 2QASA 1QCNA 2BKDN 4IURA 3QYGB 5FROA 3JCMJ 3JB9F 4M7AD 1YITQ 2LQNA 3X20B 1BBZA 4IUUA 3THKA 5GANe 4PJOG 3OYHA 4BE2A 4XK8E 1NLOC 4D8DA 4E7HA 3QJYA 2EW3A 1T0JA 2O31A 2P4TA 5DLQE 2ED1A 1QVGS 2CT4A 4Z02A 2F5KA 3H9NA 4PLIA 3C94A 2AKLA 3JCMg 3V8KA 1N8RU 3A8MB 3VV0A 2O9SA 3OYEA 3MEWA 1KC8U 4DBRA 1K9MU 1YHQA 1AEYA 1K73R 2DXUA 3EGUA 5KE2A 2SEMA 1JQQA 3VYGA 2MAMA 1QVFP 4M75D 1YI2T 4C5HA 3CCJA 4K11A 2A7YA 4N4GA 2G6FX 4YTLA 2VWFA 2QDYB 4HVUA 3CCST 1G3YA 4M7AF 1QKXA 1KC8C 2C0IA 4XTVA 1V1CA 3VS2A 1K9MC 1HJDA 5ECAA 1A0NB 1KG1A 1O9SA 4J6WA 4RMOA 3SDZA 5IHNA 2K2MA 5GAMe 5D6YA 1M3AA 1YJ9T 3LW5E 1WGSA 1RABB 1KIKA 3RBBB 2YDLA 1VQKQ 4BDYA 3CCMQ 1VQ8Q 3CCQQ 3JB9H 2DERA 3LGLA 2JTFA 3GNGA 5J3BA 3CCEQ 2B86A 2J7IA 1H8KA 5J39A 1M4ZA 2F69A 4AG2C 1M9SA 2JM9A 1IZ6A 4EPCA 1ZLMA 4KT0E 1AT1B 2JZ2A 2F2XA 3C95A 4OB1B 1YWPA 1MNEA 5GMKi 1Q95G 1WI7A 4M75F 1UHFA 2EQKA 3FJ5A 5LJ3e 2R5AA 3RNJA 1VQ9Q 4RTYA 1DJ7B 3CD6A 3OS2A 3OYKA 5FU6B 1IGQA 4IUQA 4BY6B 3I55Q 2SRCA 2ZZDA 3JCMe 2KXDA 3MP1A 4A53A 1PD1A 1M90U 3INZA 3VS6A 1J3TA 4KGZB 2HZYA 2D0NA 2RNAA 1NYFA 1Q81R 3OYFA 4J7FA 2WSEE 4A63B 4E47A 2DL5A 2X51A 1D3BA 2ZAEA 4XTZA 2GQIA 2JMCA 3RESA 4BUGA 3KXTA 2LRQA 3NTIA 1SSFA 4R56A 3CCVQ 2V26A 1M2VB 2ATCB 3OW2P 1AVZC 2EKOA 3QJ6A 1M90C 2F2WA 2HQXA 1BB9A 4LUDA 1VQMT 1PD0A 2CZ1B 1KD1R 1HYOA 1KQSS 2P0QA 3CBMA 5GAOm 2RQWA 3GF5A 2LVMA 3DLMA 4N4HA 2H8HA 4EMKB 2MMPA 3S3NA 1HK9A 3BW1A 5KYYA 5C0MA 1YITT 1WZOA 4CC3A 2OTJA 2GQVA 2KDSA 3C0CA 4J9FA 4R55A 2M51A 2NUTB 1YJNQ 3KBGA 4M77F 3H6ZA 2GF7A 2E5KA 4J9EA 1Y96B 1M1KR 3EHQA 2DF6A 2CKKA 1FYNA 4J8OA 2NYSA 4ZGJB 4QVDA 4GLMA 2ROLA 1GBRA 2QQ9A 3G71Q 2KR3A 1U5SA 2P0KA 1I07A 2C0TA 3BDLA 2O4XB 3J80E 3FC3A 3T9NA 3CCRQ 4C5IA 1UG1A 1ARKA 3EGDA 1D0YA 3QPHA 5KYUA 1ABQA 1B7TA 2V1RA 2BIVA 1YI2A 3NTHA 2H3JA 2X4XA 1EX4A 1YCSB 4BI4A 3CCSA 1G3WA 1WYXA 3QZ5B 2EYZA 5GAN6 2VASA 2FPEA 1HD3A 1YWOA 3UPUA 4JDSA 5AT1B 2L89A 2F5TX 2DIQA 2PVOB 2B8AA 3E19A 3CC7A 3H0FA 1Y71A 4XTYA 2DNUA 5IHKA 2L5QA 3PIPA 3CCMT 2KEAA 2M1HA 1NM7A 1VQ8T 1ZBXA 3CCQT 1B34B 5CK9A 1MMGA 2DFUA 5LJ5d 4R0KA 2JUFA 2ZPIB 3P8DA 4AT1B 1X69A 4B6MA 2HSEB 3QG1A 2KVQG 5FU7C 1UFFA 4A4FA 1EIFA 4F16A 2QEXT 2YRDA 3VS4A 1IREB 1PRMC 3OW2A 4HT8A 4OGEA 2E3HA 1OQKA 3M59A 1OU8A 1BCOA 5LJ5g 3I55T 2V1QA 1NG2A 3L2VA 1B3QA 2DMOA 4RG8A 1PM3A 1XOVA 1YP5A 2FHDA 5FWBA 1PSEA 4QT7A 2E5QA 2QTVA 2EVRA 2FL7A 2H3EB 1F1BB 3RUXA 1ZQ1A 4ZN3A 1H3ZA 1WX6A 3I5RA 3M9QA 4MZPA 3CCUT 2RM4A 1NJIU 1FX7A 2E6NA 1D1AA 5IHIA 3QZ9B 4JRIA 4M77B 1VIEA 2I0NA 3M0RA 4KH0B 1I5LA 2YRVA 3FRNA 3LH0A 1OPKA 3TREA 1Y7XA 2VV5A 2DIGA 2F1LA 1M30A 1I0CA 4M7DB 5DM7R 1MNDA 1X27A 1K9AA 5GAN2 4JJNK 4C5GA 4F7UG 1QKWA 4OB2B 4J9HA 4PNOA 5IN1A 2D0QB 3S6WA 3X28B 1YIJQ 3V7SA 1RLPC 4Y91A 1KQSP 2CYZB 4BB7A 3QBYA 1VQNT 1RLQC 3M0TA 4XU2A 3DKMA 2L8DA 3LYIA 3J7AF 1QWFA 1U3OA 1YITA 3EH2A 1KK7A 1D0ZA 2EYQA 2E64A 2F2VA 1VQ7Q 4BDZA 4E6RA 4ESRA 4ATOA 1EFNA 3C4SA 3RMQA 4AMCA 2KYBA 1ZSZB 3LWHA 1RAGB 2YUPA 4CRIA 3MCAB 3V8LA 1M90R 1H641 1X6GA 4HVVA 3M5AA 1BKBA 3JCMW 2YSQA 3SD4A 3JCMc 1E7OA 2EGEA 1Q86U 2CH4W 4IUTA 2YUNA 3EFOB 1S72T 4E7IA 2C06A 2MI6A 2Y4YA 4BD3A 2FZGB 2DZCA 4M78B 2CZ7B 2D9TA 2XHCA 2QXFA 3EG1A 3LGFA 3SWNB 4GY5A 1QP2A 3CC4T 4C92C 5GMKl 2P0PA 4CC2A 2MWPA 2JNGA 2K9GA 1W2BA 4J9GA 2LCLA 4QQ6A 4C92A 3HRUA 4CI0C 2HAXA 3EFRA 4ZNXA 4C92E 3I56Q 2OI3A 1WJRA 1TSFA 4DQ2A 5FW9A 3OYIA 3HPWA 4J7IA 1VQ6Q 1VOMA 5KYWA 3CCMA 2DAQA 1VQ8A 5GANd 1M1FA 4C0GA 3VS5A 4EMGA 3CCLQ 1X01A 2CUBA 4RTWA 2MOXA 4LN2A 4XU0A 1B07A 2OAWA 1YCYA 3M54A 1E6HA 2XG8D 4C5EA 2JMAA 3EGXA 3ULRB 5HCKA 4AFQC 2KBTA 2DTIA 2MYSA 5EC7A 2QEXA 4A4EA 1K8AU 2DEQA 4MMLA 1X75C 4RCCA 4KRTA 5CQXA 4NL3A 4JRQA 1OX9A 5GANg 4LNPA 2XD0A 4Z8AA 1NZ9A 1XTDA 5I11A 1UUEA 3L1AA 3G4ST 2K2VA 1R0BG 1ZHIA 2KK4A 3MPUB 3VUBA 2EKHA 2HBWA 2BTTA 2DE0X 3E9FA 4CC7A 1Q82U 3URGA 4PJOC 4DEYA 2O88A 3QSUA 4QQGA 3CCUA 1AWOA 3A1PA 4Z89A 2FYKA 2R5MA 2NUPB 3BFMA 4OMPA 5GAMd 1XQHA 4X34A 4KUIA 1U1TA 4PJOA 2VXEA 4FCYA 3CXCA 1NEBA 1M8VA 2HQHA 4PJOE 2KRSA 2A36A 2RA2A 4PJLA 3S3OA 1IHWA 1WHLA 2RO0A 1Q82C 1R77A 4C8QB 1NYGA 3H41A 4JRKA 3J81E 2EYXA 1WPYA 2NUZA 3HFOA 1BIBA 1PCXA 1UTIA 4J5YA 4QKUA 1VQNA 2KI7A 4AFSC 4XTXA 5LJ3d 1PHTA 5IXBA 1G8XA 3PFSA 1N9SA 1YBYA 3UF4A 3OB9A 4QVZA 3JCMd 1ZBJA 3TU4K 3ZL7C 1WFWA 1VQPA 4RKUE 1R0CB 3UT1A 1M2OA 2CGHA 1U06A 4ANJA 3NFCA 2WACA 5DLOA 1GRIA 5LJ3g 1UECA 3RKXA 1SEMA 1S72A 1QCOA 3P8HA 4ZTJA 2PU9B 2KNBB 3E9GA 3M4YA 3OBWA 1SRMA 2EYYA 2YXYA 1WXBA 3CC4A 3REAB 4AFUC 3MJXA 3OS5A 1HXDA 4LXCA 3PT9A 1GL5A 1FMVA 2KAFA 4PFZA 1JJ2S 2EBPA 3BE3A 3OYJA 4IKFA 4A54A 5GJWB 1WHHA 2IVWA 4FM4B 1GBQA 3CPWP 4DOWA 1RAIB 5GAOn 2XICA 2E1HA 3I56T 1FMKA 4M7AC 3MEVA 3E2UA 3VYHB 3QKJA 2E4HA 8ATCB 2QGFB 2CREA 5I22A 2A3LA 1KJWA 1N8RC 4OF1A 1NPPA 4M7AA 2QA4T 1VYVA 3JB9G 1YJWQ 2QQBA 2VYTA 1OEBA 6AT1B 2EAYA 4HCKA 3JCMP 3CCLT 2LT1A 4M7AE 1LPLA 4MZTA 3HKSA 2OTLQ 1BU1A 1NE8A 4ZTFA 5HKCA 3CC2Q 4OB0B 2AHJB 3TSWA 2ZPHB 4BE1A 2K3BA 4FSSA 2E10A 1WDXA 2BZXA 2VKNA 2JOYA 1I5OB 3NMZC 1RAFB 2OAUA 1OX8A 2D1XA 4M75C 4OMNA 1GFDA 3G1JA 2A0FB 3GPLA 4DBQA 3NTKA 4M75A 3G6ET 4L5GA 4JPBW 2KXCA 2RI2A 5CKDA 3LWIA 2JW4A 3G4SA 3A5ZB 1W6XA 4JZ3A 4M75E 2BE7D 1IHVA 1RL2A 3CMAT 1VQ5Q 3ASKA 3M0UA 1IO6A 3TQ7P 4M7AG 1E6GA 2PVGB 4M77D 2LQ8A 3X24B 2CP6A 2E3IA 4FW2A 3JRZA 2DL8A 1M8MA 2DXTA 1MV3A 3E1SA 1ZA2B 5DY9A 1EZZB 5M9OA 4M7DD 5GAN7 1VQOQ 1TS9A 2GTOA 3OY9A 2DBKA 2L0AA 2QQSA 1WNLA 4LDVA 1UGVA 4BACA 1S1NA 2MPXC 3L2WA 2O01E 2RHIA 2RI3A 1N27A 4M75G 1UDLA 2LX7A 4C0DC 4OMLA 1HSQA 5KE3A 1TUGB 2LNHB 1QVFA 3CPWA 3ZEHA 4J9DA 4HA8A 3EG2A 4J6XA 5GMKm 4OGCA 2ZPFB 5C6SA 2PTKA 2ENMA 1UJYA 4RTVA 2LX9A 2DL4A 4J9IA 5A0GA 5D7UA 2RQTA 4LDWA 1Q7YU 2CZ0B 4PFOA 3GNFB 5LL6S 1G5VA 1V29B 4M78D 1T3SA 1GCQC 4RCBA 2CH4A 3JV3A 4M7DF 3D7SB 3EHRA 2DVEA 3QDFA 3ZBDA 1GCQA 1C0MA 5GMKj 4OMMA 4PJMA 1QVGP 2KQWA 3OS0A 5CAIA 3UDCA 3ZFJA 2DD4A 2XDBA 2GCXA 2COWA 3QYHB 1Q7YC 3M0PA 3WVEB 1JJ2P 3I56A 2HCKA 2LZ6B 4FIBA 4PK4A 5KYXA 4GLKA 2GBQA 3QXEB 2JTEA 3AHUA 2QA4A 1SG5A 1YHQQ 3DLLA 2EJFA 3EG0A 5HK0A 3JCMX 4JZ4A 2HDAA 4XQ3A 2OTLT 2JS2A 2QG9B 4M77G 1KHIA 1VQKT 2NWMA 1BI1A 1YJ9A 2KGTA 3CMEQ 3LX7A 1TG0A 3CCET 5CO7A 3CCJQ 4M78F 1JBMA 2DXBA 3HFNA 1WHGA 2QQAA 4KH1B 2HEQA 3QUIA 1VQLQ 3RKWA 4FU6A 1GXIE 2HMAA 2FRWA 2KY9A 4EDUA 1N8RR 4F7UA 1VQ9T 1KC8R 2D6FA 1K9MR 1Y07A 4OMOA 2RI5A 3G6EA 2JTMA 1IB8A 4F7UE 1QLYA 2DK3A 2DZ9A 4PLLA 2CP0A 3CMAA 1NBEB 3QO3A 1RAHB 1SKUB 2J6FA 4HVWA 2RD1A 1YNZA 1K76A 1SRLA 1FWZA 3OBYA 3R6NA 2X3XD 2JS0A 1Y57A 2HQEA 2COYA 4RG2A 1SSHA 1WA7A 3UWNA 1TWBA 2FEIA 1QP3A 1TTHB 1U1SA 3CD6Q 2OJ2A 3CCVT 3O8VA 2JM8A 4C8QD 4F04B 3EFSA 2YLBA 1N5ZA 3H8ZA 3WVDB 5KYYB 1VQOT 3PE0A 4O5VA 2A28A 1OU9A 2DILA 4OMFB 4QW2A 3GOXA 1C6VX 1G3TA 1VIFA 1X2KA 2LJ0A 1VQMA 3OYGA 1NJIC 3UA7A 1UGRB 1ZX6A 2M9UA 1MMDA 3MO8A 5LJ5j 1N9RA 1QVGA 1X2QA 2YT6A 2DKGA 1R8OB 3OYBA 1NEGA 2EIFA 4BI3A 2L3PA 1BI2A 1K73U 1AZEA 4BI8B 1T3LA 2WSCE 1YJNT 1W70A 3GBQA 3JB9J 1LOJA 4J6YA 3N5BB 4EMHA 3CBPA 4QQDA 3V7RA 2A08A 3EGDB 2RQVA 2KSSA 4XU3A 1LCKA 3SHWA 5KYUB 3JSCA 3PGGA 2EQMA 2J06A 2A37A 1SHGA 4HKEA 2K3XA 2K5IA 3G71T 3JCMV 4C8QF 1K73C 1ACMB 3JCMh 2OTJQ 4HCCA 3VS1A 2RN8A 2DX1A 1TUDA 2M16A 3CCRT 3TSZA 4PKCC 3VUZA 2COZA 2R57A 1RI0A 4M4ZA 2X3WD 3A8GB 3HTRA 1AHJB 2VVKA 4FYYB 3PMTA 1ZSGA 2YRCA 3OMGA 2DTOA 1Q86C 5L8RE 1X6OA 5CKFA 3OSSC 1OZ2A 2HD0A 1JB0E 3RIRA 1RACB 2MWOA 2FZKB 5GAMf 2HKQB 3PMIA 1UB4A 3MKDA 2X4YA 2HKNA 4C92F 1BIAA 3AT1B 3CMET 2OTLA 1D0XA 1BI3A 4B9XA 1VQKA 3QIIA 5FU7B 3V7CA 3PNWC 3CCQA 1YI2Q 3EG9B 3CCEA 2QGGA 1G3SA 2M0YA 1VQLT 4C8QG 1BYMA 3M56A 1Q81U 4X9DA 3CCSQ 4MDXA 2ZGWA 1AOJA 2LQWA 4PJJA 2KT8A 1PKSA 3VS0A 2X35A 9ATCB 2LNVA 3CC7Q 1Z9ZA 4MMKA 3M4GA 2EGAA 1VQ9A 3M55A 4Y92A 1AWWA 1ZUYA 1UGQB 2RHUA 1JXOA 2GNCA 4WCIA 1WXUA 1XNIA 1RAAB 2E65A 3CQTA 3I55A 3JCMf 1KD1U 4JLGA 5CR2A 4XU1A 1V76A 1Q81C 4LUEA 5I2SA 5EG2A 1ZUKA 1KQSA 4F17A 3SB2A 2LP5A 2MIOA 2MK5A 4DBHA 1K8AC 2JVVA 2RPNA 1IGUA 3CD6T 3EAEA 2VGNA 1QW1A 2KE9A 3JCMb 2DJQA 2CSIA 2HNIA 4N0AC 1MGQA 2PVDB 2LJ1A 2M0OA 1KD1C 1PRLC 2BE9B 2FVUA 3CCVA 4JJCA 4N0AA 1WQWA 5GMKh 2ZCFB 2MCNA 2FO0A 1WHMA 1K0XA 1VA7A 3UATA 1LNXA 4PJOF 5FU6C 2DL7A 4NS5A 4BY6C 3MEAA 1YIJT 5GANj 3OW2S 2RHXA 2QTXA 2ZPBB 2RHYA 5GAN8 3MP6A 2K5LA 3FLGA 3MP8A 3OYNA 2Y90A 2IPOB 3O5ZA 2P84A 4HT9A 1VQ7T 3RERA 1SPKA 1YJNA 2QI2A 2RH2A 1P92A 3JB9I 1TH7A 2L3RA 5I2MA 3FDRA 2GFAA 2DYBA 2XI9A 4N4IA 1OV3A 1T0HA 2R58A 4J9CA 3OSVA 1U8RA 3DB4A 2FRYA 4RTXA 2MF2A 4VUBA 4C92B 2RK2A 2EPDA 1NJIR 2RB6A 4Y28E 2OTJT 3G71A 1M2VA 3PIOA 2J05A 2JT4A 2EQIA 4EMKC 3CCRA 3I9QA 2QYZA 5GAMj 5KYWB 4L6V5 2XKOC 4EMKA 4LD9K 3UA6A 4FYXB 2X9HA 1PNJA 2EJ9A 1JXMA 3WXMB 1G2BA 4F14A 2DPPB 3VS7A 2KRNA 2YUOA 2VB6A 2LDMA 1OI1A 2NUTA 4D8KA 2X4WA 1BI0A 3EGXB 4MDWA 3SEMA 2VXFA 3L42A 2D8HA 2CP2A 2YLCA 1VQ6T 4IUVA 2DTHA 1Y96A 2FG0A 1PWTA 3CMEA 4ZN1A 3CPFA 2GTJA 4V2SA 1W4SA 1WHKA 3A8HB 3M53A 1JO8A 2DLPA 5LJ3j 2LTOA 2P4RA 1AWXA 2LQKA 2DM1A 1MUZA 2EGCA 1VQLA 1BK2A 1I4K1 2O4XA 3HP9A 4GBQA 4FT2A 3M0QA 4ORZA 3FB9A 1Q86R 1BCMA 3CC7T 1PSFA 3META 1MMAA 1QMCA 1SHFA 1UEBA 2EWNA 2ED0A 5GAN5 4OP0A 5LJ5h 2BUDA 2RJEA 2DETA 2XIDA 4AG1C 4RUGA 4PJOB 5IH2A 1ZA1B 1W2BS 3QWYA 3FEOA 2AIRB 2DO3A 4Z88A 2CUDA 2DD5A 2G3RA 1WIEA 1PKTA 2KMTA 4OVAA 4WTOB 4FYVB 2C0OA 4KULA 7AT1B 2QEXQ 5IAYA 2PZ1A 1B34A 3TEEA 4QVCA 2K79A 5AYFA 1KHCA 1N6AA 1TUCA 2KT1A 4X1VA 1VQ4Q 2EQUA 4E7SA 5IT9E 4E7LA 2YHTA 2HL3A 1MHNA 2CP7A 3MEUA 5GJVB 1VUBA 2ESWA 5CKBA 4XTUA 1UJ0A 5KCOA 3RR6A 2KROA 1K0SA 2L3SA 4J83A 1OOTA 4IIMA 2XU8A 2J6KA 4P5NA 4HCZA 3CCUQ 5D6XA 1YIJA 2K7AA 1KQ1A 3M58A 4C0ZA 2QK0A 1K8AR 4JJBA 3S3MA 2K57A 4E7JA 2EFIA 3OYAA 3RDVA 4LDXA 1UE9A 2L2PA 4FW1A 3OMCA 1VQ7A 1AD5A 4M77C 4JUVA 4PL6A 3QHSA 2OX7A 2DJZA 4RTUA 3QDRB 5LJ5f 2D8JA 3FIFA 4M77A 4RTZA 1Q82R 3OYYA 3OA6A 4NOYA 1M1GA 2JJ9A 3OYMA 1VQNQ 4C0FA 4M77E 3I5SA 4M7DC 1M27C 4FT4A 1C1AA 3GLXA 3CXCS 4E7ZA 4KUDK 3NGPA 3OQ5A 1D1BA 3IQLA 3G7ZA 1WJQA 5KH6A 4M7DA 5CVIA 3GIBA 2QDLA 1NPRA 2AT1B
chains in the Genus database with same CATH topology
1UGRB 4M7AB 2M9UA 4M7AF 4MZMA 2K2VA 1KC8C 4XTVA 1K9MC 3MO8A 5LJ5j 2K3YA 1N9RA 3L2RA 1QVGA 4M7DE 4OB3B 1LJOA 1O9SA 1ZHIA 2KK4A 4J6WA 3VUBA 4RMOA 2DKGA 3SDZA 2XDPA 3E9FA 5CKEA 1R8OB 1Q82U 5GAMe 3OYBA 5D6YA 2V8KA 2EIFA 4BI3A 3URGA 1BI2A 1K73U 2VGMA 1YJ9T 4PJOC 4BI8B 3LW5E 1WGSA 2WSCE 3QSUA 4QQGA 3HSBA 3CCUA 4BDYA 1YJNT 2FYKA 3CEYA 5FLXE 5D6WA 3JB9H 2R5MA 5GAMd 3BFMA 3LGLA 3JB9J 2JTFA 1LOJA 1XQHA 3GNGA 4J6YA 1U1TA 3N5BB 4KUIA 4X34A 5J3BA 4EMHA 4ELYC 4PJOA 2VXEA 3BY7A 3CBPA 1YJWT 4QQDA 2I2LA 5J39A 2RJDA 3V7RA 2KSSA 1OYXA 4XU3A 1M4ZA 1M5Q1 3V8JA 3CXCA 1VQ6A 2F69A 1M9SA 3JSCA 1M8VA 3PGGA 1IZ6A 4UC4A 3A8LB 4PJOE 4EPCA 2EQMA 2RA2A 2RK1A 3S3OA 2ZPEB 4KT0E 4HKEA 2K3XA 2RO0A 2JZ2A 2K5IA 4BE0A 3G71T 1Q82C 3CC2T 1KQ2A 4M78C 2E12A 3JCMV 3DB3A 3C95A 4OB1B 3CCLA 4C8QB 4C8QF 1K73C 4JRKA 3JCMh 2CS7A 4M75B 4M75F 3SWNC 4ELZC 5GMKi 4HCCA 3CMAT 2EQKA 4ZGEB 3J81E 5LJ3e 3RMSA 2R5AA 1FXXA 4M78A 3VU3C 1DJ7B 2M16A 4HCBA 3CCRT 3CD6A 4PKCC 1WPYA 3VUZA 3OS2A 3OYKA 5FU6B 5GMKe 3SWNA 3CC7T 3HFOA 4JLIA 1BIBA 2R57A 1RI0A 4IUQA 4BY6B 4J5YA 2K4YA 3PTAA 4M7DG 4M78E 1VQNA 4XTXA 5LJ3d 3A8GB 2ZZDA 3JCMe 1AHJB 3PMTA 3MP1A 4A53A 1M90U 3INZA 3PFSA 5GANh 5J26A 3OMGA 1N9SA 2DTOA 1Q86C 1YBYA 5L8RE 3OB9A 4QVZA 3JCMd 1X6OA 5CKFA 3OYFA 4J7FA 2RJCA 3OSSC 1OZ2A 2HD0A 3TU4K 2WSEE 1D3BB 1JB0E 4E47A 3RIRA 1D3BA 2MWOA 5GAMf 1VQPA 4XTZA 3PMIA 4RKUE 2LC4A 1UB4A 3RESA 4BUGA 3KXTA 3UT1A 2LRQA 2X4YA 2CGHA 2DXCA 3NTIA 4FL6A 1VQ5T 3NFCA 4C92F 2WACA 5DLOA 1SSFA 1BIAA 4LDUA 4R56A 3OYDA 3CMET 2OTLA 3MHXA 5LJ3g 1BI3A 4F7UF 4B9XA 3OYCA 2EKOA 2LCCA 3QIIA 5FU7B 1VQKA 2X4JA 3QJ6A 3RKXA 3V7CA 1VQ4T 1M90C 3PNWC 3CCQA 1S72A 2HQXA 3P8HA 3CCEA 1VQMT 2CZ1B 4ZTJA 2PU9B 1KQSS 2P0QA 3CBMA 1G3SA 5GAOm 3E9GA 3M4YA 3OBWA 1VQLT 4C8QG 3GF5A 1BYMA 3M56A 3CC4A 1Q81U 3OS5A 4X9DA 4MDXA 1HXDA 2LVMA 3DLMA 3PT9A 2ZGWA 2KAFA 4N4HA 3OS1A 4EMKB 2MMPA 4M78G 3S3NA 1JJ2S 1HK9A 3BW1A 3OYJA 4IKFA 2X35A 4NL2A 4A54A 2LNVA 5C0MA 2IVWA 1I8FA 4FM4B 1YITT 4DOWA 4MMKA 4C0DB 2OTJA 2VC8A 4LD6A 3M4GA 5GAOn 2XICA 2E1HA 2GQVA 3I56T 1VQ9A 2V8JA 3MEVA 4M7AC 3M55A 2KDSA 5GAMh 1UGQB 2RHUA 2Y4XA 3VYHB 4R55A 3QKJA 2NLUA 3KBGA 2A3LA 4M77F 1XNIA 3H6ZA 4KBMB 2E65A 2V8IA 2E6ZA 2GF7A 3JCMf 3I55A 4JLGA 5CR2A 1Y96B 1N8RC 4OF1A 1KD1U 3KUFA 1NPPA 2E70A 4XU1A 2QA4T 4M7AA 3JB9G 1Q81C 2QQBA 3R6OA 2VYTA 5I2SA 2CKKA 5EG2A 1KQSA 4J8OA 2EAYA 4ZGJB 4QVDA 3SB2A 4X9CA 5CIUA 3JCMP 3LLRA 3CCLT 2LT1A 4E7KA 2QQRA 4M7AE 2PQWA 5A0DA 3L2UA 4MZTA 3HKSA 2QQ9A 1NE8A 4ZTFA 5HKCA 3X25B 1K8AC 2JVVA 4OB0B 2AHJB 2ZPHB 4BE1A 4D6WA 5I21A 1KG1A 4Q5WA 1JJ2A 2P0KA 1NPRA 3CD6T 3EAEA 2VGNA 1QW1A 2FB7A 2E10A 3BDLA 3JCMb 2O4XB 5GANf 3J80E 2HNIA 3FC3A 4N0AC 2JOYA 4L59A 3T9NA 4C92D 1MGQA 2PVDB 5GAOp 4FSXA 2OAUA 2M0OA 4C5IA 5HK3A 1KD1C 5KCHA 2FVUA 3CCVA 3HRSA 5LJ3h 4C8QC 3QPHA 5FRMA 1QVPA 2BIVA 4M75C 4N0AA 1WQWA 5GMKh 1YI2A 2ZCFB 3NTHA 2HBPA 5FRNA 2H3JA 2X4XA 3GPLA 4C8QA 3FJPA 1LNXA 4PJOF 5FU6C 3NTKA 4M75A 4BI4A 3G6ET 2ZPGB 4NS5A 3MEAA 4L5GA 4BY6C 4A4GA 3CCSA 2RI2A 5CKDA 3LWIA 1YIJT 3G4SA 1VQPT 1G3WA 2K5FA 3A5ZB 3QZ5B 4C8QE 5GAN6 2RHXA 2QTXA 3OW2S 5GANj 2ZPBB 4M75E 3UPUA 2LT4A 2RHYA 4JDSA 2L89A 5GAN8 2F5TX 2DIQA 2PVOB 2B8AA 1RL2A 3E19A 2K5LA 3FLGA 3MP8A 3MP6A 4WF2A 5LJ5e 1Y71A 4XTYA 3OYNA 3Q1JA 3CC7A 2CZ6B 2L5QA 2Y90A 3ASKA 3JAME 3PIPA 4XAXB 2IG0A 3CCMT 4M7AG 2M1HA 1VQ8T 1ZBXA 3HL8A 3CCQT 1B34B 2PVGB 3C12A 4HT9A 4II1A 1VQ7T 4IUPA 3JCMQ 4M77D 3RERA 5CK9A 2LQ8A 2QI2A 3X24B 5LJ5d 1YJNA 2RH2A 1P92A 5GAN4 2JN0A 3JB9I 2JUFA 2ZPIB 3P8DA 3X26B 1TH7A 2L3RA 5I2MA 3JRZA 5GAOr 3FDRA 2GFAA 2XI9A 3QG1A 4N4IA 1YJWA 1YHQT 1QVFS 4DOVA 3CPWS 2R58A 3OSVA 2DXTA 1U8RA 2KVQG 3DB4A 5GAN3 4JS4A 5FU7C 3E1SA 3BDUA 1WJSA 2MF2A 4LDYA 4A4FA 4VUBA 3TCJA 5DY9A 1EIFA 2RK2A 4C92B 5M9OA 2QEXT 4M7DD 5GAN7 2RB6A 4ME7A 4Y28E 3F70A 3G71A 1IREB 3CC2A 5GAOl 4F7UB 2OTJT 3OW2A 4HT8A 3PIOA 4OGEA 3CCJT 3OY9A 3M59A 1UGPB 2QQSA 1WNLA 5LJ5g 4LDVA 2VUBA 3I55T 4EMKC 5GAOq 3CCRA 4DA4A 3HRTA 3CBOA 3L2VA 4BACA 4RG8A 3L2WA 2O01E 2RHIA 1XOVA 2RI3A 1N27A 5CQYA 2FHDA 4M75G 4C0DC 1PSEA 5GAMj 3M57A 4L6V5 2E5QA 2XKOC 4EMKA 4LD9K 2FL7A 3RUXA 5KE3A 1ZQ1A 3VJPA 1QVFA 4PJOD 4ZN3A 1H3ZA 2EJ9A 3CPWA 5LJ3f 2XK0A 3WXMB 3M9QA 4MZPA 3ZEHA 3CCUT 2DPPB 1OZ3A 1FX7A 2RM4A 4HA8A 2E6NA 4J6XA 4ZGDB 5GMKm 1NJIU 3QZ9B 4OGCA 2ZPFB 5C6SA 3L2ZA 1UGSB 2LDMA 4JRIA 1OI1A 4M77B 1VIEA 2X4WA 1BI0A 4MDWA 4TVRA 2VXFA 3L42A 5CKHA 5A0LA 3ME9A 2YLCA 1VQ6T 4IUVA 2DTHA 2LX9A 1Y96A 1O75A 5A0GA 1I5LA 2YRVA 3FRNA 1VQ5A 5CCAA 4LDWA 3LH0A 1Q7YU 1JRIA 2CZ0B 4B9WA 3CMEA 3GNFB 5LL6S 4ZN1A 1G5VA 1V29B 3TREA 1Y7XA 4M78D 3CPFA 2VV5A 2DIGA 2RJFA 4RCBA 1VQ4A 5HY6A 1W4SA 4V2SA 3A8HB 3M53A 4M7DB 4M7DF 5DM7R 5LJ3j 5A2QE 2DVEA 4C92G 2LTOA 3ZBDA 3GP8A 3ER0A 5GAN2 2LQKA 4JJNK 4C5GA 3OYLA 4F7UG 5GMKj 2E41A 4O6JA 1VQLA 1I4K1 2O4XA 3HP9A 4OB2B 4PNOA 5IN1A 2D0QB 3S6WA 3P8BB 2KQWA 3X28B 4XTWA 3OS0A 3V7SA 4FT2A 4Y91A 3FB9A 2CYZB 4BB7A 3QBYA 1VQNT 2PUOB 3UDCA 5CAIA 1PSFA 3META 4XU2A 3DKMA 2L8DA 3SFMA 3ZFJA 2DD4A 2XDBA 3LYIA 3JB9D 2GCXA 1VQOA 1UEBA 2EWNA 3A8OB 3QYHB 5GAN5 1Q7YC 3J7AF 1YITA 4OP0A 1M1KU 3WVEB 2GFUA 5LJ5h 2BUDA 2RJEA 4A4KA 3I56A 2XIDA 2EYQA 2E64A 1WQ7A 4PJOB 4BDZA 4FIBA 1W2BS 2WSFE 3FEOA 2RHZA 4ATOA 4GLKA 3C4SA 3RMQA 2DO3A 3QXEB 2DD5A 3AHUA 3LWHA 4CRIA 2G3RA 2QA4A 3MCAB 3V8LA 1H641 2KMTA 4OVAA 3M5AA 3DLLA 1BKBA 2EJFA 5HK0A 3JCMX 4KULA 3JCMW 4A4HA 4XQ3A 2OTLT 3SD4A 4M77G 1KHIA 3JCMc 1VQKT 1Q86U 2EQJA 4JS5A 1BI1A 1YJ9A 4IUTA 2EJGA 2C06A 1S72T 1M1KC 4E7IA 3LX7A 5IAYA 2MI6A 3HHTB 2Y4YA 1B34A 3RKYA 3TEEA 4QVCA 5AYFA 3L2QA 1KHCA 5CO7A 4BD3A 2XDDA 4JRPA 3CCET 2DZCA 1N6AA 4M78B 4M78F 2EQUA 1JBMA 2DXBA 3HFNA 2CZ7B 3VKIA 5GAMg 2PUKB 2QQAA 2D9TA 2XHCA 2QXFA 3LGFA 3SWNB 4GY5A 1QP2A 3CC4T 5IT9E 4E7LA 4C92C 5GMKl 2YHTA 2P0PA 1I81A 1MHNA 3QUIA 2MWPA 3MEUA 2BKDN 3RKWA 4IURA 3QYGB 2JNGA 4FU6A 1GXIE 1W2BA 5FROA 1VUBA 2LCLA 5CKBA 4QQ6A 4XTUA 4C92A 5KCOA 3HRUA 3JCMJ 2KY9A 4EDUA 4F7UA 4CI0C 2HAXA 4J83A 1VQ9T 3JB9F 2XU8A 4P5NA 3X20B 3EFRA 2D6FA 4M7AD 1Y07A 4C92E 4HCZA 2RI5A 3G6EA 2JTMA 1WJRA 5D6XA 4F7UE 1YIJA 1KQ1A 2DK3A 4IUUA 4DQ2A 3M58A 4C0ZA 5GANe 2DZ9A 4PLLA 3OYIA 3HPWA 4PJOG 3OYHA 4BE2A 4XK8E 3S3MA 4J7IA 2K57A 3CMAA 4E7JA 3QO3A 4E7HA 3CCMA 2EFIA 3QJYA 3OYAA 2DAQA 1VQ8A 5GANd 2RD1A 1M1FA 2P4TA 5DLQE 4C0GA 4LDXA 1FWZA 3OMCA 3OBYA 4EMGA 1VQ7A 1X01A 4M77C 1QVGS 4JUVA 4Z02A 4PL6A 3QHSA 2F5KA 4PLIA 3C94A 2HQEA 3JCMg 2DJZA 4RG2A 4XU0A 3V8KA 1N8RU 3A8MB 3VV0A 1YCYA 3OYEA 3MEWA 3QDRB 3G4ST 3M54A 1KC8U 3UWNA 5LJ5f 2XG8D 1YHQA 1QP3A 4C5EA 4M77A 3FIFA 1U1SA 1K9MU 3OYYA 3OA6A 4NOYA 1M1GA 3CCVT 3O8VA 2DXUA 5KE2A 4C8QD 2DTIA 3OYMA 3EFSA 2YLBA 3H8ZA 3WVDB 1VQOT 3VYGA 2MAMA 4M75D 4C0FA 4M77E 4O5VA 4A4EA 2QEXA 1YI2T 4FT4A 4M7DC 1K8AU 2DEQA 4MMLA 1X75C 4OMFB 4RCCA 4C5HA 3CCJA 3GLXA 4QW2A 2A7YA 5CQXA 4NL3A 3CXCS 3GOXA 4JRQA 1G3TA 4KUDK 3OQ5A 1VIFA 5GANg 4N4GA 4YTLA 3G7ZA 1WJQA 2XD0A 1VQMA 2QDYB 3OYGA 5KH6A 4M7DA 5CVIA 1NJIC 1NZ9A 3GIBA 1XTDA 3CCST 1G3YA 3L1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMO A;  2XD0 A;  2XDB A;  4ATO A;  2XDD A;  4GLK A; 
#chains in the Genus database with same CATH topology
 4FYW B;  4M7A B;  2O2O A;  4MZM A;  1GCP A;  4M7D E;  2K3Y A;  3L2R A;  1K4U S;  1WXT A;  4OB3 B;  1LJO A;  1VQP Q;  2DYI A;  2XDP A;  5CKE A;  4DBF A;  2KYM A;  2V8K A;  2VGM A;  3HSB A;  4CC4 B;  3CEY A;  1H92 A;  5FLX E;  5D6W A;  1S72 Q;  1ZSZ C;  1PC0 A;  4ELY C;  4LE9 A;  3BY7 A;  1YJW T;  2I2L A;  2RJD A;  1OYX A;  3V8J A;  1M5Q 1;  4IIO A;  1VQ6 A;  1IXD A;  2ROT A;  3CC4 Q;  1ZSZ A;  4UC4 A;  3A8L B;  1OPL A;  2RK1 A;  2ZPE B;  1RUW A;  4BE0 A;  3CC2 T;  1KQ2 A;  4M78 C;  2E12 A;  3CCL A;  3DB3 A;  4DEX A;  2CS7 A;  4M75 B;  3SWN C;  3EFO A;  4ELZ C;  2QAZ A;  3VRZ A;  2ABL A;  4ZGE B;  3RMS A;  1FXX A;  4M78 A;  3VU3 C;  4HCB A;  5GMK e;  3SWN A;  4JLI A;  2K4Y A;  3PTA A;  4M7D G;  4M78 E;  2RQU A;  1CKB A;  1MV0 B;  1VYU A;  5GAN h;  5J26 A;  1SF9 A;  1QCF A;  3KFV A;  3REB B;  2RJC A;  1D3B B;  2JXB A;  1RAD B;  1LVK A;  2LMJ A;  2LC4 A;  1W2B P;  1VQ5 T;  2DXC A;  4FL6 A;  2AZS A;  4LDU A;  3OYD A;  3MHX A;  4F7U F;  3OYC A;  2LCC A;  2HSP A;  2X4J A;  1VQ4 T;  1CKA A;  1ABO A;  3H0I A;  2YUQ A;  3EG9 A;  2AKK A;  2CSQ A;  3H0H A;  3EG3 A;  1YFN A;  4PFP A;  2KRM A;  3G4S Q;  3OS1 A;  1D1C A;  4M78 G;  4NL2 A;  1I8F A;  4KGV B;  4C0D B;  2VC8 A;  4E2F B;  2Z0W A;  4LD6 A;  2ECZ A;  2V8J A;  5GAM h;  3VS3 A;  2Y4X A;  2NLU A;  1W1F A;  4KBM B;  2V8I A;  1M3C A;  2E6Z A;  3KUF A;  2E70 A;  4OMQ A;  1KFZ A;  2CP5 A;  3R6O A;  5IXF A;  4X9C A;  5CIU A;  3LLR A;  4E7K A;  2QQR A;  2DRM A;  2LCS A;  2PQW A;  1QWE A;  5A0D A;  3L2U A;  3PVL A;  2RF0 A;  1MMN A;  3X25 B;  2YWW A;  2BZY A;  4D6W A;  5I21 A;  4Q5W A;  1JJ2 A;  5GAN f;  2FB7 A;  2NUP A;  1TXQ A;  4L59 A;  4C92 D;  3VRY A;  5GAO p;  4FSX A;  5HK3 A;  5KCH A;  3HRS A;  5LJ3 h;  4C8Q C;  5FRM A;  2FZC B;  1QVP A;  4HXJ A;  1Z9Q A;  5FRN A;  2HBP A;  3EH1 A;  1WLP B;  2K6D A;  4C8Q A;  1H3H A;  3FJP A;  5KYX B;  2ZPG B;  2FPD A;  4A4G A;  1AZG B;  1TOV A;  3CXC P;  1VQP T;  2K5F A;  4C8Q E;  2W10 A;  1YN8 A;  2IIM A;  2GGR A;  2LT4 A;  1K1Z A;  5GAO l;  4WF2 A;  5LJ5 e;  1G83 A;  2W0Z A;  1TU0 B;  3Q1J A;  8AT1 B;  2CZ6 B;  3JAM E;  4XAX B;  2IG0 A;  5KYN A;  3HL8 A;  2BZ8 A;  3C12 A;  4II1 A;  4IUP A;  3JCM Q;  3M0S A;  1D09 B;  2HL5 C;  5GAN 4;  2JN0 A;  3X26 B;  2DVJ A;  1NLP C;  5GAO r;  1QVF S;  1UHC A;  1YJW A;  1YHQ T;  4DOV A;  3CPW S;  4JS4 A;  5GAN 3;  2CDT A;  1X43 A;  1WJS A;  3BDU A;  3PVQ A;  4LDY A;  2XMF A;  3TCJ A;  1OUL A;  2L3Q A;  4ME7 A;  4JJD A;  3CC2 A;  1XJW B;  3F70 A;  4F7U B;  3CCJ T;  2J6O A;  1UGP B;  1GFC A;  1PG5 B;  2RQR A;  4EIK A;  2DA9 A;  2VUB A;  5GAO q;  4DA4 A;  3HRT A;  3CBO A;  5L23 A;  1Q7Y R;  3NHN A;  5CQY A;  2DL3 A;  3M57 A;  2QA4 Q;  3TVT A;  3VJP A;  1QQJ A;  4PJO D;  1RAE B;  2CT3 A;  5LJ3 f;  2XK0 A;  1OZ3 A;  4ZGD B;  1X6B A;  1YJ9 Q;  1KSW A;  1VYT A;  3L2Z A;  1UGS B;  4TVR A;  5CKH A;  5A0L A;  3ME9 A;  1O75 A;  1VQ5 A;  3I35 A;  4AFZ C;  5CCA A;  1JEG A;  1JRI A;  1FMW A;  4B9W A;  1AWJ A;  2DRK A;  2RJF A;  4RTT A;  1VQ4 A;  5HY6 A;  5A2Q E;  4C92 G;  3GP8 A;  3ER0 A;  4PJN A;  2M02 A;  3OYL A;  2E41 A;  4O6J A;  3G6E Q;  2CP3 A;  3P8B B;  4XTW A;  2PUO B;  3SFM A;  4J9B A;  1WHJ A;  3JB9 D;  1VQO A;  3A8O B;  3CMA Q;  1M1K U;  2FPF A;  2DBM A;  2GFU A;  4A4K A;  2LJ3 A;  1RI9 A;  1WQ7 A;  2WSF E;  2RHZ A;  2PNI A;  1IRX A;  1M3B A;  2EYW A;  1I1J A;  1CSK A;  4A4H A;  3LH5 A;  2DEU A;  2AK5 A;  2EQJ A;  1Y0M A;  4JS5 A;  2RMO A;  3NPF A;  2EJG A;  1M1K C;  3HHT B;  3RKY A;  3L2Q A;  1JU5 C;  4JRP A;  2XDD A;  2AZV A;  1ZUU A;  4KGX B;  3VKI A;  5GAM g;  2PUK B;  2O9V A;  3QWX X;  1VQM Q;  5FWC A;  3U23 A;  1I81 A;  3A98 A;  2QAS A;  1QCN A;  2BKD N;  4IUR A;  3QYG B;  5FRO A;  3JCM J;  3JB9 F;  4M7A D;  1YIT Q;  2LQN A;  3X20 B;  1BBZ A;  4IUU A;  3THK A;  5GAN e;  4PJO G;  3OYH A;  4BE2 A;  4XK8 E;  1NLO C;  4D8D A;  4E7H A;  3QJY A;  2EW3 A;  1T0J A;  2O31 A;  2P4T A;  5DLQ E;  2ED1 A;  1QVG S;  2CT4 A;  4Z02 A;  2F5K A;  3H9N A;  4PLI A;  3C94 A;  2AKL A;  3JCM g;  3V8K A;  1N8R U;  3A8M B;  3VV0 A;  2O9S A;  3OYE A;  3MEW A;  1KC8 U;  4DBR A;  1K9M U;  1YHQ A;  1AEY A;  1K73 R;  2DXU A;  3EGU A;  5KE2 A;  2SEM A;  1JQQ A;  3VYG A;  2MAM A;  1QVF P;  4M75 D;  1YI2 T;  4C5H A;  3CCJ A;  4K11 A;  2A7Y A;  4N4G A;  2G6F X;  4YTL A;  2VWF A;  2QDY B;  4HVU A;  3CCS T;  1G3Y A;  4M7A F;  1QKX A;  1KC8 C;  2C0I A;  4XTV A;  1V1C A;  3VS2 A;  1K9M C;  1HJD A;  5ECA A;  1A0N B;  1KG1 A;  1O9S A;  4J6W A;  4RMO A;  3SDZ A;  5IHN A;  2K2M A;  5GAM e;  5D6Y A;  1M3A A;  1YJ9 T;  3LW5 E;  1WGS A;  1RAB B;  1KIK A;  3RBB B;  2YDL A;  1VQK Q;  4BDY A;  3CCM Q;  1VQ8 Q;  3CCQ Q;  3JB9 H;  2DER A;  3LGL A;  2JTF A;  3GNG A;  5J3B A;  3CCE Q;  2B86 A;  2J7I A;  1H8K A;  5J39 A;  1M4Z A;  2F69 A;  4AG2 C;  1M9S A;  2JM9 A;  1IZ6 A;  4EPC A;  1ZLM A;  4KT0 E;  1AT1 B;  2JZ2 A;  2F2X A;  3C95 A;  4OB1 B;  1YWP A;  1MNE A;  5GMK i;  1Q95 G;  1WI7 A;  4M75 F;  1UHF A;  2EQK A;  3FJ5 A;  5LJ3 e;  2R5A A;  3RNJ A;  1VQ9 Q;  4RTY A;  1DJ7 B;  3CD6 A;  3OS2 A;  3OYK A;  5FU6 B;  1IGQ A;  4IUQ A;  4BY6 B;  3I55 Q;  2SRC A;  2ZZD A;  3JCM e;  2KXD A;  3MP1 A;  4A53 A;  1PD1 A;  1M90 U;  3INZ A;  3VS6 A;  1J3T A;  4KGZ B;  2HZY A;  2D0N A;  2RNA A;  1NYF A;  1Q81 R;  3OYF A;  4J7F A;  2WSE E;  4A63 B;  4E47 A;  2DL5 A;  2X51 A;  1D3B A;  2ZAE A;  4XTZ A;  2GQI A;  2JMC A;  3RES A;  4BUG A;  3KXT A;  2LRQ A;  3NTI A;  1SSF A;  4R56 A;  3CCV Q;  2V26 A;  1M2V B;  2ATC B;  3OW2 P;  1AVZ C;  2EKO A;  3QJ6 A;  1M90 C;  2F2W A;  2HQX A;  1BB9 A;  4LUD A;  1VQM T;  1PD0 A;  2CZ1 B;  1KD1 R;  1HYO A;  1KQS S;  2P0Q A;  3CBM A;  5GAO m;  2RQW A;  3GF5 A;  2LVM A;  3DLM A;  4N4H A;  2H8H A;  4EMK B;  2MMP A;  3S3N A;  1HK9 A;  3BW1 A;  5KYY A;  5C0M A;  1YIT T;  1WZO A;  4CC3 A;  2OTJ A;  2GQV A;  2KDS A;  3C0C A;  4J9F A;  4R55 A;  2M51 A;  2NUT B;  1YJN Q;  3KBG A;  4M77 F;  3H6Z A;  2GF7 A;  2E5K A;  4J9E A;  1Y96 B;  1M1K R;  3EHQ A;  2DF6 A;  2CKK A;  1FYN A;  4J8O A;  2NYS A;  4ZGJ B;  4QVD A;  4GLM A;  2ROL A;  1GBR A;  2QQ9 A;  3G71 Q;  2KR3 A;  1U5S A;  2P0K A;  1I07 A;  2C0T A;  3BDL A;  2O4X B;  3J80 E;  3FC3 A;  3T9N A;  3CCR Q;  4C5I A;  1UG1 A;  1ARK A;  3EGD A;  1D0Y A;  3QPH A;  5KYU A;  1ABQ A;  1B7T A;  2V1R A;  2BIV A;  1YI2 A;  3NTH A;  2H3J A;  2X4X A;  1EX4 A;  1YCS B;  4BI4 A;  3CCS A;  1G3W A;  1WYX A;  3QZ5 B;  2EYZ A;  5GAN 6;  2VAS A;  2FPE A;  1HD3 A;  1YWO A;  3UPU A;  4JDS A;  5AT1 B;  2L89 A;  2F5T X;  2DIQ A;  2PVO B;  2B8A A;  3E19 A;  3CC7 A;  3H0F A;  1Y71 A;  4XTY A;  2DNU A;  5IHK A;  2L5Q A;  3PIP A;  3CCM T;  2KEA A;  2M1H A;  1NM7 A;  1VQ8 T;  1ZBX A;  3CCQ T;  1B34 B;  5CK9 A;  1MMG A;  2DFU A;  5LJ5 d;  4R0K A;  2JUF A;  2ZPI B;  3P8D A;  4AT1 B;  1X69 A;  4B6M A;  2HSE B;  3QG1 A;  2KVQ G;  5FU7 C;  1UFF A;  4A4F A;  1EIF A;  4F16 A;  2QEX T;  2YRD A;  3VS4 A;  1IRE B;  1PRM C;  3OW2 A;  4HT8 A;  4OGE A;  2E3H A;  1OQK A;  3M59 A;  1OU8 A;  1BCO A;  5LJ5 g;  3I55 T;  2V1Q A;  1NG2 A;  3L2V A;  1B3Q A;  2DMO A;  4RG8 A;  1PM3 A;  1XOV A;  1YP5 A;  2FHD A;  5FWB A;  1PSE A;  4QT7 A;  2E5Q A;  2QTV A;  2EVR A;  2FL7 A;  2H3E B;  1F1B B;  3RUX A;  1ZQ1 A;  4ZN3 A;  1H3Z A;  1WX6 A;  3I5R A;  3M9Q A;  4MZP A;  3CCU T;  2RM4 A;  1NJI U;  1FX7 A;  2E6N A;  1D1A A;  5IHI A;  3QZ9 B;  4JRI A;  4M77 B;  1VIE A;  2I0N A;  3M0R A;  4KH0 B;  1I5L A;  2YRV A;  3FRN A;  3LH0 A;  1OPK A;  3TRE A;  1Y7X A;  2VV5 A;  2DIG A;  2F1L A;  1M30 A;  1I0C A;  4M7D B;  5DM7 R;  1MND A;  1X27 A;  1K9A A;  5GAN 2;  4JJN K;  4C5G A;  4F7U G;  1QKW A;  4OB2 B;  4J9H A;  4PNO A;  5IN1 A;  2D0Q B;  3S6W A;  3X28 B;  1YIJ Q;  3V7S A;  1RLP C;  4Y91 A;  1KQS P;  2CYZ B;  4BB7 A;  3QBY A;  1VQN T;  1RLQ C;  3M0T A;  4XU2 A;  3DKM A;  2L8D A;  3LYI A;  3J7A F;  1QWF A;  1U3O A;  1YIT A;  3EH2 A;  1KK7 A;  1D0Z A;  2EYQ A;  2E64 A;  2F2V A;  1VQ7 Q;  4BDZ A;  4E6R A;  4ESR A;  4ATO A;  1EFN A;  3C4S A;  3RMQ A;  4AMC A;  2KYB A;  1ZSZ B;  3LWH A;  1RAG B;  2YUP A;  4CRI A;  3MCA B;  3V8L A;  1M90 R;  1H64 1;  1X6G A;  4HVV A;  3M5A A;  1BKB A;  3JCM W;  2YSQ A;  3SD4 A;  3JCM c;  1E7O A;  2EGE A;  1Q86 U;  2CH4 W;  4IUT A;  2YUN A;  3EFO B;  1S72 T;  4E7I A;  2C06 A;  2MI6 A;  2Y4Y A;  4BD3 A;  2FZG B;  2DZC A;  4M78 B;  2CZ7 B;  2D9T A;  2XHC A;  2QXF A;  3EG1 A;  3LGF A;  3SWN B;  4GY5 A;  1QP2 A;  3CC4 T;  4C92 C;  5GMK l;  2P0P A;  4CC2 A;  2MWP A;  2JNG A;  2K9G A;  1W2B A;  4J9G A;  2LCL A;  4QQ6 A;  4C92 A;  3HRU A;  4CI0 C;  2HAX A;  3EFR A;  4ZNX A;  4C92 E;  3I56 Q;  2OI3 A;  1WJR A;  1TSF A;  4DQ2 A;  5FW9 A;  3OYI A;  3HPW A;  4J7I A;  1VQ6 Q;  1VOM A;  5KYW A;  3CCM A;  2DAQ A;  1VQ8 A;  5GAN d;  1M1F A;  4C0G A;  3VS5 A;  4EMG A;  3CCL Q;  1X01 A;  2CUB A;  4RTW A;  2MOX A;  4LN2 A;  4XU0 A;  1B07 A;  2OAW A;  1YCY A;  3M54 A;  1E6H A;  2XG8 D;  4C5E A;  2JMA A;  3EGX A;  3ULR B;  5HCK A;  4AFQ C;  2KBT A;  2DTI A;  2MYS A;  5EC7 A;  2QEX A;  4A4E A;  1K8A U;  2DEQ A;  4MML A;  1X75 C;  4RCC A;  4KRT A;  5CQX A;  4NL3 A;  4JRQ A;  1OX9 A;  5GAN g;  4LNP A;  2XD0 A;  4Z8A A;  1NZ9 A;  1XTD A;  5I11 A;  1UUE A;  3L1A A;  3G4S T;  2K2V A;  1R0B G;  1ZHI A;  2KK4 A;  3MPU B;  3VUB A;  2EKH A;  2HBW A;  2BTT A;  2DE0 X;  3E9F A;  4CC7 A;  1Q82 U;  3URG A;  4PJO C;  4DEY A;  2O88 A;  3QSU A;  4QQG A;  3CCU A;  1AWO A;  3A1P A;  4Z89 A;  2FYK A;  2R5M A;  2NUP B;  3BFM A;  4OMP A;  5GAM d;  1XQH A;  4X34 A;  4KUI A;  1U1T A;  4PJO A;  2VXE A;  4FCY A;  3CXC A;  1NEB A;  1M8V A;  2HQH A;  4PJO E;  2KRS A;  2A36 A;  2RA2 A;  4PJL A;  3S3O A;  1IHW A;  1WHL A;  2RO0 A;  1Q82 C;  1R77 A;  4C8Q B;  1NYG A;  3H41 A;  4JRK A;  3J81 E;  2EYX A;  1WPY A;  2NUZ A;  3HFO A;  1BIB A;  1PCX A;  1UTI A;  4J5Y A;  4QKU A;  1VQN A;  2KI7 A;  4AFS C;  4XTX A;  5LJ3 d;  1PHT A;  5IXB A;  1G8X A;  3PFS A;  1N9S A;  1YBY A;  3UF4 A;  3OB9 A;  4QVZ A;  3JCM d;  1ZBJ A;  3TU4 K;  3ZL7 C;  1WFW A;  1VQP A;  4RKU E;  1R0C B;  3UT1 A;  1M2O A;  2CGH A;  1U06 A;  4ANJ A;  3NFC A;  2WAC A;  5DLO A;  1GRI A;  5LJ3 g;  1UEC A;  3RKX A;  1SEM A;  1S72 A;  1QCO A;  3P8H A;  4ZTJ A;  2PU9 B;  2KNB B;  3E9G A;  3M4Y A;  3OBW A;  1SRM A;  2EYY A;  2YXY A;  1WXB A;  3CC4 A;  3REA B;  4AFU C;  3MJX A;  3OS5 A;  1HXD A;  4LXC A;  3PT9 A;  1GL5 A;  1FMV A;  2KAF A;  4PFZ A;  1JJ2 S;  2EBP A;  3BE3 A;  3OYJ A;  4IKF A;  4A54 A;  5GJW B;  1WHH A;  2IVW A;  4FM4 B;  1GBQ A;  3CPW P;  4DOW A;  1RAI B;  5GAO n;  2XIC A;  2E1H A;  3I56 T;  1FMK A;  4M7A C;  3MEV A;  3E2U A;  3VYH B;  3QKJ A;  2E4H A;  8ATC B;  2QGF B;  2CRE A;  5I22 A;  2A3L A;  1KJW A;  1N8R C;  4OF1 A;  1NPP A;  4M7A A;  2QA4 T;  1VYV A;  3JB9 G;  1YJW Q;  2QQB A;  2VYT A;  1OEB A;  6AT1 B;  2EAY A;  4HCK A;  3JCM P;  3CCL T;  2LT1 A;  4M7A E;  1LPL A;  4MZT A;  3HKS A;  2OTL Q;  1BU1 A;  1NE8 A;  4ZTF A;  5HKC A;  3CC2 Q;  4OB0 B;  2AHJ B;  3TSW A;  2ZPH B;  4BE1 A;  2K3B A;  4FSS A;  2E10 A;  1WDX A;  2BZX A;  2VKN A;  2JOY A;  1I5O B;  3NMZ C;  1RAF B;  2OAU A;  1OX8 A;  2D1X A;  4M75 C;  4OMN A;  1GFD A;  3G1J A;  2A0F B;  3GPL A;  4DBQ A;  3NTK A;  4M75 A;  3G6E T;  4L5G A;  4JPB W;  2KXC A;  2RI2 A;  5CKD A;  3LWI A;  2JW4 A;  3G4S A;  3A5Z B;  1W6X A;  4JZ3 A;  4M75 E;  2BE7 D;  1IHV A;  1RL2 A;  3CMA T;  1VQ5 Q;  3ASK A;  3M0U A;  1IO6 A;  3TQ7 P;  4M7A G;  1E6G A;  2PVG B;  4M77 D;  2LQ8 A;  3X24 B;  2CP6 A;  2E3I A;  4FW2 A;  3JRZ A;  2DL8 A;  1M8M A;  2DXT A;  1MV3 A;  3E1S A;  1ZA2 B;  5DY9 A;  1EZZ B;  5M9O A;  4M7D D;  5GAN 7;  1VQO Q;  1TS9 A;  2GTO A;  3OY9 A;  2DBK A;  2L0A A;  2QQS A;  1WNL A;  4LDV A;  1UGV A;  4BAC A;  1S1N A;  2MPX C;  3L2W A;  2O01 E;  2RHI A;  2RI3 A;  1N27 A;  4M75 G;  1UDL A;  2LX7 A;  4C0D C;  4OML A;  1HSQ A;  5KE3 A;  1TUG B;  2LNH B;  1QVF A;  3CPW A;  3ZEH A;  4J9D A;  4HA8 A;  3EG2 A;  4J6X A;  5GMK m;  4OGC A;  2ZPF B;  5C6S A;  2PTK A;  2ENM A;  1UJY A;  4RTV A;  2LX9 A;  2DL4 A;  4J9I A;  5A0G A;  5D7U A;  2RQT A;  4LDW A;  1Q7Y U;  2CZ0 B;  4PFO A;  3GNF B;  5LL6 S;  1G5V A;  1V29 B;  4M78 D;  1T3S A;  1GCQ C;  4RCB A;  2CH4 A;  3JV3 A;  4M7D F;  3D7S B;  3EHR A;  2DVE A;  3QDF A;  3ZBD A;  1GCQ A;  1C0M A;  5GMK j;  4OMM A;  4PJM A;  1QVG P;  2KQW A;  3OS0 A;  5CAI A;  3UDC A;  3ZFJ A;  2DD4 A;  2XDB A;  2GCX A;  2COW A;  3QYH B;  1Q7Y C;  3M0P A;  3WVE B;  1JJ2 P;  3I56 A;  2HCK A;  2LZ6 B;  4FIB A;  4PK4 A;  5KYX A;  4GLK A;  2GBQ A;  3QXE B;  2JTE A;  3AHU A;  2QA4 A;  1SG5 A;  1YHQ Q;  3DLL A;  2EJF A;  3EG0 A;  5HK0 A;  3JCM X;  4JZ4 A;  2HDA A;  4XQ3 A;  2OTL T;  2JS2 A;  2QG9 B;  4M77 G;  1KHI A;  1VQK T;  2NWM A;  1BI1 A;  1YJ9 A;  2KGT A;  3CME Q;  3LX7 A;  1TG0 A;  3CCE T;  5CO7 A;  3CCJ Q;  4M78 F;  1JBM A;  2DXB A;  3HFN A;  1WHG A;  2QQA A;  4KH1 B;  2HEQ A;  3QUI A;  1VQL Q;  3RKW A;  4FU6 A;  1GXI E;  2HMA A;  2FRW A;  2KY9 A;  4EDU A;  1N8R R;  4F7U A;  1VQ9 T;  1KC8 R;  2D6F A;  1K9M R;  1Y07 A;  4OMO A;  2RI5 A;  3G6E A;  2JTM A;  1IB8 A;  4F7U E;  1QLY A;  2DK3 A;  2DZ9 A;  4PLL A;  2CP0 A;  3CMA A;  1NBE B;  3QO3 A;  1RAH B;  1SKU B;  2J6F A;  4HVW A;  2RD1 A;  1YNZ A;  1K76 A;  1SRL A;  1FWZ A;  3OBY A;  3R6N A;  2X3X D;  2JS0 A;  1Y57 A;  2HQE A;  2COY A;  4RG2 A;  1SSH A;  1WA7 A;  3UWN A;  1TWB A;  2FEI A;  1QP3 A;  1TTH B;  1U1S A;  3CD6 Q;  2OJ2 A;  3CCV T;  3O8V A;  2JM8 A;  4C8Q D;  4F04 B;  3EFS A;  2YLB A;  1N5Z A;  3H8Z A;  3WVD B;  5KYY B;  1VQO T;  3PE0 A;  4O5V A;  2A28 A;  1OU9 A;  2DIL A;  4OMF B;  4QW2 A;  3GOX A;  1C6V X;  1G3T A;  1VIF A;  1X2K A;  2LJ0 A;  1VQM A;  3OYG A;  1NJI C;  3UA7 A;  1UGR B;  1ZX6 A;  2M9U A;  1MMD A;  3MO8 A;  5LJ5 j;  1N9R A;  1QVG A;  1X2Q A;  2YT6 A;  2DKG A;  1R8O B;  3OYB A;  1NEG A;  2EIF A;  4BI3 A;  2L3P A;  1BI2 A;  1K73 U;  1AZE A;  4BI8 B;  1T3L A;  2WSC E;  1YJN T;  1W70 A;  3GBQ A;  3JB9 J;  1LOJ A;  4J6Y A;  3N5B B;  4EMH A;  3CBP A;  4QQD A;  3V7R A;  2A08 A;  3EGD B;  2RQV A;  2KSS A;  4XU3 A;  1LCK A;  3SHW A;  5KYU B;  3JSC A;  3PGG A;  2EQM A;  2J06 A;  2A37 A;  1SHG A;  4HKE A;  2K3X A;  2K5I A;  3G71 T;  3JCM V;  4C8Q F;  1K73 C;  1ACM B;  3JCM h;  2OTJ Q;  4HCC A;  3VS1 A;  2RN8 A;  2DX1 A;  1TUD A;  2M16 A;  3CCR T;  3TSZ A;  4PKC C;  3VUZ A;  2COZ A;  2R57 A;  1RI0 A;  4M4Z A;  2X3W D;  3A8G B;  3HTR A;  1AHJ B;  2VVK A;  4FYY B;  3PMT A;  1ZSG A;  2YRC A;  3OMG A;  2DTO A;  1Q86 C;  5L8R E;  1X6O A;  5CKF A;  3OSS C;  1OZ2 A;  2HD0 A;  1JB0 E;  3RIR A;  1RAC B;  2MWO A;  2FZK B;  5GAM f;  2HKQ B;  3PMI A;  1UB4 A;  3MKD A;  2X4Y A;  2HKN A;  4C92 F;  1BIA A;  3AT1 B;  3CME T;  2OTL A;  1D0X A;  1BI3 A;  4B9X A;  1VQK A;  3QII A;  5FU7 B;  3V7C A;  3PNW C;  3CCQ A;  1YI2 Q;  3EG9 B;  3CCE A;  2QGG A;  1G3S A;  2M0Y A;  1VQL T;  4C8Q G;  1BYM A;  3M56 A;  1Q81 U;  4X9D A;  3CCS Q;  4MDX A;  2ZGW A;  1AOJ A;  2LQW A;  4PJJ A;  2KT8 A;  1PKS A;  3VS0 A;  2X35 A;  9ATC B;  2LNV A;  3CC7 Q;  1Z9Z A;  4MMK A;  3M4G A;  2EGA A;  1VQ9 A;  3M55 A;  4Y92 A;  1AWW A;  1ZUY A;  1UGQ B;  2RHU A;  1JXO A;  2GNC A;  4WCI A;  1WXU A;  1XNI A;  1RAA B;  2E65 A;  3CQT A;  3I55 A;  3JCM f;  1KD1 U;  4JLG A;  5CR2 A;  4XU1 A;  1V76 A;  1Q81 C;  4LUE A;  5I2S A;  5EG2 A;  1ZUK A;  1KQS A;  4F17 A;  3SB2 A;  2LP5 A;  2MIO A;  2MK5 A;  4DBH A;  1K8A C;  2JVV A;  2RPN A;  1IGU A;  3CD6 T;  3EAE A;  2VGN A;  1QW1 A;  2KE9 A;  3JCM b;  2DJQ A;  2CSI A;  2HNI A;  4N0A C;  1MGQ A;  2PVD B;  2LJ1 A;  2M0O A;  1KD1 C;  1PRL C;  2BE9 B;  2FVU A;  3CCV A;  4JJC A;  4N0A A;  1WQW A;  5GMK h;  2ZCF B;  2MCN A;  2FO0 A;  1WHM A;  1K0X A;  1VA7 A;  3UAT A;  1LNX A;  4PJO F;  5FU6 C;  2DL7 A;  4NS5 A;  4BY6 C;  3MEA A;  1YIJ T;  5GAN j;  3OW2 S;  2RHX A;  2QTX A;  2ZPB B;  2RHY A;  5GAN 8;  3MP6 A;  2K5L A;  3FLG A;  3MP8 A;  3OYN A;  2Y90 A;  2IPO B;  3O5Z A;  2P84 A;  4HT9 A;  1VQ7 T;  3RER A;  1SPK A;  1YJN A;  2QI2 A;  2RH2 A;  1P92 A;  3JB9 I;  1TH7 A;  2L3R A;  5I2M A;  3FDR A;  2GFA A;  2DYB A;  2XI9 A;  4N4I A;  1OV3 A;  1T0H A;  2R58 A;  4J9C A;  3OSV A;  1U8R A;  3DB4 A;  2FRY A;  4RTX A;  2MF2 A;  4VUB A;  4C92 B;  2RK2 A;  2EPD A;  1NJI R;  2RB6 A;  4Y28 E;  2OTJ T;  3G71 A;  1M2V A;  3PIO A;  2J05 A;  2JT4 A;  2EQI A;  4EMK C;  3CCR A;  3I9Q A;  2QYZ A;  5GAM j;  5KYW B;  4L6V 5;  2XKO C;  4EMK A;  4LD9 K;  3UA6 A;  4FYX B;  2X9H A;  1PNJ A;  2EJ9 A;  1JXM A;  3WXM B;  1G2B A;  4F14 A;  2DPP B;  3VS7 A;  2KRN A;  2YUO A;  2VB6 A;  2LDM A;  1OI1 A;  2NUT A;  4D8K A;  2X4W A;  1BI0 A;  3EGX B;  4MDW A;  3SEM A;  2VXF A;  3L42 A;  2D8H A;  2CP2 A;  2YLC A;  1VQ6 T;  4IUV A;  2DTH A;  1Y96 A;  2FG0 A;  1PWT A;  3CME A;  4ZN1 A;  3CPF A;  2GTJ A;  4V2S A;  1W4S A;  1WHK A;  3A8H B;  3M53 A;  1JO8 A;  2DLP A;  5LJ3 j;  2LTO A;  2P4R A;  1AWX A;  2LQK A;  2DM1 A;  1MUZ A;  2EGC A;  1VQL A;  1BK2 A;  1I4K 1;  2O4X A;  3HP9 A;  4GBQ A;  4FT2 A;  3M0Q A;  4ORZ A;  3FB9 A;  1Q86 R;  1BCM A;  3CC7 T;  1PSF A;  3MET A;  1MMA A;  1QMC A;  1SHF A;  1UEB A;  2EWN A;  2ED0 A;  5GAN 5;  4OP0 A;  5LJ5 h;  2BUD A;  2RJE A;  2DET A;  2XID A;  4AG1 C;  4RUG A;  4PJO B;  5IH2 A;  1ZA1 B;  1W2B S;  3QWY A;  3FEO A;  2AIR B;  2DO3 A;  4Z88 A;  2CUD A;  2DD5 A;  2G3R A;  1WIE A;  1PKT A;  2KMT A;  4OVA A;  4WTO B;  4FYV B;  2C0O A;  4KUL A;  7AT1 B;  2QEX Q;  5IAY A;  2PZ1 A;  1B34 A;  3TEE A;  4QVC A;  2K79 A;  5AYF A;  1KHC A;  1N6A A;  1TUC A;  2KT1 A;  4X1V A;  1VQ4 Q;  2EQU A;  4E7S A;  5IT9 E;  4E7L A;  2YHT A;  2HL3 A;  1MHN A;  2CP7 A;  3MEU A;  5GJV B;  1VUB A;  2ESW A;  5CKB A;  4XTU A;  1UJ0 A;  5KCO A;  3RR6 A;  2KRO A;  1K0S A;  2L3S A;  4J83 A;  1OOT A;  4IIM A;  2XU8 A;  2J6K A;  4P5N A;  4HCZ A;  3CCU Q;  5D6X A;  1YIJ A;  2K7A A;  1KQ1 A;  3M58 A;  4C0Z A;  2QK0 A;  1K8A R;  4JJB A;  3S3M A;  2K57 A;  4E7J A;  2EFI A;  3OYA A;  3RDV A;  4LDX A;  1UE9 A;  2L2P A;  4FW1 A;  3OMC A;  1VQ7 A;  1AD5 A;  4M77 C;  4JUV A;  4PL6 A;  3QHS A;  2OX7 A;  2DJZ A;  4RTU A;  3QDR B;  5LJ5 f;  2D8J A;  3FIF A;  4M77 A;  4RTZ A;  1Q82 R;  3OYY A;  3OA6 A;  4NOY A;  1M1G A;  2JJ9 A;  3OYM A;  1VQN Q;  4C0F A;  4M77 E;  3I5S A;  4M7D C;  1M27 C;  4FT4 A;  1C1A A;  3GLX A;  3CXC S;  4E7Z A;  4KUD K;  3NGP A;  3OQ5 A;  1D1B A;  3IQL A;  3G7Z A;  1WJQ A;  5KH6 A;  4M7D A;  5CVI A;  3GIB A;  2QDL A;  1NPR A;  2AT1 B; 
#chains in the Genus database with same CATH homology
 1UGR B;  4M7A B;  2M9U A;  4M7A F;  4MZM A;  2K2V A;  1KC8 C;  4XTV A;  1K9M C;  3MO8 A;  5LJ5 j;  2K3Y A;  1N9R A;  3L2R A;  1QVG A;  4M7D E;  4OB3 B;  1LJO A;  1O9S A;  1ZHI A;  2KK4 A;  4J6W A;  3VUB A;  4RMO A;  2DKG A;  3SDZ A;  2XDP A;  3E9F A;  5CKE A;  1R8O B;  1Q82 U;  5GAM e;  3OYB A;  5D6Y A;  2V8K A;  2EIF A;  4BI3 A;  3URG A;  1BI2 A;  1K73 U;  2VGM A;  1YJ9 T;  4PJO C;  4BI8 B;  3LW5 E;  1WGS A;  2WSC E;  3QSU A;  4QQG A;  3HSB A;  3CCU A;  4BDY A;  1YJN T;  2FYK A;  3CEY A;  5FLX E;  5D6W A;  3JB9 H;  2R5M A;  5GAM d;  3BFM A;  3LGL A;  3JB9 J;  2JTF A;  1LOJ A;  1XQH A;  3GNG A;  4J6Y A;  1U1T A;  3N5B B;  4KUI A;  4X34 A;  5J3B A;  4EMH A;  4ELY C;  4PJO A;  2VXE A;  3BY7 A;  3CBP A;  1YJW T;  4QQD A;  2I2L A;  5J39 A;  2RJD A;  3V7R A;  2KSS A;  1OYX A;  4XU3 A;  1M4Z A;  1M5Q 1;  3V8J A;  3CXC A;  1VQ6 A;  2F69 A;  1M9S A;  3JSC A;  1M8V A;  3PGG A;  1IZ6 A;  4UC4 A;  3A8L B;  4PJO E;  4EPC A;  2EQM A;  2RA2 A;  2RK1 A;  3S3O A;  2ZPE B;  4KT0 E;  4HKE A;  2K3X A;  2RO0 A;  2JZ2 A;  2K5I A;  4BE0 A;  3G71 T;  1Q82 C;  3CC2 T;  1KQ2 A;  4M78 C;  2E12 A;  3JCM V;  3DB3 A;  3C95 A;  4OB1 B;  3CCL A;  4C8Q B;  4C8Q F;  1K73 C;  4JRK A;  3JCM h;  2CS7 A;  4M75 B;  4M75 F;  3SWN C;  4ELZ C;  5GMK i;  4HCC A;  3CMA T;  2EQK A;  4ZGE B;  3J81 E;  5LJ3 e;  3RMS A;  2R5A A;  1FXX A;  4M78 A;  3VU3 C;  1DJ7 B;  2M16 A;  4HCB A;  3CCR T;  3CD6 A;  4PKC C;  1WPY A;  3VUZ A;  3OS2 A;  3OYK A;  5FU6 B;  5GMK e;  3SWN A;  3CC7 T;  3HFO A;  4JLI A;  1BIB A;  2R57 A;  1RI0 A;  4IUQ A;  4BY6 B;  4J5Y A;  2K4Y A;  3PTA A;  4M7D G;  4M78 E;  1VQN A;  4XTX A;  5LJ3 d;  3A8G B;  2ZZD A;  3JCM e;  1AHJ B;  3PMT A;  3MP1 A;  4A53 A;  1M90 U;  3INZ A;  3PFS A;  5GAN h;  5J26 A;  3OMG A;  1N9S A;  2DTO A;  1Q86 C;  1YBY A;  5L8R E;  3OB9 A;  4QVZ A;  3JCM d;  1X6O A;  5CKF A;  3OYF A;  4J7F A;  2RJC A;  3OSS C;  1OZ2 A;  2HD0 A;  3TU4 K;  2WSE E;  1D3B B;  1JB0 E;  4E47 A;  3RIR A;  1D3B A;  2MWO A;  5GAM f;  1VQP A;  4XTZ A;  3PMI A;  4RKU E;  2LC4 A;  1UB4 A;  3RES A;  4BUG A;  3KXT A;  3UT1 A;  2LRQ A;  2X4Y A;  2CGH A;  2DXC A;  3NTI A;  4FL6 A;  1VQ5 T;  3NFC A;  4C92 F;  2WAC A;  5DLO A;  1SSF A;  1BIA A;  4LDU A;  4R56 A;  3OYD A;  3CME T;  2OTL A;  3MHX A;  5LJ3 g;  1BI3 A;  4F7U F;  4B9X A;  3OYC A;  2EKO A;  2LCC A;  3QII A;  5FU7 B;  1VQK A;  2X4J A;  3QJ6 A;  3RKX A;  3V7C A;  1VQ4 T;  1M90 C;  3PNW C;  3CCQ A;  1S72 A;  2HQX A;  3P8H A;  3CCE A;  1VQM T;  2CZ1 B;  4ZTJ A;  2PU9 B;  1KQS S;  2P0Q A;  3CBM A;  1G3S A;  5GAO m;  3E9G A;  3M4Y A;  3OBW A;  1VQL T;  4C8Q G;  3GF5 A;  1BYM A;  3M56 A;  3CC4 A;  1Q81 U;  3OS5 A;  4X9D A;  4MDX A;  1HXD A;  2LVM A;  3DLM A;  3PT9 A;  2ZGW A;  2KAF A;  4N4H A;  3OS1 A;  4EMK B;  2MMP A;  4M78 G;  3S3N A;  1JJ2 S;  1HK9 A;  3BW1 A;  3OYJ A;  4IKF A;  2X35 A;  4NL2 A;  4A54 A;  2LNV A;  5C0M A;  2IVW A;  1I8F A;  4FM4 B;  1YIT T;  4DOW A;  4MMK A;  4C0D B;  2OTJ A;  2VC8 A;  4LD6 A;  3M4G A;  5GAO n;  2XIC A;  2E1H A;  2GQV A;  3I56 T;  1VQ9 A;  2V8J A;  3MEV A;  4M7A C;  3M55 A;  2KDS A;  5GAM h;  1UGQ B;  2RHU A;  2Y4X A;  3VYH B;  4R55 A;  3QKJ A;  2NLU A;  3KBG A;  2A3L A;  4M77 F;  1XNI A;  3H6Z A;  4KBM B;  2E65 A;  2V8I A;  2E6Z A;  2GF7 A;  3JCM f;  3I55 A;  4JLG A;  5CR2 A;  1Y96 B;  1N8R C;  4OF1 A;  1KD1 U;  3KUF A;  1NPP A;  2E70 A;  4XU1 A;  2QA4 T;  4M7A A;  3JB9 G;  1Q81 C;  2QQB A;  3R6O A;  2VYT A;  5I2S A;  2CKK A;  5EG2 A;  1KQS A;  4J8O A;  2EAY A;  4ZGJ B;  4QVD A;  3SB2 A;  4X9C A;  5CIU A;  3JCM P;  3LLR A;  3CCL T;  2LT1 A;  4E7K A;  2QQR A;  4M7A E;  2PQW A;  5A0D A;  3L2U A;  4MZT A;  3HKS A;  2QQ9 A;  1NE8 A;  4ZTF A;  5HKC A;  3X25 B;  1K8A C;  2JVV A;  4OB0 B;  2AHJ B;  2ZPH B;  4BE1 A;  4D6W A;  5I21 A;  1KG1 A;  4Q5W A;  1JJ2 A;  2P0K A;  1NPR A;  3CD6 T;  3EAE A;  2VGN A;  1QW1 A;  2FB7 A;  2E10 A;  3BDL A;  3JCM b;  2O4X B;  5GAN f;  3J80 E;  2HNI A;  3FC3 A;  4N0A C;  2JOY A;  4L59 A;  3T9N A;  4C92 D;  1MGQ A;  2PVD B;  5GAO p;  4FSX A;  2OAU A;  2M0O A;  4C5I A;  5HK3 A;  1KD1 C;  5KCH A;  2FVU A;  3CCV A;  3HRS A;  5LJ3 h;  4C8Q C;  3QPH A;  5FRM A;  1QVP A;  2BIV A;  4M75 C;  4N0A A;  1WQW A;  5GMK h;  1YI2 A;  2ZCF B;  3NTH A;  2HBP A;  5FRN A;  2H3J A;  2X4X A;  3GPL A;  4C8Q A;  3FJP A;  1LNX A;  4PJO F;  5FU6 C;  3NTK A;  4M75 A;  4BI4 A;  3G6E T;  2ZPG B;  4NS5 A;  3MEA A;  4L5G A;  4BY6 C;  4A4G A;  3CCS A;  2RI2 A;  5CKD A;  3LWI A;  1YIJ T;  3G4S A;  1VQP T;  1G3W A;  2K5F A;  3A5Z B;  3QZ5 B;  4C8Q E;  5GAN 6;  2RHX A;  2QTX A;  3OW2 S;  5GAN j;  2ZPB B;  4M75 E;  3UPU A;  2LT4 A;  2RHY A;  4JDS A;  2L89 A;  5GAN 8;  2F5T X;  2DIQ A;  2PVO B;  2B8A A;  1RL2 A;  3E19 A;  2K5L A;  3FLG A;  3MP8 A;  3MP6 A;  4WF2 A;  5LJ5 e;  1Y71 A;  4XTY A;  3OYN A;  3Q1J A;  3CC7 A;  2CZ6 B;  2L5Q A;  2Y90 A;  3ASK A;  3JAM E;  3PIP A;  4XAX B;  2IG0 A;  3CCM T;  4M7A G;  2M1H A;  1VQ8 T;  1ZBX A;  3HL8 A;  3CCQ T;  1B34 B;  2PVG B;  3C12 A;  4HT9 A;  4II1 A;  1VQ7 T;  4IUP A;  3JCM Q;  4M77 D;  3RER A;  5CK9 A;  2LQ8 A;  2QI2 A;  3X24 B;  5LJ5 d;  1YJN A;  2RH2 A;  1P92 A;  5GAN 4;  2JN0 A;  3JB9 I;  2JUF A;  2ZPI B;  3P8D A;  3X26 B;  1TH7 A;  2L3R A;  5I2M A;  3JRZ A;  5GAO r;  3FDR A;  2GFA A;  2XI9 A;  3QG1 A;  4N4I A;  1YJW A;  1YHQ T;  1QVF S;  4DOV A;  3CPW S;  2R58 A;  3OSV A;  2DXT A;  1U8R A;  2KVQ G;  3DB4 A;  5GAN 3;  4JS4 A;  5FU7 C;  3E1S A;  3BDU A;  1WJS A;  2MF2 A;  4LDY A;  4A4F A;  4VUB A;  3TCJ A;  5DY9 A;  1EIF A;  2RK2 A;  4C92 B;  5M9O A;  2QEX T;  4M7D D;  5GAN 7;  2RB6 A;  4ME7 A;  4Y28 E;  3F70 A;  3G71 A;  1IRE B;  3CC2 A;  5GAO l;  4F7U B;  2OTJ T;  3OW2 A;  4HT8 A;  3PIO A;  4OGE A;  3CCJ T;  3OY9 A;  3M59 A;  1UGP B;  2QQS A;  1WNL A;  5LJ5 g;  4LDV A;  2VUB A;  3I55 T;  4EMK C;  5GAO q;  3CCR A;  4DA4 A;  3HRT A;  3CBO A;  3L2V A;  4BAC A;  4RG8 A;  3L2W A;  2O01 E;  2RHI A;  1XOV A;  2RI3 A;  1N27 A;  5CQY A;  2FHD A;  4M75 G;  4C0D C;  1PSE A;  5GAM j;  3M57 A;  4L6V 5;  2E5Q A;  2XKO C;  4EMK A;  4LD9 K;  2FL7 A;  3RUX A;  5KE3 A;  1ZQ1 A;  3VJP A;  1QVF A;  4PJO D;  4ZN3 A;  1H3Z A;  2EJ9 A;  3CPW A;  5LJ3 f;  2XK0 A;  3WXM B;  3M9Q A;  4MZP A;  3ZEH A;  3CCU T;  2DPP B;  1OZ3 A;  1FX7 A;  2RM4 A;  4HA8 A;  2E6N A;  4J6X A;  4ZGD B;  5GMK m;  1NJI U;  3QZ9 B;  4OGC A;  2ZPF B;  5C6S A;  3L2Z A;  1UGS B;  2LDM A;  4JRI A;  1OI1 A;  4M77 B;  1VIE A;  2X4W A;  1BI0 A;  4MDW A;  4TVR A;  2VXF A;  3L42 A;  5CKH A;  5A0L A;  3ME9 A;  2YLC A;  1VQ6 T;  4IUV A;  2DTH A;  2LX9 A;  1Y96 A;  1O75 A;  5A0G A;  1I5L A;  2YRV A;  3FRN A;  1VQ5 A;  5CCA A;  4LDW A;  3LH0 A;  1Q7Y U;  1JRI A;  2CZ0 B;  4B9W A;  3CME A;  3GNF B;  5LL6 S;  4ZN1 A;  1G5V A;  1V29 B;  3TRE A;  1Y7X A;  4M78 D;  3CPF A;  2VV5 A;  2DIG A;  2RJF A;  4RCB A;  1VQ4 A;  5HY6 A;  1W4S A;  4V2S A;  3A8H B;  3M53 A;  4M7D B;  4M7D F;  5DM7 R;  5LJ3 j;  5A2Q E;  2DVE A;  4C92 G;  2LTO A;  3ZBD A;  3GP8 A;  3ER0 A;  5GAN 2;  2LQK A;  4JJN K;  4C5G A;  3OYL A;  4F7U G;  5GMK j;  2E41 A;  4O6J A;  1VQL A;  1I4K 1;  2O4X A;  3HP9 A;  4OB2 B;  4PNO A;  5IN1 A;  2D0Q B;  3S6W A;  3P8B B;  2KQW A;  3X28 B;  4XTW A;  3OS0 A;  3V7S A;  4FT2 A;  4Y91 A;  3FB9 A;  2CYZ B;  4BB7 A;  3QBY A;  1VQN T;  2PUO B;  3UDC A;  5CAI A;  1PSF A;  3MET A;  4XU2 A;  3DKM A;  2L8D A;  3SFM A;  3ZFJ A;  2DD4 A;  2XDB A;  3LYI A;  3JB9 D;  2GCX A;  1VQO A;  1UEB A;  2EWN A;  3A8O B;  3QYH B;  5GAN 5;  1Q7Y C;  3J7A F;  1YIT A;  4OP0 A;  1M1K U;  3WVE B;  2GFU A;  5LJ5 h;  2BUD A;  2RJE A;  4A4K A;  3I56 A;  2XID A;  2EYQ A;  2E64 A;  1WQ7 A;  4PJO B;  4BDZ A;  4FIB A;  1W2B S;  2WSF E;  3FEO A;  2RHZ A;  4ATO A;  4GLK A;  3C4S A;  3RMQ A;  2DO3 A;  3QXE B;  2DD5 A;  3AHU A;  3LWH A;  4CRI A;  2G3R A;  2QA4 A;  3MCA B;  3V8L A;  1H64 1;  2KMT A;  4OVA A;  3M5A A;  3DLL A;  1BKB A;  2EJF A;  5HK0 A;  3JCM X;  4KUL A;  3JCM W;  4A4H A;  4XQ3 A;  2OTL T;  3SD4 A;  4M77 G;  1KHI A;  3JCM c;  1VQK T;  1Q86 U;  2EQJ A;  4JS5 A;  1BI1 A;  1YJ9 A;  4IUT A;  2EJG A;  2C06 A;  1S72 T;  1M1K C;  4E7I A;  3LX7 A;  5IAY A;  2MI6 A;  3HHT B;  2Y4Y A;  1B34 A;  3RKY A;  3TEE A;  4QVC A;  5AYF A;  3L2Q A;  1KHC A;  5CO7 A;  4BD3 A;  2XDD A;  4JRP A;  3CCE T;  2DZC A;  1N6A A;  4M78 B;  4M78 F;  2EQU A;  1JBM A;  2DXB A;  3HFN A;  2CZ7 B;  3VKI A;  5GAM g;  2PUK B;  2QQA A;  2D9T A;  2XHC A;  2QXF A;  3LGF A;  3SWN B;  4GY5 A;  1QP2 A;  3CC4 T;  5IT9 E;  4E7L A;  4C92 C;  5GMK l;  2YHT A;  2P0P A;  1I81 A;  1MHN A;  3QUI A;  2MWP A;  3MEU A;  2BKD N;  3RKW A;  4IUR A;  3QYG B;  2JNG A;  4FU6 A;  1GXI E;  1W2B A;  5FRO A;  1VUB A;  2LCL A;  5CKB A;  4QQ6 A;  4XTU A;  4C92 A;  5KCO A;  3HRU A;  3JCM J;  2KY9 A;  4EDU A;  4F7U A;  4CI0 C;  2HAX A;  4J83 A;  1VQ9 T;  3JB9 F;  2XU8 A;  4P5N A;  3X20 B;  3EFR A;  2D6F A;  4M7A D;  1Y07 A;  4C92 E;  4HCZ A;  2RI5 A;  3G6E A;  2JTM A;  1WJR A;  5D6X A;  4F7U E;  1YIJ A;  1KQ1 A;  2DK3 A;  4IUU A;  4DQ2 A;  3M58 A;  4C0Z A;  5GAN e;  2DZ9 A;  4PLL A;  3OYI A;  3HPW A;  4PJO G;  3OYH A;  4BE2 A;  4XK8 E;  3S3M A;  4J7I A;  2K57 A;  3CMA A;  4E7J A;  3QO3 A;  4E7H A;  3CCM A;  2EFI A;  3QJY A;  3OYA A;  2DAQ A;  1VQ8 A;  5GAN d;  2RD1 A;  1M1F A;  2P4T A;  5DLQ E;  4C0G A;  4LDX A;  1FWZ A;  3OMC A;  3OBY A;  4EMG A;  1VQ7 A;  1X01 A;  4M77 C;  1QVG S;  4JUV A;  4Z02 A;  4PL6 A;  3QHS A;  2F5K A;  4PLI A;  3C94 A;  2HQE A;  3JCM g;  2DJZ A;  4RG2 A;  4XU0 A;  3V8K A;  1N8R U;  3A8M B;  3VV0 A;  1YCY A;  3OYE A;  3MEW A;  3QDR B;  3G4S T;  3M54 A;  1KC8 U;  3UWN A;  5LJ5 f;  2XG8 D;  1YHQ A;  1QP3 A;  4C5E A;  4M77 A;  3FIF A;  1U1S A;  1K9M U;  3OYY A;  3OA6 A;  4NOY A;  1M1G A;  3CCV T;  3O8V A;  2DXU A;  5KE2 A;  4C8Q D;  2DTI A;  3OYM A;  3EFS A;  2YLB A;  3H8Z A;  3WVD B;  1VQO T;  3VYG A;  2MAM A;  4M75 D;  4C0F A;  4M77 E;  4O5V A;  4A4E A;  2QEX A;  1YI2 T;  4FT4 A;  4M7D C;  1K8A U;  2DEQ A;  4MML A;  1X75 C;  4OMF B;  4RCC A;  4C5H A;  3CCJ A;  3GLX A;  4QW2 A;  2A7Y A;  5CQX A;  4NL3 A;  3CXC S;  3GOX A;  4JRQ A;  1G3T A;  4KUD K;  3OQ5 A;  1VIF A;  5GAN g;  4N4G A;  4YTL A;  3G7Z A;  1WJQ A;  2XD0 A;  1VQM A;  2QDY B;  3OYG A;  5KH6 A;  4M7D A;  5CVI A;  1NJI C;  1NZ9 A;  3GIB A;  1XTD A;  3CCS T;  1G3Y A;  3L1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...