4RMWA

Crystal structure of the d76a beta-2 microglobulin mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKAEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Conformational dynamics in crystals reveal the molecular bases for D76N beta-2 microglobulin aggregation propensity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmwA00
4Q74A 1ZE3C 4IS6A 2JJWA 4MAYA 2EYSB 5KVFL 3S5LB 1JZ2A 1JGEB 1PDKA 4YXHH 2J5LC 4OGAD 4U1NA 4S1SL 4EUPH 4YO0A 4WTZA 3O11A 3ARSA 1ZHLA 4FZEH 5DO2C 2Z8WC 4F57H 5EB9A 1YY8B 3LS5H 1NCNA 2JB6A 4LQFL 1QSEA 2ZUVA 4BJLA 4K3HA 5FECB 2IBGA 2JIXB 2X4OB 1R0AH 2QQKL 1CD1B 1LK3H 2QHLA 4Y88A 2GSGB 3CFKB 3BIKA 3Q5YA 1S8DA 2FLBT 2IBZX 4YGVA 1XF5B 1IAOB 4U1MB 1KCVL 5EOQL 1N59A 1U8QB 4OFVA 4EXKA 4I3RL 5LBSH 1JUFA 1S78D 3FCTB 1WZKA 2VXUH 5HHVH 4U3HA 3PV7A 4OB5L 4XNXL 1CVSC 4FQJH 4LU5L 1WBYA 3UZQA 2R8SL 5GS0L 1T1WB 4JPWH 1R5WA 4U1HB 4N0FA 4GLRI 3BKMH 3H3BC 4O5LL 4M7JL 3ARFD 3BPLB 2DD8H 3AFLA 5JOPD 3AU1B 1FIGL 1MIML 4F9LC 4XZUB 2ADIA 2AK1L 3FT2B 4PJAA 3MA7B 1EMTL 2A74B 4MAYD 3UJIL 1RZJC 3O6LL 3CFJB 5CFHA 3GM0A 2NY7L 4HV8A 4RMUA 1V5JA 5DMGD 3SN6N 1D6EA 4P3CL 4F7MA 4HUVA 5T3XL 4HIIB 3VFTA 5I1GH 5C0GB 5F7EH 1HNGA 4AG4H 4D9QD 4F9PA 4PY8I 1QSED 1BQSA 1T22A 3B9KA 1OL0A 4WHCA 5IBUG 5LGJA 1K2DA 1RUAH 1W72H 1WWBX 2PTTB 4L8SC 3D18B 1KEML 2JK5B 2ATPB 1GIGL 2H32A 4HXBL 3T77A 3S36X 1WCQA 5D7IF 3STZA 1UM4H 4OCSH 4QF1A 2AXFA 4KVNH 3BQUB 3K1KC 2DM4A 2HKHH 1NGXB 2XFXB 3V6ZA 2NY6C 3BZEB 3KR3L 2I60H 4OI9A 4XVTL 3JWDC 2A9NH 4NHUA 2O5YL 4U6HB 2WANA 3HB3C 4EXPX 3QCTH 2K7QA 3CAFA 5L88H 1KCSL 4UTAH 3DUUA 4P9HL 4ZS7H 43CAA 3JWOL 5ERWA 2DBLL 2YPLE 3IDXH 3LS4H 4Q7DA 1WUNT 5ETUA 2YPLB 1V3MA 3FAWA 2OL3A 1QRKA 2P44B 4LASH 3B9KD 5IVZA 4Z7NE 4L4VA 1TETL 3OXRA 4WHYH 1MH5A 2W9DL 5E4IA 5IW1B 4F9LA 2VSCA 1QA9B 3S5LG 2ILLA 1R3IH 4ORGA 2X1QA 5GGSY 5AEAA 1KPVB 1CIDA 1U8KA 4BYHA 2VLMD 4HMCA 1MJ7H 4YX2L 5KW9L 3ARTA 3GMNA 4UZGA 5IQ7H 2OSLA 4QKXB 3F7YA 5DRXA 4Q2ZA 4LVOC 5DO2D 3GSRA 1EFQA 1UEYA 1YDPB 3EYUL 5D6CB 5LG1A 5J13C 3VXOB 5IT2L 1IGYA 3GBMH 2NX5A 5CJOH 3CLEL 1GJIA 4L8SA 3FFDA 4YHIA 5B8CB 3V8CA 4G42B 4LCYA 1HZHH 3MRLB 2CXKA 1NKOA 5CZVH 4KJWC 3ULSA 1MWAH 4F15B 1PKQE 3EDJA 3FO2A 4UT9L 1PKQB 3WO4C 3KPPB 1UB6A 1GXEA 4XP6L 1UJ3B 5ITFA 3OXSA 4L4VD 1AGEA 3CFCH 3VW3H 1DUZB 2VXSL 3TN0B 5F7LB 4P2YA 2Y5EA 3BH8B 1B0GA 1CXLA 3PIQA 2CDGA 2QQQA 4PJGE 3BISA 4JVPA 3FT3B 3RX8A 3EYQD 2UZXB 3E6HA 2QLVB 3EHBC 3T4AB 4PJGB 2VMFA 3D39A 2BNQB 2X4RB 4H88L 2FBJH 4IRZL 4OLXL 1R6VA 1WQVT 1W0VA 1GHFL 2NX5D 5EA0H 1JWUB 1QFWH 5DUMH 3QPXH 4PGEB 1U8NA 1G7LA 3OR6A 2V17L 4EDWH 1OOAA 1IC4H 5JHDA 3L9RB 1F4XL 1UWGH 3TFKC 1QLRA 4U6TA 3QUYB 2DLFL 1I8MA 1BIIB 1NDMB 1NBZB 2DKSA 4L3CA 1LE9B 3P4OB 4LAJH 2NY6D 1KN4L 2AJSL 3MJ8A 3CX5K 1ZHBA 3HFMH 5JW3L 3HB3D 4DGVL 3QWOA 3HRPA 1K3ZA 1FVDA 1YEFL 4YQXH 1C08B 4R96A 2EH7L 4YUEL 5HVHB 1YEDA 5D1QC 4P3DB 4ZFFA 4M1DL 3RZCC 4A6YB 3D39D 2QBWA 3EYFB 1INEH 3FRUA 2E9JA 3X3FH 5DK0B 5I8KH 4XPAL 1NSNL 3CVHH 4J1UB 5D72H 5FOBB 3MCG1 4WO4C 5HY9A 2DQFB 1CE1H 4GKNB 3JTTA 4AEHL 1CR9H 1FG2A 5JHDD 1TZHA 1NAMB 1A47A 4RAUB 1S7XA 4JZJB 3HN3A 3NZHH 1EXUB 5FYJH 4ELMA 4RGOH 1ZGLM 4YR6B 4JRWA 2LVEA 4FXKA 3FN3A 2NYYC 3MNVA 1W0YT 4OD1H 1ZHKB 1GZQB 2E27L 2FECI 1MHEA 4HIJA 2QTEA 4YBQC 3MGAA 1FO0L 3CSPA 1U3HB 4KJWD 3VD3A 2EKJA 1KG0B 4WENB 3VE0A 3PXJA 5CLWA 4ZXBB 2DWEB 3MNWA 2H2PC 4O2CB 1NEZB 2YPVH 5DJ0B 5D6DC 1Q9LA 3Q6GH 3CDYA 4D9RE 3KPRA 1WBZB 4XBGA 1VFAA 1OM3H 4K9EH 5I30H 5K59F 3G04B 3IU3A 4HPOL 1ZA3A 1J1PL 2NPLX 3KLDA 3A6OA 5HVFB 1LWRA 4HIHA 2D7NA 2E7CA 5C0CA 4OZIA 3QXDB 1D5MA 3P0YL 1ACZA 2B1AL 1ZANL 1F13A 1YUHA 4G3YH 3VFVB 4FQ1L 4J3WA 5HI3C 3TBTB 2VXQL 3EHBD 4L9LC 3RZCA 3QA3A 3ULVL 3BT2H 4MD5A 4MD0B 2V7NB 4WEMB 2J8UA 5DJ6B 5IP4A 1VEOA 4FFZL 2D7TL 3RTQC 1NFIA 1JWSB 3DNKA 4NBXB 3DGGA 2OYPA 3AREC 5EG6C 5T1KA 4JQXC 5CSBA 2EE2A 2ZCLH 4WO4A 2HMIC 5EU6A 3MUZ1 2ZPKH 4JG1H 1DSFH 2VE6A 5CBAA 3TFKD 5T3ZL 1WC7A 1I85C 1FYTB 3PUCA 1S7WB 2Q6WA 3QUXB 3LRGA 4X80H 1KULA 1RZ7L 1QHPA 1RIVH 2NTFA 3FMGH 5JNYB 3KPRD 1FZOA 1BM3L 1F90L 1T1XB 3FQUA 5IW3A 3MLVH 1ADQL 3LZFH 3VFGH 5C0CD 2A73A 4QXUL 1EGJL 1G6VK 3IJSB 5I8EB 4HUXA 4ELKA 1CG9B 5F9JA 5FUZL 4X9GA 5HGBA 3K4AA 4GXVH 4P0DA 4KZEH 4WFFD 4TOYH 3RZCD 2IGFH 2CIIB 4GRMB 4UI2A 5E9DA 5D6DA 2LTQC 5C2BH 4UOW0 3WEXB 3MV01 4LSRL 1QFUH 4WDIB 1EHXA 4QRRE 4PJBE 1HQRA 4BQCA 2H9GA 1Z9SA 2FH6A 4FQHA 4PJBB 1H3XA 5T1KD 2YUWA 2CRZA 2Y23A 2B0SH 2VXVH 1KJVB 3MROB 3RWIA 4WO4D 3UTPD 5EU6D 2VQ1B 1F42A 3QRFM 4G80A 2APVA 3MJ7B 4HLZG 5TE6L 1MCBA 3OPZL 3RUGE 4L9LA 4NO2A 2EO9A 4NBZB 3RUGB 1I3UA 3EYOB 4TSAL 4OF3A 4LK4A 2QV2A 2X4QA 4GKSB 5B39A 1J8HA 1JWMB 5E5MB 4KRNA 2NYYD 4RAVA 4TVSa 3RTQA 3AREA 4Q9RH 3DSFL 3LDBC 4JQXA 1JJUA 2YR3A 4WW1A 3K80A 5JUEH 4YBQD 3BAEL 3V6FB 1VHPA 4ZAKC 3AMKA 5ILTL 3WIFA 1MCSA 1NEZG 1I85A 2H2PD 2YN3A 3VXUA 5E9DD 1T0MA 3OJDA 2AABL 2EKSB 5A16B 4OUOA 2UWEA 1JHKL 3DX7A 4G5ZL 3VMPA 1N4XH 4Z7QE 5HI4C 3E0GA 3S37X 3NABH 4S1DC 5C0NC 2AJXH 2XWBB 4PGDB 1JZ6A 4ZUUB 3ZKSD 5IB2B 5DZNA 2NR6C 2ENYA 3WXWL 1SEBA 5C6PB 2DQEH 3DO7B 2I5YH 3RVTC 2YUVA 1CWVA 1G0YR 4DN4H 3EYSL 2ICES 5HI3D 4K71B 3OB8A 2QR0B 2YS4A 1JK8B 2ICCA 4MZ3A 4OFYA 2XQYK 4XTRC 1J8HD 3SKMB 5I18H 4U1LA 1DN0B 1R5IB 4ISVA 4HMEA 3RTQD 1FFPB 4H8WC 2BXZA 5I1KH 3ARED 4JREC 2APBA 4ZQKB 2HMID 2OS7A 1FAIL 1RZKL 3W9EA 3X3GL 4LSTH 2IANA 2R0ZL 5JOPE 1DQLL 1ACYL 2DTSA 3AGVA 2ARJQ 2KKQA 3C5SA 4UDTB 5JHLH 1KTDA 4KHTL 4QHLB 4P2QA 5CJQH 3TBSA 4U05A 4O9HH 3T0DA 5F6HJ 2DLGA 5GGVH 3MV7E 1J1XH 1DLHA 3WN5B 1A4JA 2GSIB 3VWJC 3MV7B 5KS9F 3O11B 1ZHLB 5LKNA 1CFTB 3V9FA 1QSEE 3P9LB 3HI6L 1UZ6E 2R23A 2JB6B 1P7HL 1OP9A 4ZAKA 2FB4L 1QSEB 4K7PH 4PRNB 5GSVB 5L0QB 1PGRB 2Y07L 4PJDA 2EDOA 4Y2DC 5I0DA 4MA8L 1S8DB 4XP9H 4MYWB 4OFYD 4XCYB 1N59B 1ITCA 4FQPA 1UACH 3RNQA 4EI6A 3ARGB 3KPMA 5MEOA 4MA7L 3KPQB 5GRUL 4JPKL 3MLXL 3DV4A 3KLAB 1EEYA 2CRYA 2VZSA 3C8KA 2MKWA 3K2UH 2ZNXA 4JCLA 5D7SH 5MEQA 3WS3A 1ZS8B 4OSUH 4N0FB 3FB6A 4QYOA 3RL1A 4UB0L 2CKBA 5JORB 1JTOA 3U1SH 2IF7A 3BPNB 4KI5C 1M1SA 3ILQC 3B8SA 4G8GE 4E5XA 4ZO7A 2ADIB 4P2QD 4OIAA 3BKJH 4G8GB 4R7NA 4JDTL 4WIQA 1JV5A 4RDQF 1FH5L 1JCKA 4G6ML 3MJ9A 4FQ2H 1J8KA 3QISA 4G8EA 4F7MB 2HFFA 1T4KA 1BLNB 4NC2B 1IGTA 3ESVF 1BBJA 3C09C 2ZCKH 2GKIA 4AY0A 4ZAKD 1D5XB 1X5KA 1UGNA 2LV4A 4LSDA 5LGJB 1K2DB 1R24A 5DJAA 4E9LA 1NGZB 4UQ3A 1OT1A 4KK5C 2VLME 4AEIL 4JM2B 5HI4D 3EOAA 2VITB 4S1DD 3GBNL 5C0ND 5JW5A 2ZKHH 1NCBH 2D0GA 3ROLA 1NUDA 1WZMA 4LKCB 3QO0A 2NR6D 3DYMA 1VACA 3DUSA 4HGMA 5JPMB 3VWJA 2AXFB 8FABA 3AB0B 1MJUH 2YXFA 1XF4A 1A9EA 1NDGB 1WIPA 3RVTD 1P1ZA 5E2TH 3L95B 4Y2DA 3S7GA 4YK4B 4Y5VB 2Z31C 4NHUB 3VXRE 2NW2A 4OV5A 3QFDA 4JRXA 3VXRB 4P46C 4XTRD 4HKZA 1MFEH 5L8JB 1ODAA 3DUUB 3IS0X 1U8PB 43CAB 1AGFA 1FORH 1KB5B 3QB7C 1CZ8H 2X4NA 4JM4L 3MCLH 1KLUB 2XIDA 2BVPA 4L4VE 3VXMA 2MCG1 4ORZC 3I2CH 3RIFF 1GPOL 2DQGH 1U6AH 4MA1C 3NFSH 4B53A 1LO2L 3U6RB 4AQOA 1RULH 5AYUL 2AK4A 2Y1VA 2YD2A 1CLZL 2HLAA 4ORGB 3OX8B 4KK6C 1HXYA 4GG6A 1NFDA 4MNHB 1U8KB 3BVNA 4G6JH 4RISL 3ULUL 1A2YA 3SCMC 4BZ1L 2OSLB 3VWJD 1PJ9A 3IDGA 5I1LB 3MNZA 3QI9A 3G5VA 1BOGA 3WKMH 3ZT7A 5E1HB 2NX5E 4Y2DD 5E2WL 1IGYB 1U58A 3ZTNH 4POZC 5CEZH 4JRXD 4NKIH 4UIKH 2UYLA 4A6YL 3S3PA 3ZYIA 3KJ6L 1M7DA 3QQNA 4D0DA 3LVEA 1KACB 3VG9C 1CK0L 1P53A 4GMSH 4CU6A 4XP5L 2VC2H 2XY1A 4Z78B 4X99A 2JELH 3DUHA 2UZIL 3VXMD 1A6VH 2C3XA 2NY6B 1EDQA 4PY7A 2O93L 4HDIB 5JQHC 4K8RL 4KI5D 2C5DC 4F33A 2Z31A 3ILQD 3ZYOA 3ORJA 1NAML 2AK4D 1JPTL 2BHZA 4P46A 3MBEB 1Q38A 4JG0L 1B0GB 2X70A 2DLHA 1HSBA 1MUJB 3D9AH 2UVFA 4WY7H 3D39E 3W5NA 3E6HB 1OT2A 3BEWA 3KXFA 1MAJA 5D2LF 1VPOH 3D39B 3SE9H 3RKPA 3QI9D 1UM6H 4OBRA 5GISL 4OGXL 1MFDL 1KFAL 4P23C 3MJGX 4LSSH 4JFPA 4B0MM 3Q6FB 3ZT6A 1YEGH 2IH3A 2PTVA 2DM2A 4FQIL 4KK5D 2VJXA 3MQIA 1Z3GH 5JHDE 2BVOB 4ONHA 1BD2B 3OR6B 4LKXA 4DCQB 5F9OL 5HYJA 5IMMB 1B90A 3SCMA 3U4BL 1QLRB 4JR9H 3VXTA 4LVOB 3Q0HA 5TDOA 1S9WA 2Y06H 1E6JH 1N8ZB 3TIDA 1QQDA 4XPBH 1S9YB 2Z8SA 3MJ8B 2EE6A 4X4MA 4OLUH 1C5CH 2Z31D 4WCYH 4ODWA 4ODVH 4RA3A 1MPAL 2F5AH 3QWOB 4IJ3C 5E95B 4P46D 5TPWH 4FP8H 2DQTL 1DEDA 2F54B 1H9VA 3GJFA 5IB3A 3I3BA 4R96B 4WJ5B 5D5MB 3DRQB 1DE4A 3KXFD 4ZFFB 3SQOL 5DHVH 4H0HB 3MACH 2MPAL 5LWYL 1ZVSA 1DTUA 2XKNB 4Z5RB 5K9OA 1F00I 1XGYL 4NC1C 1KSRA 1VGEH 5D93B 4LARH 4KC3B 1T0PB 4DGYL 3MRGA 4CKVX 4KK6D 2EDHA 1KTLA 5HYJD 3SCMD 3BSZL 4EBQL 1G9EA 4HWEL 1NCCL 4Y89A 4XC1H 1MFAL 5FUOL 1Z6JT 4ELME 1M05B 2A1WH 3K46A 1AKJB 1CICB 4EUPA 3SE8L 3N06B 4ACPA 5D71H 1V3KA 1DQDL 2BOCB 4P23A 3MUHL 1EBAA 1RK0A 1PZUB 3F65A 2P42B 4Y7MA 4LOUC 4POZD 2WBJB 3BW9B 1DANU 4NBYB 1G6RH 5FYKH 2C1OA 5DC0A 1AIFA 2VDNH 2BX5A 1QSVA 2NNAB 3MXWH 5E2JA 5DFWH 5JW4N 3QXUA 4U7SA 1OAQH 5GGQL 4XBEH 2ICWI 4KJYB 3KPRE 1Q9LB 4ZUWB 4X8JB 3V4PL 5KJRH 4XBGB 3W9DB 3WMSA 2CMRH 1UA6H 4GKOA 4YDIL 3GHBL 1EAJA 2PYEE 4OZIE 4OQTH 4LNVA 2MCPL 1NFKA 1T3FA 4FFYH 1A4KA 1F6LL 4GRWE 2PYEB 1AXTH 3CK0L 3QFJA 4OZIB 1CD8A 5TE7L 4M7KH 4NQDA 4GRWB 3BESR 4XNZB 5BV7C 5FKPA 2GCYA 1WZ1H 4Y4FC 4WFFE 4ZFZA 4LCUB 1CU4L 5D1QB 1XCTA 1MHPL 2EE9A 4Y19E 3TT1L 4MSWA 1DBKL 3QA3B 2FX8H 2J8UE 4MD5B 4Y19B 1K8IB 3H6JA 4LNRB 5F8QC 4PV8B 4P23D 1VCAA 3UTZA 4PGBA 3O3AB 3UTPE 1UQSB 3DGGB 5EU6E 3TNNA 5CEXA 4MB5A 4WO4B 2EDTA 3S88L 2WWMC 5KZCD 4CN4A 3C9NA 2ED7A 2VE6B 4YPGB 3ROOB 5J9PA 4NZUH 3JTSA 1MNUL 3FN9A 2XKUA 4OIIL 1YQ2A 3D69B 2MQ3A 4DQOH 3NCEB 2NTFB 3RHWF 4D9LH 1FZOB 5I15L 5DF0A 3FQUB 2P7TA 4JHAH 4DKFL 4QY8A 3GMQA 1YEIL 2FGWH 3MRHB 2BNRA 3U82B 4LCIL 3I3DA 1EO7A 2DOCA 3QFJD 2AJVH 2OM5A 4YNYA 2MOVA 5J06A 4NQDD 5HDOA 1DL7H 3HRZB 1Q9KA 1A1NA 4XNYH 4DW2H 4Z7WA 5F9JB 2R2BB 4MAUH 5E9DE 2X10A 5I71C 2NY1C 5LXGH 1HIMH 4PYHA 5E99L 5BW7C 5A2KH 1CDUA 2XTJC 4OZFB 4APQB 2JJVA 4X6DA 1T04A 4YDVA 4X6EA 1JYXA 2VZ1A 5IHUL 4JHZA 5C9JA 4EOWH 2H9GB 4PRAA 3BDBA 4ZFGL 4LRNH 3RWIB 3QT2A 2YPKB 3OKEA 4Y4FA 1G1YA 2VN7A 4MXVF 3WFEL 3IJYB 4L9LB 4NO2B 2CO6B 4KVCL 1K8DB 3DHJA 1J0ZA 2Z35A 1J8HE 4JDVA 5FA3A 5TFSH 2O61B 1K9TA 4X6CE 5B39B 4AT6B 2F58L 4X6CB 2UY7A 4XCFH 4LOUD 3KPTA 1JNLH 2BNRD 2CDFA 5KTEL 1RUQL 4AIZA 3BDXA 1J5OL 4M61A 3LEYL 4L8BB 4F8QA 1IC1A 3T65B 2ED9A 3ZE2F 1KT2A 4FN0A 5C09A 1MWAA 2UWEE 2B39A 2VSDA 4FFWC 1QBLL 2OZ4H 2UWEB 4GRLB 1U3JA 2QADC 1QYGH 1A9BA 32C2A 1DVFC 1YPZF 1IAIL 1FVEA 1U41A 4D0CA 5HPMA 1QACA 3G08B 1OSZA 5C6TH 1SEBB 3O2DL 1JMZA 4Y4FD 3ZDYF 2IFFL 1DBBH 2GTWB 3F5WA 2AV1A 3KJ4B 1MLBA 1J05A 3IDYB 4GQ9L 4PRPA 4WFHE 5FGSA 5BW7A 3GMRB 3QZWA 1VGKB 3GZKA 4I77H 3IFLL 1P2CB 4DZBB 2VXTH 4DOHB 5DUBB 1EZVY 1OTSC 2DJSA 3RPIB 4ISVB 4LLMA 3ZE0E 1VESA 12E8L 1WAAF 1Z9MA 1WISA 1TZIA 2WWMD 4TUOA 5HHOA 4ODXB 4MNGA 5FM5M 1H5BC 5DGQA 2FLRT 1LO4H 5IGXL 1FZMB 4FTVA 3AS1A 3OMZA 1QFOA 5C09D 4P2OC 5KANG 4KROD 4NQEA 3C5SB 4P2QE 3SGEH 1KTDB 3D25A 1IT9H 3KNBB 4P2QB 1XGQB 3KHOA 2HVKA 5IEKA 5E0QA 3A67H 5KAQG 3L3OA 1NH6A 3ESUF 1JPSL 1GYAA 4K9EC 1KCUH 5BQ7A 3LDBB 2Q3AA 4S0SD 5IVXE 3BO8B 3EZJB 1G9ML 3BP6B 1CFBA 1YEHL 5IVXB 2R23B 4PJDE 3QG6B 1ZTXL 1JF6A 5HYQB 2NY1D 4PJDB 2FHCA 4WWKB 2YA0A 3E2HB 4JCMA 1KB5L 4PRPD 4OLVL 2XTJD 5C70A 5CZXC 1SJXA 3RNQB 3FB8A 3KPMB 2G60H 5GHWH 1SVCP 5I1JL 1N5YL 5IK3A 1KYOJ 4LPYA 4H0IA 2HRPL 3DV4B 3TM6A 3CVHA 4QXTA 4BUGA 2P48B 5HHOD 4TVPH 6FABL 5C08B 3WS3B 4NNYA 4NT6B 1LEKB 2XQBH 3RIFK 3FB6B 3TT3L 4FTVD 5M95B 3EFFA 4IOIA 1S3KL 3O2VH 3PDGA 4NQED 4R9HA 3BPOC 4P99A 5DD1H 1DQML 5B39G 5ITBL 3V0WH 1BBDH 4R7NB 3MCKB 4X4ZA 1NAKL 3QNZA 3I6KB 5AWNH 4G8EB 4JREB 5CINL 4GFTB 2BHUA 4OM1L 4HHAB 4Z0BL 1BBJB 3RJDA 1QBML 3H42L 4Z7UF 1F3DH 1H5BA 3P11H 1FLRH 3BHBA 1PBYA 1R24B 4P2OA 4FFWD 4HKXB 4C57C 4UQ3B 1KIPB 5TF1L 3B83A 1ORSA 1E4XL 4ONGH 4W6YB 1DVFD 1O5DT 2E9WA 3ROLB 3MXVH 3CH8A 2NZIA 1FAKT 2CPCA 4GLRH 4YWGL 2J4WH 3DUSB 4OD3L 1ZLWH 5D8JL 3VFWA 1S7VA 1VB9A 4LF3A 4UTBH 3SY0A 5MP6H 3K74B 2C4FU 1TJIH 1A9EB 2EYTB 4MLSA 3G6AA 1JGUH 1UENA 1BAFH 1A3QA 2GEEA 4Y2DB 1T2QH 3S98A 2BFVH 4JRXE 2NW2B 5IB4A 3SDXE 3C08L 3D3VA 2ZUTA 3V5HA 1RV6X 3NZ8A 4GW5A 3SDXB 5FYJD 4PB0H 5DJ2B 1OTSD 1S5HB 4E0RB 5F88A 3EJJX 4YHOH 3BDYH 5F96L 2W92A 1AGFB 2BVTA 2NY4C 2ZG2A 4P59L 5ACLA 2WP3O 3VXME 4J7RA 3B9EA 4Z6AT 2J3SA 4MCZA 1HHGB 3FT4A 1JYWA 4KJPC 4JEGB 1A6AA 4JPVH 4P2OD 3CNKA 4B5EA 2X7LB 3WXVH 4YHML 4GG6E 1T1YB 3VGAC 5C0RH 3UC0L 2FIKA 2WM0A 3N1GC 3BVNB 5K9KA 4I18B 4IHOA 3DTXA 4DUXA 4I5BA 5ESQA 5AAMA 4NKMB 1YYLH 4LLAA 1FNFA 4DGIL 4KZDH 3MNZB 5H2BB 4FA8A 1E28A 4KHXL 1NKRA 4K3JL 1LO3L 1JL8A 1EA9C 1U58B 5EN2B 4BQ9A 4C56E 3D3VD 4R26H 4PJIE 4KTYA 3GEWB 5CZXD 2UYLB 5AZ2L 3U30B 4C56B 4YXLH 3I50H 4JB9H 4PJIB 5B22A 2AGJL 4D0DB 1MCWM 2AJYH 3GMLA 4HLJA 3K1DA 4U0QB 2R0KH 1UXSA 2W60B 3CMOL 5K33A 3CU7A 4Z95H 2E7MA 3IKCB 3FONA 2OTWB 5DI8B 4D3CL 4LGRB 5DT1L 1IJ9A 5HHNA 3BP7A 1A3LL 2Z31B 3WKNA 4MGXA 1DBJL 5LCVH 3UBXI 4KKBC 1EO8L 4P46B 3B8YA 3NVQA 2P4AB 5DHYA 2X70B 1RJLB 3GO1H 1HSBB 2VQUA 5ICYA 5K9QI 4M5YL 5IB5A 2MWCA 4X5XA 5GGRA 3BKCL 1YNTB 2YD9A 5IMOA 1ZT4B 4F7CA 3P77B 5DFTA 3P4NB 3B3IB 4JO4L 5HYJE 4K7FB 3PGDB 4AMKH 5HYJB 4O00A 1ZK9A 2EIZB 5C0IB 4KH2A 2E6JA 4JY6B 5DUPL 1I8IB 5FCUH 3IXTB 1UM5L 4C4KO 3TIDB 2ESVE 4X4ME 1QQDB 1FDLL 3LHPH 4HJGA 2ESVB 3O41B 4XPTL 4ODWB 1F4YH 3WYRA 4LDOB 3IAPA 1ZLUK 4F7PA 2R4RH 4YEFA 4ZDHA 2NXYC 3I75A 3MV9B 3AS3A 4NYLA 2APXA 2FGZA 4PJ7F 4NP4H 4MDIB 1KJ2B 3GIVB 2NY4D 2Y5TB 4FRWA 3HCVA 2PO6C 4HS3A 4JFFA 1ZA6A 2VH5L 2XZAL 2A83A 3EDFA 3WFZA 4JY5L 3ARRA 2BCKA 1MCFA 5E8EB 1JBJA 3NCMA 2WSKA 5INCA 2GK2A 5IJVA 4KJPD 5FOJA 2R4SL 1PX4A 1SY6L 3X13A 3MRGB 1VERA 1KTLB 4NNXA 2YK1H 1ORQB 1I75A 4HUWA 1AO7D 2K1MA 3F6IA 2VDKL 2B5IC 1XGUA 3C87A 4JN2B 2Q7YB 3SPVA 4BKLA 4EUPB 4EDXA 1I9RH 3WIIH 3RHWK 1B0WA 2NLJA 1WVZA 5DDHB 1CDCA 3CSGA 5IW6B 1QKZL 1V3JA 3HC3L 3ZTJH 2M2DA 4NQSA 1P7QA 1G7IB 4PD4J 1QZ1A 1EJ6A 2H41A 4LFHD 4G8IB 3H9ZA 1NBVH 2H1PL 1MEXH 5KZCB 2W65B 4IMLA 1J88A 4J3OC 1GGUA 1BVLA 1G7QA 1B4JH 1S9XA 5C0FB 4HS8L 1Z5LB 3G6DH 4JFFD 1XCQA 2XWJA 4I48A 3I02B 1I1RA 2WUBL 1UWEH 4FXLA 4TSCL 2H2SC 4R4NC 2A6JA 4UAOC 3SDCB 3HZMA 5LQBL 5CIPH 1AQKH 3QFJE 4ZOBA 3NFNA 3QEHA 1ZGLB 1SEQH 3GHEL 4KKBD 4NQDE 1NPUA 3QFJB 4RFEB 2UUDK 2AJZA 2IPKA 3FB5A 4U0RB 4KV5F 4KAQH 1EERB 2GCYB 3DOSA 4UT7H 1TZGL 4HWBH 4KKAC 3UTTA 1XCTB 3IAGC 2YBRA 4MSWB 4JJHA 2BOBA 3MA9L 3CLFH 4NO3B 2PO6A 3QXVA 2D7QA 4WV1B 1NGQL 4MQ7B 1NGYB 1DFBL 1CL7L 4MZ2A 4NC1E 1WEJL 2SEBA 5E08H 1P7QD 1X4YA 4OUUA 4NGHH 3F12A 3FQRB 3BYYA 1W72B 4L29B 3TYFA 3LKOB 2CIKA 5CJBA 4Y5YB 2QQLL 1T1ZA 1CLYL 1XZ0A 1YMMA 1F58H 5FO7B 4CL7A 1J86A 4HWUA 1S7QB 5SX5K 1ZLUH 3VFSA 3M07A 1X6NA 2BNRE 3MYJA 1QTYT 1YEKL 3GMQB 3KDMB 1FV1A 2BNRB 4V2BA 5FM4A 2NXYD 3PJSA 1Q9WA 2OR9H 3K81A 5HXMA 1Q9KB 1A1NB 3OKDB 3OKKA 4PJ9C 5EOCL 3H2WA 3NMEA 3L1OL 3QQ4A 3UTTD 5K9JL 1T83C 4QRTA 3ABZA 3UDWC 4GW1A 4RZCA 4P57B 3DARA 2PO6D 3HZYA 3IXAB 3OAYH 4X6DE 3AAZA 3MMEA 3VD7A 2R0WH 4X6DB 1KLFA 1T04B 3F8UB 2EXWC 4OCYH 4XC3H 3DX8B 1GGIH 3SDYH 4XXDA 4JO3H 4PRAB 1DLFH 5F9WC 4S10A 1AI1H 1QR4A 2GHWB 1CTNA 3IU4H 5KSAC 3BKYL 4BH7A 3I9GL 3OF6A 3TA3C 5D7IA 1YMMD 3OKEB 3UPAA 4WU5B 4Y4FB 4D94A 4JRYA 3PWJB 1P4BL 2VAAB 1YEEH 3QAZC 2G5BA 5ANMA 1L0XA 4EUPG 3MUGB 15C8H 1TJHL 2Z35B 2X4UA 3QQ9C 3RGVA 3DROB 3G5YA 2FX7L 4R6UA 2Y7QA 4UILL 1RVFL 3HNTH 1LILA 3A6BH 4F7EA 2BMKA 2GT9A 4KMTL 5FO8B 4OF8A 2BSED 2CDFB 1AY1H 3N1PC 3GKWL 4M61B 3TWCL 5DSCA 5FA4A 1RZFH 5ALCH 1IKNC 1BVKA 1GC1L 3LH2L 1YC8A 5C09E 2MNUA 5C09B 4DEPB 1N0XL 2YD6A 2XPGA 2UUDH 4JHWL 2H2SD 3HI5L 4R4ND 2O5ZL 1DANT 3KPNA 32C2B 1OGAA 1I7RA 3NIGE 1EEZB 3IDIB 2X1PA 3LEVH 4D0CB 5HPMB 1I9IH 1L7TL 3ARYA 3MOBH 2QJDA 3OF6D 4DTGL 4PJ9A 4EQ3A 1NLDH 3IFNL 4JRYD 4PJ8C 4KKAD 2AV1B 3BE1L 4JZOA 3RDTC 1T83A 1MLBB 5I71B 1ZEAH 4PRPE 3UDWA 5EDXA 3TZVC 4JFYB 4PRPB 3QZWB 3VRJA 3K7UA 3RGVD 4P5KA 1C5BL 4JFQB 3SQBA 4KPHH 4PG9A 4XCCH 5J4MA 3QDMA 4BFIA 5I17A 1U95A 2N7BA 4OCLC 3QUZC 2EDFA 2GJZB 5CEZD 1NL0L 5KSAA 1TZIB 3MRKA 4J23A 3TA3A 1FL6A 1R3LA 5FO9B 4FTVE 4OI8A 3CXHK 4NQEE 3CD4A 1KJMA 3ZHLA 1KBGL 1I7UB 2XZQL 3MLWL 5DD3L 5BXFB 5DD5H 2EO1A 3D25B 1BFOA 1DJSA 1N64L 4M43H 2HVKB 3RFZC 4HFUL 5JA9A 5I73C 3PWVB 5J57B 3V6OC 4D2NA 3GSWA 5A2JH 4NFCA 4PJCE 2D31A 5BQ7B 3EOYG 4HWNA 4PJCB 4TUKL 4PJEE 4PJ9D 4PJEB 4Z76B 1A6TB 1IKNA 3LKSA 4CNIB 1MF2H 4YHPA 3MX0A 4Q6IC 2OK0L 3MZGB 3OKMA 5EO9B 1QLFA 2DTMH 5EO0A 4Q9QH 4G6KH 3B2VL 5DHVA 4K7PX 2QADB 4DVBB 5DMYA 2EXWD 1DVFB 2LU7A 1FZJB 2XA8H 4KRMB 5SWQA 3GSXA 3T1FB 3CFEA 4JO2H 4LLVB 3CVHB 4QXTB 3ULVF 4L3EB 5KSAD 3B43A 3NIDF 3H8NA 3RGHA 5AZEL 5A3IC 3TA3D 3B6SA 4PJ8A 3WCYA 3EW3B 1BVZA 3RDTA 1JGLL 4BZ2L 3H9HA 1HSAA 2DMCA 2AXGA 3K0WA 4UOW1 3TJHC 1LD9B 3TZVA 4IOIB 2HJKB 4I2XB 2V9QA 5FYJE 3FQTA 3QQ9D 1W0WA 4DKAA 1KXTB 5IBTH 5F70A 1NGWB 4X7DC 5SWSA 5IFAL 4N8CH 3H7LA 4M8VA 3QNZB 4HK0B 3QUZA 4IRJB 4QNPF 3V4UH 1Q72L 4OT1H 5I1HL 4CVXA 3TV3L 1HHKA 3DO3A 3IDUA 4HC1H 4IIQC 4MD4A 5D7JB 5JW4M 1G6RA 1TCRA 1FPTL 3V52L 2OTPA 1ERNA 3V8OA 1OAYH 4WI3A 2QSCL 5GRJH 4TRPH 1B0RB 3BEVB 3OAUH 3X17A 2Q8BL 4P2OB 4I0CC 5CAYB 2V2WB 3CDGA 4Z7OE 1J12A 3V5DB 1ORSB 4BQ8A 1FG9C 1JPGA 1U91B 3V6OA 5F1NB 3LEXA 1NMAL 3WLBB 3Q2CA 5HVGB 3HUJF 3BN9C 3WHE0 4OQTA 1LDPL 2L4OA 2ZUWA 5J6HA 1S7VB 2HT2D 1UC6A 2M1KA 4U6VL 1EFXB 3MRPA 1OAKH 4M62H 4PJ8D 3RWDA 1BEYH 3RDTD 5T1MB 1FFOA 1RUPH 1JVKA 3D3VE 3ZMRA 1AQDA 3HR5B 4Q6IA 3TZVD 3QZWG 2DQHH 1MQKH 3MRCB 5AUMB 3BZDA 1MRCH 1PZ5A 2A6IA 2CGRH 2MTPA 3W81A 2ZUSA 5SWSD 5F88B 2VWEC 1F5WA 4NNPL 3QUZD 5JR1L 4HULB 2DM3A 1JHLH 3FO1B 5FYKD 4NRYA 1U8OB 3P2TA 5JQ6L 3GSNB 1A3RH 3RIAF 5EC2A 5KG9A 3FT4B 1MCHA 3CPLB 3MJ6A 4KQ4H 2OI9B 4DKEL 5I76B 3WIHH 1ED3A 2D7PA 4RSVA 4M7LL 1AGBA 3HZVB 1UCBH 5B3JE 4I3SL 1IKFL 1I4FB 1TDQA 3IFOB 5E8NA 3QJHA 5ESQB 4PYGA 2R29H 4IIQA 1FC2D 4K55A 3WUWB 3VXNA 1OWRM 1Y6MR 4PB9L 4M4PA 5D1XC 4K94H 1E28B 1OSPL 1UCTA 4QXWA 3R4DA 1MQ8A 1KJ2L 4RGNC 3DX6A 5IMLA 1WWAX 4D8PB 4OLZL 4HKJA 4FQQB 5ADOL 2G2RA 3W0WA 25C8L 1CE6A 5C2UB 1FNHA 5DQJB 1XGTA 5F7FA 3Q48A 4O2FA 3L6FB 3EDEA 5ALBL 2I9TA 1A14L 1UXSB 4UBDC 3MYZA 5A3ID 2IWGA 2VYRE 5IQ9B 5DJYA 4ZD3H 2A77H 3HI1B 5HHNB 5DURD 3TJHD 4YHYC 1NCDH 4LVNC 4FQXC 3FOMA 2BSSA 3SOBH 43C9A 4QTHA 1I1YA 2FCBA 5DHYB 4FZEL 1HOCA 4F57L 2ZJSH 1FC1A 2FYYA 3PWNB 2ZP0T 2DIJA 1SJHA 1DBML 4JFXB 2RGSA 3O6FB 4M6OH 4NM8H 5ESVB 3MRFA 1FSKB 1LK3L 2JJSC 5IB5B 5GGRB 2QHRH 2VDQL 3KGRA 3PWPA 3AROA 3BZ4A 2HG5B 4L4TE 4F7CB 5LBSL 3EYVA 4RRPA 4L4TB 4TNVF 2DQIL 2VXUL 3KS0J 3PWLA 3W0WD 5HGGS 1KTKE 3VGAB 5CWSA 4FQJL 2OZ4A 1AO7E 1JYNA 5HHPA 2EDLA 4PBXA 1AO7B 3OR7B 3MRQA 1IM9A 3BN9D 5EBLA 4Z8FH 4OLWH 2Z9TA 1BQHB 1NCWH 3GBLA 2OMNA 5DYOA 4LSPL 3W2DH 3TO4C 1MRFH 2P8PB 4NUGH 1RD6A 1VKXB 4CVUA 2I26N 3AS2A 2AEQH 3QIUC 5I75B 3X11A 1YECH 4WVRA 3UO1L 4LCCB 2IQ9H 3LMJH 3WJJC 1D6VH 2B7DT 1U2HA 3CFIC 3ZKNC 5F7EL 3RQ3A 5KVFH 3LQMA 4AG4L 2C4FT 1GGBL 4BSVB 1TVBA 3PF2A 1RUAL 1U3ZA 1QFHA 1ZA6B 4RMQA 1W72L 2FDBP 2A83B 2BCKB 4NZDA 2RFXA 4U6YB 3PWPD 3C2AL 3INUH 4WEUD 5IJVB 4LQFH 5EZLB 1U8MA 2OR8A 3HMXL 4W4NA 1IL1A 4IOFC 2QQKH 2WQRA 1FBIH 1FVCB 4FQXA 1VENA 1RK1B 1YC7A 4QHNB 4KVNL 1KCVH 5EOQH 1SQ2N 1TVHA 2HKHL 1IEHA 1JHTB 1NANI 1IM9D 1XGUB 3WUWG 1KGCD 3PHSA 4M6AA 2APTA 2A9NL 2JJSA 4PR5A 4PRDB 4OB5H 4XNXH 4EDXB 1R3JA 4IBLT 5GS0H 3LRSB 5JOEA 2HJLA 5L88L 3TESA 4H5SB 4ONFH 1OF2B 4RGND 3QDHA 3HNVH 4ZS7L 2YEZA 4Y4HB 3IDXL 5C0JA 1TQCC 2X41A 3DIFA 5F3HB 3KLHC 2AK1H 5EOCJ 4IMLB 5F1KC 4U3CA 1BVLB 4CMHB 3O6LH 4BUHA 4LASL 2FO1A 3DETC 2NY7H 2OL3H 4PJGF 2ORBL 4UBDD 3WFCH 4U1IA 4DAGL 1XGRA 4L8CB 1MAKA 3U2SA 3TO4A 1R3IL 3MZTA 2XACC 4HW6A 1F11B 1S7SB 2EDXA 1CIUA 3QIUA 4FQXD 5DWUL 2V7HA 4N68A 5HGHB 1VFMA 5IQ7L 3U36B 2NXYB 2AJZB 1VFBA 3FB5B 3UTQA 3WJJA 2IFGA 4XVUC 2Q7NA 4B50A 2CKNA 1E6OH 3BP5A 3UTTE 5KS9A 1CDBA 1P4LA 1PFCA 3QHZH 1XFPA 1GIGH 3VRIA 2BOBB 1AD0A 4HXBH 3GBML 4NUJA 5CJOL 2PCPA 4CN1A 1JGDA 2ADJB 5DQ9B 5F3BB 1C12A 1CF8H 3ULUF 1MVFA 5TGBB 3KR3H 4KQ3H 3BH9A 5CZVL 5D2NC 2AKRA 2MMXA 2O5YH 2VB5A 2VTFA 1XF2B 4LHUB 1YMME 2CIKB 2H3NA 4HUKB 3QDGE 4R90L 4X6FB 4KFZC 1TMCB 3QDGB 5A2LH 2FO4B 4P9HH 3VI3E 5INDB 3U0WL 1BQHG 3JWOH 1EHAA 2DBLH 3QBTB 3CFCL 4M1CC 3VW3L 1O7SA 3F7PC 2GQHA 4OFPA 5GGRY 2ATKB 4TVPD 3TO4D 1JP5A 3WS6C 3QIUD 1TETH 1FV1B 1LNUA 3WFDL 4S1RH 4PRBB 3DRTB 1N5AA 4LFHG 2W9DH 5J1AA 1IEAA 4XMKL 1Q9WB 3RNKB 3E6FA 3OKKB 2L0DA 3ZKND 2ITCA 1KIRB 1HYSC 5TDNB 2FBJL 4QT5B 4FQCL 3BXNA 4YX2H 4BFBD 4MX7A 2P5EB 4RZCB 8CGTA 1G7MB 4JLRA 4XHQA 1A7PH 2WUCH 3KPOA 3AAZB 3MMEB 2W1NA 4PJXA 5EA0L 1QFWL 4L4JA 3WNLA 1B88A 5DUML 4EVNB 4UAOB 4QRSB 1Q9OB 4EDWL 1IC4L 1UWGL 2OBGA 5E1AB 5D7IE 3RY6C 4UT6H 5D7IB 4R97C 5JO5B 5ANME 4WW2F 1XR9A 5ANMB 5E5RB 4BQ6A 4X9BA 3HFML 3JV4A 35C8H 3TBYA 3G5YB 4RMTA 1X3DA 2Y7QB 4F3FA 1KXQE 4O2EA 3LPWA 4F7EB 4RQQA 5CEZE 1T20A 4ZFOA 4OGZA 1S5IH 3GMOB 2VXSH 3WDHA 3KLHD 1U8JB 3JVGC 3VGHA 2FJGA 5MI0C 5DSCB 1FLTX 5FA4B 1DR9A 1INEL 2W0FA 2FWOA 3VGEA 4N8VA 3DETD 1X7QA 5I8KL 2V5YA 3CVHL 1IILE 5D72L 1F45A 2XPGB 1VDGA 1FHGA 4BSWB 3PQYB 5EU7C 4UUJB 5EO1B 3KPNB 4XRCB 3WS6A 4KDWA 4OLXH 2QEJA 4HMDA 2ADGB 2HA1A 1GHFH 3HS0A 1R3HA 3NZHL 4XVUD 4CMMA 3EO1A 5FYJL 5KSBB 2ZOLA 3IJHB 3D0LA 4RGOL 2V17H 3QCVL 2Z8VC 1F4XH 3ALWA 3L5WA 2XXCB 2B4CL 2V6HA 2DLFH 4LSUH 3VRJB 4P5KB 1FQ9C 1EIBA 4BFGA 2AQ3A 4CJ0A 3MGTA 1KN4H 2AJSH 4BFIB 4ZSOA 5I17B 5IBLC 2AI0H 5CILL 3B9AA 5FV2A 1V7MH 3FL7A 4OFKA 4UIMA 5IEHA 5F9WB 4NHCL 1OD9A 1OLLA 2FATL 5JW3H 3RY6A 1UB5A 4M8QA 1FL6B 3TA3B 4LDLB 5E7BA 1FFQA 1OM3L 3UPRA 3T2NH 1F6AB 4NWTL 5I30L 3DV6A 3RZWA 4M1CD 1L7IH 4U6XA 4X5WA 1BFOB 5F89A 4G7VL 3M1BA 2XQYG 5ICZB 5EUOB 1QSFB 4MQTB 2H45A 1JIBA 3WDIA 1KN2L 4G3YL 4XPAH 3JXAA 5J11B 5GS3A 2K7PA 1RUML 4OCXL 4AEEA 4P5MA 3NA4A 4KRPB 2FJFB 3BWUC 1P69B 1HYSD 4CDHA 5D2LA 1M6OA 1AP2A 1DUYA 3PV6A 3ZYJA 4AEHH 2IPUK 1H3VA 2VABA 3C5ZC 1QLFB 4ODSH 4ZYKB 3RUGF 1Q0YH 4RNRB 1QVOA 4CVZB 4J12A 1TQBC 1YN7A 2ZCLL 2Z4QB 3GSNL 1SJEB 3LOWA 3GSXB 4JG1L 5KSVA 1DSFL 1NJ9A 1JF1B 4K3EH 1DQJA 1HI6B 4YIQB 2XRAH 4X80L 1ES0A 1ETZA 3CFDB 1RIVL 3UTSA 3RIAK 3RDTB 2B1HH 1FO0H 4PP1C 4KGJA 2AXGB 1MLCB 4LQ1A 3V0VB 3MLVL 5D1ZC 3L3DB 3KPSA 3FQTB 1W0WB 5SWSE 1HH6A 2KBGA 1H0DA 3ECBA 4FXGA 1W8OA 3KYNA 3V79C 3Q3GB 1QEWB 4Z7QF 3QUZB 1EHNA 4GXVL 1J1PH 4TN9A 1HHKB 1HWGB 2HTLD 4TOYL 4POYA 2IGFL 2JB5L 5ICXB 3MRJA 1I8LA 5ECJE 1KUMA 2B1AH 3EBAA 5CMAA 4H0GA 1B6UA 4PBVC 3CZFA 5IMKA 4FQ1H 1QFUL 4H1LB 3ES6A 4LSQL 3ULVH 4G9DA 3BZFB 3V6OE 5IV2A 2B0SL 1JPGB 2FRGP 5E6IC 5CIPA 4WUKH 4M5ZL 1XIWB 2D7TH 4UNVA 4MJIB 1SM3L 2EDRA 1CXFA 5F7DB 3UTSD 4IDLA 4Q6IB 3C5ZA 4HWBA 2F15A 5LGHL 5T3ZH 3KPSD 4DUWA 1A7NL 4J6RL 1XMWA 4Q9RL 3DVNB 3SKJL 1RZ7H 3WFHA 1JFQH 5JUEL 5DR5H 3NTCH 1IEBA 5IBLD 3VFOA 5ACMA 1UKTA 3V5KB 2J6EL 1ADQH 2AERT 3U83A 1Y6NR 3HAEB 3P73A 5ID0A 3IRZA 4XPGH 5I6XB 4NRYB 5E70A 5DQDH 5EIIB 4V1DA 1FE8H 5KG9B 4R0LC 1UZ6F 1N4XL 5DURB 3H7BA 4P2RA 2F19L 2AJ3A 1A6WL 3NABL 2AJXL 2V5RA 1BECA 4ETQB 1UXWB 5D1ZA 3QUMH 5L6YL 4TNVK 1CFSA 5CGTA 5J12C 3LKNA 1CTOA 4F58H 2CLRB 3PL6B 1D9KC 3QDJE 4LLWB 4GKZB 4POUB 4LSRH 2FEEI 4DN4L 3QDJB 4FNLL 4IIQB 5I2IA 2XICA 4HWZB 4O02H 1LO5A 3MRMA 5J1TC 3WE6B 3RY4A 1OGTA 1A5FH 2G75A 3C5ZD 3ZL4L 5TE6H 5FGRA 5IMLB 4Q6YA 5EH1A 3OPZH 2FR4A 3W0WE 5I1KL 3W0WB 1JNJA 1PY4A 2EC9U 4NN7B 4HIXL 5AG9A 5E6IA 4O2FB 3MPCA 4MQXC 5I16B 4AIXA 1YA5A 3V0AC 2MHAA 5GZOC 4BH8A 4PJFF 4YGAB 3NN8B 5HYSB 5DJYB 2VZVA 3KYOA 2Z92A 4X7SH 5MENA 5H8DA 4V1DD 1FFNA 3BAEH 1BOYA 4PP1D 4QRQB 5CJQL 3TPKA 1EK3A 4P2RD 4LBEA 1LEIB 4O9HL 4LMQE 5D1ZD 4XWOC 3WSQH 3HC4L 4QTHB 1IGMH 2ARJA 3UJJH 4JM2F 4P5TB 1JHKH 3VFMB 1SYVA 3MLRL 4B7IA 3MRFB 4HS6A 1F3JB 3O0RH 1MI5A 4XP9L 3GRWL 3GSQA 4NKOB 4R4FL 4R0LA 4H1LG 5IHZB 3IGAB 3EYVB 3FRPA 4PUBH 3PWLB 2A0LC 3FB7B 3FFCA 2OJEA 3L5JA 1N7ML 5HDLA 1X5GA 1D9KA 1SBSL 5HHPB 5BMFH 2PYFA 5D7SL 1KGCE 2I27N 5E6ID 1IM9B 2JCCA 4OZHB 3OSKA 4JFHD 4OSUL 2E8ZA 4HCRL 5HGDA 2YWYA 2AAVA 3CCHA 1WWWX 3DX9A 1RZGA 2Z91A 5I8OL 1CDIA 1ZWIA 5D1XB 5MEND 4OCNC 4RGNE 5EZJA 4JJ5A 4F80A 4EIGB 3KWWB 1P4IL 1BF2A 2VDOH 4RGNB 4XNMB 4RIRB 2EC8A 5JZ7C 3GJEA 3S96A 3HE6B 5B38A 3ARDC 2ITDB 3OG6B 3MJ9H 4UOJA 4S1QL 1IC7L 4GS7C 3JV6B 4KHTH 2DQJL 2ZCKL 3MODL 1KJ3L 5JXAH 2W9EL 4W68A 2NW3B 3DWTA 3ZO0A 5E94A 3HAEG 1HH9B 1TVBB 3QIWB 4HKBB 1PG7X 1MI5D 4YDKH 5I1AB 1JRHI 3SKOA 5JOFB 2XWTA 4YH6A 1U8LB 2Y36H 1WFUA 5EWIL 4OV6F 4NQVB 1U8MB 3QH3A 1NCBL 5FK9A 4LVNB 2AV7A 4FQXB 4I3GA 5TQ0H 5IJKC 1B6DA 1YPZA 5D7LA 3FFCD 3R8BB 4TULL 4DVRH 1MJ8L 1TVHB 1D9KD 1BJMA 3H9SA 4YHZH 4IOSD 2XXMB 3M17B 5GRUH 1TJGL 4IRSB 4YXKL 4CUCA 4JPKH 5ENWA 3MLXH 5BCAA 1R3JB 3VJ6B 4XNUL 4NRXB 4LLDB 5IFJA 2CQVA 2W0PA 4CBPA 4UB0H 1FNEA 1RUKH 2QQNH 2CUMA 3F7VA 1FORL 4XP1L 5C0JB 1CZ8L 3DIFB 1RURL 1WAAA 1CGTA 3OKOB 3V95A 1CQYA 2DI8A 1FH5H 4MQXD 4M93C 4G6MH 2EDWA 2DQGL 1U6AL 1CBVL 3NFSL 4IDJH 5E00A 3NCBB 3OL2A 1A1MA 1RULL 4TVPE 1XGRB 3KYKL 2WIIB 5JA8B 3U2SB 2VLLB 3L7FB 3CX2A 2HFEA 4Z7VE 5CBEB 3UZEA 1XR8A 3O8XC 1SMAA 4G6JL 1T0NA 4XWOD 4LEXH 4Z7VB 3ARDA 1HNFA 5D7LD 5DS8B 4WI8A 5EZIH 5KS9E 3EO9L 3QULB 1QHOA 4AEIH 3H9SD 3GBNH 3L3IA 2NXZC 1ZHNA 3PWUB 1JN6A 2LE9A 2NCMA 3TPUA 3VRIB 2F53A 5J6GA 2PW2A 1CFVL 5BJTA 5CEZL 3FQNA 4HC1A 4OF6A 1JGDB 4NKIL 1C12B 1F4WH 2MQ0A 5E56A 4K94C 3U7WH 1ZSDA 4RRPG 4MHHI 5HDQH 2X42A 3QXAA 2AKRB 5IJKA 3U79A 1RY7B 2VC2L 2BHYA 2A0LD 1BX2A 2H3NB 1KPUA 2JELL 1NCUA 2R56H 1A6VL 3GI8H 4PTUA 5D5MF 2R1WB 2OTUA 2EDQA 3MRNA 4OZGE 1EVTC 4Q0XH 2DDQH 4OZGB 3LD8C 5KSUA 2X4PA 1KIQA 2I9LA 4S2SB 3O4LB 3TVMB 5MERA 4G6FD 3ZT5A 1GPOH 3GK8H 1AE6L 2CJUL 4FG6C 4XX1E 5JZ7D 1LO2H 4U1SB 3ARDD 1I1AC 5JDSB 1OAUL 1IEAB 4WY7L 1TQCB 5AYUH 3UP1A 5I66A 3L5HA 1VPOL 1CLZH 4X9IA 4NN5C 2DWDA 3VGDA 1BWWA 4PS4H 1RHFA 4RISH 3ULUH 4EJ1C 5DJDA 4BZ1H 2F53D 4JLRB 4PJXE 4QHKJ 4AL8H 5C0EA 3NACH 1YEGL 2HWZH 4PJXB 1DQTA 2GY7B 3IS1X 3SGDI 4XCNA 5TE4L 4MJ2A 4W4OC 3U4AA 1AJ7H 3FQXB 4R3SA 5BO1L 4LLQB 3J7HA 1IQWH 3O8XA 1UFUA 3AM8C 4OFDA 3D2UA 4JR9L 3NCJL 1BFSA 3WIHA 2DM7A 3MRDA 3MLSH 4GG8A 1E6JL 2DN7A 4N0YL 2JF1A 5CEYB 4WNQA 1XR9B 1RIUH 1I3RA 3JBG7 1C5CL 4ODVL 3CUPB 1YNKL 2F5AL 4OTXH 1LDSA 2AS5M 2X89A 4PRIE 3WLWC 4FP8L 3QQ3B 4F3FB 4ERSL 4ONOA 4PRIB 5D2NE 2DQCL 3TCLB 4NRZB 5D2NB 3L3HA 4QRUA 2P8LA 1JPTH 3SJVE 4J8RA 4GRWF 3MACL 4PTTB 3SJVB 5ACZA 4JG0H 4U4BA 4N8VB 4ZMAT 1T5XB 1X7QB 3BPCA 5DEZA 1D5BA 5GRXG 2C26A 1VGEL 1RJCA 4QHMB 2DQDH 4LARL 4RFNB 3RWGB 5FM8A 3JV0A 3S3SA 2HP4A 1MFDH 3O8XD 4ZOAA 1QFPA 1I1AA 3ZHKA 3D2UD 3HS0B 4XC1L 3CX5J 1ONQA 4FQIH 2A1WL 3EO1B 5EPMA 3P9WB 2DMKA 3D0LB 5D71L 5DJZA 2CDEB 2NXZD 2W0LA 2IEPA 2IG2H 3U4BH 5CD3B 2ENSA 2Y6SC 5FDWA 5HHQB 3L5WB 1INQB 2VLRA 2ZUQC 1X5JA 2X89D 1EEUA 4W4OA 2VDML 1HDMA 1MFBH 2VDNL 3MGTB 3ME0A 5AYQA 5GS0C 5EBMA 4M3KB 5EFIB 4LEOB 4UIMB 5KAQF 3AM8A 1OAQL 4GUPA 3O3DB 3S9DB 1DCLA 5T1LA 3EDDA 2OQJA 3UPCA 5DJXB 1YJDL 3L7EA 5FB8A 3QNYA 3UPRB 2CMRL 3OTTA 1UA6L 3DV6B 4JE4B 1CGUA 4D0BA 5F89B 1OLZA 3KPLA 1RFDH 2FSEB 1XF3A 4LVHC 5LWYH 4MA3B 4JY4B 4M7KL 4RDQG 4WFGE 4FG6D 3ILPA 1WZ1L 5DMKB 3MOQA 1I1AD 1XGYH 3IF1A 4ZUSB 4G7YH 4P5MB 5D2LE 5E2VL 5JPNA 2FX8L 3QUKA 5GS1C 5MI0B 4DGYH 5F7WC 3VH8A 2P45B 3WHXA 1RHHA 5ESAA 2ZG1A 3EYQC 4ZPTB 3BSZH 2VABB 3CGTA 4EBQH 1FJ1A 4HWEH 5F1IB 5HJ3A 5EU7E 2VLRD 3Q5TA 2P24A 4ZTPL 5BRZA 1QVOB 3QNXA 3BP4A 5CP7B 4LIQH 4X6CF 1DQDH 1G0DA 3O9WB 1BJ8A 2KL6A 5HHMD 1E4KC 4XNQB 5T1LD 2GAZB 1LP9F 4K3DH 5TJWK 3UTSE 3G5XA 5IG7A 3TNMA 4D9LL 3GI9L 3PGCA 3VFRB 4P9HC 2W0KA 1M71A 1RAMA 3JWOC 5FF6A 2QSVA 3WLWD 3SO3C 2UWEF 2AJVL 1X9QA 4F7TB 1C16A 3ECBB 2BC4A 4XNYL 5BVPH 4DW2L 3KYNB 5FYJU 3CFBB 2XZCH 1UZ8A 3OG4B 4PJ7A 5EUKA 2H26B 1DN2A 2MCPH 2OJZH 4WU7B 3VI4E 1HIML 3CK0H 1GZPB 3MRJB 3RVWC 4N8VG 4UV4H 4U2YA 3NH7L 2FHFA 3X14B 5IMKB 1CU4H 4QWWC 3AC0A 3P4MA 5DD6A 1MHPH 4LPVA 3TT1H 4EOWL 4OKVB 5BRZD 3STLB 4G9DB 4JAMA 1MCOH 5IV2B 2E6PA 4ZODA 3F6LA 2EEBA 5DRZA 2XZZA 3MRBB 3BWAB 5BV7H 3ZE0F 3ZSTA 3S3JA 5GS1A 2Q8AL 5F1SA 4XB8A 5CHNA 4N9GB 2KQNA 3S88H 5TFSL 4I9WD 3HE7C 3D5OF 4F37K 5EU4B 3VFNA 2VZ3A 4Y8DC 2Y6SD 3C5ZB 4AM0B 2F74B 3TGXA 5C8JB 1D5IH 4U1JA 1JNLL 2ERJC 3P9MA 1S9VA 2VZTA 4OIIH 1TQBB 2IMMA 4MDJA 1U42A 2WAHA 5GS0D 5HVWA 1IEBB 1KLGA 2VIRA 2BVYA 3VFOB 1IGJA 1HHIA 3U0PA 3C6LA 1E4KA 1LEGB 1JTPA 4M00A 4LCIH 1RJZB 4JFEA 1BZ9B 2ICWA 5IVXF 3IETB 4K23H 4EI5C 2OZ4L 4P2RE 5CSZA 1FNGA 3H7BB 5ID1A 4P2RB 1N3NA 4M02A 1P6FA 3DVGB 1CFSB 2J88L 5E99H 3LKNB 5FHAH 3BOVA 1A7QL 5C6TL 5GJTH 4M48L 3R06A 4QCIA 1Z0NA 5IHUH 5TH2A 4Y5XC 4WHTA 5I2IB 5IR1A 2X40A 2DAVA 3EGSA 2W38A 3MRMB 3PDDA 1IGIH 4I77L 5KN5B 3WFEH 3X12A 4NSKA 2FR4B 3DBXA 5M94B 3IDNA 1R5VA 2O5XL 2HJFB 3MO1A 4JFHE 4WFED 3OGOE 4KJQC 2WWKO 5E6IB 3LKQA 2MHAB 4BH8B 5MENE 1NMCC 5KTEH 4R7DB 4JFED 2RBLA 4H26B 3VFPA 5MENB 3LEYH 3HE7A 2DB8A 4R2GC 4HH8A 2X4SB 4MMZC 3NCFB 5T5NG 1U8IB 4OLYL 1FL5B 2D9QB 4A2LA 3EOBB 1U93B 3E8UH 5EBWB 5F6IC 3ZTJG 1WT5C 4O51A 1PKOA 3OJVC 2NQCA 5DD0L 1MI5E 3QR2A 5HYIA 5IKCB 1IAIH 3MGOA 3HMWH 3OB0K 1MI5B 1K85A 1CN4A 3RVWD 1DP0A 3O2DH 4GW4B 4EI5A 3GSQB 1BF8A 1H3UA 3P40A 2WBKA 3DVFA 2IFFH 5I1DA 4QWWD 2H6PA 1K4DA 3CC5A 4GQ9H 4G8FA 3RL2A 3SDXF 2JCCE 3JUYA 1D9KB 3IFLH 1F2XK 2HKFL 2YSSB 2PYFB 4TVPL 5JLZA 2JCCB 4JDZA 4EQ2A 4Y5XA 2EIEA 4NDMB 3CCHB 2HVJA 1T21B 3O2VL 3VWKB 4CDGC 3QO1A 1HN1A 4DN3H 3HE7D 1N2RA 5EZJB 4LLUB 4M1GL 4CW1A 3REWA 3C6SA 3GJEB 2BSTB 2QSTA 4G43A 4L8DB 3MRRA 5B38B 3K8KA 5AWNL 1RIHL 2C3GA 3PHOB 3DXAA 3HZKA 3WHE1 4UDUA 3H3PH 4M3JA 2GUOB 4XBPA 4X9FA 3MLZL 1FLRL 5JTWA 5D4QA 3ZE2E 4I0KA 3OHXA 3LQAH 2VLKA 2V2XA 1P84K 3SKOB 4I1NB 2ZNWA 4EI5D 1G9MH 1NCAH 1T2XA 2XWTB 1MCDA 1YEHH 3TEUA 1LE5B 3MUY1 1YPZE 5D7LE 3V2AR 1MAMH 2CLVA 5ADPL 3MXVL 2IC2A 1VEMA 1FNSL 1YPZB 3PHQA 1KB5H 4OAWA 3MBXH 2J4WL 1GVIA 5I74C 2VUOA 4XI5C 5DJCB 3LKRA 4PJIF 4NQUA 3ULVC 5GGTH 5MP6L 5HGAA 3ZDYE 1WT5A 5I1JH 2XNAA 1N5YH 4IM8A 1BAFL 2BY3A 4GSDL 3TO2A 5ENWB 1T2QL 2BFVL 4M9OA 4XPFH 4J3VA 1ZV5A 5C86A 4XCEB 3RWFA 4MCYB 4HUUB 1ZGLP 5B21A 1ZLVK 5IFJB 2PR4H 2B2XL 3I6GA 2GITA 3OKNA 5C9KA 4ZNEA 5HD8C 4YAQA 5DEFA 3EO0A 1QO3A 1WBXA 3F7VB 2HH0H 3DXAD 1FRGH 1WAAE 4HJ0C 3VXQA 4RMWA 1DQMH 2NY2B 5ITBH 1QR1A 1QLEH 4P49A 1NAKH 4KJQD 1OB1A 2IJ0C 3LQZB 1FCCA 1WFOA 2YC1A 1K4CA 2A9MH 5DVOA 5C0BE 1CT8A 4QRPA 1I7ZA 2VLKD 5CINH 5MEPB 4JPVL 3TP4A 5SX4I 1A1MB 5C0BB 4Z0BH 3WXVL 3KLSA 1QBMH 3ISWA 3NAAH 4R2GD 4O4YH 3CVIH 5C0RL 1X5LA 1IQDB 3TIEA 5DRNB 3O3BB 1NANH 1PQZB 2HAZA 5GSRA 3WL9A 3BRDA 1FO0A 1QBAA 1KV3A 2LABA 2VDRH 4KUZH 1FIEA 2EC9T 4WI4A 4Y16C 3T09A 1YYLL 2GTZA 3OB0H 3T0EA 4GS7B 5TF1H 4KZDL 1E4XH 4XGZA 2R1XB 5BOZG 3U46A 2VLJA 1XH3B 1SYSB 2F53E 2ICEB 5BZWB 1JGVL 1HQ4B 3L3JA 3H0TA 3OKLA 3SKNA 3TPUB 2X9WA 2PW2B 1CGWA 4YDLB 4P9ML 4OD3H 3PNWA 1HEZA 5EC1A 4CN6A 2PXYC 4R26L 3VXSA 4PP2B 4X6BA 4UU9B 4YBHA 4M7ZC 1AHWC 4JB9L 4QHUA 4TUJA 4CADA 3MLUL 3C08H 1HHJA 1BX2B 1CFNB 4I0PB 1FN4A 1Y18B 4JFOA 3UZVB 1M7IA 2OXGA 3B5GA 1VFOA 3RWHB 4QRRB 1NBYB 1U92A 5H35A 4P59H 3LSOB 5I19H 2ZWLT 3QEUA 2VL5B 2X4PB 4NZRH 2I9LB 1KPRA 5MERB 4MJ5A 3RWJB 1T6VN 4NQCA 4E42A 1DEEA 3HLAB 2NY0B 4NKQB 5B38G 3GO1L 5F71A 4HIEA 3P0GB 4GXUN 4X4XA 1CI5A 5C0DA 2QL1A 4YHMH 2KUTA 4QEGA 4LCWA 4C83A 3BRFA 2DWDB 3B5HA 3D85B 2VLJD 1XAUA 3VRLF 3MR9A 5ISZA 2GJ6A 5E2UL 3QYCA 1ADQA 5C0EB 3VXSD 4M7LT 2RB8A 4DGIH 4F2MA 4JKPH 1EGJA 1GAFL 1RMFL 5DGRA 4R3SB 5DVKA 4UINH 1V05A 3O8XB 3QJFB 4K3JH 2VZOA 2V2TB 4Y16A 1EAPA 2D2OA 4XI5D 3ZDZE 3HUJA 3QUMA 5AZ2H 4OCMC 5K93A 3EZ8A 3ULVD 5HHXL 1G9NH 1JNHB 2IBZY 5FCUL 3MRDB 3O4OB 4C54A 1QFWM 1O7VA 1ZLVH 2QKIA 3IVKA 2MJWA 5L2JA 1S7RB 1MREL 2PXYA 3CMOH 5T5FL 2HTKC 1AHWA 1JTTA 4NQCD 5HD8D 4D3CH 4XMPH 1AD9A 5DT1H 4GMTH 1A3LH 2K3TA 2WINA 4UQ2B 3S5LA 1JGEA 1AXSB 1X44A 4HJ0D 4YHNA 5T3ZD 1QD0A 4J8RB 5KVEH 4NO5B 4LCWD 2D3VA 2BXYA 2N4IA 5ACZB 1FL3B 5SV3A 1YY8A 3QEGH 2HFGH 5ISZD 2GJ6D 1D5BB 1WIOA 3VD4A 5FECA 2WV3A 2X4OA 4Q97A 4M5YH 1CD1A 2EYRB 2MSPA 1N0LA 4OKDA 5EIVA 2YK1L 4U1MA 3ARFB 3VXUD 3PXHA 4KY1H 1U8QA 2R2CA 1D5ZB 3DGCR 1N6QH 4Y16D 3OGCA 4IS6B 4MAYB 1X4ZA 4JN1H 5EPMB 4NN5B 1I9RL 4U1NB 5DJZB 3T3ME 1X5IA 1T1WA 1KCLA 2VLRE 4YO0B 1P7KA 1GGCH 4D9QE 2VLRB 1G7HA 2PXYD 4KTEL 2WP3T 4MQSB 1KC5L 1ZT7A 2NY5H 3AU1A 3S35L 4GRWH 1FDLH 1NBVL 3FT2A 1MEXL 1J11A 1ULVA 3MA7A 4N90D 2A74A 5HHME 4PFEA 3BIKB 5I9QC 4XVSL 2N7AA 4GUPB 4YGVB 1B4JL 4WI7A 1HYRC 1JUFB 1UWEL 1S7UA 4AQ1B 1WBYB 5CD5C 1AQKL 1SEQL 3U4EA 1R5WB 2IAND 3UBXA 2VH5H 2XZAH 4EKXA 4X6DF 5L9DH 1UG9A 4MNQA 2PTTA 4KAQL 1WTGT 4I4WA 4PJAE 5B8CC 2C4XA 1LMKA 3IF1B 4PJAB 2JK5A 2ATPA 1SY6H 5JPNB 4F15C 3CLFL 1RHHB 4HV8B 3O6KL 2FECL 3UYRH 2RCSL 1D6EB 3A6CL 1CLCA 4YBLC 5D70H 5H94A 4HUVB 5ELIA 5BRZE 2BRRL 1OQXA 1UJ3C 4WTXA 5HJ3B 3VFTB 5E03A 3BZEA 1E0OB 3BIBX 5E08L 3QI9C 4O58L 4MS8C 2F8OA 4NZTL 3QNXB 4GO6B 4U6HA 1T22B 3B9KB 3MLYH 1A7OL 2FL5A 1BP3B 5AD0A 4FABH 1F58L 3HPJA 5IHLB 4HD9A 1YYML 1KCRL 4I9WE 3G5XB 2J5LB 3UXFA 2H1PH 2YPLA 3PGCB 2H32B 4OZFH 2PW1A 3T77B 3STZB 4QF1B 1IGCH 3O2WL 2ZUQB 4NJAH 4GAGH 3V6ZB 5IFHH 2HTKD 1A6PA 2WMPA 5IW1A 4MNQD 1C16B 2OR9L 2BC4B 4TSCH 4RMRA 1V8HA 5LQBH 5EORH 1T03H 3NIGF 1MCNA 5GJSH 5ERWB 4QLRA 2R0WL 2EH8L 4M9PA 5D6CA 2LVCA 3C5JA 5ETUB 4OCYL 1P5VA 1GGIL 3SDYL 3ULUC 1WGOA 4HXAH 4JGJA 2OL3B 4JO3L 3VXOA 2YKLH 1DLFL 4JAMB 1NGQH 5IVZB 4C4KT 4L4VB 1DFBH 3OXRB 1MH5B 4L9DA 2D03L 5DRZB 1UEMA 5B8CA 4G42A 1N26A 3MRLA 5HVHC 4EEEA 2WIMA 3N9GH 5FCSH 1H3PL 15C8L 5CHNB 5JDJA 2YPLD 2EICA 1CLYH 1PKQA 3GMNB 3VFNB 3VDCA 4WTZG 4Q9CA 4BSJA 2CH8A 3F7YB 3HNTL 5DRXB 4Q2ZB 1UJ3A 5L2KA 3GSRB 1S9VB 4MB3A 1DUZA 4WFEE 1AY1L 3I3EA 4KXZH 3CDCA 4YC2C 3TN0A 3FO0H 4YZFE 2NX5B 3OZ9L 5C0AA 3W11C 5ALCL 3U7YH 4L8SB 3FFDB 4YHIB 4PJCF 3FT3A 1INDL 4MB4A 1HHHA 1U3YA 4LCYB 4JZJC 2ICWB 3T4AA 4PJGA 5CSZB 4PJEF 3ULSB 2BNQA 5EOCH 5ID1B 3FO2B 4B7LA 5CD5D 5C92A 4NWUH 1UB6B 5D96C 3SO3B 2CUHA 5ITFB 4L1HA 3MOBL 3OXSB 1JWUA 1AGEB 4JKMA 3R06B 1NLDL 3MFFA 2RHEA 1BGXH 4WW2C 3L9RA 1U3HC 1KIUA 1ZEAL 5IR1B 2AP2A 1J10A 3PIQB 1BIIA 2CDGB 1NDMA 4ODHH 2AEPL 4KPHL 4N5UA 5CJXC 1CGSL 1H8SA 3F7RA 3DBXB 2Y4SA 5L2KD 1A0QH 1AGDA 3EJZC 1L9MA 4MS8D 1TJHH 5CP3H 1YMHA 3TN0D 2FX7H 1F3DJ 1W0VB 4UILH 5C0AD 3GFUA 3BYTA 4H25A 4HEPG 4KK8C 4LPCA 2YMXL 4BFEA 1C08A 3N85H 3RKDC 1FCGA 1FFRA 1GOHA 1U8NB 1G7LB 2FX9L 5JHDB 3WFBL 4A6YA 1PSKH 3ZE1E 1QP1A 2BNQD 4M43L 3EYFA 3PP4L 1I8MB 4AIOA 1GC1H 3LH2H 3Q1SH 4HSQA 4L3CB 3GM8A 2ERJB 3WNPA 3VG0L 5DK0A 5A2IH 5J13B 4J1UA 5C6WH 4U3XA 2DI7A 2ZSVA 4ZS6C 5FOBA 3B5TA 1ZHBB 4XVJL 1MRDL 2DQFA 4GKNA 3SO5A 3MGOB 2LAGB 3OKYA 4NM4H 3RX5A 1FVDB 1L7TH 3HC0A 4L3AA 4RAUA 2DTML 4JZJA 4ZOEA 4G6KL 1TNMA 1YEDB 3T8XA 4WUUA 1EXUA 4ZTOH 3IFNH 4I13B 1HCVA 4YR6A 3ULUD 4PY8J 2XA8L 3WO4B 1NUFA 1K4DB 3F58H 4RWYL 3FRUB 4GAJL 1GGYA 3S36L 1ZHKA 4KI1A 1GZQA 2DL2A 4JDZB 4PGCA 4OBSA 5E8PA 4WW2A 1U3HA 1KG0A 5HY9B 4ZXBA 3JTTB 2DWEA 1FG2B 1J0IA 1EJOL 2MKLC 1UH3A 1TZHB 4N1HB 3K4DA 1S7XB 3B9VA 5IBTL 5CJXA 3C6SB 4N8CL 3DXAE 3REVA 1NC2A 3G04A 4ELMB 3DXAB 3HZKB 3MLWH 5JMRA 3D0VA 2JTDA 1BHGA 5CKAA 1UH4A 4FXKB 5F6HI 3MNVB 1OP3K 3PABA 3W11D 4XBPB 1OAYL 3E3QC 2VLKE 5F7KC 3E1F1 1D7FA 4TRPL 5B3JF 2P1YA 2VLKB 1YEJL 1NMCB 3VFVA 1MHEB 4HIJB 4KTDH 1FGVL 4HF5H 1PD6A 4WUUD 2A38A 3VE0B 4MD0A 2V7NA 3MNWB 3MREA 1CQKA 2CLVB 1OW0C 3PHQB 4PJHA 3KPRB 1VFAB 5J3HC 1JWSA 3IU3B 5IESL 1ZA3B 5HGAB 5F6IB 4U31A 4M62L 5C0CE 4HIHB 3TO2B 1U3HD 5C0CB 2GW5A 1D5MB 2DQHL 5E8OA 4HQQL 5GRZA 2DICA 2CUIA 1FYTA 5AZEH 2Q87A 1YUHB 1S7WA 1MRCL 2EDYA 3QUXA 4WEBL 3OKNB 2CGRL 3UEZA 4H20H 3RZCB 5FYLH 3EO0B 1QO3B 2HN7A 1NC2D 3EJZD 1T1XA 5I1IH 3U7AA 2J8UB 2BNUA 1JHLL 1JRHH 3LAFA 3RA7H 1NFIB 5I8EA 4OF7A 4KK8D 3L5XH 2OLDA 3GIZL 4LPXA 5DLMH 1D6VL 5CUSL 5T1KB 5TF0A 1EPFA 3RKDD 4KQ4L 5E6ZA 1Q72H 4K71C 5I1HH 5EU6B 2EDNA 3L5IA 4X83A 1FGNH 1CGVA 5T1DH 5CBAB 3UROR 1FPTH 3WIHL 5B4MC 3ARPA 2R0LH 1WC7B 2QSCH 3KYMA 5GSRB 5TQ2L 1UCBL 2Q6WB 4KROC 5CSGA 3WEXA 2Q8BH 3QP3A 2GTZB 4ZS6D 1MCCA 3NGBC 4XGZB 5EULV 2DQUL 3CH1A 4K94L 1KJVA 2VDPL 3ARBC 3MROA 2VQ1A 1NMAH 2A73B 3SKNB 2DL9A 4HUXB 1HEZB 4P2CG 2WK2A 4ELKB 4WWID 1FYTD 5HGBB 4XP4H 2VKWA 2RQ8A 3EYOA 5GGUA 4YDJA 1TXKA 2C3HA 4TUJB 2HYMA 5E9DB 4GKSA 1JWMA 5E5MA 2E6QA 3NPSC 1OW0A 1IMHC 3ULVE 1HHJB 1DQQA 2CK0H 5DZLA 4YE4H 1URLA 3NIDE 1FN4B 1RJYA 3WN5C 1M7IB 1OAZH 3NFPA 1HQRB 4ZD3L 2A77L 4FQHB 1U92B 3R1GH 3QEUB 3LKPA 4L1DA 4NQCE 3KG5A 4G80B 3SOBL 3TJEH 2EKSA 4NQCB 4DK3A 4E42B 1KOAA 5A16A 3S4SA 4EIZC 1F02I 2VAJA 3NOIA 1OP3H 5T3ZE 1SVZA 3ARGC 5F72S 4MXQC 4DKEH 1EO5A 5KVGL 2XWBA 4LCWE 1T6WA 5C0DB 4M6OL 2X4QB 4JGUA 4ZUUA 1J8HB 1OQOA 2YD3A 5IB2A 3EFDH 4C83B 4RAVB 3RTQB 1KB9K 3DO7A 1F4HA 5ISZE 2GJ6E 3MR9B 3AREB 4I3SH 2C3WA 1IKFH 1T7YA 2GJ6B 4WW1B 3RPKA 4ALAH 7FABH 2QR0A 1OTTC 3VXUE 1JK8A 3NA9L 3WIFB 3VXUB 5DVNA 3FAXA 1T0MB 3OJDB 4L5FL 3HUJE 1ND0A 4WI5A 4RFOL 1KJ2H 4CU7A 1EAPB 4OLZH 3DX7B 5J3HD 1FFPA 3QDAA 1A6ZA 25C8H 1WZLA 3GGWA 4GQPH 4ZQKA 2BJMH 3ARBA 2FH8A 4XWGH 3IVKB 1MRFL 1MY5A 5BOPA 2P8MA 2E3VA 4JZNA 1YECL 4U49A 1BZ7A 1CDJA 4M7ZB 1AHWB 2IQ9L 4N90E 4UDTA 2BVEA 1ZLWK 3RI5F 2K9UA 4QHLA 2WINB 4JM2C 2X2YA 3AUVA 2LTQB 4YHNB 1A64A 1I8KA 5JMOC 4U1LB 3WN5A 3EOTH 3SGDH 2GSIA 1IVLA 3MV7A 5C7XH 4OGYL 1CFTA 1YNLL 5GPRA 3AB0C 3P9LA 3INUL 3PE9A 1DBMH 4PRNA 2IANE 5GSVA 2EDBA 3W9EB 1FBIL 2FBOJ 3L3KA 3LQAC 4Y5VC 4YK4C 2IANB 4JKLA 1YY9C 1I3GL 3OAZK 3VDAA 5B4MD 5F7UA 1G9MC 2VDQH 4XCYA 1T80A 3ARGA 3OGCB 1T7ZA 1I1CA 3KPQA 2W91A 3THML 1MFCL 2DQIH 3TBSB 3KLAA 3U9PL 1WICA 1J0YA 2VN4A 3ARBD 1MCEA 1H8NA 4AJ0A 4P4KC 1DLHB 2ZZUT 2ZOKA 1B9ZA 1A4JB 1HCFX 2YZ1A 1KCKA 1ZS8A 1KEGL 1P7KB 3VI3F 4ONFL 1DZBA 3HNVL 1G7HB 5A43C 1T7WA 5JORA 1ZT7B 5DEGA 4ZAKB 2D0HA 2ED8A 3K2MC 3O2DA 4LSPH 1G84A 5AAWA 1WFNA 4X7TA 4G8GA 1MCRA 4U2ZA 5LGKA 4HT1L 5EU5A 1PY9A 2OL3L 4Y1AA 3UO1H 4EI6B 3WFCL 2PN5A 5SV4A 2CO7B 5MEOB 1BLNA 3MV7D 4PJFA 4E41A 1C7SA 1S7UB 1EEYB 4TQEL 1D5XA 1GGBH 3C8KB 2OP4L 5J0BA 3U4EB 5MEQB 4JKWA 4MNQE 4PV9A 5T33H 3UBXB 4QYOB 3RL1B 1RZJL 4X98A 4MNQB 2CKBB 1NGZA 3C2AH 4I4WB 1E6OL 4JM2A 3ARGD 1AFVL 4N0RA 4E5XB 2VITA 4MXQD 3HMXH 3QHZL 1Y0LA 3PGFL 1JZ3A 4HZLA 1JV5B 4LKCA 5DA0B 5JPMA 2FJHA 5E24E 3K3QA 5H94B 2HFFB 1CF8L 1T4KB 1NDGA 1J0JA 1IGTB 4P48A 3BUYA 4CGTA 4KQ3L 3L95A 1IC5H 1OTTD 4Y5VA 1X5AA 2FL5B 3VXRA 3MBEC 4G8GD 5DJAB 5AD0B 3BUTA 1KELH 1U8PA 3HPJB 2I07A 4YFLF 4Y1AD 1KB5A 3EOAB 5JW5B 4E41D 4P4KA 1KLUA 2BY2A 2PW1B 3JWDL 3QO0B 5GGTA 1VACB 2IPUG 3VWJB 4PPTA 3QCUL 8FABB 3U6RA 4S1RL 2ORBH 1XF4B 3MRIA 3LN4A 1P1ZB 3WNKA 4DFIA 2E5EA 4HG4K 1OPGH 4DAGH 1MY7A 1OAXL 3OX8A 4JM2D 3ZLQC 2LU4A 4JFDA 5I9QB 3QFDB 4OV5B 4JRXB 4MNHA 4RWHA 1SBBA 2F9BT 5DWUH 4HKZB 1A7PL 2WUCL 4RMVA 5KSBF 4BZYA 5I1LA 3OAZH 3BGFC 2D0FA 2X4NB 3C5JB 1A7BA 1NGPL 3S37L 3RAJL 2F5BH 2BVPB 1I1FA 3VXMB 1YY9D 4KI5E 3FN0L 4UT6L 2AK4E 3VXRD 2AK4B 3MSPA 3P4LA 4OCRH 1NFDE 2HLAB 1HXYB 4GG6B 1NFDB 2Q3ZA 3AXLA 4Z78A 1AC0A 4R90H 1A2YB 35C8L 2ADFH 4HPYH 4P4KD 1G9NC 3P0VL 4YBLB 1HINH 5L2KE 2BRQA 3IDGB 3U0WH 3C09B 1EX0A 5L2KB 1KF9B 4HDIA 1BFVH 3QI9B 3G5VB 1BOGB 2BK8A 1S5IL 2AJUL 5D93C 5C0AE 5EUOF 2J7LA 3MBEA 1HKLL 1Q1JH 5C0AB 4JFDD 3QRGL 1M7DB 3WFDH 4BELD 1MUJA 1QNZL 4J3XA 3H3KA 1HHHB 3S97C 2EIBA 4XMKH 2BNQE 4DFHA 3P30H 1CICC 3GSUA 1CVRA 4FQCH 3QG7L 4YHKH 4X99B 3UBXG 1BJ1H 4QTIH 3Q6FA 2WBJC 4PY7B 3UJTL 3QIBC 3SGKC 4F33B 4LAQL 4GXUM 3TH2T 1J87A 3RP1A 3T2OA 2BVOA 2VQTA 1BD2A 3MFFB 1JNNH 4DCQA 5K9QG 5IMMA 1XEDA 3UMTA 5DVLA 3TLRA 5A40E 1QOKA 4U1GC 4LSUL 3BD3A 3KXFE 3RRQA 3ULUE 2P49B 3BEWB 3KXFB 1N8ZA 1S9YA 1AGDB 1PW3A 2AI0L 4OIBA 1V7ML 4R8WH 1T7VA 4MA1B 1YMHB 4JO1L 1L4IA 1CLOH 1J1OL 3N0PB 3MBED 2NY5C 4JFPB 1IM3A 3GNMH 2F54A 3M8OH 2IH3B 4H25B 4XNZC 1UYWL 4WJ5A 5D5MA 3T2NL 4ZUTA 1MJJA 1MELA 4ONHB 3DRQA 1VA9A 1F4AA 4LKXB 4NJ9L 1L7IL 3LIZH 1DBAH 3SCMB 2AQ1A 3VXTB 4TPRH 5TDOB 2XKNA 1S9WB 4Z5RA 2I24N 1UADC 4YC2B 1NUGA 1PLGL 2ZSVB 4QXGL 4URTB 1BD2D 4A2MA 1E4JA 1PG7H 3HC0B 3GJFB 5IB3B 4ODSL 4WUUE 3T2PA 3VG9B 2X4TA 5GRVK 1Q0YL 3T8XB 4FQLL 1M05A 4WUUB 1AKJA 1CICA 4LSVH 1DE4B 4UV7L 1ZVYA 2DLIA 3QCVH 2BOCA 5J56B 4KRLB 1ZVSB 5D96B 5CZKA 3CXHJ 2B4CH 1I9EA 2WBJA 4K3EL 3BW9A 3QIBA 5H37H 3SGKA 5K9OB 2XRAL 2F54D 3OAYK 1MCIA 2NNAA 4PGCB 4HJJH 2B1HL 2E9IA 4WW2B 5CILH 5E8PB 3ELAT 2XG5A 2KDGA 4NHCH 2FATH 4JFZH 4XAWH 1OD7A 5I1CH 1YN6A 4KJYA 1WJ3A 4ZUWA 4APQC 4X8JA 3REVB 3W9DA 2PTUA 5C3TA 1NC2B 4NWTH 1IBGH 2DKMA 3D0VB 1IGFL 2IBBA 3L3GA 4P23B 1RK0B 4G7VH 2PYEA 3SE3C 1CGXA 3PABB 2VDLL 3S34H 1KN2H 2C1OB 4LCUA 1AIFB 5GIRA 5D1QA 3W39A 3O6ML 1RUMH 4OCXH 4Z77A 3HA0A 1AKJD 1CICD 4Y19A 1BWMA 1K8IA 4LNRA 4PV8A 3MREB 4PJHE 4DJMA 4WUKL 4PJHB 4M03A 3O3AA 2WBJD 2AEWA 4W81A 5F9DC 5I1EH 3QIBD 3GKZA 1UQSA 5JIPA 3GSNH 1T3FB 1A4KB 1MIEL 4IJ3B 2GIYA 1GSMA 3QHFH 1EH9A 4YPGA 4NQDB 1FYTE 3ROOA 1A7RL 2X09A 4XPHH 5E8OB 5FKPB 5DMIL 1WSST 1SY6A 4ZFZB 2DRUA 1UJTA 3D69A 1JFQL 4GRLC 5DR5L 3NTCL 2NTSP 2HN7B 2R69L 5IUSA 3EKCA 3RGVC 2RAMA 2BNUB 2C1PA 3MRHA 2DMBA 2PYED 4LIQE 1IFHL 4XPGL 3UTZB 4PGBB 3HRZA 5DQDL 3KVQA 1FE8L 3TNNB 4TNWF 5CEXB 2XN9A 2R2BA 5D1QD 3KJ4C 1ZXQA 4ENEC 3WD5L 3C9NB 3QUML 3IDYC 4PLKC 1CDHA 2JB5H 3T3PE 4Y19D 5D7KD 5J9PB 4F58L 4NIKB 4OZFA 3KYMB 4APQA 3JTSB 2UY6A 1B2WH 1GGTA 4LHJB 3U48A 4LSQH 1RPQA 5DK3A 2P7TB 3E3QE 1FP5A 4O02L 3SE3A 3CH1B 1P9MC 4QY8B 1A02N 5JW4Q 4X9HA 3NIFE 4OZHF 2YPKA 2DBJA