4RMVA

Crystal structure of the d76h beta-2 microglobulin mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
b'MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKHEYACRVNHVTLSQPKIVKWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Conformational dynamics in crystals reveal the molecular bases for D76N beta-2 microglobulin aggregation propensity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmvA00
4OZHF 2P45B 2IAMD 4YGVB 2GKIA 3FFCB 3RWFB 4WU5B 5ALCL 1FAIH 2I24N 1GC1L 3QDAA 1UCTA 1UADC 1UWGL 4X4ME 3SDCC 5HYSB 3JV6B 1XGRB 2WBJA 1MY7A 2IPTL 2AV1B 3DROA 4P2OD 4PGCA 1SM3L 3GGWB 4YE4H 1CF8L 3MLRL 3D2UA 3V5KA 4NO3A 1FG2B 3KYKL 3BDYL 1IKNA 1VDGA 1JWMA 4POUB 3HRZB 4LF3B 4OFIA 3DV6A 4JKPL 5FHBL 1BWMA 4PS4H 2AXGB 1RJYB 2X89A 4XNMA 5HYIA 2V5MA 3BZ4A 1I3GL 1VERA 3GI9L 3VFGL 4OF8A 4WHCA 4JFFD 3EDFA 4HK0A 4JFQB 5BVJB 3MOBH 2JELL 4WO4B 3STZB 3CIQA 1V5JA 3SPVB 3AS2A 3TIDB 4XGZB 1Q9KA 3C08H 1NAML 3MRBB 4YWGH 3S35L 5A2KH 1ADQH 2IADB 1CD9B 4RA0C 1R3HB 3NCYP 1ZVSA 5IF0B 4OGYH 4LP4A 4HKBB 1RD6A 4LVOC 4OCLC 1VGKA 3K46A 3SKMA 3CXHK 1CIDA 4X6EA 4AEEA 1T7XA 3PP3H 2W60B 3DHMA 5D72L 2MQ0A 3S5LG 4P5TA 3CVIH 2R9HD 2DQCL 4ESKA 1RUAH 2EXWC 4XI5D 2J4WH 5I30L 1A2YA 2DIAA 3H9SB 2AK4E 3F12B 3QFJE 3KJ6H 3ZYOA 2J5LC 1QLFA 2VR9A 1HILB 5GJTL 3KPPB 4F33B 1HI6A 1GJIA 5GS2H 3UTTD 3H9YA 1T20A 3M45A 1GL4B 3LEVL 3IFNH 5CJXC 1MCJA 1C16A 1A14L 1UZ8A 3UTSE 1AJ7L 1LEKA 1A9BA 2ESVD 3ARFD 2KKQA 2ED8A 5HHPA 3LS4H 1FO0H 4H1LG 2B1AH 3EYUH 4CVWA 1UM5H 4RWHA 3SKOA 3MRCB 1U58A 3AB0C 4PUBL 1WZMA 4ZOAA 4BUHA 2NZIA 2XT1B 1RU9H 4PJAF 4ODUB 4NKOB 4U7SA 4U1MB 5FGBA 3VXPA 4JFHD 2FWOB 2Q7YB 4N0CC 1FNAA 3B3IB 1I8KB 5I1KL 3EOTL 5ACLA 1KCVL 1R3JA 5M7QA 1JP5A 4QXUH 4Y8AA 5TDOB 1A02N 3NCJL 3SE9H 2MOVA 1UCBH 3L3HB 5FO7A 4Z5RA 3BZEA 3WNLA 1OPGL 5E1AB 3TF7C 3OX8B 2ZUWA 1E27A 2VLME 3DSNA 1N4XH 4MXVF 4WU7A 4N0UE 2CIKA 1L0YA 1FAKT 1UXWB 2BSRB 4I3RL 2AJ3A 4HJGB 3RY4A 1I7RA 5FDWB 3T1FA 3VMOA 2BNRD 2WIIB 3NZ8B 5KS9A 4UUJA 2XZQL 5D93C 4KJYA 4GSDH 3X3GL 2V7NB 4G8FA 3LSOA 4NJ9H 2OTWA 1AGDA 2YN3A 1B0RA 3DETD 3MV7A 1F6AA 4IOSD 1BLNB 1XGUA 3QDMA 5EZJB 1AC0A 1U8MA 3BKJL 3VXUB 2DLFH 2PO6A 1MF2L 2BXYA 3GJEA 5CJ8A 2E8YA 4JFPA 4Y5YA 1VGEL 1ZXQA 4KDTC 4E0RA 1RZFH 3MCG1 4TVPE 1NEZB 1TZHB 5IHUL 1PKQE 1QSFD 1RHHB 4XPAL 5D5MB 3TO4C 4ZO9A 1BREA 2XZCH 4R90H 1CDYA 3O3DB 1R5IA 4XPFL 3SQBA 3A6CH 2YBRA 2DIJA 4Z7WA 2VDLL 5HI4C 5INCB 3BQUC 2Q6WA 3HNTH 1SJHA 2QKIA 4ZQKA 1C1EH 2IH3B 1CN4A 1XGYL 3KYNB 1VEMA 5SX4I 1QBML 4EQ2A 4JGMA 3CDYA 1YECH 3C6SB 4MAYA 1J1OL 3OGOE 4HUNB 3PE9A 4WV1C 2BNQE 2AJXH 2ZSVA 2VKWA 1DQLL 5ISZE 3H7BB 4OM0L 4PG2A 4WWKD 2EH7H 4GS7C 5JHLH 3OXRB 4ELKB 4D94A 4KDWA 5D7JD 1KLUA 2VN4A 3S88H 5I1LA 1T5XB 1FCCA 4Z9KB 1JE6A 4L4VE 5ID1B 5E8DH 5F9WB 1X7QA 1RZGB 3FFCD 3VFNA 3CX5J 1T3FA 4KVCL 4JG0H 4PJ8B 5KN5B 2PXYA 1NBZB 5H94B 1MCWM 1M05A 2OXGA 4N0YL 4MLIA 4HIEB 1KJ3L 5CD5D 4HWZB 4I48B 3QIWB 5IT2H 3HUJA 1F6LL 2EDLA 4PY8J 4NWTH 5IHBA 5EC1B 3VW3L 4RGMC 4U1NA 4DTGL 2BVUA 3ULUE 1UKSA 3EO9L 2VITB 4OKDA 3RJDA 3UPAA 3GRWA 4OJFH 1C5BL 2QQKH 3U7YL 5GGQH 3EJYD 4DW2L 4LCUA 5BV7C 4WO4D 1G9EA 1GGUA 2VL5A 2MKWA 3V5KB 3G9AB 3ZL4L 3MLWL 4ZSOB 2ZUVA 5DZNA 4M8VA 4FP8L 3ZDYF 2BY1A 4PJFA 5D7IE 2D03L 2FJFA 4Q0XH 2V5YA 3KWWB 1IEAA 4XNMB 1WCBA 1MI5A 3BZ4B 1A7RH 1TFHA 1O5DT 2ATPB 2X1XR 4LSVL 4CVXB 4M1GH 5I66A 4HK0B 3IS0X 4HH9A 4OLYH 1D5BA 3GUTA 3WD5H 4R0LA 4YHZL 2VLRA 3MRNB 3O6KH 1Q9KB 3KDMA 4NZTH 5DD6B 1GPOH 3H9SD 4KKCD 5H2BB 3MV8B 4OZFG 3HZKB 1MQKL 1II4E 2EEDA 1ZVSB 4HGKC 1ZA6A 3FOMA 4TPRL 4TN9A 2F54E 1VGKB 1I8MA 1NSNL 5IROA 3Q5TA 2XV6B 4GRLC 4M4RA 2EC9T 1X3DA 1WIPA 2PNDA 2IALA 3AC0A 2J1KA 3QRGL 3RP1A 5I1JH 4J2XA 5KANG 2C4FU 1EJOL 2WK2A 4D0CB 2H6PA 4WGVB 3X3FL 5ADOL 3EYVA 2EO1A 5F7UA 3IU4L 4M1DL 4JO4L 3OKYA 2DM3A 2B1HL 2BZDA 1MCQA 1IJ9A 5D7LD 3L6FA 3ZTNH 5FDYA 1HI6B 3BH9B 1KTRL 1CLZL 4HXBL 2ZCLH 5JUEH 2VXVL 1DE4B 2ICWB 4KQ3H 1X4YA 3RNKA 1NGYA 3VFMB 1ZGLP 1AHWB 3QUXC 3UZQA 1BF8A 4OGAD 1JPSL 3LOWA 2BFVL 4NZUL 3VU2A 3HNVL 5C0CE 4LCWE 3V6OA 2XACC 2WMPA 3CPLA 4XC1H 1JWUA 3MA9H 5I76B 1FNSH 4GUPA 2DWEA 4G6AD 4PJBB 4LSQH 4G6FB 2CKBL 4K71B 5EU6B 3RDTC 4I0PD 2YPLB 5ANME 4P2RB 1DVFB 1KYOK 4LPCA 2OR9L 2QSQA 1JZ6A 2AJVL 4OIBA 4UT9H 1FH5H 3NPZB 4JQIH 5F1NB 4KXZH 5HYJE 1AQKH 1NUDA 2DQGH 1NANI 2EYRA 1DQQA 3P9WB 5F9DC 4XP1L 2FEEI 1FL6A 2H26A 35C8H 2FGZA 3ULVL 5FOBA 5CIPH 4X4XB 4JHZA 5SWSB 1E28B 15C8H 1JNNL 4UI2A 5F6HI 1AD0A 3L95A 5AG9A 1HYSD 1VFUA 1B88A 1G0DA 4TOYL 4GBXD 4UOW1 4NKMB 4XMLH 3VXSA 3FTGA 4K8RH 2LTQB 5D96B 3WS3B 3O9WC 4WU7B 2MKLC 1WBZB 2BMKB 5IHLB 3HE7A 1PQZB 1CXEA 3T1FB 3O3EB 2XQBH 4RFOH 1HQ4A 3QHZL 4HG4K 4JFXA 3RX7A 3LN4A 1K4DA 4KUCF 4Z95H 3RU8L 3NABL 1G7JA 3ZKXB 3C9NA 5F1IA 1EV2E 4ZNCD 5A40E 3IXTB 3RVTD 1JFQL 4U1IA 1QLEH 3P9LB 5DRWA 4HUXA 5HHVH 3BYYA 4PJXF 4R26L 2Y07H 1NEUA 1P4IL 4QHKJ 4Y4HA 4RISL 4P3DA 3NBNA 2Y6SD 5EO0A 1W8NA 1AY1H 2BY0A 1EO8L 1ZLSH 1FL3B 3FO1A 3QRFM 3DIFB 1JTOA 1J18A 3TIEB 3DJ9A 4OLWH 3LHPL 1W0VB 3DI3B 4QRPE 4R97B 1BVKA 4NIKB 1YEKL 4WWID 3B6SA 2B2XL 2ZNXA 3ULVD 2KPNA 1A7PH 5J6HB 3NMEA 3QIWD 4NNYB 4Q9RH 3VXOA 4RWYH 2N7BA 4FMFA 2EYTA 3VI4F 1SHMA 4YH6A 2IG2L 5E8OA 5DDHB 3VD7A 1NBQA 2NXYD 3VFNB 2DM4A 4I3SH 5T5FL 2HH0H 3QIBB 1RZJH 2VZOA 5D1ZC 1S7UB 1KIQA 5BJTA 1DQDL 4BZYA 4S10A 4NO0B 4IDLA 4CNIB 4NQXB 2MHAA 1B9ZA 2EE3A 1KIUA 2CRYA 2DLHA 2R2HA 3QXWA 2X09A 1CBVH 1RY7B 3I84A 1A4KA 3MRQA 1NCTA 4NP4H 2DIBA 1MFBL 4Y2OA 3TBVB 1L4IA 4X6CB 5FGRA 4F7CA 4L3ED 2APBA 1DEEA 2CKNA 2CUMA 2Z8RA 4X7TB 5DEGB 5CP7A 1JPGB 3WNNA 4Z7UE 3EOYG 4HDIB 1JZ5A 3OJMB 1I7TA 4QRRE 1WZ1L 2FJFB 4EI6B 1QEWB 5DK2A 5JA9A 3O2DL 1N5AA 2FD6L 4WFFD 1U8PA 2MCPL 3FRUB 5FYKL 1TPXB 1M6OA 4KTEL 4HH9B 3FKUS 3JUYA 2VDPH 3GUTB 3X14B 4HJ0D 2AJSH 2VLRB 3TH4T 3MRMB 2NZ9D 1P4LA 1CQKA 3DLQR 3OXSB 5EO1B 1F6FB 2RIKA 3EIFA 4U2ZA 3JSSA 1P6AB 5DHYA 1BECA 5IW3A 4I0KA 3D85D 3NA9L 4Z0BL 3IKCA 3BKCL 4YAQB 3KPRD 3MLXL 1S7WB 5I8KH 5E9DB 5B3NA 2XFXA 3FOLA 4DEPC 1EK3A 2ZUTA 3C5ZB 2FEDC 4J7RA 2NXZD 4AIZA 3EYVB 5HBBA 4U6YA 1K6QL 3FO0H 4BQ6A 2X4PB 3PWUB 1W0WA 5AYUH 3S35X 2I5YH 2XTJE 2YPLD 4XX1G 3L6FB 1JNJA 4LSTH 3S97C 2IC2A 4NGHH 2DQEL 1MHCA 3BEVA 1JNLH 3EOAB 3VCLA 3PV6A 1IGCH 1S7TA 4KRMB 5GRZA 4NSKB 4YLQT 3BISA 5EDXA 1EGJL 4NN5C 2H3NB 1JZ2A 1KEGH 5JOEA 1JGLL 1OM3L 1H3PL 3L7FA 1BBDH 1NL0L 4ZOCA 1JGVH 4WW2A 1MCNA 2WWMC 3ZKQD 5DGRA 5SWSD 3T4AB 3MV9B 4G6KL 3SGDI 3VGFA 5E5MA 4IMLB 2GYSA 5GS0H 5B21A 1BD2B 2XA3A 3LQZB 2R2EB 1DQQB 3FB7B 4EVNB 4UTAH 1XF4A 2ARJA 5EZOL 4K7PY 3IDYB 1OAXL 5F8RC 4FQXD 32C2A 5TF1L 5IOPB 4YHKL 4GAYB 5T5NG 2NY4B 4Q6YA 3KXFE 1CI5A 3RL1A 5KVFH 3ESVF 2QSTA 3GSNA 1YNKL 3SDDA 5FYKU 3TBWB 2D7NA 1CFNB 3P0VH 4JFYA 5AUMA 3G08A 3Q1SH 1NGQH 3N1PC 3VXSB 3ZE1E 1J0IA 4KHTH 3MRRB 2APWA 3MRKA 5T1KB 4PRDB 3Q6GL 1T66C 2Y4SA 4P46D 2C4XA 3CLEL 4EI5B 5I8EA 3UYRL 5GHWH 2BOCA 4HZLA 2D0GA 2G5RA 3QEGL 5F1IB 4Y7MA 3EFFB 2HRPH 4XB8A 2ESVA 5ETUA 4G8GE 4KRPC 3G6DH 2R0ZL 3ARDC 2UWEA 4JR9H 4OZIA 4OCNC 5CBAB 2A73B 1J05A 4XPHL 5F44A 4EDWH 2GHWB 3SDXB 1Y6NR 4FN0A 4P3DB 1CVRA 1ZEAL 3ULSB 4LLQB 3RL2A 4JKWA 3OHXB 1FLRL 1NCWH 5EZIL 4YFEA 1IM9B 8CGTA 4APQD 4HWEH 4P59H 3HPLA 2AS5M 1KTDB 5TF0A 5IW6A 1MIMH 3LEYL 5BVPL 5FUZH 2A6JA 3VXRA 4LOUD 5I0ZA 4G8EA 1ES0A 4Z7QF 3UDWC 4XCFH 1M7DA 3B6SB 3GHEL 3I6LD 2HT2C 1KIRB 4OLEA 3UTZA 4UB0L 4NO0D 2ITCB 3FFDB 3E3QE 1DBKL 3RVUD 1EBAA 3IDXL 4LLAA 3WJLC 5IB2A 1NJ9A 4MCYA 5ALBH 4KVNH 2BJMH 4D9QD 2SEBA 3GRWH 4KKNA 4RNRB 5I73B 1WT5A 1F3DH 2Q8BH 5CJBA 1N64H 2DQTL 1OL0A 1HE7A 4KK6D 3TYFB 1XF5B 3LKRA 5EOCH 1DP0A 2DQIL 3KS0H 1XCQB 3LDBC 1T80A 2C9AA 1MREH 4ZS6D 2BNRA 4NKDB 4CJ1A 2HG5B 3IETA 3RVVC 3W39A 3MRFA 6CGTA 3ZYIA 3LVEA 4NZRH 1G9NH 2FSEB 1QFUH 5F6IB 5I6XB 4OUUA 2HAZA 1DSFH 3PWLA 2E3VA 4PB9H 1BOYA 1I1AD 2J6EA 2DQUH 5JDSB 4MMXC 1MCOH 4KTDH 4IMKC 3MRGA 2X4SA 4WHDA 4D3CH 3SE4A 1A5FH 4EIGB 1SVZA 1TJIL 2IPKA 1IGML 1H0DA 1DEEB 3EZJB 1T1YA 4X8XA 1WC7A 1VACA 3MACL 1PZUB 3VXMB 2B0SL 4OFVA 3W11D 5C7XH 4UV4H 4HBCH 5IMKB 5DK2B 4WW1A 4Y8DC 2VR5A 5C07D 4MSWA 3U30B 3PL6C 1OAQL 1N0XH 3QPQC 1U2CA 2EDOA 3IS1X 2D4DA 3K1KC 3ROOA 3EYFB 5IG7A 1M6OB 5E9DD 4X7SL 3GHBH 4KGJA 2HJFA 4DOHB 1SY6L 3DBXA 1A9EB 4PJEA 1JF6A 3AXLA 4KROC 4S1RL 3FT4A 4TULH 4WWKA 5DJ6B 3U1SL 4PGDA 5DLML 1ITCA 2X41A 1Q1JH 1WEJL 3ARGD 5TE4L 2AJZB 1IC7L 2FBJL 5ID0A 3C2AH 3L9RA 4PLKD 5CWSB 2CDGB 3K74B 4WCYL 3IKCB 2DS4A 4FQJH 3FMGH 3QH3B 1GGIL 4I4WB 4GRWF 4UQ2B 5C9JA 3O6FB 4R7NB 3U4BH 3H2WA 4N5UA 3CMOL 2AJYH 5I1IL 1W72L 5GS3A 1D7FA 4XPBH 1NCBH 2F5AL 3UJJL 1WAAF 1D5MA 4QOKB 2AEPL 4H20L 3TN0A 3CFKB 3V0WH 4ZPVB 2VZTA 1YEJL 3TT1H 4YQXL 1F58L 2ZOKA 3DTXB 4OCYL 1MHCB 4Q74A 3CSYB 3AROA 4YXLL 1AO7E 2MPAH 1GXEA 3W0WA 3U6RB 5I75C 3RHWK 4Y16A 4HH8A 2VSDA 4MXWH 5FYJU 3LIZL 5SWZB 4GRMB 4F2MA 2UUDH 4JFEA 3VI3F 4DAGH 4BJLA 3NZHH 3PQYB 1T7WA 3RPIB 2OTUB 3MNVA 1B2WH 3KAAA 1FNHA 2NY4D 4WW2B 4Z7VB 4YUEL 3B9KD 1MUJB 4PY8I 1I9JL 1MIEL 3UBXG 1A4JB 3X12B 5E5MB 4AL8L 1F3JA 1OTSC 1F4XH 4BSJA 2XWJB 4FFVD 2CLRA 3QSKB 2BERA 4NOBA 4HLZH 3RGVC 3WKML 4JGJA 1JF1A 5KSUB 4DQOH 4U1JB 1LWRA 1NFIA 3GBNH 4KI1A 4XCNB 1WITA 5JLZA 4PJ5A 2GY5A 3AREC 2V17H 2GFBA 3MJ9A 3RL1B 4UDUB 3SDCB 1YEIL 2NY3B 1GIGH 4N5ED 2YPKB 3GIZL 3SDDB 1LK3L 4TUKL 4JFYB 1HOCB 3G08B 3HZMA 3PGFL 1BX2A 1UACH 4HFUH 3T3ME 2YC1B 2Y06H 1AE6L 5C08E 5K33A 2R2BA 1NLBH 2BVYA 1FZJA 2HVKB 1T22A 3CH1B 3G04A 3H42L 3V0AC 3GMOA 2GCYA 2C1OA 4Z7OF 1E6JH 4MNQD 2H32B 5D7LA 2NPLX 4JAMA 4QGTA 1IM9D 2ARWA 2QQNH 5DSCA 4HZLB 5IMLB 3M8OL 1NUFA 1BEYH 4UT6L 2BVQB 4OZIB 2ZSWA 1BGXH 4HSQA 1K2DA 4ZOEA 5D70L 4HW6A 4N90E 2GK2A 4IIQA 4NQDB 1P9MA 1A3LH 2FLBT 3PHOA 1K8DB 2RAMA 3DMMA 4I0PA 1QZ1A 1KPVB 4NYLB 5HI3C 4YBLC 4NM4H 4WDIB 4M1CD 3HPLB 1EO7A 4WNQA 3WFBH 2P47B 1MCRA 1AFVH 3MLPA 1Y18A 5E08L 5IW6B 1TDQA 4KFZC 5H37H 1LQSR 3EOBB 3VXRB 4X0KB 1ES0B 1M7DB 4JE4B 1QNZL 1ORSB 2H2PD 3UTZB 4WY7H 1UWXH 2W65A 2GAZB 4MJIB 4XRCA 5K93A 3PABB 5DUMH 5JW5B 3C6LA 5J3HD 3TZVB 1H8OA 2VXUL 5ESQA 2CGRH 5ICYA 3GO1H 3OKNB 4Y19B 5CJQL 4KMLB 1FHGA 2DI9A 2SEBB 3VFVB 4FMKA 4GBXA 5DQDH 3CZJA 2F8VA 1RJCA 4OCXH 3LQAL 3V5DA 4OFKA 1F00I 4HCRA 2EC9U 4OTXL 5J9PA 3KYAA 4FTVE 1JRHL 4NO5B 4A6YB 4J3WA 3IDJA 4RZCA 4QRQB 4FQHA 1WBXA 4MB3A 3UC0H 3JTSB 2WANA 4OUUB 5JMOC 1S7VB 2VABB 4L3CA 4OD2B 3SE3C 4EIZC 3V0VA 3CFCL 1IGFH 4OGZA 1NDMB 1R0AH 3K2UH 3HE6D 1U8HA 2VXSL 4QRTA 5I1CH 3LS5L 5HGGS 2V7HA 2XN9D 2CKBA 2P5WE 3MCKB 4YC2C 1TETL 4I9WD 3NFPB 4G8IB 4JY6A 5F71A 4FG6D 3V52H 1EIBA 3C5JA 4NRYA 2NLJB 4DKEH 2DKUA 1J1XH 3LRGA 3HR5B 1ACZA 5SX5H 4XVUD 1DBAH 5TDPB 4L4TD 4L9LA 2L7JA 5EIIB 3ZSTA 1VFAA 4BH8B 2ED9A 4JQVA 4HF5H 5IVNA 1KTKE 4AEIL 4G9FD 3NA4A 4LVNC 2J2ZA 4Y5XC 5IK3A 1FZMB 3P4NA 5E95B 5L0QB 3QUMA 5T3ZH 1P5VA 4POZD 1U3ZA 3RRQA 1S78C 5DMGC 1IAMA 2X4NA 4U1GB 5TH2B 2HT3D 4PGDB 1JTPA 3HZYA 1DLFL 4O2CA 3RHWF 4PJXB 1F4WH 4QHKI 2ZNWA 1MHEA 4DFIA 2FX8L 2CRMA 3O2VH 5JPMA 5JTWA 5JW3H 3HG1D 5KVEL 1JUFA 2YRPA 5MENB 4IRJC 4K7FB 2X4RA 5D2NB 3UTQA 1NCCL 2QBWA 4JRYB 3L3IA 3N06B 1HH9A 4EEEA 1EUUA 9CGTA 5SWZD 2MTPA 4MNGA 2BK8A 4PJ9C 2EIZB 4UT7L 3ZHLA 1NFDE 3VXQA 1C5CH 2ZCHL 5GS1B 3CVHL 1F42A 4X8JB 2VZSA 2F19L 3OZ9H 1Q0YL 1Q38A 2AEIT 5FA4A 4HXAL 3H0TA 1UKQA 3G6JE 1HN1A 4R96A 1IQDB 4L3EA 1J11A 4Q6IA 1UGNA 1N6UA 1UYWH 1GAFH 1D6EA 1VADA 2Z31A 3SGKC 4PGZA 1Z3GL 1WK0A 5DURB 1MOEA 3R4DA 4PJHA 1T7YA 3GSNH 3VWJC 2NX5E 4ZTPH 5FCUL 2XYCA 3QWRA 4YHML 4CUCA 4W4OC 1YEEL 5KSVA 4NHCH 3SDCD 3W5MA 1F90L 1WIOA 3EKCA 4LK4A 1CGTA 4U1HB 1JF1B 2QHRH 1MNUH 3S37X 3PGDB 3L1OL 2V5TA 3QWOB 5GSVA 1GC1H 1UWGH 3I50H 1L7IH 4A6YL 4HC1L 2GFBB 4JQXA 3ZMRA 3TT3H 3D85A 3OAZH 3SGEI 5SX4H 1SM3H 3MLRH 5A2IH 1XIWC 3KPRA 1KC5H 1LO5B 4NN6C 1UJ3A 1RFDL 1VA9A 2N56A 1I8LC 3U46A 1H9VA 1PEZA 2CMRH 5FHBH 4OZGF 4NQDD 3HC4L 1FN4A 3SCMC 3JWDH 3UX9B 1FE8H 3LB6C 4FABL 1HH6B 2OXHA 1RK0A 2W0FA 5F1SA 1OGAD 4UZGA 4IBLT 3VFWB 4AEFA 4UNUA 4PREA 3NIDE 4QHLA 5IB5A 1QLRA 4FXKA 1JPFB 3LKOA 5CLWA 3NAAL 5E6IC 5H8DA 5CINL 2X1PA 4YHIA 3WLWD 5EU5B 3PHOB 4PTUA 1OB1B 4MB5A 3DMMB 1U9KA 2X4UA 4GJTB 3MRDB 5C09A 4G3YL 4AQ1B 4MJID 5D72H 3PHSA 5E94A 1JGUL 4ZUVA 1RZIB 4F57H 1BFOA 2P5EB 4XP5L 4PY7A 4Y19D 4CVUA 1OF2A 2EEBA 5HHOD 2L0DA 4O2EB 1ZANL 5GJTH 3ZDZE 4ONFH 3N85L 1IGIL 1EA9C 2VH5L 1ZT7A 4FQXA 3OKLA 5CUSL 7CGTA 4O2FA 1GGBL 4J3TA 4QTHB 3MNWB 1AJ7H 3HMXL 3C6LB 4CW1A 4Z7NE 3UZVB 3QB7C 1PYWB 3ARRA 1IC4H 1H8NA 3MLVL 2J6EH 5DQ9A 3QUXB 3WYRA 5AYQA 3ULUF 1CLYH 3QCVL 4NO2B 5AZ2H 2IGFL 4G7VH 3IDNA 4GKZA 4LLVA 3FZUC 5HJ3B 3T0XA 1TMCB 4RAUB 5DK0B 1H15B 2YZ1A 5A3IC 1KEML 1PD6A 2A9NL 1T2XA 2CO6B 3FT2A 3A67H 3JXAA 5KVGL 1T7ZA 2IJ0C 3IDJB 5BZWA 1QFWI 5E24E 1A22B 5CHNA 2G5BA 2H8PA 2YD2A 4MGXA 1RUPL 5TDNA 5D7IF 4L3CB 5HVHB 3KNBB 1N3NB 4K2UH 2IAND 1M4KA 3FHAA 3RJQB 1IILE 3OG6B 2EDFA 3KPOA 4HIHB 1RIHL 4YXHL 3RX5A 1U8HB 2J7LA 4J12A 4BSVA 2FIKA 3T4YB 4RX4D 2V7HB 1EH9A 3S8WA 3F7PC 4KUCD 4V1DD 5D5ME 5BZDA 4U7KA 4Y1AE 3WBDA 3E2HB 4NRYB 1I9RL 2VDQL 2X4OB 4APQA 1UVQB 3MOAH 2C1PA 5FF6B 1KLFA 1Q0XL 1A6WL 4Z0XA 3QO0A 1W8OA 2GJZA 1QD0A 2YS4A 5IR1A 2ICEB 1Q9OB 3MREA 4I3RH 5DS8A 3GMRB 3MZGB 3BPOC 4K7PH 1UM4L 1BBJA 5BV7L 1Q9WB 3G5VA 1EVTC 3RVWD 3UBXA 4JRYD 4M7ZC 3TO4D 1LHZA 1I8IA 4YZFF 2AXFA 2XTJC 3HZYB 4B41A 1D6VH 1YMHB 1JWSB 1K9TA 3UJTL 1UH4A 3TNMA 5CKGA 2VL4A 3BMWA 4X4ZA 5CBEA 5GRJH 2NY0C 4G43A 4O5LL 4WTZG 4MQSB 1B0WA 3C87A 2HLFD 4S0SD 3UTQB 3QDJE 4HPYL 3Q48A 4P9ML 2VDLH 2Z35A 4QT5B 4WVRA 2W0PA 4MNGB 1MRCL 3QG6B 3U0TB 5IBLD 4ONGH 1XGYH 3VXQB 1NKRA 3FQXA 4KMTL 3NVQA 1I1AA 5FM5M 1DQMH 3OR7A 3HPJB 3BFOA 3JZ7A 2F74B 3B8YA 5DJ2B 4AG4H 1F02I 3DO3A 2VRAA 3JWOL 3FJTA 4EN3B 5DXWA 1PX3A 2FL5A 3F5WB 3QQ9C 2BNUB 4O4YL 2BSSA 2R39A 1NMBH 1V3MA 2RGSA 4DKFH 4Q6IB 5BRZB 2V2TA 1RZ8A 1INEL 3MJ9H 2ZCKH 5I1HL 4K94C 2J88H 1JPTL 1XH3A 1KLGB 1QSVA 2X4QB 2Y36H 3HAEA 4Y4KB 4PJHB 3LAFA 1Y0LA 5C07A 4YXKL 5KSVB 5DR5H 3NFSL 1KCUL 4YIQB 2R69L 5GGUA 5C6WH 4MA7H 3H9ZA 3EGSA 3VW3H 2ZG1A 4JPWL 1D9KB 3G5XB 3ILPA 1R24B 2ATKA 1F5WA 3F7YB 1O0VA 2F5BH 4G7YL 1L9NA 3VG9B 2QR0A 2FJGA 3SKJL 2X4TA 1MHHB 1WQVT 4EQ3A 3G5YA 5C70A 1YEGH 5CZXC 2FX7L 1U8QA 2EE6A 4S2SA 2YR3A 3M17A 2AQ3A 5C0FB 1UJ3B 5DD5L 3EDEA 1VSCA 3GIVB 2J8HA 3U46B 4OT1L 1CTNA 5GZOC 2C7UA 2KQNA 4G6ML 4LSDA 2D03H 4MHHG 1SJVA 6FABL 1KACB 1MH5B 3BGMB 1AD9B 1XZ0A 4NQVB 4QXWA 4PRPA 1KB5L 4TQEL 3K8LA 1RK0B 3FQUB 4OCSL 5KTEH 1S9VB 1ZVHA 1CGVA 1L9MA 1AI1L 5LG1A 5FB8B 4GRLD 3VDAA 5GRUL 5KZCB 4XMPH 4FXKB 5JOPD 4PRAA 5DJZB 5HHXL 1OAYL 4PD4J 3BEWA 3IAPA 5E2WL 1BJ1H 3PP4H 2D31B 2FYYA 3IDGB 4PJBE 1A7NL 5F3BB 5I18L 1UXSA 2EXYC 2OK0L 5I15H 1S7SA 1NSNH 3P4OB 4W70A 2MCG1 4LNRA 1KPUA 2XRAL 4TSAH 1LO3L 4UINH 3TA3C 3PWJA 5C09B 1FNLA 1AXSA 2F58L 4ONOA 3DXAA 3B9KA 3QRGH 4NQCD 1JK8B 1FVEA 2GK0A 5KOVC 4EOWL 3O8XC 3X3FH 4I18C 4LBEA 3F7RA 1T03H 3BW9B 4JO4H 3QUXD 1CXLA 5J1SC 4KZDH 1IKFL 3TO2B 4HCRH 1CFVL 4U1LA 3PWVA 4MD4A 1MPAH 4Q2ZB 3GKZA 2ID5A 2NW2B 3GJFK 1UB5B 1G9MH 5L2KD 3TVMB 5K9KA 4YBQD 4HUUB 2BFVH 4NZUH 4L8DA 3QEQB 3BPNB 3WS6A 2DM7A 2Z92B 5C0BD 3U82B 4RRPG 2XWTA 5D6CA 2CKBH 1W72A 1ROWA 5KW9L 5CSBA 5HHNA 4NKQB 3VWKB 3BIKA 5F89B 4J3VA 1X4ZA 5HXMA 3EHBD 1ZS8A 3S96B 3FT2B 2BRRL 5KS9E 4G5ZH 2AVGA 4Z6AT 2DQFB 2AJVH 3BP4A 3VDBA 2ICES 4LLUB 4DGYL 4M9PA 2WWKT 5GZNC 3MBEB 2CXKA 4Z7UF 3MV7E 3D18B 4DN3H 4L29B 1YQVL 2LAGB 3QDME 3QUMH 3O4LB 4TUJA 3O9WD 3SEPA 1I7ZA 1EEQA 1Z5LA 4FOMA 3RWJA 3HKFA 3MMEA 5BZDB 5F88A 4NM8L 1UZ6E 2NY5C 3BP7A 2C1PB 3LZFL 3HCVB 1QBLL 3J7HA 4N9GB 4NPYA 1MJUH 5FECB 4MQ7B 5CEZL 4Z7WE 5J4MA 5DTFB 3RWDA 4QTIH 5E8NA 2F8XC 1EFXB 4MXQC 5IR1B 1HWGB 1WICA 1JNHA 1YEDB 3WSQL 4NT6B 3QHZH 4O02L 2Z8WC 2APVA 3V2AR 1M71B 3RWEA 3G5VB 2YEZB 4HMDA 4QXGH 4BK4A 3OGCA 1JFQH 2PR4L 3SGDH 5LWYH 5A43C 3QUZB 4ZFZB 4JO1L 2EKSB 1I1RA 5DRZA 2HA1A 2ZZUT 5IIEA 3ARDB 1P4IH 3RPKA 3TJHC 1MSPA 4M43H 4TRPL 3VFOB 5DHVA 5CBEB 3BHBA 1RUMH 8FABA 1Q8MA 1NMCB 4GG8A 4JY4B 5IEHB 3HUJE 4OCWL 2GI7A 3GMNA 1JTTA 2DICA 2IAMC 3TBTA 2ZOLB 5LCVH 1S9WA 5C71A 4IOIA 5FEBA 4Y0GA 3T3PE 5HDQH 2WLZA 5FO9A 4NBZB 3FQXB 2B2XH 1BHGA 1DBJL 1VFBB 3DYOA 3OR7B 5C0DA 5D1ZD 2Y7QA 3MGAA 5FUCC 1OAKL 3ZTJG 1U92A 1G0XA 4PG9B 4OCRL 2BSSB 1T21B 4M48H 3D25B 5E2UL 4EXKA 5T33H 5IFJB 4XCEB 1RZ8B 4PIRF 3B9EA 4PJFE 3LH2L 1TITA 4Y5VC 5CEZD 3HAEB 5T5FH 3WIHL 4F7EB 4L4TA 4HIIB 4PGBA 2HVJA 1MI5E 4ZD3H 4KUZH 4X6FA 5IBUG 3QZWA 5JXEC 4YK4B 3CFJA 1J12A 2NYYC 2Y5TB 4G9FA 4XP6L 2VMFA 4BQ9A 3TEUA 1CD8A 2GITB 1S5HA 2QSCL 4CN6A 5I71C 3R8BB 1EAPA 2VLRE 3EGSB 1NUGA 3ZSSA 4QRUB 4UTBL 3QFDA 3ZE1F 2NNAA 2PYFB 3ESUF 3QG7L 5FYLE 1K3ZA 5HGBB 2XNAA 5HGAA 3BUTA 3SN6N 3V4VH 2A74B 3HG1A 3VH8A 4MJ4A 5AEAA 1SEQL 1LE5B 2R15A 5KZCD 5DK3A 3BXNA 4ZAKB 5C2BH 3H3BC 3GMQB 2YPVH 1Q72L 3N9GL 3REVA 2IFFL 1KPRB 1XF3A 1DANT 2G2RA 4PRPB 5DMIH 3TBSB 4UAOB 1SEBA 2UZIH 2YN5A 2VXQH 1U95A 5IM7B 4L8BB 4J3OC 1INQB 2AGJL 4M62H 2GQHA 1HHIA 4PPTA 3S98A 4PJCF 5JPNA 4JKLA 3V6OE 2AK4B 3BEWB 3QFJB 3NPSC 3L3OA 2R23B 4Z8FL 5FYJE 1Z6JT 3QEUA 4R2GB 1RSFA 2ZUQC 4Z0BH 1H3GA 3BKCH 3UTSB 3VGDA 4X83A 3MV9E 3PGCB 2GK0B 3FCTA 3TVMD 2GT9A 1K6QH 1LD9A 3UAJC 2ADFH 5EA0L 1TJHL 3PF2A 1NUNB 2EDBA 3EZ8A 4MD4B 3B43A 3WE6B 3KPSD 4GAGL 2VLKD 5HY9A 3LKSA 1MCSA 5DI8A 2CXGA 1PG7W 4ODTH 5F9JA 2R4SL 5B8CC 3QPXL 4HZAA 1I3UA 2WWMD 5ITFB 3D69B 1PX4A 3MBED 3L3KA 4Y89A 3WFCL 3LKPB 2CRZA 3ZKMC 2GTZA 4DCQA 1FGNH 4K23L 3VXSE 3PDOA 1OM3H 3O4LD 5EU7E 4LLWA 4LHUA 1ZMYA 2GSIA 5A16A 4ZFOB 2YA2A 1MFDL 3BP4B 3O3AB 1OGAA 3DI2B 3QXAB 2VXTH 5GGRY 4J6RL 5ESAB 4RMVA 3CNKA 3CVHA 2FLRT 4ISVA 4BELD 5EZOH 4N0UB 1OP3K 3DSFL 1P84K 3D9AL 5E6ZA 3SDXE 4OD3H 3FHQA 1Z5LB 2CIIB 1L7TL 1T66D 1KN4L 1BFTA 1ZAGA 2DD8L 4XMKL 3JVGC 5CEYB 3P30H 4LLYB 4Q9QL 3BP7B 2R0WL 3O0RL 2JTDA 4NPYB 4JY5L 1NCNA 3MO1A 4KRPD 5FGSA 3RWDB 3QDGD 1MWAL 3ARDD 1NGWA 4HX1B 2BP3A 3BIAX 4KHXH 5HHOA 5BMFL 1V3LA 4XTRC 1IM3A 1PKQB 3OKEA 4OD1L 3UYRH 1MCCA 3H8NA 1CFTB 1MRDH 2OZ4A 2CDEB 5DZOA 2NQCA 4YDIH 1KTLA 4JDZB 5E03A 3SGJA 2X5PA 2OP4H 4LHJB 2R0ZH 1MLCA 1FG9C 4WJ5B 1KJMB 5ENWA 3F7VB 4JDVB 5IIEB 4XPHH 3RAJL 2CR3A 1FL5A 4P2QA 3ZDXE 3P3YA 1OGTA 5LBSL 1I7UB 1X5JA 5CD5C 2JIXD 5ACZB 2DF3A 2BNQB 1F8TH 3DHJA 4ODVL 5ISZB 2QTEA 4WHTB 2R1WB 3ES6B 1HKLL 3OKKA 3GMNB 5GRVL 4JPVH 1S9WB 3L3GA 4IOIB 1M7IA 1FFQA 5ERWA 1OP5K 1ZHKB 3OKDA 1BZ7B 1TQBB 4XBGB 1T7VA 2IANA 4K9EH 5JOFA 2I60H 2JJTC 2OL3L 5ADPH 1J5OL 4P49A 1C12B 1DBKH 1FV1A 1CDIA 4NUGH 4V1DA 1JZ3A 5JO5B 1S7RA 2Q8AL 3QP3A 1F3DJ 5TQ2H 3T65A 25C8H 2WINB 5HDBE 2H2SC 2A6DA 1EEYA 4PRID 1OWRM 2C3WA 1QSZA 3QJFA 4FQPA 3DGCR 4LPVA 5EOQL 2DDQH 4JFOB 5LAXB 4PRHA 2CK0L 4JVWA 4DOHE 5EUKA 4CADB 4KKCC 2P4AB 4WFEE 3TO4A 1T2QL 4UNTA 3QFDB 2NNAB 3WIIH 4F9LC 5D7IB 4LSPH 5EULV 2MWCA 2J12B 2XNAB 3BKYH 4NC0B 3P77A 3BQUA 1BM3H 3T1WA 3T77B 1KBGH 3VH8B 2ZWLT 3PL6D 4H0HB 5H35A 3CGTA 3QPQD 4NNXA 3FO2A 4ELMF 1TZIB 3GM8A 1X5FA 2K1MA 1TJIH 4E41A 3RY6C 3L3JB 5D7SH 4OF5A 4WV1A 4KROD 2DAVA 3I9GH 3QFJD 4JN2B 5EBMB 5DYOB 1QFWM 1YN6B 4X6BB 4JFZH 2G2RB 1OY3B 4RRPA 4GLRH 4R2GD 5D1QB 4AMKL 1CICB 2F54B 2VDNH 4NRZB 3CUPA 1OAQH 3ALWA 1AKJA 2I9LA 4FS0A 4OGAC 1NMAH 2FX9H 2HKHL 4PB0L 2A77L 1HHIB 4K3DL 4RDQF 4AENA 2JJUA 4S1RH 3ARXA 2X2YA 1PAMA 3U1SH 3VGAB 1XCTB 1UH2A 4LSSL 4TVPL 4MAUL 3RVXC 3DUUA 3MQIA 4P57B 3FQNA 5GGRA 3PXJA 4MS8C 5EBLA 4JG1L 1GGIH 4Z7VE 5FIEA 2YKLL 1OAZH 5B38B 3D39A 1LK2B 3BIBX 2GT9B 1FIEA 4OFYA 4PV9B 3VGEA 5I1IH 2JE8A 1W72H 4LCWB 4ODXB 2PTTB 3S7GA 4NNPL 3UJJH 3FQRA 2E6JA 3GB7B 2EYSA 4HGWB 3KLHC 4LRIC 2PW1A 1KJ2L 4PLJC 1B4JL 5ANMB 2PCPB 1F11A 1T6WA 5HY9B 1IRAY 3MR9B 1F58H 1N7ML 3GMLB 5F9JB 5F1OB 4ZUUB 5ICXB 1VENA 4IDJH 2NY2B 4MA3A 1HYSC 4TNWF 1CFQA 1RJLA 3MLTA 5J0BA 2AW2A 4HS3A 2F53D 4OBSA 4P9HH 5HYJB 1T4KB 5E99L 1OTSD 5GXBB 3T0AA 1MCPL 2EIBA 2LU7A 1RK1A 3TV3H 2GTZB 2E7MA 2R0KL 4CDHA 1AGBB 1RUQH 5L9DL 2VWEE 3RGVD 4HKZA 2V9RA 4DN4L 4IOFC 4K8RC 4YDJA 3BRGC 1IC5H 1HHKA 5D6DA 4LKCA 3IJHB 3K8KA 1I9JH 5A16B 1KENH 4ZXBA 3VMPA 2LVEA 2ARJQ 3ARED 1OSZA 4JANA 5D1XB 4HWBL 5J06A 3ULUL 5FA3A 4BFIB 5FO8A 3SJVD 2ESVE 1JHLL 4GRLA 5FXCH 2E7HA 2XZAL 2OX5A 2UWEE 3MA7B 1HCFX 4OZIE 3OPZL 3WJJA 4ZFFA 3HN3A 2VZ1A 3P9MB 4WEBL 3CSBA 1K8IA 5DUBA 4HV8B 5GGSY 4NQCA 1WSST 4KRLB 5DHVH 5F9WC 3WFHB 3CZFA 3CCHA 2EDXA 3MYJA 1N8ZA 5J13B 4GQPH 4NC1E 4X6DA 1HYRC 4P4KA 1LP9F 4PJ8C 3VXRE 1IAIL 1FIGH 1HIMH 5INDA 3QCTL 1FVDA 3U79A 5JQ6L 1LDPH 2Q1EA 4JB9H 4DVBB 3KJ4B 3QIWC 4AY0A 3OKEB 5IB4B 1ZWIA 1BZ9B 3RDTA 1EUTA 1WWBX 5EPMA 5HI3D 1I1YB 2DQDL 1TLKA 5E4IA 4UT6H 5L2KA 1MLCB 1P1ZB 1JN6A 4L4VD 1P4BL 3AVEA 5B3JE 5IGXL 4PJDA 1NFDF 3EDJA 4WUKL 3TESA 1B4RA 2XZZA 5I8OL 5KSBA 2BNRE 1MCKA 4XC3H 3OF6D 3G6JF 3W9EA 1REIA 3MNZB 3FB5B 3IDIB 1ZLVK 3A6BL 2AXHA 4P5MA 5JIPA 3VJ6B 4M8QB 2QHLA 1I3VA 2NY6B 5ERWB 3CH8A 4C54A 2HKFH 2G60H 4KV5E 1QVOB 3CFDA 3TFKD 1QNZH 4X99B 2G9HB 3Q6FA 1A6TA 1E6OL 2VQ1B 3O9WA 4R4BB 1CT8A 3EW3B 3F8UB 4PRNA 4KJQC 3QCUL 3QWQB 1YJDL 3P0YH 4YDVA 3MSPA 4XBEL 5AD0B 1HHJA 3UPRB 3HC3L 2A6DB 1EEYB 3KHOA 5CMAA 3IF1B 3AS1A 5E8PB 1Z9LA 3KYMB 4JZJA 4HAGA 3GSOA 4J4PC 3RUGA 3WDHA 3NCYS 4HJ0C 5DRXB 5DQJA 4GW1B 4QGYA 2P7TA 3CK0L 2JCCA 1QYGL 2NZ9C 4PJEE 4DK3A 1QA9A 3GMMA 3FB6B 4Z7UB 1RZKL 5I16A 2Z91B 4JHAH 3DRQA 1WV7T 4RGNE 3GSWB 1F4YH 4XNYL 1G7QB 1E4XL 5FOJA 1AXTL 5D1QD 4KQ4H 5FCSH 1CICD 2F54D 4H8WC 4WI7A 4M61A 1YQ2A 2HFGL 3MRLB 1A3RL 4QRSB 1AHWC 4R8WL 1NCDL 3QYCA 3TCXA 3NIDF 4OQTL 3T0VA 5DVNA 1JZ7A 1SJEB 4HUVB 3GSUA 2DQJL 2UY6A 5DMGD 3QNYB 4K71C 2C26A 5HSFA 2AKRA 3DX8A 1QSEA 3P11L 4MJ2A 1DVFC 5F72S 5AWNH 4WHYG 3CUPB 4H26B 1AKJB 4X9FA 3VD3A 5ITBH 2DBJA 4LEXL 4RAVA 3UMTA 1HSBA 3BPOB 2IWGA 3C5SB 3VXNA 4OV5B 5D1ZA 5C0CD 5K59E 3W0WE 1NLDH 1CR9H 3G5ZA 1TVHB 4OAWB 1DLFH 4DZ8A 4ZNEA 4JM2B 4G9DA 2C3VA 4TSCH 1P7QA 1U8JA 3ZDZF 4JFEE 3UJIH 1C5DB 2D7PA 4NQEA 1PSKL 5GGRB 1A3QA 3M1BA 4PJ9D 4P2YA 5I1DB 1ZGLB 3NOIA 4M6ML 4Z7NF 2RJMA 5IV2B 4EBQL 1CVSC 4J8RB 1NGZB 1E4KA 5TE6L 5IQ9B 3NIGE 5DA0B 2LTQC 1NDGA 5D96C 5JIKA 3FQRB 3R0NA 2KBGA 2EYSB 1CFSB 2PW1B 2A9ML 1ONQA 1WFTA 5J6GA 4X9HA 3V6FA 4MJ5B 1F11B 3U4AA 5K9OA 1R5WB 2X42A 4PJ5E 5GGSA 3VWJD 1INDH 3ZKXC 3CVHH 4N0FB 5T1MA 1TJGL 5D1XD 4HXAH 1T89C 4AT6A 1FGVH 3QA3A 3WXWH 4E9LA 2VISA 1I9EA 4NUJB 1RK1B 2OSLA 3NIFE 2X70A 1JMZA 1Z3GH 2DQHH 5E5RB 1CU4H 1EFQA 2IMMA 4MDIA 4XP9L 4I8DA 4H88L 3KXFB 1TXKA 2RFXA 5F93C 4D8PA 4ZXBB 5D5MF 4MD5B 4MQTB 2R1XA 1JHTA 1OSZB 4JANB 3QUKA 2NY1B 5D7KE 1ITBB 1HXMA 5HYFA 3O2WL 3GSRA 5HGHA 2CK2A 3QI9B 3S36H 5JNYB 1A7OL 4R97C 1DQTA 1ZA3B 4DGIH 5IJKC 2V9QA 1CGXA 4JJ5A 1DN0B 1OCWH 2OZ4H 4PP1C 4OLVL 4U6HA 4MQXC 5ACMA 2WUCL 2BY2A 3SCMD 4HC1H 4PG2C 5HYQA 2W9DL 3RWHA 3DO7B 5DUBB 3LB6D 1HINH 3IGAB 4CL7A 4MA8L 4G8GB 1QR1B 1WTGT 1ORQB 5DEFA 4QRPD 5DFTA 3QIBC 3EDDA 2HFFA 3RWCB 4P4KB 4YHPB 4ODWA 5E6ID 5L6YL 3FQTB 1P53A 4UQ3A 1J87A 2VDOH 3KPSA 5JMRA 2BY3A 4LP5A 2VLKA 3RNQA 3GZKA 4FFYL 3RVUC 1V3JA 1UB6B 1ZT1A 1JN6B 2R29L 3SO3B 5CAYB 1ZLUK 2CLZB 5CINH 2W9EH 3P73B 4H5SA 4EUPG 4KK6C 3S4SB 3UTPE 1DBML 3OJDA 2K9UA 1N6QL 3U0PA 1MJJB 3T0WA 3MJ7B 1KCRL 4QYOA 5B38G 1B6DA 1EAJA 2XY2A 2B39A 3BPLB 4UV7L 4N9OB 4KC3B 3CDGA 1DANU 1UA6L 4I18B 1SMAA 5D71L 4U6VL 4N8VA 3QHFL 1BQSA 1ZANH 1ZT4B 1FFNB 1MAMH 1TPXC 3HMWL 3Q6FB 1A6TB 1GZQB 3DVIA 4XX1E 5IVZA 1JJUA 3FONA 1GGBH 3D0VA 4BZ1L 5EC2A 5A3ID 4GW4B 4R0LC 5T3XD 4PRNB 4UOJA 3RA7H 3B83A 1G1YA 4ZTOL 1NGPL 1UM6L 2B8OT 4JJHA 4DVRH 3W11C 5GJSH 3OV6A 3QCVH 4QRRD 3JV4A 1YMMA 1JL8A 1PG7L 5FHAH 5DEZA 2IQ9H 3V6ZA 5C6TL 5IROC 3QDGA 5DC9B 5CMAB 3Q5YA 5JDJA 3RUGB 4JCMA 3C5ZC 3VRJB 1MAJA 5KVGH 4YDKL 2P7TB 5LGHL 2JCCB 1YNTA 4LPYA 2AJUH 2DB8A 1HKFA 4HT1H 3CDCA 4NC2B 2W38A 3V4UH 1YYLL 4IS6A 3DRQB 4K94L 3C60A 1U93B 3NFNB 5I19L 4F7MA 4YBHA 4N8CH 4I0CC 4WENB 4C59B 4HKJA 1CDJA 1X5LA 5K9QI 2JIXA 3WUWA 5C0GB 3UDWA 1MJ8L 5TQ0H 3MLZL 5TGBA 4BZ2L 1JV5A 3QIUA 1TCMA 3O6ML 3U9PH 1G7MB 3GNML 1NCAH 5DD1L 3WJLA 4PJBF 2XTJD 4U49A 4L4JA 4MNGE 5C0JA 1BF2A 1SBSL 3MV01 3BKMH 2ORBL 4LCYA 5C0EA 1XGQB 1WLHA 5KAQF 5DD0L 1H5BB 1P7HL 3B2UC 4ODSH 1OARL 2Q3AA 1YDPB 3L5JA 3FO9B 4U31A 2NY0D 1FRGL 1E4WL 5CEXB 2X1WL 3G5ZB 3HI6L 3UYPA 3KVQA 3QNXA 4L3EE 3IDYC 1D5IL 4LSRL 1QR4A 3UJTH 1MCLA 1IT9H 4NQEB 4PJHE 4S1SH 1CG9A 4PRIA 4O5LH 5IB1A 1XR8A 5CSZA 4FFVC 4HPOL 2ZUUA 1SYVA 3IXAB 3A0OA 5C1MB 1A1OA 1DDHA 1H3WM 1MHPL 2PYED 5EZLA 4LIQH 4JDTH 4IMKA 1U8LA 3QQ9D 4XWGH 2O5XH 4MYWB 5J6GB 4MD0B 3V6FB 1Z9OA 4EI5C 3H6JA 5IBTH 3PWPD 4KMTH 5K9OB 3L5XL 3MLUH 5GGSB 5GGVH 5L7XL 5T1MB 2DRUA 4U6TA 3HLAA 3PL6A 4AT6B 3QA3B 3KPRE 3TPUA 3QXDB 3C8KA 2XWBA 2RR3A 5DJCB 5IKCA 3QI9D 4FQQA 4MJ6B 4IHOA 2OSLB 1CD1A 1MCWW 3IAQA 2VLJD 4NZJA 1V7NL 3LMJL 3BAEL 2CH8A 4J1UA 3KR3H 1ZHNB 4I5BB 3SOBL 3THMH 1ZHLB 2VAAA 5C0RL 4L8CA 3QJHA 2DLGA 2FGWH 1BQHA 3BPCB 5MEOA 4OLUL 4D8PB 2OJZL 2RFXB 4YXKH 5KSAB 1F45A 4NQUA 1BFVH 3NFSH 4HS8L 1QQDB 1UZ6F 3QUKB 3S34L 2AV7A 4G8GD 1N2RA 5HGHB 2YK1H 1EEZB 5CZXD 2DL2A 3I6GA 5HPOA 3OAYK 4YPGA 4G6JL 3E0GA 2OL3A 4WFGE 2P8MB 5C08B 3N1QC 1KFAL 1MJ7H 1FYHB 3GK8L 5GZOD 4U6HB 1ND0B 3KPLA 1BWWA 1IVLA 2W0KA 4XAWH 3WHE1 3SKJH 1JGEA 4I77H 5DMKA 2V2WA 5C09E 4K3HA 5AZEH 3EFDL 2BCKA 2E8ZA 3HZVB 4E5XA 5I73C 2GTWA 4G6MH 1FNEA 2JB6A 3CFEA 4YDLC 1G7PA 3W9DA 5LQBH 4UQ3B 1ZTXH 3QEHB 2EXYD 1IAOB 4A2LA 2LQRA 3EO1B 4L5FH 5J3HC 3LEXB 2WM0A 1RZ7L 5D8JL 2BXZA 3HUJF 1D5XA 2IQAA 2NY5L 4X5WA 3VFRB 3B4NA 3N1MC 4BSWA 2XA8L 5F6IC 4LU5L 4BQBA 5I6XC 3BH8A 2VIRA 1QP1A 4QO1A 2NY7H 3O8XD 2F53A 5BS0D 2DJ4A 4XPTL 4H5SB 2EDTA 1NC4A 5D2LA 4XZUB 5F9AC 3T3PF 2J3SA 4C83B 1FO0B 2OK0H 1JGDA 2ITDA 4GKSA 4LAJH 1YN7B 5TE7L 2ZUQB 2IH1A 3MUHL 1NC2D 2V5SA 4JPKH 4QYOB 4X6CF 4HWUA 2HMIC 4RIRB 3KPQA 4EOWH 3HFML 3AREA 2CDFB 4ZFGH 3MODH 4KI5E 2JJSC 2OJEB 1CFVH 3SJVA 2XY1A 4PJFF 4N8VB 1DLHA 3MC0A 5GSRA 3U30C 1FPTL 1G6RL 1MFEL 3STLA 1YA5A 3O6LH 4OZGA 5BOPA 4KKBD 1KN2H 3IRZA 4JM4H 5I1EL 5IVZB 4FTVB 3D0VB 4FG6C 4S1DC 5MEPA 1T5WA 2DBLL 2VZ3A 4NZDA 3F6LA 4BQCA 3FT3B 3JV4B 1YMMB 5GZND 4PTTA 3SDAB 3GKWH 4ZUTA 1A6VH 3CXDL 3DV4A 1J8HD 3SY0A 5I1AB 4UU9A 3VGBA 4O51A 1FAIL 4POZC 5IQ7L 4KAQH 3V4PH 1RURH 3O6FC 1YUHB 2P5WB 4GKNA 1KJ2A 4P23B 3VFTA 3G6AA 5CS7A 4LPTA 4FZEH 5FKPB 3IKKA 3WNOA 4YE4L 3FQWA 2D7TH 3I75A 5IWLA 2DYPB 2V5RA 4IS6B 3C60B 5I8CB 4GXVL 1A64A 3PHQA 2HN7A 1P7KB 3KPNB 4RBPK 4G42B 3LPFA 3K4AA 3RZCB 1I1FB 4FQIH 2EO9A 4UIMA 5TGBB 4PRBA 1HXYB 1QHOA 3MOBL 3LKQA 2X10A 3OF6A 4A2MA 3MRJA 1RIUH 1ZOXA 4HWBA 3C08L 4HIXL 4YWGL 1EMTH 2E9IA 2ERJB 4WW2C 3TJHD 2BDNH 4OGYL 3T0EA 1AO7D 2YZ8A 2QV2A 4MA1B 5E2VH 1KJVA 2K7PA 3CVIL 4JO1H 3CSGA 1FZOA 3EYOA 1RUAL 4JFDA 4FZ8H 4XNQA 2J4WL 4U4BA 1FCGA 3S4SG 1C08B 3KJ6L 1NFDB 4LLMA 2JLLA 3MJ8B 3CLFL 3S6CA 3OKMB 3SE3A 2NY3C 5C07E 5DJXA 4B7LA 5DJ0A 1WISA 3SDDC 5CSZB 3DX9B 3DUSB 5CGMA 3IFNL 1DDHB 4N68A 4OCWH 3FL7A 3G6JB 3E6FB 1MCDA 4NDMA 1DUYA 4WUUA 5DGQA 3LS4L 1FO0L 2CLVB 2XPGA 1FFOA 4C56D 3WN5B 1UM5L 4HLJA 3T2NH 2NX5B 1DN2A 3T04D 3QULB 4GRWH 2R1YA 1A7QH 5DF0A 3CDFA 2ZPKH 1AH1A 1WZKA 1KCSH 3TNNB 1OAKH 4I3GA 1T04A 1GGCH 2V2XA 5JXED 2NYYD 3MRPB 4Y5XA 3MXVH 3TPUB 4Y4FB 3O45A 4KY1H 1RU9L 1R5VA 3LKNB 3RTQB 1AP2A 3SDXF 2ICWJ 4J1UB 2AXJA 4L8CB 1KG0A 2VAAB 2EDYA 3P4MA 1OAUH 3TCLA 4PRPE 4OI8A 1A6ZA 4XP6H 4F9PC 1IMHC 3U83A 3JWDC 3KYOA 2MMXA 3R06B 1U8NA 1UCBL 4LCCA 5TPWH 2AV7B 1N2RB 4NC1C 3HNSH 3I6GB 4PV8A 4YPGB 4IRJA 2EZ0C 1N59A 4JZNA 3WLWC 4TNVK 5T1LA 3WEXA 4XB7A 4QXTA 4CDGC 1HEZB 4YFLF 3KPLB 5IHZB 1JGEB 3GBML 2V2WB 2VSCA 3TZVC 4PJ9A 2DKSA 1NAKH 3LD8B 3DXAE 3OKOA 4GSDL 5F21B 5E00A 1BAFL 1YC8A 2F9BT 4NJ9L 1FJ1A 4EJ1C 1FBIH 1L0XA 4P5KB 5FM5O 5DC0A 3ZDXF 3BSZH 1TQCB 5FM4A 5IMOA 3W9DB 2P24A 2DLFL 3QO1A 5C2UB 3AU1A 1UQSA 3BE1H 2P8LB 3KPTA 1RZFL 1WTLA 2Z8SA 4WTWA 4D0BA 2CPCA 3VWJA 4RFNB 1P2CA 1I3RA 4QHMA 1XF2B 1HHHA 2XZCL 2UVEA 2VIRB 4R90L 2XXMB 4W4OA 1YY9D 4C4KT 1ED3A 3A6CL 4QHUB 1NC4B 5D2LB 4UIKL 3UAJD 1JGDB 3HNTL 1PJ9A 4XT1C 2FECI 1IGYA 1C1EL 2IH1B 4FTVD 3ROLA 5IP4A 1LE9A 1YECL 3I3DA 4ONHA 4KJPC 3KPQB 2AJXL 1FORH 2EH7L 3U9UA 5JHLL 4PBVC 2GIYA 4K3EH 1XIWA 2L4OA 2NW3A 5HDBF 4IRSB 3S88L 2GW5A 1J1PH 1X5YA 1NBVH 1S9XB 4TUOB 3ZKMD 4B53A 5E8DL 1I8LA 3VRIA 5L0QC 5IW1A 3X13B 5HHQA 1Q9LB 3OR6A 4QCIA 3QPXH 4P23D 2PW2B 1I9IL 4U1GC 2YD9A 2I07A 4X98A 5F7HA 4RFEB 2G75A 5IT2L 1T0NA 5CIPB 4RGNC 4DWHA 3HS0A 3ARBA 1YEFH 2A1WH 4LCIH 2GSGB 2YXMA 3JUZA 3OG4B 4ZUTB 4NHUB 2KUTA 3RKPA 4QRPA 4IJ3B 3MYZA 1WIUA 4PLOB 1QKZH 5FUOL 4O51B 3HI1B 5E6IA 43C9A 2IBZY 1FYTA 5IFAH 5D2NC 1HCVA 4GKNB 5IMMB 1WZLA 2BOBA 3RVWC 4ZUWA 3E8UH 4OJFL 4Y1AB 1MFDH 2QQKL 4NJAH 3CC5A 2VLLA 5B39B 4N1EA 1MELA 2WSKA 1MRFH 1ZE3C 3RWIB 1U3HB 3D3VA 4OIIH 1PG7X 3DVNA 2XIDA 3LV3A 3D9AH 4GMTH 4HKXA 4AJ0A 3T0BA 2A83B 5GS1C 2HFEB 4Q0XL 1MFCH 1CD0A 5F7DB 3L3DA 4XTRD 5DO2C 5JXAH 4OZ4A 3MRHB 2HLFC 1A7RL 3TYGH 2DD8H 4NWUH 1AGCB 4M1GL 4UIMB 1X5AA 5JHDA 3IJYB 4OLYL 4ZUSA 4BA8A 4HUWA 4Y2DB 3QUYB 3WD5L 3MRJB 5IBLC 1QRNB 4JLRA 4NZTL 4U1SA 5BMFH 1GPOL 2VB5A 2BVPA 2ED7A 3MLYH 4JCLA 4U1KA 5EO9B 5KJRH 5HDOA 1VKXA 4WW2F 4LAQH 4Z7VF 4LPWA 1N0LA 1GOGA 3TBYA 3QDJB 2YOCA 4XCYB 1CXIA 4RDQG 3F7QA 4RQQA 5I1JL 1ZHBB 3VD5A 3GFUA 2BC4B 2CQVA 3AAZA 1XGPA 2C5DC 2Y72A 2OMBA 3MZTA 4JFDB 5DFVC 1IGTA 2ENYA 3HB3C 1G7IA 3PJSA 4L4TE 1YEHH 2R8SH 4F7PA 3F58H 2AAVA 4FQ1H 3NTCL 3ZTNL 4N8PA 2WBJB 5DJ0B 3DROB 3W2DH 5JUEL 3WIFA 4G9FE 4PGCB 3DGGA 2JJWA 3JTTA 4Y4FD 3D2UB 4NO3B 4NDMB 4WUUB 1JWMB 3DV6B 2HLAA 3V7AE 4XC1L 1CIUA 3MA9L 1FNSL 5KANI 4TNVF 1AQDA 3O4OB 4OV6F 5IB3A 4XNUH 4IRZH 2DMBA 4LSQL 4PJ7A 4UBDC 2H2SD 2R1YB 4M6OH 3RY5A 2OL3H 3HG1E 1XGTA 1IGJA 2ADJA 2HRLA 2Q76A 3DURA 1J5OH 2V2XB 4XNXL 1KULA 5F7KC 3TP4A 1OSPH 4LEOA 2UWEF 4IIQC 4JQIL 4OZIF 1AQKL 1AP2B 2DQGL 4YO0A 3DMMC 2DWDA 4GAJH 35C8L 3TCLB 5FAAA 3SKMB 1TTFA 2BVOA 4X6EB 5J11B 3JWOC 4P5TB 15C8L 2FO1A 1GHFH 1A2YB 1UH3A 5DWUH 1QLFB 3AS0A 5T1LB 5JR1H 1PW3A 4K8RL 2DKMA 2FB4H 4P2CG 1T20B 4YHNA 3C6LC 5L2JA 1DJSA 2P8PA 1C16B 1RIVH 2EIDA 1UZ8B 2XQBL 1LEKB 1A9BB 3I02A 3AMKA 3OKOB 3MGOA 5HHPB 1F97A 5E00B 3VFSA 4JO3H 43CAA 1FJ1B 1MFAL 12E8H 2PYEA 1QLEL 2IMNA 5HHVL 1XR9A 3SKOB 3D87B 4AMKH 1T1WA 3D0LA 5IMOB 1U58B 2Y07L 1S7XA 1BMGA 1F3RB 3QQ3A 4KWUA 1BOGA 4KZEH 3RVXD 4AZ8A 1AY1L 3PWPA 3QQ4A 4YBQC 3MRIA 5I17A 4MS8D 1BQLH 1ZLSL 3UZEA 3NH7L 1MCFA 3U36A 3IU3A 2QADB 1G9MC 1TENA 4HWNA 5EOTA 3VXPB 1RVFH 5HVHC 4PJIA 3ALPA 3QNZA 4OLWL 2ILLA 4XPGH 4BFBD 1FC1A 2VLJA 4KV5F 3KLHD 3IFOA 3EHBC 1KGCE 1R3JB 2YA0A 1IGYB 4PLJD 5F3HA 5HYSG 4JG1H 3E2HC 1OTTC 4CRPA 1X6NA 3WFDH 3QQNA 2I25N 1A7PL 5FO7B 1M7XA 4Z5RB 3BZEB 1OGAE 2VN7A 3WL9A 3U9UB 4L9LC 1A0QH 1E27B 4RWYL 1F13A 4M6NL 3AY4C 2IBBA 1OD7A 3OAUH 1KJ2H 2Q20A 3VXUD 3ARUA 4LARH 2CIKB 2GJ6A 4QY8A 2AJ3B 5IW1B 5HHQB 1CE6A 4I3SL 1I7RB 4IOFD 2HH0L 1UWEL 4K8RD 1RZJL 2NCMA 2HJKA 5KS9B 4UUJB 4KJYB 1KXTB 1GOFA 1WWAX 2AI0L 4X98B 4G8FB 4PJEF 3LSOB 3GJFA 2OTWB 2Z4QA 1AGDB 1GH7A 3ILQC 1B0RB 1O7SA 1K4CA 3MV7B 1F6AB 4PJCA 4AQOA 2X44D 1XGUB 3QDMB 2KH2B 3RWGA 1U8MB 5GISL 5L9DH 1CBVL 4RCAA 5HVWA 4BKLA 2PO6B 5HHOE 2E9JA 3GJEB 4JFPB 4Y5YB 4E0RB 3GSXA 4NP4L 1FYTB 3BJ91 1H3TA 2HT4C 1KNOA 3NN8A 4ZUWB 1DQJA 4HWBH 1K5NA 1T2JA 1R5IB 1VPOH 3TA3A 3H9HA 4Y2DD 2YBRB 3SDYH 1RULH 4Z7WB 3IDMA 4L3AA 3DVNB 2Q6WB 1SJHB 2P43B 5BS0A 2QKIB 5DMYA 4ZQKB 4P2QE 4HKXB 3VA2C 4PJ8D 1UG9A 2LE9A 4OZ4B 4MAYB 4EN3C 5HHMB 2CUHA 2ZSVB 5BQ7A 3GDBA 1NC2A 5K59F 1U8KA 4ZUSB 4Q6IC 5D4QA 4D0DA 1KLUB 1FZKA 2FZ3A 2AJSL 5I1LB 4QF1A 2X05A 1YYML 4Y4KC 5KG9A 1X7QB 3SKNA 4F15B 1T3FB 3QCTH 4H8WL 4U1KB 4UNVA 2PXYB 1YC7A 4Z76A 1VKXB 1A1MA 1M05B 2IANE 4KJWC 3HUJB 5I8KL 5C0AA 3NIGF 3S5LA 4RQQB 4V1DE 2FO4A 1D9KC 1IL1A 5J1TC 4U1NB 1IEBA 2YD5A 4FNLH 4MNHA 3EYSH 5ELIA 3F6IA 1LEGA 2PKDA 3OSKA 2X89D 3VG9C 3ARYA 3PJSB 4F7PB 1DL7H 3U48A 1J8HA 2R4RH 4LSTL 1S8DA 3CX2A 5GIRA 1T1XA 5MI0B 1UJ3C 1JNLL 4LCUB 4PRHE 4LGRB 1IGCL 2VL5B 1YY8A 3A6OA 4KJQD 3A6BH 5L88L 3BN9C 3NIFF 3MV8D 4H1LA 4PJFB 2HLAB 4M7LL 2OCFD 3OMZA 1KEGL 1IEAB 4WEUD 1QTYT 4HEPG 1WCBB 1MI5B 4PJ7B 1E6OH 5I66B 1BBDL 2ADJB 2Q76B 1JGVL 1D5BB 3WXVH 4J4PD 3QCUH 4P5TD 3BVNA 2E27H 4R0LB 4WTXA 4E41E 3T8XA 3KDMB 1WBYA 4LEOB 1UJTA 1BJMA 5J12B 3PNWA 4JVPA 3B9DA 3VI4E 2DWDB 2EEAA 3BP6A 1ZA6B 1CGSH 3FOMB 4UTAL 4JRXA 1I8MB 5DUPH 1NEZG 5A2LH 4UILL 3O11A 2IALB 5KBNC 4WI5A 2MFNA 5KVFL 2UVFA 2H6PB 1AGFA 5DRNA 4HFWA 3P0VL 4PFEA 3IFPA 5F96H 1LDSA 4MDJA 4AM0A 1AXTH 1NGQL 4G6FD 2B4CC 4K3JH 1Y6MR 2X1QA 5EU6D 2IAMA 4P2RD 5IJVA 1DVFD 5HYEA 5L2JB 2RBLA 4R8WH 3TVMC 5D9SA 3RNKB 1NGYB 3BPNC 3I02B 2HP4A 1A6UH 3FRPG 5GHWL 3D39E 4P2OA 3VFSB 5BW7A 1CGUA 2YUZA 3CPLB 2JJVA 1JWUB 7FABH 5EORH 4FXGA 4GUPB 2DWEB 3QHTC 3G6DL 2XG5A 4JR9L 4M93C 3VWKC 3CXHJ 1DBBH 3S37L 1S7XB 4EDWL 4C56A 3T0DA 3QQ4B 4LEXH 4Y5VA 5CFHA 3MRIB 5I17B 1NCWL 4KI5C 3CMGA 3MBEC 4PBXA 4JFFA 5FYKD 4HWEL 2WWKO 4XVTH 4P59L 1NBYA 2EYRB 4GG6A 1JZ8A 4PJIB 1MIML 3QNZB 1FL6B 2H26B 4R4FH 2VDML 5FOBB 3WLBA 2YD7A 4LIQE 2JK5A 1PSKH 1PFCA 1WF5A 1Z9MA 3RI5K 1KT2A 3ECBA 4O9HH 4OM1H 1RMFH 1AD0B 2K3TA 3L95B 4ELMA 3WCYA 4DZBA 2CJUH 3MV7D 1EHNA 2XKSA 3FTGB 3QDMD 5ALBL 4KVNL 5MERA 5JOPE 3GRWL 3IJSA 2GJ6B 4QY8B 1GCFA 3HE7B 2Q8BL 1N64L 1HQ4B 4JFXB 3LN4B 5EOCL 3UTTA 1K4DB 4B50A 1G7JB 3QUZC 1MREL 3C9NB 1J0JA 1JHKH 3ARFA 4U1IB 1J86A 1VESA 4NQCE 2N1KA 5DRWB 4HUXB 2ICWI 5MEQA 3Q3GA 2ZJSH 3RWGB 4NZRL 1QFUL 2PN5A 4X6DE 5SWQA 4Y4HB 4ALAH 4CKVX 5EO0B 3BT2H 1NMCC 3BD3A 3H3KA 3GSXB 2D7QA 4PB9L 1S5IH 4PP1D 2DQUL 1KNOB 3GSQA 3O3BA 4MQXD 5GPRA 1MCOL 3LRHA 4KTDL 3FO1B 3KLSA 3QBTB 1K3IA 1HK6A 5I1GL 3O2WH 5FYLL 3VA6A 2XI9A 4D3CL 1A5FL 2O5ZH 3FN0L 1GOHA 5CSGA 4D9RE 4XXCC 2C4FT 3CU1A 4PJDE 1BVKB 3QIBD 5C7XL 4HBCL 5T3XH 2PXYD 2WUCH 1NAMA 3GI8H 2FH8A 4MMZC 4D9LH 3PDGA 5KSBE 3GHBL 3VXOB 4D0DB 3ZZ1A 5B8CA 2FZ3B 2EYTB 2YUWA 2I26N 3PIQA 4XP4L 4KK9C 4TULL 5E8OB 4FFZH 5KG9B 4GFTB 1Q1JL 4OZFA 4PJHF 4YK4C 4YDLB 5ILTH 1KIQB 5KAQG 1I75A 3C2AL 4I2XA 5BJTB 4FFYH 1HZHH 3V79C 3CX5K 4FQJL 4EDXA 2MHAB 5FYJL 4EKXA 2R2HB 2R29H 2AJYL 4OKVA 2XKNA 4NQSA 4XPBL 1A4KB 1NCBL 2ADIA 2C3GA 1KELH 3MRQB 4E42A 4MZ3A 5IVXA 4NFCA 3KHQA 1NGXA 2R0LH 1G7LA 4M5YH 1JZ4A 3TT1L 4YX2H 2DOCA 3RUGE 4F7CB 3DWTA 4ZAKC 1QSFA 4QHNA 2JCCE 4CMMA 2DLTA 2VLRD 1LMKA 2GUOA 2VE6A 2ZUYA 5CP7B 1B0GA 3JVGA 5FYLD 1I7TB 1EERB 1A6AA 4UAOC 3U4EA 5J1AA 1N5AB 4KPHH 4DAGL 1LP9A 3NZHL 1U8PB 1I4FA 2XTLA 3SE8H 3RX8A 4K07A 4GMSL 4YJZL 1B2WL 1LNUA 3BP5A 5BXFA 3C5ZD 3BVNB 3T8XB 1NGPH 1F4XL 1KIPA 3PNWB 1C8PA 1P4LB 4R2GC 2D7MA 5D7JA 3L7EA 3IVKA 4WI6A 5DC4B 4HIJA 1QSEE 4FQCH 4YGVA 1DFBH 2AABH 3GBNL 3FFCA 5DHYB 4WU5A 4G80A 5CILH 5FV1L 1GGYA 2F15A 2V17L 2XFXB 1XGRA 3FOLB 3JV6A 2DLEA 1VEPA 3SQOH 4AIZB 3GGWA 4LVEA 5MP6H 1GIGL 4U6YB 4XHJD 5J7CC 4HFWB 4JN1H 2VDRH 1W0WB 5FYJD 1FG2A 1RAMA 4ZNEE 3UBXI 3STBA 4K94H 4AM0B 1UACL 4HFUL 2D3VA 4CVZA 4KRNA 2Y06L 3HRZA 4LF3A 1JPST 2AXGA 1RJYA 4NQEE 2Q3ZA 3BEVB 5T1DL 5JZ7C 3VCLB 3MV9D 5TJWK 3PV6B 3RI5F 1S7TB 3I2CL 2BVTA 1MJ8H 3B2UD 4P2OB 1BD2D 1MVUA 4HHAA 4WO4A 1KB9K 3STZA 4DGVL 3SPVA 4FXGB 1BEYL 5GRVK 3TIDA 4XGZA 1EHLH 1BGXL 3MRBA 2M1KA 3VG0H 1VCAA 3L7FB 1X5HA 4FFWC 5IF0A 4OLXH 5IFHH 3BGFB 3HI5H 4JFFB 4LMQI 2W60A 4NM4L 4KI5F 4ZG1A 1CL7H 5F9OH 3WFBL 1AFVL 3VXSD 5C86A 2LFGA 4LGSB 3V8OA 1XF4B 2ARJB 3LN5A 3H9SA 3KLDA 3F12A 5T1KD 3MLSH 32C2B 4YEFA 3GJFH 1HILA 3HE7D 1B90A 4ZS7H 4QWWC 4F9LA 4EI5D 1BQUA 1J0YA 3ECBB 3PG2A 5ESVA 5EU4A 2WV3A 3GSNB 4WY7L 1OT1A 3NACH 4JGUA 1VEOA 3B5GA 5DUML 5AUMB 4GRWE 3BWAA 4ETYA 2CGRL 1BIIA 2P1YA 4OB5L 1J88A 3RY6A 3MRKB 3IJSB 1KYOJ 1WCQA 3R8QA 2WAHA 3QAZB 5DQDL 2H41A 4OCXL 5I8EB 1T1ZA 3GBLA 3UTTB 3QT2A 2BOCB 3RIAK 3MPCA 4BH7A 2ESVB 5ETUB 3ARFB 4ODUA 4NKOA 2UWEB 3Q3GB 4QKXB 3UC0L 1J05B 1V7NH 3LMJH 2FWOA 2YWZA 1I8KA 1CDCA 4W6WB 1J0ZA 1X5KA 3RL2B 3INUH 1IGFL 4HBQA 5CCKH 3KPSE 1L6ZA 5CZVH 2VLKE 3K2UL 4YHOH 3S34H 1CK0H 5I1CL 3L3HA 2P46B 5SV3A 4XVSL 1J1XL 2A6JB 4WI2A 3OX8A 3HRPA 1TQBC 1DBAL 4G8EB 4ZODA 4HG4J 5IESH 4N1CA 1NAMB 4Q9CA 4HF5L 2BSRA 4HJGA 5FDWA 4BK5A 1EZVY 4LQFH 2A2QT 5IB2B 4KTYA 3ULUC 2V7NA 3PWNA 1NJ9B 4MCYB 4GLRI 4LGPB 5I74B 1LVEA 4Y88A 1BLNA 5F1KC 3TFKC 4L8SA 1JYVA 4YFDB 1WVZA 5EZJA 2DJUA 3VXUA 4ORGA 3LKRB 4DUWA 3O2VL 2H45A 4I2XB 4Z7OE 5JW3L 4M00A 2BNRB 1EJ6A 5D8JH 1NEZA 1TZHA 2YRLA 4H1LH 2NY5H 3IETB 3W39B 3MRFB 3U7WL 2HMID 3NGBB 4F37K 3O3DA 4OKVB 2XKNB 1LO4H 5EFIA 4NQSB 3VXMD 1AR1C 1YMME 4JHWH 2XQYK 3PWLB 5IVXB 1GVIA 5INCA 5CKAA 3QDGE 5JIIA 5C0NC 4HUMB 5TE7H 2IH3A 4HJJL 1JYNA 3MRGB 2X4SB 4X80L 3C6SA 3EYQC 2ICCA 4M7LT 1QSFB 2D0FA 2Z8VC 4S1DD 1V8HA 4CMMB 1NH6A 4P99A 2IPKB 2OMNA 1H0DB 3LQMA 3H7BA 3OZ9L 4WFED 1RHFA 2VE6B 3OXRA 1T1YB 4ELKA 5DT1H 1B0GB 1WC7B 1VACB 5D1QC 1R3LA 3DX6A 1CICC 1T5XA 1FPTH 1XEDA 5EIVA 5ID1A 1UYWL 1GAFL 4WW1B 1RZGA 4M02A 4MSWB 4HLZG 4TSBL 2WP3T 4LSUH 3ROOB 4PJ8A 4ZTPL 5IG7B 1NBZA 5H94A 2HJFB 4HIEA 3O6FD 1BP3B 1UKTA 2B5IB 3DBXB 4HWZA 4NHCL 4PJEB 3VGAC 5HD8C 3AXLB 4FQ2H 4I48A 5DD3H 3QIWA 3FT4B 4WWKB 1A47A 4F80A 4RGNB 5D7JB 1A21A 3IVKB 5EC1A 4QOKD 3ARSA 2H1PH 3CXDH 2J8OA 2VITA 2QHRL 1MNUL 5ID0B 3L9RB 4HQQH 3MFFA 4G80B 5IQ7H 5J89A 1SYSA 3I50L 5DMJB 1L7IL 1IFHL 3TT3L 5C9JB 1ZK9A 4M3JA 1YJDC 1KC5L 4X9IA 4ZSOA 1D5MB 3TN0B 4CVZB 4GXVH 5FV2A 3PQYD 2CMRL 4O58L 3OB8A 4J3XA 3KWWA 2NY2C 2ZOKB 3JV5A 3JWDL 4PRIE 4LVHB 3WNMA 1FE8L 2ATPA 5F7MC 4CVXA 4F8QA 4RGOH 3W0WB 1MVUB 4CMHB 4HHAB 5E8EA 5DZLA 4Y16B 3ME0A 3MRNA 1RZKC 4X7DC 1DEDA 4LRNH 4F2MB 4ZYKA 3CFIC 3WO4B 2MQCA 4GQ9L 4JFEB 4HIXH 5DD6A 3CU7A 5H2BA 2OR7A 3MV8A 4JO2L 3LN9A 4DKDC 3HZKA 4LQ1A 4LFHD 3MNVB 5H37G 5E4EB 4AYFA 5D1XC 4KK5D 3MV11 1F3JB 2NY3D 4OI9A 4GXUN 4R9HA 3SDDD 4F7TA 3RIAF 2CLRB 4J4PA 3T2OA 4NCC2 4F57L 4D0CA 4OCMC 1HSAA 1NFIB 3LN5B 4IEFB 1PVHA 5ALCH 5JLZB 1QHPA 3N1FC 3CLFH 4ONFL 4PJ5B 3BH9A 2IPTH 1EHXA 3H3PL 2HFTA 1DE4A 1CF8H 5ESVB 2ICWA 5EU4B 4YPJA 4PJGA 3VFMA 1AHWA 5J13C 3HZMB 3KYKH 3BDYH 3BWAB 1BIIB 1BX2B 4P48A 1IC4L 2J6EL 2R2BB 3B9AA 4JKPH 5E7FA 1FZJB 5I76A 1CLYL 1BVZA 1T22B 5AZ2L 3G04B 3GMOB 4G7VL 2GCYB 2C1OB 3KJ4C 4PJBA 4XH2A 1UENA 1I3GH 5EU6A 2YPLA 5D7LB 3GI9H 4JAMB 3VFGH 4P2RA 1T1ZB 1DVFA 3SGJC 5DSCB 2JELH 3A67L 4BH7B 4X7FC 4LPUA 2DI7A 2O26U 3DNKA 1OP3H 2ZSWB 1NAMH 5F1NA 3S35H 1K2DB 3VXRD 2H9GA 2VQUA 2IPUK 2EZ0D 4IIQB 4M6AA 5DJDA 1JRHI 4UOW0 4YGAB 4I0PB 4K2UL 2EIEA 2AP2A 4XBPA 1J9CT 4X4XA 1F2QA 3O2DA 5SWSA 3TZVD 4WNQB 1E28A 2DQCH 4OZFH 1Y18B 5I30H 4HGMA 2NY6C 3MOAL 4F37F 2B20A 2F53E 1S7QA 4NKMA 2QQLL 5D2LE 1OQOA 1FQ9C 3WS3A 4U3XA 1WBZA 1YPZA 2BMKA 3GBMH 3LEVH 2RCSL 1PQZA 5LKNA 1A14H 2W65B 3O3EA 4K7PL 4XRCB 1MVFA 5ESQB 5ICYB 3PWNB 1BAFH 3IXTA 4KDVA 2APXA 1T89A 2AQ1A 3SJVE 3P9LA 2J8UA 4GBXB 4L8SB 1D6VL 4PUBH 3BZDA 4ORGB 3V5DB 4OZGE 5J9PB 3RIFF 4P46A 2FEEL 5GRJL 1FL3A 4RZCB 2UY7A 4FQHB 1WBXB 3JV0A 4MVBC 4KJPD 3DIFA 1OD9A 1VFMA 5EFIB 3TIEA 4UIKH 1OP5H 1PEWA 3V0VB 3EOTH 5I1KH 1KCVH 1EGJA 1W0VA 5K9JL 4LFHG 2P42B 5IJKA 4ONGL 3ARVA 3NCJH 4QRTB 1RUKL 2CKBB 3IYLW 1V7ML 4JY6B 4KK8C 1DQML 5J6HA 3C5JB 4AG4L 1OW0A 2A38A 3UO1L 1OPGH 1IZKA 1AC6A 4NNYA 4RGND 1R3LB 3DX6B 5CJ5A 5LXGL 4L9LB 1NMBL 4DKFL 1VFAB 5DDHA 3K3QA 3MJ9L 2ZCKL 1RV6X 2J88L 1T0MA 5IK3B 2Y36L 2FBOJ 3QIBA 4Z77A 2EDQA 2XZQH 5MEND 3P4NB 1S7UA 3QUMB 1I9IH 3X3GH 1QOKA 5DR5L 4F58L 2IBZX 4NO0A 4JM2C 2X4NB 4CNIA 4NQXA 4MA7L 3ARPA 4O2CB 3RKDC 3CAFA 2YXFA 4XXDA 5KVDL 1QRNE 3BKJH 1MHEB 4JZOA 3VMNA 3TN0D 1CWVA 1ERNA 1MF2H 5JPMB 2NXYB 1VGEH 3MFFB 5FUOH 1JUFB 2PTUA 5IHUH 1SYSB 3T0EE 3WNKA 4O00A 2MNUA 2F5BL 4XPAH 5DHXB 4GAFB 3TBVA 2X4RB 3T09A 1H8SA 3ZYZA 5DO2D 3OL2A 3W0WD 4X6CA 1YEGL 4XPFH 3L3IB 2X6MA 1HH9B 3P40A 4Y16D 5DEGA 4X7TA 4JFED 1JCKA 4JFDE 1JPGA 3MGTA 4HDIA 5DURD 1QBMH 1X9QA 3B8SA 1QEWA 4EI6A 1QFHA 1J1OH 4L9DA 2C3HA 1DQLH 4B0MM 4OM0H 3OJ2C 3FRUA 5FA4B 5DJ8A 3H0TB 5KTEL 2VZVA 3X14A 5E8EB 4R96B 4L3EB 4WUUE 4XMPL 3MRMA 4ZYKB 1VADB 1D6EB 2Z31B 4Q97A 5JA8B 5D6DC 2QSVA 3OXSA 4KVCH 3PP4L 5EO1A 5DFVD 4ZXBC 4PJ5D 1ODAA 3HB3D 5I15L 4N0YH 1KJ3H 2NY1C 4TSAL 4MHHI 3F65A 5CJOL 4UINL 1FDLL 4YAQA 3QI9C 1S7WA 5E9DA 4F7TB 1GRWA 2KZ1B 2A6KA 3C5ZA 2VDKL 3WJJC 3Q0HA 4DTGH 1T03L 1HSAB 3EO9H 4YZFE 2X4PA 2XKUA 3PWUA 4KZDL 1U8OA 2FATL 4HCRL 5F7EL 5GSVB 1MPAL 3ARGA 1Q94A 1C5BH 3NTCH 3U7YH 3ETBF 5F7YC 4DW2H 5GRYA 3D85B 4UBDD 1KB9J 5D7KD 3EOAA 3KPRB 5EUOA 5JW4Q 4I13B 1G9ML 4PJGB 3ZE0E 3ZL4H 3MLWH 4FP8H 2NXZB 2NTSP 4P4KC 4NSKA 3BD5A 4WFHE 2H3NA 1FN4B 1OWWA 3S3PA 3DECA 4XH2B 4LDOB 3DMMD 2W0FB 2JB5L 4LSVH 3RGHA 4YHLL 4XNXH 3T4AA 4PREB 3MV9A 3ARQA 4G5ZL 4QHLB 2P5ED 1QLRB 4IMLA 4YHZH 5IB5B 3SO3C 1WFUA 2CUIA 3LKOB 1BD2A 3LQZA 2R2EA 2H9GB 1FP5A 1TNNA 1MQKH 3FB7A 3ZT6A 4YHIB 4DN3L 4EVNA 1TVDA 4OZHA 4TPRH 5DJDB 4PTUB 3QUML 5DJAA 2N7AA 3E3QC 2X4UB 3FAXA 5IOPA 1OHQA 2LU3A 4B5EA 4XBPB 4GAYA 3BRDA 5E94B 3BPLC 1ZSDA 1Z0MA 3C6LD 4ZUVB 1I85C 1EJOH 1BFOB 4PY7B 5ADOH 3IU4H 4M1DH 1OF2B 3TBWA 2O93L 1CFNA 1S7QB 3UTPD 1MJUL 1SY6A 5C0IA 4LASL 2B1HH 5BO1L 4QTIL 2OQJA 3MRRA 3BWUC 5MHSD 4HXBH 1CLZH 1YPZB 5T1KA 1ZT7B 4CN4A 2VXVH 4FQXB 4PRDA 1CLOL 2W91A 3OKLB 1JF5A 4O2FB 4F3FA 2IBGA 4EI5A 4CW1B 1JPSH 3HNVH 5DQ9B 1P69B 1MFAH 4QXGL 3EFFA 2GY7B 5LWYL 2J8UB 3IDNB 4GKZB 4KKBC 4LLVB 4JZJC 2A73A 5CBAA 3SDXA 4M43L 4M93B 4MNQA 2UZXB 2OR9H 4KH2A 3ULSA 4P46B 4LLQA 3UPCA 2BSED 3OHXA 1RUML 1MY5A 1IM9A 3NH7H 1OTTD 1BIHA 1ZLVH 2W59A 2GJJA