4RMWA

Crystal structure of the d76a beta-2 microglobulin mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKAEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational dynamics in crystals reveal the molecular bases for D76N beta-2 microglobulin aggregation propensity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmwA00
3MBXH 1G6RA 1LDPH 1AY1L 3QQ3A 1FGVH 1B4RA 4Z0BH 3TBYA 3BO8B 3FQWB 5DMJB 5AUMB 4R3SB 2R1XB 3G5VB 4G6KL 1CCZA 3BH8B 4ODBD 3L7EB 2ERJB 3QDGA 5IG7B 2H32H 3V5HA 1WITA 1FNSH 4TTDC 3B9KA 1JV5B 4Z7UE 4YBHA 3U7WL 4MZ3A 1KB9K 1P53A 3KYKH 4PP1C 2QQLL 5JORB 2ZUSA 5DEFB 3LKRA 4Q9BA 4PTUB 2R1YA 3MREB 3GUTA 4XVUD 1ZLUH 1ODAA 3DROA 2NY7H 4S2SA 3U83A 2CDEA 1MAKA 4XWOD 4HUVA 2H2PD 2IPUK 4DKDC 4ERSL 4UT6H 4BFGA 5L2KB 1NCBL 1BBJB 3K8MA 5HGBA 1AE6L 4QKXB 5F7EH 4I5BB 1NGPH 1S78D 4ZXBA 1FV1B 4DN4L 1G7HA 2FLBT 3BD5A 3PWUA 5IVXB 1JHLH 1FNEB 1RZ7H 3FQXB 1FNAA 2NY3C 2VR9A 4Y2OA 1Q8MA 4XZUA 3L5WB 4NJ9L 4LHUG 4NIKB 3UTQA 2HTLD 2F19L 2YPLA 4X0KB 3I02B 3SJVA 4YJZL 2KQMA 2XRAL 3VCLB 5MHSD 4P2RD 5MEOB 1PSKL 2XKSA 4DOHB 4DGIL 4HIJB 3SE9L 5BXFA 4F8QA 4I0KA 3RVTD 5CCKH 2AJVL 4ZDHA 1TZIB 2XICA 4LSTH 4GAGL 4CDGC 3I75A 2JJSA 1FL3B 2AEIT 2W0FB 1ERNA 2JB6B 3HFML 2YUWA 3EDFA 2WW8A 4YPGA 5HGDB 1FYTB 1IT9L 3L3DB 4FG6D 5CD5C 1INQA 3HS0B 1JFQL 1F8TH 4U6VH 4OZGE 5T1KA 4AL8L 4YHNB 3F7YA 4U0RB 4PFEA 4D2NA 4OZIA 5F9AC 1PEWA 5IJKC 3NCJH 3LD8B 4MD0B 1DUYA 1JZ4A 1B2WL 4X99A 3NACH 1ZVSA 4FZ8L 1A21A 5T3XH 5K59E 3TYGL 1PX3A 5AAMA 5C0CE 4M5YL 5E8PB 1OCWH 1OP3H 3JTTA 4HCRL 5CZVL 2ESVA 2DICA 2VJXA 5EZIH 4I9WD 3TJEL 3O11B 1CGVA 4AM0B 2OI9B 1YMHA 3QJFB 1U8NA 5D96C 1X9QA 1I7TB 5J6GA 1S7SA 5CJOH 4QHKJ 1P7QB 1RJLA 4LF3B 3OKNB 1NDMB 5DC9B 3QIWA 4OZIB 1D7FA 4MWFB 3TJEH 5D2NB 1MREL 3MRLB 4JKLA 3TA3A 2UYLB 3KYNA 5I1JH 5GGSB 2LU3A 2VYRE 1D6VH 2ORBL 1DCLA 4JAMB 1FL6B 1H0DB 4M5YH 4HPOL 1YMME 4XPAH 3ARDC 4JFEB 5TJWK 5E5MA 4X6BA 1AQDA 2E6JA 1P2CA 3O3UN 2IQAA 1NC2B 2GITA 3UJIH 1S5HA 4DWHA 2MCG1 5C0AD 4JCMA 1WIUA 2IBGA 5GRJH 8CGTA 1ACYL 3ZE2F 1IL1A 5F1NB 1CD1A 5CD3B 3GO1L 3QUXC 1OAXL 2YK1L 5IMOA 3JV6A 4JG1H 1MCEA 1DL7H 4M5ZH 4ONGL 1NDMA 3KXFA 3IDIB 1XR9A 1CLZH 4NGHH 3EO9H 3HUJE 3U7YL 1WGOA 4WY7L 5E8EA 1K4DB 4P2RB 1IGJB 3IJHB 2J3SA 2UWEB 2VR4A 4Z77A 1G7HB 3V5DB 1U8HA 1F4HA 1YEDA 4NQEB 2FIKA 2NY4B 1NAML 1NBVH 3H9ZA 3S97C 2J2ZA 4Q6IA 3QIBB 3S36L 5ITFB 2VUOA 4RRPG 2V6HA 2AK1H 3WNOA 1UQSB 3WDJA 5IVZA 5TH2A 1KCVL 4PJDA 1GOHA 3MR9B 5AEAA 1WBYA 4NUJB 4KZDH 1BFOA 3KHQA 3BGFB 3MLVL 1U8MB 4NJ9H 1U91B 4M62L 3MODL 3QIWC 3IYLW 3MRNB 3TFKC 2AQ1A 3G6DH 5CAYB 3KHOA 1IM9A 4MD0A 3ME0A 2P5WE 1DN0B 3UPRA 1IEAA 4WFFD 3VW3H 3W81A 1ZA3A 4I0PA 1AE6H 2R69L 3ZKXC 3L6FA 1HZHL 3DMMB 1GZQA 4N9GA 3OKEB 4AIZB 4YAQA 1S7RB 3CLEH 4UT6L 1FZKA 3P9MA 1UG9A 4MNQE 4QRRE 5D7JD 1YMMA 5B4MC 4XNXL 4HH9A 2BVUA 2CMRL 2FYYB 1IMHC 2YD2A 2YD4A 3MRMA 4ZAKA 4NP4H 1BQHB 3KPQB 1EH9A 3X3GH 5IB2A 1BD2A 3LS5H 3LN4B 2E7LA 2HLAB 5HHMD 1IAOB 4YXKH 3U7WH 5ANMA 5F3BA 4V2BA 4ODSL 2A6JA 1A3QA 3AS2A 4P9HL 4LSUH 1DR9A 3K74B 1UACL 4L5FH 5K93A 2XT1B 2H9GB 4HKZB 1UXSB 4LLDB 3QDMD 2YD8A 2I27N 2HRPL 3DX7B 1BOGA 2H2PC 5LJYH 1OAUL 4JY6B 2X4OB 1AY1H 4K3HA 1EHLL 1HQ4B 3HNSH 3FMGH 1JJUA 5C70A 1C5DB 1WIOA 2CR6A 2ERJC 3ZTNH 1NGZA 3OJVC 3CH1A 1S3KL 1U6AL 5KG9B 1RUKH 2BNRB 4GW4B 5DURB 4HV8A 4QXTA 4P49A 1FG9C 4XCYB 2LU4A 3RA7H 5BCAA 1JWMA 5I2IA 2VDML 4NKIL 3I2CH 1XF3A 3D87B 3IDXH 5SWZA 3SQBA 1T0NB 4M6MH 4QNPF 2FO4B 4PRHD 1TJGL 1CXKA 3HPLB 5GSVB 3U7AA 2C4FU 4NQEE 4KC3B 5KN5A 3BWAA 3UJTL 1A9BA 2FRGP 4XPGH 3SCMC 1X5HA 3TNMB 4BFIB 1ROWA 1UM6H 4XNYL 1T1WA 4ONHA 2DF3A 4OJFH 4Y4KD 4WIQA 2BVYA 4OCSH 1VGEL 1MFEH 5I71C 3LKPA 3U0PA 5CEZE 2OZ4L 3D25B 3EHBC 5D7LA 3A6CL 5GGVL 2F5AH 3T65B 1FPTL 1T5WA 2VLJD 1DN0A 3BPLB 2FEEL 2NY2B 1S9XB 5I74C 2IH1A 1RVFH 2CLVA 1AIFB 4NO3A 4GW4A 5DA4A 4PR5B 2AERT 4Y4KB 2MHAA 3P0VL 4QHUA 2WBWB 1UB6B 4MXVE 4DZBB 3IJSA 1OP9A 2B2XL 4WGVB 5EU7E 1A64A 1S9WA 5DQDL 5DJXB 5CEZL 1KFAL 5I8EA 5CZXD 4TVPE 1XF1A 1RUQL 4LOUD 4TUJB 3TBVB 1VADA 4OIAA 4M8QA 1ONQA 3B8YA 5H35B 5JR1L 1J8HA 4PGEB 4ZAKD 2D0FA 5IEHA 4LLWB 2W59A 3ARFA 5ANMB 4XI5D 2R2HB 4PJXF 4R2GB 3CX5J 1M7XA 1T2QH 5E6ZA 4LEXH 1NMCC 3MJ6A 3TO4C 3BPOC 3W9DA 1Q38A 4PGZA 2DQEH 3STLA 4GRWE 4AY0A 5HTSA 4M93C 4DVRH 3MOAL 1Y6NR 2BXZA 4P2OA 2CKBB 4HMCA 4YFLF 1D9KD 4J4PC 3BQUA 4HEME 1F90L 5EC1A 5L7XL 1IAOA 5CD3A 3KYAA 1S7VB 4D8PA 4XMKH 1TZGH 5AG8A 2P5WD 4ZFFB 3OGCA 1A6VL 5GQBA 2YBRA 4O2FA 3PHQB 3QNZB 4MQ7B 5J1AB 4QF1A 5E24E 1LP9F 1JTPA 1MJUH 4JQVA 1SEBA 2X42A 3FOLB 5T3XE 2X4SB 5BW7A 1BQHA 1UADC 3KLHC 2A83A 4Z8FL 2XKNA 3MOBL 1JVKA 4MQSB 3TA3C 3VGFA 4NQDB 4KKLC 3QXAB 2ED7A 4L8SA 3HE6A 3TIEA 2O61A 2D3VA 3NMEA 1ITCA 2R0ZL 4C59B 3QEGL 1JNNH 4PJDB 3O0RL 4IS6B 4YC2C 1W72L 4K3JL 3MRFB 4X9IA 4U7MA 3WXWH 5I1GH 3DXAA 3QI9A 4NFBA 1U91A 5GS0L 4IOIB 4M6OL 5IVOA 5KVEL 2A6DB 3LEYH 4EQ3A 2YKLL 1L6XA 1ZT1B 4KJWD 1T7XA 3ZDYE 5DD1L 1E4KA 4MZ2A 5FYLL 1AKJD 1KTDB 1OAKL 1S7UB 4ZQKB 2Q7YA 1GCFA 4G7YH 2XZQH 5DD0L 5GGUA 4MX7B 2IAMB 5J4MA 4KHTH 3BE1L 3WNPA 2PO6C 3ZKMD 1PKQA 1J1XL 4EJ1C 1H3VA 4RNRB 4UOW0 1R5VA 5DXWA 1ZKAA 5D1ZB 1BVKB 2WLZA 1CDJA 2UY7A 3MXVH 4ZNEA 3KYMA 2LV4A 3TO2B 1ONQB 3FAXA 3VXUA 3RIAF 1OSZB 1FZJA 4MXQC 4N8PA 1E4XH 4NNPH 4PV8A 3RFZC 3QEUA 1HWHB 4G8EA 2XNAB 4LMQI 5I1HL 4IRSC 3DV6B 5IBUG 5INCA 4Q7DA 1XCQA 2BVQA 4X5XA 1KPRB 4XPTL 5GGRB 1PY9A 3LB6C 1Z3GL 4ODUA 4YBLC 4QTHA 2E27H 1YYLL 4U1NA 1DQDH 3IT8D 2EC8A 1OB1A 1CU4H 2P44B 1EHXA 3OWEA 1HH9B 2VQ1A 5JW4N 1R5VB 1JF5A 1PKQE 3ILQD 1JZ8A 2VC2H 4DGVH 3GSNL 3QDHA 5D2NA 4AM0A 4JM2A 5E03A 1DBKH 1ZHNA 4MS8C 4PD4K 5E2WH 2XXCB 1QD0A 3MLZH 3VFSB 3QIWB 4P23B 5C09E 3F7VB 3KPSD 4KVNL 3TNMA 4BFIA 4EIGB 2HVJB 4WUKL 5KSAA 2OI9C 4QO1A 3DROB 3QI9C 4PJEE 1T4KB 4N0UA 4P2QD 1ZSDA 5IFJB 4HLJA 2CD0A 2DQFA 4EBQL 2ZG1A 1BBDH 2X4RA 5EBWB 4ZQKA 1CF8H 1NJ9A 2QR0B 5MEND 4Y4FA 1YC8A 5MENA 3FB6A 5FM4A 2Z31D 5E4EB 2Y23A 4PJFB 1W72A 3JV4B 3MLWL 2EDHA 4EZMA 2VO5A 2OR8A 5HYJE 2W0KA 1TJIH 4I0CC 4JM4L 5FV2A 3K8KA 5L2JB 2YXMA 1JBJA 4WTZA 5DQJB 4CU7A 4Y4HA 5HYJA 3UTQB 4MCZB 3O8XA 5DQ9B 4ELME 4HS8L 2VSDA 3QI9B 4OF8A 3WJJC 7FABL 3GJFK 4O9HH 4FNLH 3VI4E 4GRMB 2DKSA 3FN0H 4ZDHB 4XVJL 2DJ4A 5C6TH 1T5XA 3C6SA 4ZD3L 2YA2A 4UOW1 4K71C 3WEXB 3UDWA 3SGDH 1EDQA 3E0GA 5EC1B 1OQOA 4NCC2 4OAWA 5IROA 1N4XH 1NLDL 2PTUA 1RJZB 3AGVA 5FYJE 3QG6A 4LRNL 5LWYH 3RGVD 5GGTA 5DO2C 1RZIA 2YHGA 3IDMB 5B8CC 2P8LB 5AZEL 5EORL 3ZMRA 3OKOB 4MHHG 5MP6H 4JFXA 4U2ZA 3WUZA 1VFAA 1T04A 5C3TA 2VH5H 5D7KE 2NY1D 2K7PA 3OHXA 3U48A 5JLZA 4ODHH 5FA3B 2JCCB 2FJHB 2ZCKH 5EU3B 1KG0A 1PZ5A 2HJLA 2YMXH 4MA7L 1E6JH 3PHOA 3RX7A 1U58B 5CJXC 2EH8L 1G7LA 2XTJB 1VGKA 3D18B 1W8NA 1PBYA 3SKOA 1ZWIA 1LNUB 2DQFB 2H9GA 1CR9H 3NPSB 2CGRH 3S6CA 4OQ1A 3WUWA 4ODXA 1I3GL 3NAAL 1LK2A 3GIZH 1G7PA 4OCLC 1Q94B 2O93L 3PGFL 3EO1B 2W60A 1OM3H 2P24B 3I84A 5FAAA 4XT1C 4N0FB 1RULL 3WIIH 1CK0H 3LZFL 1AR2A 1SY6A 3BIKA 3FOMA 5CLTA 3U9UA 5C07A 4KJQD 5L0QC 1KCSL 5HY9A 3D39B 3WE6A 3X11B 2B0SL 4KI5F 3QQ4B 2Q8BL 2NPLX 3K1DA 3MRKB 3P30H 4K8RC 4QXTB 3RY5A 5L8JB 1T20B 1ZHKB 2EDKA 1RUPH 4G7VL 5HHNA 3D0LB 2EDEA 5HHOB 2DTML 4F7CA 2IGFL 4QHLB 2VLKA 2ZG2A 5C08B 1NH6A 2HFGH 5B3JF 4PRHE 4OLUH 4AIOA 4GXVH 4HFUL 1N7ML 2H3NB 3MA9H 4OT1H 3ZKND 2PNDA 1T0MA 4XMPH 1A7NL 4PJGB 3HAEA 2YC1A 1TCMA 4N8VG 1IAII 4S1QH 4G6JH 2HT4D 5E9DA 1D6EB 1ZLWK 1SJEA 2EE3A 3QIBA 1WZKA 2NY0D 2FCBA 2FGWL 1TPXB 2J6EL 4PRIB 3Q48A 4TQEH 2DDQH 2WBJA 3NGBB 1S5IL 1SYVA 1UWXH 1MCWM 3O11A 4HUMB 3T0EE 3TBVA 3QHFH 1PG7L 4ODWA 4TVPD 1ZEAH 2OTPA 2ZUWA 3G5ZA 3N50A 4A6YH 5BRZE 1KB5L 3CFKB 4KJPD 4W6XB 5JQ6H 3KWWB 1CLCA 2FHFA 1WT5C 4RBPK 1MIEL 3V0AC 4GKSA 4JM2D 2R29L 1TVBA 3FFCA 3BSZL 5HGGS 1FAIH 1ULVA 3ARED 4IDJL 1CVRA 3U82B 4HWBL 4XC3L 4I0PB 2M2DA 2ADIB 1BZ7B 5C0JB 4UTAH 1IEBA 1L9MA 5I8KH 1DP0A 2R4SL 2DWEA 4K7PL 4CW1B 3H9YA 3ARXA 3ULUE 1IGFH 4CN1A 3UBXB 1PX4A 2GQHA 1H3TA 5DHVA 2QHRH 1BLNB 5E1AB 5TE4L 4QOKE 3KPMB 3FTGB 4MXWL 2FJFA 4WDIA 3NN8B 2BMKA 3MSPA 5D1QD 4D0BB 4OUUA 5F9DC 2P8PA 2NXZD 4ISVB 4JHZA 2NY2C 5I74B 4G80A 2X4NB 4Y1AE 2AABH 4HK0B 1C5BL 5HI4C 4JDVB 1JF1B 3SKJL 2BDNL 3ZDYF 3WXVL 3BP6A 1KJ2H 3P4OA 1T1XA 3WJLC 1RIUH 2FIKB 1GOFA 4K3DL 3TBWA 3E2HC 4ONFH 2R0WL 4OF7A 4IMLB 3MRPA 3K3QA 3KXFB 2X1WL 4MQXC 3PXHA 4HFWA 4LFHD 4KMTH 5DJ6A 3C9NA 4ZUVB 2FX9L 1QSED 5CBEB 4HF5L 1EUTA 2FWOA 3LKRB 4MXVF 1R0AL 1WWBX 4GKNB 4M6AA 4QTIL 4XAKE 1EEZA 3BJ91 3ZE0E 3LIZL 4QHNB 2YZ8A 2BVTA 1OPGH 3MV7E 1MH5A 2NY6B 2VXQL 1KIQB 1CGTA 4MJ6A 3ZL4H 2CUIA 1BPVA 2IBBA 2C3VA 5JLZB 3GRWH 4K94C 4PJ8B 3G08B 2OR9L 5DJZB 1QHOA 3P11H 5EPMB 5FM5O 3HG1B 1Q9KA 1OP5H 1J0KA 2XTJD 3LSOB 3PABA 3HNTH 3PWNB 5JTWA 3PIQA 2Z4QA 4H8WC 4CW1A 3LKOA 4X80L 4XCCL 4ENEC 4U31A 1I85C 5EU5B 5IB3A 4LVOC 4QOKD 2ICES 5DHVB 2RCSL 1G0YR 2JELL 1C08A 4H1LG 5HHPB 2XQYK 3L7FA 1WFTA 5LAXA 1AO7B 1MCPL 2GUOB 1R3KA 4XHJC 2CRIA 3KS0J 3E8UH 2DBLL 4ALAL 5DRNB 3G5ZB 3UC0L 1CICA 4BQ6A 5C8JA 3QPXH 4MAYD 4GKSB 3FB7A 1MI5B 1QRNA 5TQ0H 3QULB 1J8HD 4EDWH 1D5MB 3ROLB 3P77A 4RMWA 5DRWB 5FXCH 4ZNEE 5HHOA 3TJHC 5E2VH 2BJML 1JHKL 3G6AB 2XFXA 2YRPA 1V7NL 3OXRA 4JN2B 4HJJH 5KS9F 1ZK9A 2YEZA 4L3ED 4N5UA 5HJ3B 4PBXA 1JGUH 5TDOB 4MQTB 1N5YH 1JPGB 1D5BB 1IGCL 4ODTH 4WUUB 2FL5A 4M1GL 1UC6A 5E6IA 2EE2A 4F9LA 5FYJU 1PFCA 5JXED 3JSSA 2V2WB 2WBKA 2JB6A 5E95B 1IEHA 4GT7A 2WANA 5GRXG 1LO4L 2E6QA 3QUYB 3IAGC 3WNKA 1RFDH 1MUJB 4R97B 3T8XB 1C12B 3T3PF 2VLRB 4UDUB 2PTVA 1A1OB 4MWFA 1TTFA 4TUKL 1QRNE 5D7SH 3DXAB 2EE6A 4HWEL 1WC7A 5D1XD 2FECL 3TBSA 5L2KE 1QSFE 3I3BA 5C0IB 1JK8B 4G6AC 5CJXA 1FVEB 3MRRA 4G3YL 2WBJD 4XVSL 3F7RA 4HD9A 2ICWI 1NMAL 3D2UB 4KRLB 2YSSA 1ORQB 3BEWB 2VKWA 2ESVD 3GSWB 3VXME 1RIHL 1PJ9A 4EDWL 3BPCB 1U9KA 5JIPA 4HAGA 2X9WA 4LLVB 4U1IA 1YQ2A 3QPXL 3DBXA 3IJHA 3JTSA 1U3HB 4S0SD 4G9FE 4I8DA 1MJ8L 2XV6B 3M45A 4L4TE 2PF6A 1YEDB 5CINH 3ZYZA 4EQ2A 5C0AE 4B0MM 3EOTL 2Q76B 4EXPX 4EEEA 1PYWB 2JCCA 5IB4B 4JO3H 2LU7A 4Y5XB 3LHPH 5E4IA 2R2BA 3RU8H 2NXYC 3KAAA 3MOQA 4R4ND 4HGWA 2C3HA 1NAKH 4N1CA 3WFZA 1N3NB 1F11B 4RX4A 4DZ8A 2VABB 4KQ3H 5EFIA 4NZTH 2NY5H 1AGFB 3BDBA 5KVFH 4UUJA 4N1EA 3CZJA 2DQGH 3WIHL 1P7KB 1NGYA 4RBPH 4J2XA 3LB6D 1AGCB 5I30L 1WICA 2BMKB 4Y19E 4S1RH 4IMKA 3BEVB 4MA8H 4YHZH 3QFJA 1EO7A 3KLAA 5JPMB 3EGSA 4ETQA 1AKJB 2D31B 1LEIA 2H41A 3KYOA 5KSBA 4F3FA 1OPGL 1UCBL 1JPTL 3AREA 4FP8H 5KOVC 3LIZH 4HWNA 3E3QE 2VLMD 1IC7H 4PS4L 3RZCB 1EAPA 4H88H 4M48L 4OCWH 5FYKU 5ADOH 5EBMA 3DVNA 4UIKH 4M6NL 4BSVB 3MFGB 4G42A 3H9SA 4PJDF 1A6TB 3BP4A 3U30B 4HIHA 3O41B 3T09A 4U1GB 4KMTL 3T2QA 5EBLB 3NH7L 4JFEE 2Y25A 5TE6H 3JUZA 1YEHH 1FP5A 5JOFA 4PJIE 1IFHH 3KS0H 4CNIA 3IFOA 1UH2A 5JW4Q 2OQJA 2QBWA 3VXSE 4JRXD 3WXVH 4F37K 1EHNA 4OBSA 4JPWL 4V1DA 1EO5A 1R3KB 2KDGA 1ETZA 4HWBA 2R1WB 2V7HB 3CFDA 5BQ7A 1FYTA 4YHIA 4OTXL 4GQ9H 1TVHA 1VB9A 3RWJA 2WBJB 4PJIF 3O6FD 3LOWA 3S35H 4W4OC 4MD4A 4XBGB 2AJSH 4MVBD 3NIFE 3O8XD 5HGDA 5TF1L 5E56A 4KY1L 4DK6A 4Y5VA 1QA9A 2O26U 3G5XA 3H3KA 3QZWG 4K07A 5INCB 4XH2B 3U2SB 4K7PH 1DBML 4LCWD 1YEKH 2DJUA 2DD8L 3OGOE 3JBG7 1EEUA 4XC3H 3X3FL 1K85A 1MRDH 3RHWF 1Z0NA 3ECBB 1WEJL 1JPGA 2R29H 2CIIB 4PG9B 5HYSA 4WV1B 4X9HA 4KMLB 2OXGA 5HDBF 1IGML 1OP5K 3T0DA 3CVHA 2NXYD 5IWLC 4U05A 2X2YA 1QNZH 3MYZA 3CJJA 5T5NF 2H6PB 4DUVA 4JRYE 1CGXA 3VRJA 4HZLA 1NLBL 4MJ5A 3BIBX 2JLLA 1T0NA 5FUOL 1AXTH 5INDB 3GHEH 1GAFH 4KKCC 4O2EA 4U1GC 4RAHA 5DEGA 1FGNL 1BECA 3RDTA 5L2JA 3BHBA 5HI3D 1N7MH 1AXIB 1J0YA 1DBJH 4HFUH 4PJIA 3ZTJG 4OLUL 3OZ9H 3BZFA 1IC1A 3JZ7A 1L7TH 3O6FA 3RI5F 5CZXC 1LNUA 3K46A 1VSCA 3N0PB 3IKKA 3MO1B 5TDNB 3C9NB 4ZUVA 1LE9B 1X5KA 1KPVB 2XQYG 1AO7D 1P1ZA 4W81A 5EIQA 4KKCD 2AQ3A 5IBTL 1RUPL 4YDIL 3BN9D 2VRAA 4OF5A 3HZMA 5DMKB 1TITA 1JN6B 1B3JA 3QCTL 4YO0A 1YYML 4UT9L 4YDLC 2B0SH 3JV6B 3WFEL 3QXAA 5ETUB 3MRDB 2Q1EA 5KSBE 5LXGH 5C6PB 4UDUA 4PJHF 3T1FA 4PP2A 2ADFH 2XKNB 3HLAA 1QEWB 3AY4A 3TM6A 1TZIA 5F9JA 4YDJB 4Y1AB 2IMNA 4P4KA 2FZ3A 4YXLH 5DDHA 4Q2ZA 2B5IB 4DTGH 3T2NH 5D8JL 4ZXBD 4X6EA 4PJXE 5I1CL 4XB7A 3HE6C 3O3AB 1KIQA 2ADJB 2VN4A 2DIAA 2JKXA 4DAGH 3IGAB 1I3GH 1K5NB 4S1DD 2HYMA 1HE7A 3SGKA 1P6AB 3WEXA 4WUUD 2QSTA 3MRGB 4NKMB 3DUSA 3K7UA 1JZ3A 3O3BA 1HHHA 2DI8A 4FQXC 3MACH 3PDDA 4NKOB 2DQTL 5DD3H 5ACLA 5D7JB 4HIXH 2GJJA 4G8IB 5A1AA 5H37H 3BQUB 3ES6A 4NOBA 3V6OE 5T1DH 1CFSB 4YBQC 2W9DH 4ODHL 4KI1A 1WWCA 5E5UB 4YEFA 1J10A 5BV7L 1TZHB 4OGYH 5D5ME 5LAXB 1EA9C 3TYFA 1CICB 3V6BR 3V4UL 2VDKH 3OX8B 1A9EB 1FZMB 4P48A 3FB7B 2IPTH 4W6YB 4YAQB 1WZ1H 3TH2T 3B2VL 4AIZA 4IJ3B 1MRCL 1QLEH 4OGXH 4HHAA 5FM8A 3OKKB 5ESAB 3RL2B 2G60H 4PB0H 5IG7A 2CK0H 2E6PA 3KPQA 1X5XA 5A2KH 2VISB 3DSFL 1UA6H 5I16A 5HXMA 1EO8H 3LRHA 3JWDH 3RNKA 3SPVA 1OAQL 1V3JA 4PJ7E 5JDSA 4XXCC 4LPWA 3RDTC 1U42A 1C8PA 3UBXA 2B1HH 2WUCH 3V4VH 5C0RH 2OL3H 2VDPH 1RZKH 4XTRD 4M00A 7CGTA 1LDSA 4QRPE 4FFWD 3SDYH 4PJ9A 4NNXA 5EOCJ 5IKCA 3EYOA 2CRZA 2Z8SA 3LQZA 3HG1D 3FZUD 3LDBB 4ZFOA 1QO3B 1RHHB 1TJIL 3C60D 1I4FB 1ES0B 1AQKH 3VFUB 5I1DA 3D39A 3X11A 4QT5A 3NIDE 4ZOAA 2XTLA 4JVPA 3WNMA 4GO6B 4LIQH 2XN9E 1JTOA 3HC0A 2C1OB 2DS4A 2QADD 1FNEA 3RVXC 2WWMD 3MR9A 1Z9MA 2AGJL 4Y5VB 1NEZG 5DK2B 4GLRH 5J06A 2DRUA 3L3HA 4JFYB 1BQSA 4L29A 4PGDA 5EZLA 4JPKL 2OTWB 4Q6IB 1CDGA 2NY0B 1CG9A 4K23H 3ZZ1A 3RTQC 5BJTB 3VWKC 3BKJL 3PQYA 2CRYA 3ARBC 4CVUA 1L9NA 2HVKB 5E6ID 5C0EA 5JXEA 1BFVL 4WUUE 5DJ8A 5JOPE 4ZUTA 3P0YL 2QSQA 3UPAA 1ORQA 3BEWA 1QLEL 5HI5D 3K1KC 4WV1A 5F1OB 3MMEA 2R1WA 3R8QA 1ZHBB 3LAFA 1RJYA 2GYSA 5A3ID 3B5HA 2EEBA 4GSDL 3LN5B 1DLHB 3QNXA 4C56E 3GZKA 1NFDB 4I3RL 4M1DH 1BM3H 3QA3A 1ORSB 2NZIA 1L7IL 4O5LH 3DXAE 1I8MB 3PF2A 1IE5A 1XGTB 2EZ0D 4TPRL 1AGBA 4NSKB 1GZQB 1W0WB 5FO9B 5DTFA 2CQVA 4MVBC 2P8PB 3CSBA 4CU8A 5SWSD 1KCUH 4K7PY 4H26A 1VADB 3D39D 3HMXH 4WW2A 1JNHA 2X4PA 4LEOA 1A6AA 3MACL 2C26A 4FQ1L 3UTTB 5I16B 1FAKT 1CS6A 2D7PA 4RAUB 3S4SG 2PYEE 5DUML 3WFBH 2D7TH 3CXDH 4RCAA 4QRRB 3O3EA 1MI5E 3KVQA 2DM2A 3VRIB 4HHAB 2VLLB 1J1OH 4AIXA 5D1XC 1JWSA 4PRBA 1WFUA 4NC1E 2C3WA 4ZFFA 3ULUH 1FZOB 4QYOA 4I0PD 3DYMA 3AREC 4DTGL 3MUGA 4RIRB 5TE7L 5MENE 1NL0L 4YXLL 1UB5A 1NJ9B 4FQ2H 3CVIL 2J8UE 3RY6A 4KPHL 3OB0H 1NGYB 3HCVA 1NL0H 4EDXA 1TIUA 3Q6GL 5CSZA 4LCYB 3SDCC 4Z7WF 4ZO7A 1NCCL 4D9RD 1QUNA 3PJSA 4HK3N 4JFQB 3HPLA 3QFJE 4MB3A 4ZPTB 3IFPA 1WAAE 4HMEA 4JN2A 4HG4K 2XZZA 4WFED 2NY0C 3WS3B 3C6LD 2NY1B 4YDIH 4PJXB 5IBTH 5EO9A 2G5RA 3VD7A 3H9SB 1IBGH 3TIDA 4BZ2L 1T22B 3L1OL 4OD1H 1OF2A 1PQZB 1RURL 1UWXK 2YA0A 2V5YA 4X0KA 5IHLB 4K3JH 3TPKA 1HHHB 1GH7A 3KPRA 1U8PA 3SDDD 5JORA 1RJZA 1NCWL 1T7WA 4JFFE 4TPRH 2R0ZH 1P5VA 2AV1B 4IOSD 3HZKA 2IALA 1YY8A 1L0YA 5F8QC 1ZLWH 4JFZH 5GRVK 1BM3L 5KSUB 4HWZA 3GHEL 5FGCE 2G75A 3MOBH 4GSDH 4PP2B 1CFQB 1NLBH 1W0YT 2V2TB 3CFJA 2APXA 5ESQB 5GRUL 2VLRA 1U3JA 4MD4B 4XBGA 3GSNA 5J56B 1FE8L 3S9DB 1A6VH 2UWEF 4OKVA 3O4LE 4TULL 2XWTA 3D9AH 2CUMA 2BRQA 4HS3A 3NA9L 4NN7C 4LCIL 3BRDA 3BXNB 3UCRA 2GTWA 1TFHA 4HS6A 1AD9B 5I9QC 5D6DA 5F93C 3GI8L 4U6TA 4P3WA 5ERWB 1KLGB 3QEUB 4S0TD 4CJ0A 3STBA 2ZPKL 2FX7H 4G6MH 4O58H 1FVDB 4R0LB 5HHOE 2KQNA 2WM0A 4EUPA 1GYAA 1G6VK 4HH8A 1C5CH 1T21A 2RQ8A 4FZEL 3SDDC 2AJSL 2XN9B 4M43L 4PP1D 1CFNA 4U1IB 1UXWB 1R3HA 4OKVB 4PLOB 3MA7A 4HJ0D 3ZKQD 2MSPA 3Q5TA 1M1SA 4OB5H 1P4BL 4GQ9L 4L9DA 2OK0L 4OQTA 1LWRA 3V4VL 4U0QB 5F3BB 5D5MF 5L0QB 2ATPB 3D0VB 5GJTH 5D4QA 3MNZA 3X14A 5HVFB 1QBBA 5IB2B 1OAQH 3QIUC 4OCXL 4ELMA 2E8ZA 5CSZB 5DD5H 5DO2D 1UA6L 5GSRB 1CGSL 4Z7UB 1IFHL 3IU4L 4P2YA 5K9OB 4FFYL 5TE6L 1LO5B 3A6CH 3HE6B 1I1RA 1HSBA 4FABL 25C8L 3A6BL 4LLDA 1NUGA 2YUXA 1J0JA 4FQHB 1U8PB 4J1UA 3KPMA 1VDGA 4B7IA 3MRIB 5FKPB 4I0PC 4XPGL 4LVNB 4BQ8A 4J3UA 1NFIA 2IPTL 3STZA 2NY2D 3L3KB 3VCLA 2VDKL 3WYRA 5ITBH 5IW6B 4PS4H 3DX9A 3FRUB 3JV4A 1BQLH 3B9AA 5BV7H 2VLKD 1DLFL 4LBEA 3KPNB 5ETUA 1MHCA 2FB4L 5H8DA 5KANG 3OL2A 5L2KA 1RZ8B 5KSAD 3NPSC 5GSRA 5D1ZD 2VB5A 2YPLE 3SJVE 2L7UA 3IFNL 4S1RL 2ICWA 5FCSH 1MY5A 1BZ9A 1I1AB 4URTB 2HJFA 1DQJA 3SY0A 5F9WC 3V5KB 2SEBB 3QIUB 4OZHB 2DQGL 2JJUA 3GSQB 3ARDB 4EUPH 1L6ZA 2ITCA 5CP7B 3BZEA 1IEBB 4LSUL 5MENB 4PJAE 4QNPE 4GBXA 3EYVA 3OKDB 1BJ1H 5D8JH 3QDGB 2H1PH 3HUJB 4UB0H 3EOAB 2IEPA 3V6OC 3WIFA 2C1PA 1UB6A 4NWTH 3ELAT 1H8SA 1MJ7L 3IU3A 1CFSA 1KLGA 1K4DA 4N5ED 4JFOA 5C0AA 5DHXB 1WISA 2Q20A 4HWUA 4JZOA 5IJVB 1R3IH 1MEXH 3CLEL 2CJUH 3S34H 2WWKT 3H6JA 1DFBL 1G9EA 5CSBA 3H2WA 2EEDA 1Q0XH 4HKBA 3LSOA 3PABB 4UV7H 1QTYT 1J0HA 1Y6MR 3VJ6A 3KLAB 4P2RE 1Q9LA 3VW3L 2UYLA 1L7TL 1CZ8H 1RIVL 3OZ9L 4MNGE 3VXRB 4MAUH 3MODH 1NMAH 4DZ8B 2EKJA 1IC5L 4ZS6D 2CIKB 2BY3A 4B53A 5D93B 1I7TA 4KZDL 4PUBH 2DWDB 3CH8A 4OD3H 1GAFL 2BNUA 1Q94A 2B8OT 4BUHA 1WCBA 2X4QB 1KNOA 2E9WA 1DDHA 3B5GA 2BHYA 3MJ9A 4N0FA 4N5EC 1J7VR 2KKQA 5DJYB 1EBPA 3LY6A 2EC9U 3RNQA 4LAJH 5D7SL 4TUKH 3HZYA 5DK0A 4LSPL 2QKIA 3SDCD 3QDGD 3QISA 5DJCA 5LKNA 3RY4A 1OY3B 3QEQA 4X98B 4QRSA 4M9OA 2BHUA 3RL1A 4Z6AT 1WEJH 1MCOL 4FTVB 4BYHA 5CBAB 4ZFOB 4NGHL 1MVUB 1OGAD 4PJ5D 2I07A 2ICCA 3SHSA 3ZKSD 5F88B 3CFBA 1IGCH 1EJ6A 3KGRA 4ODXB 5T1KB 5CP7A 1YEKL 1EHAA 2L4OA 3WKMH 2APVA 2A6DA 4UILL 3UJIL 1JRHI 5DEZA 1PGRB 5SX5K 1YPZF 4KY1H 4PJEF 2Y06L 1A3RH 4KHXL 2Z91B 5DMIL 2Z92B 2Q87A 1WT5A 3K8LA 3WKNA 4Y4FD 4GBXD 3RWEB 3QUKB 2P8LA 3C8DA 4CMMB 2ZWLT 4P2QA 3WD5L 4MA1B 3TESA 4G8GE 2X41A 5SX4I 4KKAC 1DQQB 1NC2D 3NCMA 1V3LA 1DLHA 2X1PA 3QRGL 3QP3A 3QUZA 1AGDA 3LVEA 3T1FB 3UC0H 4JPWH 3GJFB 4K9EL 2ZZUT 4ALAH 2VXVL 5J7CC 1EGJL 1MPAH 2WMPA 4L3EE 3HE6D 1I8IB 1GGBH 3FAWA 1FHGA 3P9MB 1W0WA 2W0PA 3H8NA 4ZXBC 4MD5A 4X7CC 4HCRH 5CZVH 4YFEA 4P5TA 3WFDH 1CFVH 3BPOB 4FQXA 5IVZB 4G43A 5DLMH 1MWAB 2ADGB 2P4AB 2Q8AL 5C3LD 2JK5B 4UQ2A 1I1FA 3SOBH 4X80H 2JJTC 3WUWB 4PJCF 3ULVE 5GGVY 5DRWA 4TTGA 2EXYD 4X8JB 2HT4C 2AJ3B 4UU9A 3ZYOA 4LSQL 3BUTA 1D9KB 1U2CA 2B4CC 4HJ0C 3DBXB 3RVXD 3MRCA 1JZ7A 2VZVA 3QDMB 1YY9C 4GH7B 4U6VL 5F8RC 3PDGA 5F6HJ 5FIEA 4I1NB 3SEPA 3HE7A 4KJYB 5HVWA 1FNGA 4TUJA 1BJ1J 1WSST 4MSWA 3C60C 5IHBA 5I17B 5CGYC 4U3XA 4G80B 1N26A 2EIBA 4WEMB 3WN5C 3WIHH 1WBXB 4QTIH 5CCKL 4PLJD 2HJFB 5ACMA 3SE9H 1R0AH 4PRHA 2GJ6B 3I6LD 1ZLVK 4OLYL 3BP5B 1A6ZB 3FT3B 3QQ4A 5CIPH 2OS7A 2VERN 2DQUH 2F19H 3HZMB 1BLNA 1IGYB 1MHEB 2ENYA 1FVEA 1T20A 3MRRB 3RU8L 4NN5C 5CEXB 5ICYB 2A74B 3UTPD 2VSCA 3CLFL 4PRDB 3EHBD 2AJUH 1CIDA 1EZVX 3EYSL 2WINA 3QPQD 3TH4T 3O6LH 1U8KB 4D9LH 3VMOA 4K9EH 3FT2A 3HZKB 3DX8B 3A0OA 2OM5A 1C16A 1KCRH 3I6GB 3QRGH 2FSEA 2VDLL 4POYA 2VKXA 1F2QA 4XHQA 3DWTA 5ESQA 3RX5A 1EXUB 2AEWA 4FQIL 4LIQE 3O2WH 1T7YA 4GRLC 1J12A 4MXWH 5EA0H 3TC9A 2VLRE 1A3RL 4HGWB 4C57C 3DUSB 1A9EA 1FZMA 2GY5A 3L5XL 2H32A 4WW1A 2QQLH 3KYKL 3MNVA 4UILH 3UDWC 1JNLH 3V7AG 4K2UH 2R4SH 4IJ3C 5I8KL 2K9UA 1CL7H 5E8EB 4MD5B 4DKAA 1TXKA 3HUJA 4HWBH 5DJAA 1C16B 5J9PB 4Z7WB 5IW3A 5FB8B 2QEJA 4RFOL 3QRFM 5AD0A 5FGSA 5I75B 4AG4L 3FO0L 2AS5M 2D31A 1KB5B 2FH6A 2O5YH 3P40A 5D7JC 4X6CA 4KDWA 3VWKB 5KJRH 4RAUA 4P5TC 3GJEA 2PYFA 1T03H 3UAJC 4K7PX 5HHME 3MLTB 4KH2A 3O6KL 4PUBL 4G6JL 1CGWA 4F3FB 3DRQB 1DSFL 4KTEH 3UTTE 4Y5VC 3F7VA 4MAUL 1MF2L 5FUCE 1A3LH 3IDGA 4APQA 3DV4B 1RIVH 3BDYH 2YZ1A 4Z7NF 4NC1C 3CNKA 1IQDB 5FA4B 5L9DL 4J1UB 5C1MB 2BCKB 5ICXB 2JIXB 3CDYA 2VXUL 4Q0XL 2CJUL 3RKDC 3S34L 4YZFF 1R3IL 4X4MA 4Y89A 4WUUA 3FQRB 2FWOB 1QPXA 2E9BA 2W65A 3ARVA 2HWZL 4QRSB 2XG5A 4G9FA 5EU6E 2YA1A 3IRZA 5T5FL 1F6LL 3BHBB 4O51B 3ETBF 4PGDB 4GMTH 5EZLB 1EEYA 4LGSB 5L8KB 3VWJA 1YEGL 1OM3L 3FO1B 5IESL 4QHMB 4DVBA 4Z77B 5BJTA 4WNQB 4CADB 4DW2L 2L0DA 5DUBA 3JVGC 2P5EB 5KSAB 2J4WL 4OKDA 3S8WA 5F1NA 3PDOB 4EI5D 3BISA 3QJHA 4PJHA 5ICXA 2D2OA 3IDIA 5E8OA 2XWJB 4FS0A 1CBVL 4Z76B 4RWYL 3VGEA 1MAJA 2CSPA 5T3ZD 3ORJA 2EDRA 4PG9A 3OV6A 4MJ2A 4U1KB 5ADPL 2P5ED 3IFNH 2Q6WB 4NBXB 5C0BA 3GMQA 3LQAL 4U1LB 3VXPB 2CKNA 3LEXA 4UOJA 3VMNA 5IM7A 2IFGA 2VLLA 1LE5B 1MCSA 1OL0A 3REWA 2RIKA 1WZMA 2VH5L 3HMWL 1OTSD 3PNWB 4DEPC 5EDXA 4Z5RB 3GMOB 2OXHA 5HGHA 3RDTD 4OUOA 3UYPA 5AZEH 2HT3D 5EU4B 3GBNL 2NX5B 3MZGB 1SEBB 4LQFH 4P5TD 3FO2B 3MBEB 5JA8B 3RUGA 3U0PB 2COQA 1P84J 4JQVC 4HJGA 4F7TB 2DQDL 1F3JB 2BNQD 4X99B 3RJQB 3C60A 1A6ZA 2GKIA 3FT3A 1WJ3A 3LD8C 2GK0A 2ADIA 1I3VA 2MPAH 1Y18A 3GSWA 4K3DH 2BSSB 3CGTA 2NTFA 2GK2A 3LKSA 4BH8B 3FN0L 2BDNH 4WJ5B 1XR8B 2NR6D 4F33B 2AABL 5F7NC 7FABH 2X4QA 4OFIA 3U6RA 3THML 4PJBA 4YHML 5MERA 1NBZB 2MQ0A 3CZFB 4HUUA 3AMLA 4LASL 5DZLA 3T0XA 5FF6B 3OHXB 5TFSH 3KPPB 4JANB 3SE8L 2GSIB 2J88H 5JIHA 4LHUB 4R90L 4D9RE 3MUZ1 5ACZB 3STLB 4O58L 1F3RB 4FQHA 4KWUA 1FFPB 3ZHKA 2ADJA 3NCYS 3MFFB 1CF8L 1FSKC 1LD9B 3SDXA 3B2UC 4RGNB 3SGJC 2YN5A 4P59L 3GI8H 4EBQH 3AAZA 1M7DB 3SE3C 1WCQA 2Y7QA 4RFEB 1KCLA 5IVXA 4IOFD 3TVMC 5IW6A 1G84A 2XZCL 5HHQB 3D9AL 4XHJD 3RGVA 1H8NA 1QFHA 4R4NC 3BYYA 3ULVH 1CDIA 1ZEAL 4J8RA 5DQJA 1OLLA 3I6GA 3SDDB 3GKWH 4Z7VF 4RGOL 2FGWH 4PJ8A 1AHWA 1FZKB 1X44A 3GSNH 2VC2L 4DGVL 1Q9KB 4N90D 3VD5A 3OB0K 1NBYA 2VE6A 1INDL 2D0GA 2AJZB 1CU4L 1DQDL 5IR1A 1YYLH 1OW0A 1T89C 2AJYL 2HJKA 2J8HA 3F7PC 5B38A 3C6LB 1FG2A 1V3KA 2ZKHL 4N0UE 1UWGH 4ZG1A 3QHZH 5CGYD 3O81A 3MJGX 3T0BA 4JRWA 5DK2A 2A9ML 1LO0L 2NMSA 4QGYA 5I1HH 5GRVL 3L1OH 3RWDB 4P3DA 3UPCA 3EJYD 4JKPL 4JKKA 5BRZD 4GW5A 1T7ZA 4HX1A 1A7PH 5EBGA 3OKYA 4CGTA 3B6SA 2FNBA 4X8JA 4RDQG 1M71B 2WBJC 1UH4A 1FVDA 4R0LA 1FYHB 3MRBA 3VFPB 1A2YB 1U8IA 1Z5LA 5GISL 4TN9A 3BAEH 1FLTX 1SJEB 3BKCH 1U95A 4PJ9B 1UM5L 4LKXA 1BVLA 4OLZL 1KULA 1CK0L 5FYLD 2I5YL 4KTDL 4LLQA 1L0QA 1QHPA 1N6QL 4NBYB 1IM3A 4L8SB 1V3MA 4AZ8A 4LAQL 1I85A 3L3GA 4R26H 3RVUC 1MJJA 4ZODA 5KTEL 4OZIF 3NAAH 1H3UA 1QBAA 3EFFB 4FA8A 3FOLA 5CMAA 1GGTA 4BQCA 4UIMB 2CDFA 4IBLT 5DMGD 2OJZH 5DD1H 2BNUB 3QFDA 3GMRA 3JWDC 3C09B 3WFBL 4WFHE 2YKLH 3O8XB 4TVPH 4FQ1H 4HGMA 5CUSH 1YECH 4I77H 1TVDA 4LP5A 2YMXL 5E0QA 3V0WL 4R97C 3TJHD 3SDXB 2Z31A 1Q0YH 4WHDA 3VGAC 1JNNL 3S5LG 1WWAX 3DECA 1L7IH 1F5WA 5I6XC 1RK1A 5BRZA 2IMMA 2C3GA 4YHOL 4E5XA 3IFOB 3IFPB 2OJEA 4XBPA 4JY5L 4G9FB 3IDNA 4A2MA 1U8HB 4ELKB 1F4WH 4GRWB 2GIYA 3TT1H 2OR7A 5I0DA 4PJIB 2A1WL 1BEYH 4LHJB 4BZ1L 5E9DE 1RU9H 4XNUL 1QVOA 3KXFE 1JMZA 2MOVA 3DI3B 4HBCH 1LMKA 1V5JA 4L1DA 4PJGA 4XVJH 3UTSB 5CGMA 5KW9H 5L7XH 4OM1L 2PR4L 4PD4J 1BGXL 2BSSA 4FNLL 1FG2B 3MOAH 3O3EB 2Z93A 4YIQB 2F53B 1JWSB 3WBDA 4JFDE 1T83C 1OT2A 1E6OL 2PCPA 2X4TB 4MJIE 1TENA 3OR6B 1GPOH 2AV1A 1AHWB 3B43A 5IIEB 4N0CC 4KGLA 1ZTXL 1E28A 2EYRA 2VDOH 4DK3A 1XGRB 4GKZB 2Z8WC 4JM4H 1EK3A 1C7SA 2PETA 5KS9A 2V5SA 1LO2H 1FC2D 3B9KD 1KB5A 3BYTA 2Y1VA 3SDYL 4H25B 4UT7H 1I7ZB 2KZWA 1KFAH 1WFOA 3EDJA 1WLHA 4QHKI 3L5JA 2PW2A 4XPHL 5EU6D 5C0RL 2B2XH 2WUCL 3QUMB 4D94A 5JHDB 1L4IA 3F58H 4EVNB 1CE6A 3ULSB 4Y5YC 3TZVB 5D7IA 4WCYL 1F11A 2DI7A 3PWUB 5HYQB 4JRYB 5AYUL 2LAGB 2IANE 1MFEL 1X5ZA 1HIML 1CIUA 1DQTA 3SKMB 1KF9B 3C5ZB 2AJ3A 2ZCHH 1UM6L 4QHLA 5J6HA 3W2DL 4O02L 4OFKA 2UZIL 4C4KO 4I5BA 2CDEB 5E94A 4M6ML 2UVEA 2VDMH 3MBEC 4FMFA 4NKIH 1U92B 2NXZC 2JIXA 3PP3H 2E27L 5FHBH 3PHOB 2W9DL 1QSFD 2BNQA 1P2CB 2YD6A 1U6AH 1T80A 5T3XD 3GGWA 4OLVH 1WQVT 3L3DA 3MUJA 2AJXH 3C6LA 5IHZB 4M7KL 3WSQL 2XWTB 5KSAC 3QUZB 4U49A 5T1MA 3AC0A 2F54E 1HOCA 2GTWB 5FGRA 2HRPH 1N64L 2HN7B 2HT2D 2WQRA 3LKPB 1IAIL 4M1CD 1TTGA 2CR3A 3STZB 4DAGL 1G7QA 4X7TB 1G6RL 1YDPB 1T5WB 4NRYB 4MMZC 1QVOB 5SWZE 5I1CH 3T2NL 3QUYD 1II4E 1J1XH 2GCYA 2IBZX 3ULUD 4BA8A 4JFDD 4NHCL 4PJBF 3R4DA 4YHLH 4JKMA 4OLEA 1BQUA 1OAYH 2G2RB 2G9HA 4L3EA 5BMFH 5DD0H 4O4YL 4WEBH 3LMJL 4GRLB 4UT9H 4PJ8C 4Z7VE 1A1OA 5FA3A 4KXZH 3NFNB 2VDNL 2V7NB 1YN6B 4LPTA 1A4JB 3IF1B 3GFUA 3V5KA 4PV9B 3TYFB 2C5DC 1LHZA 1R3JB 4NQCE 4Y16B 5E08H 1T1ZA 4NZJA 1J8HB 2HMIC 3W9DB 1W72H 1XGUA 2C7UB 2ED8A 2NY4C 2R2HA 5EOTA 4JFHD 4AT6B 5CEZD 2DOCA 4NM8H 1AFVH 4RAVA 4YUEL 4NZDA 2GK0B 2LTQC 2R9HC 1AXTL 1J0ZA 2BZDA 5DHYA 3S96A 2AK1L 2EDBA 1SBSH 2E3VA 3HB3D 1NFIB 1NAMH 1D5MA 2D7MA 5IOPB 3KR3H 4RMRA 3ISWA 2ENSA 4F33A 5FO7A 3MXWH 3FFCD 3BW9B 4GAYB 2BVOB 1MJJB 2F8OA 5C8JB 4NNYA 4LKCA 3LPGA 4HKBB 3ZYJA 4CVZB 4TSAL 1S9YB 3UJJH 1IKFH 1S78C 1A02N 4XNQA 5I71B 4UQ3A 4EI6B 3ZKXB 5T1MB 4IS6A 2YK1H 3BZFB 3ZE0F 1IGIH 5C0DA 1M7DA 1ACYH 3QUZD 4Y4HC 2QQNH 2BHZA 3HG1A 3UYOD 1GIGH 4NRYA 5CILH 5D7LE 3QUYA 1MELA 4XBEH 1VFMA 5FGBC 1K4CA 3PIQB 2A6IA 1A14H 3C08L 4HXBL 1DVFC 1X5AA 1FIGL 3MMEB 2HKFL 1I8LA 6FABH 4NHUB 1KV3A 1NMCB 3W9EB 5I76B 3DTXA 4WWKB 5JOPD 4WW2C 5ID1A 3VE0B 5SV3A 3QWOA 4GAFB 2ZCLH 3GSXB 3CU7A 2ZUQC 3AY4C 5J11C 1C1EL 1XT5A 2AJZA 1KC5H 4LSVH 3VXRE 1P6FA 2AI0H 4KK5C 2R1XA 3C09C 1CE6B 1GSMA 3ULSA 1JK8A 4KROC 1OCWL 1MI5A 1YMMD 4Y5YB 3TZVC 3V5HB 1KIRB 5IMLB 2E8YA 4PYGA 2I24N 1CD0A 5IVXE 5T33H 5D2NC 4U4BA 3VXMB 3UJTH 3F65A 4WHYH 4P0DA 1B2WH 3RTQA 5KBNC 5LBSH 1A1MA 4H88L 2G75B 1S7RA 5IB1B 3FB8A 3QXWA 5LCVH 3DHJA 3QDGE 1F8TL 1LE5A 3GBML 1S3KH 3QSKB 3WN5B 4BK4A 1ZVYA 5GGRA 5K9QI 2UVFA 1VENA 4MGXA 2C4FT 4F7MA 3PWNA 2ATPA 3D0VA 1NCNA 4WO4C 3UYRL 5H2BA 2YUVA 2IADA 3QNYA 1SJHA 3ARRA 4KRPD 1VKXB 5KVFL 2AJVH 4PJXA 3M1BB 1PG7X 4NZTL 1U8LA 2J12B 2QSCH 4P9HH 4KQ3L 2NY6D 4N0YH 2XRAH 5ISZD 3GI9L 3PHQA 1G9MC 2FBJH 5FEBA 2YPKA 5F1KC 3G5YA 5E8PA 1QFWH 2WIMA 4HPYH 4NZUH 2A2QT 4V1DD 1A6PA 1TLKA 4LCUA 1FCCA 4X7DC 1RZ7L 4FXGB 1I9RH 4XNXH 3S98A 3K0WA 2IJ0C 4QLRA 4GMSL 3NZHL 1R6VA 3WIHA 3H9SE 2OJEB 3HC0B 4IIQB 2AEPH 1OSPH 5JOEA 1OTTC 2YD7A 5F21B 5I19H 3OSKA 1ZMYA 5DJXA 4BH7B 3TBWB 1YN6A 3C5JB 4ZUWB 3PNWA 4XBPB 5LG1A 1VA9A 1CWVA 1BZQK 1A7OH 1QFWL 1HXMB 4JFYA 1MFCH 2H26A 2E7LC 5EO0B 3FZUC 2HH0H 4R6UA 2P8MB 1NC2A 2GITB 1N0XL 2WINB 3TO4A 4L8SC 1KCVH 4U1MA 4OIBA 3TWCH 3CU1A 5AZ2L 2QSCL 3KPLA 4LGPB 5E70A 3GJFH 2IH1B 5IB1A 4BSWA 1XFPA 3AFLA 3Q1SL 4HQQL 1BFTA 3T4YB 3EFDH 1FGVL 1ZHBA 1KJ3L 1YQVL 4DGYH 1UCTA 2QADB 3VXMA 2L7JA 2XPGB 5ISZB 1RFDL 2DB8A 5CZKA 3KPOB 2C1PB 4NKDB 3ARYA 4XAWL 4X7SH 1YMHB 4WY7H 1J8KA 1CLZL 4U6HA 5LCVL 1IGTA 3HE7B 1J1PL 4JG1L 4KJYA 4ODTL 1OAXH 2D7OA 3IDUA 1TVBB 2Q3ZA 3RVWC 4H5SA 1U8LB 3EOBB 2HJLB 5I73B 5C92A 4PGBA 1V7NH 1B6UA 5H94B 4J6RH 4L8BB 5FDYA 1JHKH 3D18A 1QFPA 4KRNA 4PRID 3DO7A 2V17L 3G5YB 1MCIA 3WHE1 2F8XC 4KDVA 2P7TA 1OP3K 3EO0B 4UTBH 1F2XK 3N06B 3ARPA 1ZHLA 2IFFH 3NZ8B 3MUHL 1SM3L 43CAA 2ZCLL 1CGUA 3HE7C 3EZ8A 1YJDC 1WCBB 5GGQL 5CFHA 3QUXA 4LKCB 4NQDA 3VDCA 3IDJB 1KIPA 3O45B 3BIAX 5FCUH 1F42A 3VI3F 4XNQB 2K1MA 1X5GA 2JELH 3TVMB 4ORZC 1SEQL 3HN3A 5IWLA 3OXRB 5K9KB 5HHQA 1OD9A 1LD9A 4W4OA 1SYSA 4KK6C 3SCMA 5HYJD 1K9TA 5D7IE 1GIGL 1LVEA 1JGLL 5FOJA 2EYTB 1FV1A 4W6WB 3NIGE 2DBJA 3RP1A 2QQKL 3WHXA 4LHUD 4MCYB 1X5YA 3OF6D 3MV8B 5L6YL 1QLFA 5DRZA 4XH2A 1I7RB 4M7ZC 4X6DB 2OR9H 3NABL 2Z92A 4XI5C 3BPCA 5I1EH 1I1YB 4RGMC 4ZAKC 3FB6B 5C2BH 2MNUA 2ZP0T 5IQ9B 4I9WE 5IT2L 1HNGA 2F8VA 3VFPA 1FLRL 4PPTA 5FDWA 4APQD 5HI3C 4R0LC 1XGQA 3S3JA 1T3FA 5EN2A 2RJMA 1HILA 1P84K 1T7VA 5F7HA 1A6TA 3BP4B 2OBGA 2EDLA 3RWDA 4GW1B 3H7BA 1A4JA 2G9HB 2CRMA 1R3LB 1MAMH 3M1BA 1AFVL 1JYXA 1LP9B 3I9GH 3G9AB 4M7JH 2R8SH 4F37F 4QXGL 3SQOL 2AK4B 3ULUC 3A6OA 4P5TB 1GVIA 1RIUL 4FQJH 4AEIL 2AXHA 2FO1A 3C8KA 3N9GL 1QSZA 3MZTA 5GS1C 3IJYA 1AGCA 1C5BH 3U0TB 1QFUH 4JCLA 2QLVB 4GG6A 3LEXB 4UV4L 5HGHB 1HHGB 4Z7WE 1AGFA 3F7QA 3ILPA 3LRGA 4ERSH 5E7FA 4O4YH 4WEBL 1F4XH 3EO0A 1OAYL 1BIIB 1NGZB 4UIMA 1IC4H 1Y6KR 3D85A 3RUGF 5JW5B 5J6GB 4BH7A 5TE4H 2GY7B 4WFGE 3RKPA 1DN2A 3OPZH 4S10A 5BVPL 1IGFL 2XTJE 4EN3A 3TH3T 5J89A 3RPIB 5D6CB 4LLUB 3Q2CA 4OFYD 4FFVD 3LH2L 4CAGA 1DQML 4IMLA 5BO1H 5IGXH 3QUML 3FQNA 1KB9J 1IAIH 3BMWA 4LPXA 4JO1L 2NYYD 1P4IL 3MCLL 4CNIB 5DJ6B 4WEUD 2LE9A 1MIEH 1KENH 2W9EL 1KN4L 1E4WL 3ESUF 4D0DB 4M7KH 3WSQH 3DETD 4EOWL 4QXWA 1AGEB 4WWKA 5T3ZE 1HSAA 4Y16C 5BQ7B 3M17B 4U6YB 3OR7B 4TQEL 5I1IH 3PQYD 5HPOA 1JPFB 2A77L 3QH3B 4Y5XC 4KDTC 2OCFD 5FO8A 5HHOD 1XGRA 3CUPA 4GKZA 3GSXA 5JZ7D 1CFTA 2UZIH 4UBDD 3F7YB 2VAJA 1F6FB 3W2DH 4D3CL 2FJGB 1A7NH 2WNGA 4K3EH 4A2LA 4JKWA 4OD2A 4GXVL 4OZHA 4BELD 3TBTB 4M03A 4Q74A 1HIMH 1UH3A 1F6AB 3AMKA 5AYUH 2DTMH 6CGTA 5JDJA 4NN6C 4FG6C 1GZPA 4LCCC 4N0CD 5DSCB 3LV3B 1FL5A 5GIRB 1DZBA 1WFNA 2HFEA 4OGAD 3FFDB 1X6NA 5JW4M 3OKMB 4OAWB 3HI6H 3OR7A 3DUUB 1HHIA 3L9RB 3RTQB 1WTGT 1U8MA 2CDGA 4JVUA 4F2MA 3TN0C 3BZDA 3FB8B 2Q8BH 5DFVD 3CFEB 2DKUA 1AGBB 3WJLA 1P9MC 3IAPA 3VXOB 1QACA 2DLGA 2JB5L 3S88H 4JFOB 4P99A 3HC3L 1HNFA 1HKFA 2HTLC 5T5NG 3CDGB 1MLCB 4O2FB 4WENB 4PBWD 2Q76A 2OP4L 5F7DB 2YOCA 3QG7H 3HB3C 3P9LA 4YR6A 2YXFA 3LS4L 5KVDL 3Q0HA 4KV5F 4OCYL 3IXAA 5ACZA 3GIZL 5TDPB 2W91A 3PWLA 3DETC 1E6OH 2IH3B 3HI1A 3O2DL 4BKLA 4XNZC 5EBMB 3VRJB 2CGRL 2P48B 3O4OB 5DEFA 3GUTB 2D03H 4XPBH 3MGTA 1EAJA 2GTZB 4JG0H 5D2LB 2BFVH 5D70H 1JGEA 3HI5L 3QNYB 2IADB 1EBAA 2C1OA 4OSUL 4TOYH 3DYPA 4M61B 1JV5A 2ICEB 2ZSWA 4XNUH 1ZLSH 4NZRL 5CHNB 4PTUA 1B0WA 5DVOA 4MNHB 1KNOB 2F53D 4HXAH 4P9MH 1EFXA 1R5IA 2A1WH 5GGSY 1QSEA 3KDMB 3RBGA 5C0BE 4MNQA 1SMAA 2YD5A 1P4LA 3MUGB 4I3SH 3D3VA 4KZEH 4HUKB 2V9QA 2MKWA 4TSBH 3KPSE 5DMGC 3GSVB 4P23A 1KIPB 1W2KT 3O45A 2VQTA 3RWIA 3K4DA 3FT2B 5LWYL 4GKOA 1CICC 1U3HD 4NNYB 3IDGB 1FNLA 5GS1A 4Z0XB 3BUYB 3RHWK 1P9MA 4Z7VA 3M8OH 2ZSVB 2VZ3A 1ZLSL 3M07A 1CN4A 1AJ7H 1KPVA 3QQ9C 3BZEB 3HI5H 1M6OA 3T65A 2XXMB 4P3CL 3CDFA 1J11A 5DR5L 5F7MC 4JRXE 4BSJA 2IG2L 1I9JH 3DV6A 4HS8H 3Q3GA 3PHSA 3CFCH 3T0EC 3VH8A 4BJLA 3WFCH 4B50A 4NQXB 3PP4L 4YGAB 3R1GH 4R4FH 5HDOA 2DM7A 5FYJD 4NRXA 3LS4H 5D96B 5KVDH 4G5ZH 4QRQA 1XH3B 2X1XR 2OP4H 1N6QH 4APQC 4JPIB 2LABA 3QDJD 2VL5A 3ARGA 3X17A 43C9A 4Q9QH 1H3PH 3SGJA 4HMDA 2JB5H 1UM5H 2B39A 3AU1A 3B9EA 3BKCL 2IQ9L 3V0VA 5IEKB 3BOVA 1AO7E 4Y19A 1EERB 1CG9B 2F9BT 5EU6A 2CDFB 3OG4B 4G43B 5JQHC 3FL7A 4HK0A 2NW2B 4BM7A 1I1FB 2BK8A 1AXSB 2R39A 3L3JB 4JZNA 5EIVA 5JHLH 1A6UL 2IH3A 3O9WA 5J3HC 2GT9A 3H9HB 3MRPB 2HG5A 2NY3D 4WFHD 5E2WL 1AD0B 4K3EL 1G9NH 5J1AA 2C9AA 4WGWB 1JGDB 5DFVC 5IKCB 4JRYD 1INDH 2WK2A 4OI8A 1KJMB 1J88A 5FO9A 4HUUB 2HFFB 2BP3A 2ZNWA 3QUXB 3P4MA 1X4YA 1K2DB 4RGOH 4QCIB 1Z3GH 5DJ0B 2FR4B 4JDZB 4JZJA 4MCZA 4LSSL 5E1HB 5F72S 4I18A 2A83B 1PZ5B 1JIBA 4PRHB 3QT2A 4XVUC 1KN4H 1FCGA 5T1KD 4XP4H 5F88A 2PTTB 3CFBB 2J8OA 3ZDZF 1XF3B 5SWZB 5L8LB 4PJ5B 4U3CA 3QIBD 2A73B 1OGTA 1P4IH 5LGHL 3U46B 4YEEA 4JHAL 3P3YA 4E41B 2M8XA 4FXKA 5EO1B 3X13B 3O2VL 3OTTA 2F58H 5E94B 3WFHA 3RVWD 1NFDF 2A6IB 3GNML 2ATKA 3RZWA 5DWUL 1MH5B 3GMPB 5J6HB 4P46D 3OJDB 4Q9QL 1DDHB 3PL6C 4UZGA 4JDZA 1IC4L 1C08B 4XX1E 5EOCL 3GMLA 3Q3GB 1VACB 4HKJB 4LASH 4PJAA 2NZ9D 3IS0X 1F4XL 1IJ9A 4RGND 3R1GL 3AM8C 1K8IA 4L3AA 4RZCB 1HKLL 4FTVE 2HT3C 3C87A 4KI5E 4U1HA 5FYLH 2VN7A 1B88A 2CXGA 2E7BA 2R23B 2IBZY 3GIVA 3QQNA 3G5XB 4OCNC 1NKRA 5D1QC 4BSWB 1QA9B 2D4FA 4NQDD 5DJ2B 1Q9LB 5EO0A 4AEIH 4LARH 3WHE0 1BX2A 5FOBA 1NCTA 3ARQA 1S7QB 4QXGH 1HXYB 1G1YA 8FABB 3DMMD 4N9GB 4X6DE 1PDKA 4Q9CA 3N1PC 2DQDH 5CHNA 2NY5C 3RRQA 1P7QD 3CMOL 1TTUA 2DMKA 3GBNH 1R5IB 3VRLE 5ISZE 2RGSA 1YNKL 2Y5EA 1OAZL 4RGNC 4TSBL 2ILLA 1HI6B 2O5XL 4KZEL 3E6HA 1QR4A 4I3SL 1QP1A 3IFLH 1MJUL 4WI6A 1Q9OB 4YK4C 4XNMB 3V9FA 4NT6B 5E99L 2R23A 2EICA 3PL6D 4JM2C 4ZPVB 4ZPTA 5IT2H 4R2GD 1NC4D 4XMKL 4JR9H 4NZRH 4P4RA 1U0QA 3BKYH 3LQAH 4EDXB 5C0JA 1IQWL 3KNBA 2WZPD 4MDIB 3OKKA 3RVVD 3VH8G 1IQDA 1KOAA 5CKAA 5DS8A 5D70L 2FHBA 1FDLH 4DVRL 5CBAA 3PJSB 4L29B 5L6YH 2W38A 2D03L 3TN0D 1D5ZB 4H20L 1UJ3A 1GC1H 4LEXL 2QQKH 2VLKE 3OKLA 3QEQE 5EWIH 3TEUA 3HUJF 4HKXA 1W0VB 4DW2H 2QKIB 4RIRA 1RMFL 3H3PL 1AKJA 4RMSA 3QDME 2M1KA 4WO4A 4KVCL 3HPJA 5FCUL 1S8DA 4EI5B 1FFRA 1DVFB 5EUOA 2F54D 5DK3A 4HCRA 4GAYA 1KT2A 5JZ7C 1G7IB 4K8RD 2PO6B 4X6CE 1INQB 3NA4A 3PDOA 1HSBB 5FUZH 5D1ZA 4F57H 4JAMA 3NTCH 3CVHH 4WNQA 3QR2A 4CADA 4OD2B 1EUUA 2Y5TB 5F7UA 1U8QB 2VR5A 4WU5A 3ZSSA 5GXBB 2V17H 35C8H 4PJGF 4OJFL 3UP1A 3CFIC 3ULUF 1FN4B 3BZ4B 1CLYH 4J6RL 5EOQL 4C55A 1MFNA 1TJGH 4YFDB 4Y2DC 3GMLB 4NHUA 3W9EA 3EKCA 4XXDB 3MRHB 1URLA 4HIIA 3L95A 1ETZB 4PJGE 4P2OD 1X5LA 2R1YB 3MREA 3BRGC 4O2CA 1VEPA 5FECB 3RWFA 1DUZA 4YH6A 3GMNA 3KPSA 1BHGA 2CO7B 2NNAA 5I66A 1L0XA 4RFOH 4QWWD 4LCCB 1OVZA 4U6HB 3VXOA 2JJTA 4PGEA 1E4WH 1RZKC 2B4CH 1EHLH 2ITCB 3QUMA 4DQOH 1OLZA 3EFDL 4K8RH 4HS6B 1OAUH 2X44D 1R3HB 3DO7B 4H5SB 3Q1SH 4HQQH 3RWCA 4JO1H 2AXJA 5ERWA 4PGBB 2P1YA 2R0KH 3LH2H 1CL7L 5FV1L 4K2UL 2KPNA 2EXWC 2VISA 1JNLL 2K7QA 4IEFB 5CLWA 1E28B 2EYRB 3BJLA 3C2AH 5C0BD 4E41E 1A7OL 1U3HC 5E8NA 2EIZA 1GGCH 4XCNB 4HWZB 1HH6A 3A67L 3UBXG 3ARFC 1U2HA 4MNQB 5FKPA 1CFQA 3F8UB 1H0DA 1OSPL 4L4VA 1HZHH 5LVEA 5A2IH 3RBSA 3ARBB 5HDBE 3AAZB 3MRLA 5F1IA 1MQKH 5C9JA 1FVCB 1S8DB 4GAJH 1NAMB 3O6LL 1Q72L 2R9HD 4PGJA 3MO1A 1E4JA 3EYSH 5CJ5A 4R96B 2NY4D 4RFEA 5IMLA 4GW1A 3MLVH 3BZ4A 2H2SC 4XP6L 2HMID 3D3VD 5F89B 3GI9H 1MAML 4MNQD 1A0QL 5E8OB 2IAMA 4OLYH 1T0MB 5I8OL 2Y5TA 4JY6A 5M94B 3KPRD 3NCYP 3ARUA 5EH1A 3S5LA 1XEDA 5FYKL 1A5FL 1H3XA 4JVWA 3SDDA 4NRXB 1D5IH 3QI9D 5F6IC 4WWID 3REVB 1YPZE 4YHPA 2X9YA 4OFYA 4I13B 3VH8B 1PKQB 3W5MA 5DZNA 1DQJB 2F15A 5C0ND 5I1EL 2W07A 2VITA 3IVKA 12E8H 1NQBA 3U7YH 5I1AB 4Y1AA 2HAZA 1HOCB 2F53E 3MV7B 5FYKE 4JY4B 2NY6C 2Z0BA 3BI9X 3P73A 5KS9B 4NPYA 1A9BB 4HH9B 4R7DB 5GRJL 2VZTA 1HHIB 4KGJA 4WW2B 4NDMA 4Z7UF 3BGMB 3U2SA 2BY2A 3V52L 2HA1A 3L5IA 5D5MB 5DA0B 4M1CC 5DTFB 3SOBL 1JWUA 2DWEB 1QYGL 5DYOB 1U95B 5F7FA 5MEPB 1KLUA 4IDLA 4Z95L 3K80A 1A2YA 1U8IB 5T1LD 5I1JL 1REIA 3MRBB 5F6IB 3MLUL 5F7KC 4YHPB 5I1KL 4U1LA 1ZV5A 1MREH 5GGQH 2R0LL 2RFXB 5JNYA 2IWGA 1C1EH 3MLPA 2VZOA 4PY7A 4H1LH 4P2OC 2R56H 1DBBH 4QF1B 3AXLB 3VRLF 1FO0A 4NPYB 5EUKB 4G9DB 3MBED 1NEZB 3AUVA 5EZIL 5JO5B 2A6JB 2B20A 4U6YA 3RPKA 3S37X 1CTOA 5FK9A 3WMSA 3MLUH 5C71A 3MLYL 3QEHA 1N3NA 4MDIA 6FABL 3GDBA 5F44A 1NFKA 4Q6IC 4NQEA 3MV7D 3EOBA 3ZKMC 5JUEL 2PO6D 4KHXH 1EV2E 3PE9A 1EEYB 3U79A 5CILL 3NACL 2F54B 2QQNL 1IKNA 4FFVC 5C9JB 5JW3L 5EZJB 4P57A 4RFNC 4E41A 1SQ2N 3BP7B 4XMLL 4NQCA 5MI0C 1ZS8B 3J8F7 3N85H 1I4FA 1ES0A 3AXLA 5EB9A 5GJSH 3V6OA 4I2XB 3E3QC 2Y72A 3DIFB 3ARTA 4CMMA 3SKNB 1CXIA 3UJJL 5JPMA 2IAND 1X5JA 5E8DH 1JFQH 2FX8L 1TCRB 3ZHLA 4C58B 3TLRA 4DGYL 5L88H 3HFMH 4LSPH 3ZE2E 1YQVH 1D5IL 1VFOA 4OZFA 2NLJA 5D71L 2D4DA 3KR3L 4GQPH 5I1DB 1G6RB 4NKQB 1ZGLB 1G7JB 1SBSL 5SWZD 4DGIH 3QCVH 5I8OH 5DGRA 1QLRB 5AZ2H 1PSKH 3TA3D 4KUZL 3C5SA 2I9LB 1H3WM 3MRFA 2CLVB 4EN3C 5JMOC 1T1WB 4ZFOL 3RY6C 1MFCL 2JIXD 2Z93B 1KIUA 1A1NB 2Q86A 4GW5B 2Y07L 4HX1B 3WCYA 4PJCB 4Y0GA 3P4LA 1ADQA 1NGWB 1U3ZA 5C0CA 3QDMA 5F7EL 3VXSD 3L95B 3FT4A 4JLRA 3OX8A 3FO9B 5IOPA 1S7XA 1F45A 4WV1C 5JPNA 1VEOA 5IEHB 1TZHA 2Y6SC 1VFAB 4XRCB 1XIWB 4U6XA 1HHKB 3A67H 4N0RA 1GGCL 1NBYB 4X98A 2CLRB 1RZGA 4PRNA 4YHLL 4RWHA 1GHFL 3RQ3A 2ADGA 3EGSB 2PXYD 2JE8A 4PRAB 5KAQF 4L4TB 3I85A 4C54A 5JXAH 4KFZC 2X4UA 5TGBB 3X12B 2R0KL 5GGTL 3U0WL 4ZTPH 4F15C 1CDUA 1SY6H 3WHXB 1M4KA 3CSPA 1XAUA 3GSRB 3OAUH 4WI2A 1YPZB 2EIZB 3N1MC 4HIJA 3R0NA 3UYRH 2VDQL 3HNVL 5BXFB 4AENA 3W0WE 5C07B 4JPVL 4GG6F 1AD0A 1ZAGA 1IGYA 2AJXL 4CU6A 4AEEA 4NJAH 3BP7A 4RGMB 4ZAKB 3S36X 3QAZC 3VFMA 4NC0B 4GLRI 1JI2A 2FB4H 4HAFA 1MWAH 2V9RA 5CJ8A 3SCMD 3QIUD 4YDVA 1LP9E 3UZVB 4F9PC 5SX5H 4JFFB 5ENWB 5ITBL 5MEQA 2XKUA 4O02H 5EUOB 43C9B 5T33L 2E5EA 1HYSD 3MNVB 2Q7NA 2R2EB 35C8L 1ZLVH 2ICWB 2FBOJ 2NTSP 1R3LA 4ORGB 3EJYC 3GMPA 1DVFD 5BS0E 3EOYG 1UQSA 4PIRF 4GBXB 5E9DD 5AWNH 2ZNXA 4P3DB 4FXKB 2XWBB 2RB8A 5D2NE 5E2UL 4NQXA 3PGCB 2NY3B 2J5LB 3GEWB 4ODVH 2BERA 2HJKB 1KGCE 1P4BH 1CLOL 4OB5L 5MEQB 4O2CB 1H15A 5FECA 1WVZA 1MLBB 5E2TH 3V8CA 2BOBA 1LO2L 1DANU 4YX2H 1OGAB 1FIGH 1I8IA 3C08H 5KANI 5FOBB 3H3PH 1MFDH 2CUHA 1GPOL 1GXEA 5IROC 3V4PL 4QRTB 2PXYA 3DVIA 5EWIL 4GRMA 2ID5A 1AR1D 3WO4B 3L9RA 3K2UH 5DRXA 5I18L 4LPYA 1OSZA 4PRPE 5EZOL 2PR4H 5EO9B 3EDKA 4P4KC 2OL3A 3B3IA 3B2UD 3UX9B 1IKFL 3D1MC 1I9EA 3B9KC 4POZC 1XF5B 1Z2KA 3DX6A 1RU9L 1TQBC 4TULH 1Z9LA 3W5NA 3OR6A 3G6AA 3HRPA 4XP5H 1QRKA 5DC0A 3TFKD 3MXWL 4L4TD 4WW2F 4LCWA 3MNZB 3X14B 1YZZA 2QL1A 4L9LC 1OAZH 1TNMA 1QKZL 3CUPB 1KJVB 5FK9B 4DCQA 3JWOC 1LEGB 5ILTH 4JFZL 4ZOEA 2DQIH 2P45B 4JEGB 2XA8H 5F96H 4P4RB 3VXNA 4OF3A 5B8CB 1FVCA 1NCWH 1MVUA 1G7LB 4NUJA 2XYCA 3V0WH 4EUPG 4LARL 3ARGD 5CUSL 3SDXE 1Y0LB 4BZ2H 2I07B 3PGDB 4HUXB 3DPBA 4IRSB 2Q86B 4R8WH 3FCTB 1AIFA 3W0WA 2N4IA 2AVGA 3DUUA 4KRPC 4MNGA 1U8KA 3RIAK 1Q1JH 5LGKA 3LV3A 1YEJL 4NQVB 4OZ4A 3SE4A 4NO2B 5KTEH 2X6MA 3QUKA 3ALXA 2DQJH 1BZ9B 3EAKA 3MCKB 5D1ZC 4Z76A 4ZS7L 1UJ3C 4LP4A 2CLZA 1EAPB 1OW0C 1MCKA 1DBAL 1T89A 2W0LA 3ARDD 4FTVD 5HVGB 5TF0A 2GEEA 3CVIH 2I5YH 3GMQB 4NQED 1FORH 4YNYA 2VITB 3IVKB 1B0GB 3MYJA 4JHWL 1T2XA 4U1HB 3ULUL 1FFNB 2F58L 3H0TB 4JO2H 1YUHA 5K9JH 4AEHH 4LSRH 1I75A 1J1OL 1HINL 1GGUA 1ZGLP 4X6FB 5DD6A 4XNZB 3D39E 3W82A 2EDNA 1FO0L 2VABA 4KXZI 3HMXA 1A7PL 1QFWM 2X7LB 5DJ8B 4LU5L 1XGUB 2C7UA 3CC5A 4NO0A 3EYQD 5C0AB 1LO0H 1RJYB 1A1MB 1A7QH 4WI5A 4LSSH 4KK5D 4YHIB 5IV2A 1MCLA 4NUGL 5B21A 3VFOB 4P46C 2N1KA 3L3IB 2BOCA 3OQ3B 3RTQD 1NSNL 2AJYH 5C08E 4QOKA 1NGXA 3WO3B 3C8HA 4Y7MA 2MCPL 2Z35B 1KG0B 1S7TA 1UEMA 2XZAH 4XCFH 3UTTD 2ESVB 1RJCA 2CKBL 2WWMC 1N59A 3MJ8A 3U6RB 3RKDD 1IZKA 2AK4D 4G8GA 4Z78A 5A40E 3D2UD 5C0GB 5I9QB 5FHAH 4MJ5B 1TDQA 1FL6A 2O5ZH 5JHLL 5CD5D 4NBZB 2B1AH 3KYNB 3ABZA 2ZOLA 4DN3H 2XZCH 4QXUH 3U0TA 3MV8A 5D1XB 3FCTA 5C6WH 2ZUQB 5J11B 3J7HA 5BS0B 4P59H 2AGJH 5GS0C 2VXSH 4XPHH 4FQCH 4J8RB 3MUY1 4LIQL 4OZHF 3PV7A 4OI9A 4BQBA 1ZANH 3ARSA 1H3PL 2J88L 4HUXA 1KCKA 2DQCH 4Y8DC 3REWB 3F6IA 3VXUD 5BW7C 3HZVA 3O2DA 5D7LD 1I1AD 5J57B 1ZTXH 3WNLA 4R4FL 4BZYA 1EMTL 3PP4H 3DJ9A 2DM4A 3O4LA 1CQKA 2WIIB 3DI2B 3QDJE 4RFNB 3WFCL 5IQ9A 3CFCL 1RZKL 3I02A 3JV0A 5HDLA 2B1HL 5HPMA 2GJ6E 2IG2H 4U33A 3E2HB 4LRIC 1A4KA 3VMPA 1HWGB 4HT1H 4OM1H 3VFWB 1BAFH 2VAAB 4Z9KB 4NO0B 1T6VN 5HHXL 3NCEB 4N8CL 4UAOC 1W72B 1OWWA 3AS3A 1EGJA 4MAYB 3JTSB 4PJCA 3CPLB 4KU1A 4G8IA 3VI4F 5EC2A 5IUSA 1S9VB 2E9JA 3MQIA 5FKAB 4AMKH 5I8CB 1FBIH 5F9JB 4JY5H 3VE0A 1TJHH 4PRBB 1T6WA 3V4UH 1KXTB 1F4AA 3TBYB 4X6EB 5KOMC 1YJDL 1IM3B 3HMWH 5AG9A 3QQ9D 4CBPA 2DYPD 4HXAL 5F6HI 4YDKH 5J8OA 3QXTA 1Q0YL 5T1DL 2IF7A 3F5WA 3UO1L 3FQTA 2FD6L 4OZFG 3CDGA 3U9UB 3GK8L 1YECL 4KK9D 2DQTH 5DD3L 3OBAA 1CICD 5KSVB 4RWYH 4TVPL 4E9LA 2BFVL 3WNNA 4OZGF 5E8NB 1XCQB 2BVQB 4X5XB 1ZHLB 5BS0A 2DLIA 3PGDA 3O9WC 1F3DJ 1D3CA 4OIIL 4QTHB 3RI5K 4DJMA 4F7PA 5DGQA 4S11A 4DUWA 3ULVD 4OCYH 1UXWA 5IESH 1QFWI 1YY8B 1YEGH 3SGEH 2GSGA 4MA3A 4QRRD 3PWVB 2EZ0C 4GJTB 3JWNC 4GKNA 3HC3H 2ZUTA 5LXGL 2HWZH 5GS2D 2C3XA 5KZCB 3ARZA 2HKHH 2OSLA 5DUPH 5GISH 3P9WB 4MSWB 3H42L 1QSEB 3KDMA 3MRJA 4NQUA 4PG2C 4XC1H 4IRJB 4WU7B 1NANH 2W65B 4QHMA 4DVBB 1B6DA 5HI5C 4Y1AD 1NDGA 1T4KA 2P42B 2WSKA 4KKNA 1JTTA 1QSFA 2EXYC 5L9DH 1T1XB 1CXEA 1BMGA 1AP2A 3BN3B 5DUBB 3D3VE 1F4YL 5HVHB 4KK6D 1K3IA 3T77B 3LKQB 4UINL 1F00I 1YNLH 2AK4E 4NRZB 3PQYB 4M3JA 3QWOB 3QHZL 1DBJL 2GAZB 5C09A 1GGIL 1QLFB 3UEZA 4LL9A 3SDAA 2W9LA 4CUCA 4WHYG 2B7DT 3LQZB 4FRWA 2NXZB 2OTWA 4D3CH 3ZT7A 1FGNH 5D2LF 3O6KH 4CL7A 3INUL 1AGDB 4MX7A 1DEEB 3ARWA 4LDEB 1PY4A 4JQIH 1NCDH 1PLGH 2AKRB 3L7FB 1OB1B 1INEH 1FRGL 2O5YL 3GM0A 2ARJA 1QBMH 3GKWL 1BREA 4Y4KA 2CK2A 5DQ9A 2PCPB 2X4TA 4C83A 4R7DA 3TP4A 2X05A 1QNZL 3FN3A 2FJFB 1KT2B 5FYLE 3R0MA 1S7SB 3TNNB 4EOWH 5CKGA 4L9LB 2BVPB 1N8ZB 2X5PA 3EW3B 3H7LA 1QZ1A 3UTZA 2E7MA 4OUUB 1KENL 2W9EH 4P5MA 4PJBE 1MVFA 1ORSA 2JCCE 5F7YC 3PL6A 3MCLH 3UPRB 5HHVL 1NC4A 1NBQA 3X3FH 3UTTA 4YIQA 4L4VD 4CKVX 2BC4A 2EECA 1XZ0A 5IFHH 5K33A 1DBMH 5JDSB 4HKXB 3GB7A 1YEEL 3T4AA 3KPRE 1N2RB 4L8DA 4R90H 1ZLUK 1YN7A 4PJ7B 3SE8H 2H6PA 1UJ3B 1MFBH 4TRPH 3ZT5A 1XIWA 5IFAL 2YPKB 4YPJA 3CVHB 2NTFB 4OCRL 3DURB 5EA0L 3OJMB 1SVZA 1S7TB 3FT4B 1RHFA 4JLRB 3ROOA 1KEGH 4L9LA 4O2EB 2FATL 1EX0A 4LCWB 1NANI 3PWPD 1G9MH 4OTXH 4UV4H 3WN5A 4WHTB 5HGAB 3I50H 5CEYA 2FR4A 1FJ1B 1NEUA 1QFUL 4NOFA 2VDRL 3U9PH 2YPVL 1NUNB 5D7IF 1UEYA 1S5HB 4D9LL 2EH7H 4LLMA 4HULB 2C4XA 4J3SA 1YEHL 4TNWK 5K9KA 1MHHB 4LLAA 4P5KB 2DWDA 3CCHA 2MQCA 4I2XA 2ZUXA 3MRKA 3I9GL 4PRPB 2H3NA 3CSGA 2D7NA 2VIRB 5IK3A 4AJ0A 4LNRA 4S1DC 4F80A 4JRXB 3BVNA 4M48H 4OCWL 4EI5C 4G6FB 5IMKA 1JN6A 4V1DB 2P5EE 2R4RL 5JHDE 5BZDA 1G7QB 4F9LC 1S9YA 1VACA 4HKJA 1U8OA 3FHAA 3B9VA 4MA8L 4U0RC 5JMRA 4LLMB 4P4KB 2EE9A 5C2BL 1K8IB 4RZCA 4XWGL 3JWOL 5ADPH 2EDYA 4UDTB 2IC2A 3KPTA 3QJHB 4JZOB 5IB5B 1JZ5A 5JPNB 3D25A 4PJ5A 3NCBB 3HR5A 1IAIM 1CBVH 2NNAB 1JNJA 3UTSA 1U58A 1WBYB 2NY5L 3NBNA 1S7WB 3T08A 4AEFA 3BT2L 4OFDA 3QEQD 4NYLB 1O7VA 3KWWA 1SJHB 4RSVA 3U36B 2R15A 3TGXA 3BWUC 3MJ9L 2BXYA 3LCYA 1KPUB 1SEQH 3N1GC 4WO4D 1CFVL 2KZ1B 4NKDA 1XIWC 3P4NA 3ES6B 4OZIE 3FJTA 1JGDA 1MRFL 3IDMA 1XZ0B 2GSGB 4MA3B 4QRPB 2NX5A 3QO1B 4NC2B 1MHPL 4FOMA 3GJEB 1CL7I 3O9WD 3GBLA 3VFTA 2HG5B 4JY4A 2VZ1A 1SM3H 4J3XA 1MIML 1UM4L 4OZFH 1YMMB 5DJ0A 1MCBA 1JPST 2EDDA 3B9DA 2BSRB 3P73B 1WF5A 1KJMA 5D5MA 5DJDA 1BF2A 1ZA6A 4Y19D 5KSVA 5DMIH 5FO7B 1TETH 3RL2A 2R2BB 5JA9A 15C8L 1NUFA 1MWAA 5EOTB 1A3LL 2Y06H 3TVMA 4AT6A 4KUCD 3I6KB 3K81A 4XVSH 4ZUWA 1Q9WB 1I3UA 1DSFH 4KTEL 4NQDE 1J18A 3IDYC 2ZSWB 4G3YH 2P5EA 4ZTOH 3BVNB 3E6FB 3SDAB 5GZOD 5GHWH 3CIQA 3S5LB 5KJRL 5DMKA 1GJIA 4X7SL 3FO0H 1U8NB 4P2QE 4PJBB 2AXGB 4EI5A 2QR0A 3MFFA 4YE4H 3PGCA 1T66C 3PV6B 1TQCB 2OMNA 5J13B 1S9WB 4MJIA 1HHJA 1AI1H 1U3HA 2NR6C 5A16B 4XVTH 1X4ZA 3EBAA 4C4KT 1WK0A 1KELL 4Y4HD 1S7WA 1UKTA 1XGPB 3EYFA 1JGUL 4OD3L 5ALCL 1AD9A 1U93B 3GSNB 2VLME 4P23D 2MHAB 4FXGA 4HJGB 3HR5B 2BJMH 3T0VA 3T1WA