4RMWA

Crystal structure of the d76a beta-2 microglobulin mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKAEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational dynamics in crystals reveal the molecular bases for D76N beta-2 microglobulin aggregation propensity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmwA00
1JNHB 1MJ8H 3LKRA 3P11L 3PP4H 1F11A 1Y0LB 2D7QA 4EDXA 5A2JH 5CZVH 2PYFA 3T0EC 2WMPA 1I4FB 4H26A 4R96B 3B2UD 4G9DA 3MUGB 5C71A 4CVWA 3V52H 5BV7H 2WUBL 3T04D 3V6OC 1XGRA 4HEPG 3ARED 3B2VL 1SEBB 2XACC 1NDGB 4NGHL 4WUUA 2DBLH 3BJ91 1U93B 1RZ7H 4M8VA 2DKUA 3Q48A 3UJIH 1RK1A 1IKNA 4JPWH 2MMXA 2WZPD 3GRWL 3K3QA 1ZA6B 3HI6L 4OB5H 5DJ6A 2V5TA 5FYJU 3NH7H 5HVWA 2G60H 3KPTA 4KKLC 3L3GA 3O9WA 4WHYH 1U6AL 4HZLA 1LD9B 4Z7WF 1LGVA 3G6AB 3BIAX 4KRPD 1PKQA 3BDYH 4NQUA 5AAWA 4ODUB 4PJXB 3T3MF 4S1DC 1FZOA 5CWSB 1X5KA 2X4NB 4P2OA 4KMLB 2VSCA 4LASL 3DMMA 2A74A 5CEYA 5JPMB 1VFMA 3BP7A 1U8PA 3DV4B 2NCMA 5DHYA 4E5XB 3MBEB 3SJVA 5ID1A 1GJIA 3PIQA 2I07A 2VUYA 4LHUB 2NXZD 3MMEA 2J8UF 3ZTJG 2VZUA 3BIKA 3LIZH 4X6FB 1J0JA 3QXDA 4MB4A 3P4OA 1OP3K 4O2FB 2YRPA 3DBXA 1YNTB 4G9FE 3SPVA 1DVFB 1H5BB 5E6ID 3QYCA 3KPPA 3MACL 4UINH 2XN9D 4QO1A 1XGRB 5IJKC 4JQIH 2X89D 3MXVH 5E7FA 4GW1B 4PJDF 2HH0H 1R6VA 5DMIL 1RUPL 4YHYB 1RIUL 4O2CB 4OFIA 1XAUA 3RY4A 3HCVB 4QYOB 3G5YA 2BRRH 5JHDB 1QP1A 1VGKA 2JJUA 4YR6B 5HI3C 4NN5B 1YECL 4PRID 4XP9L 2R0ZL 4NHCH 5LG1A 3TBTA 4NRYA 5FECB 5JIIA 4JY4B 4PJHE 2B4CH 4KROD 1H3GA 5DRWB 1PJ9A 2R2BA 2F74A 3OXRA 3FT4B 5H8DA 4QRSB 3QZWA 2NNAB 1UJTA 3D39D 3BPNC 1U3HB 4CMMA 5BJTB 5DF0A 3VXMD 3SE4C 3I6GA 2P7TB 3OAYK 4YDLB 3Q6GL 4TULL 2VISB 4R97B 3CPLA 3I9GH 3PV6B 4UV4L 4JY5H 1KPVA 5GS0H 2Z4QA 1XGUA 3U4BH 3OG4B 3LSOA 3VI4E 1T1WA 1HSAB 4AIOA 1XGPA 5F9OL 1M7IB 1KTLA 1IM3B 3L6FA 4QHLA 2YK1H 4LPWA 1PQZA 4XNZB 4PY8J 4S10A 4X6DA 4XRCB 1AJ7L 1NMAH 1ZLUK 4K7PH 5JDSA 1IT9L 4NOFA 1UJ3C 4M48L 4DZ8B 3DO7B 1NC4B 5L8KB 4ETQB 1BJ1H 5B8CA 4N0FB 4IJ3C 1A9EB 1QFWL 3AS0A 1LK2A 5JW4M 2VWEC 2FD6L 4CRPA 1ZVYA 1U3YA 5HY9B 4N0UB 1RZ8A 3EDDA 2IQ9L 5DRZB 5ISZD 5SX5H 4YDJB 2WW8A 2APXA 1YUHA 1YMHA 2N7BA 4R96A 3A6BH 3I02A 1OW0A 4ETQA 4R6UA 5JMRA 1KIRA 1NFKA 1OGTA 3HE7C 4U0QB 5FYKE 3NOIA 4P2OD 3BPCA 4ODSH 3C60D 1MVUB 2QADC 3HZVB 3V5KB 5F7FA 3LRSA 1FL3A 3LH2L 3RZCA 1FE8L 1UB6A 1HE7A 5E5MB 4WFED 1GC1H 3F5WB 4F9LA 3F7YA 4XVUC 1RPQA 2GCYA 2GT9B 1IGIL 1X4YA 1WAAE 1GOHA 1OB1B 5BVPH 2XWBA 5EU6B 4YHNA 3K2UH 5C0AA 4L4VB 3F12B 2NY7L 4WW2A 4MMZC 1U8KB 3HPLB 1EHLL 3IDXH 1FDLH 1DVFC 4GRWF 5JPMA 1QACA 4F15C 2P8PB 1DUZA 4XCNB 2CUHA 2NW2A 3JSSA 3P77B 5E5UB 5C0AE 1LE5A 2P5EA 3B9DA 2CLRB 3MX0A 1EEZA 5SWQB 1TNNA 1HH6B 3QH3A 3T2NL 3X3FH 5LVEA 1GGYA 3PHSA 5ESAB 3PGCB 2VZSA 1FFNA 1NMBH 1ODAA 6CGTA 5IOPB 4C58B 1KB9K 4J4PA 3GRWA 1ZT1A 2HG5A 5TE4L 4QRRD 4O4YL 2AQ3A 5F88B 4XPHH 1VSCA 4DUXA 4CU8A 3M8OL 2V5MA 3Q6GH 2X9YA 3SCMB 5H37G 1N5YL 2W0FB 1EEZB 3KLSA 3FQTA 3TN0C 2F8OA 3MLRH 1MCOH 4IMLB 1TQBB 2Y1VA 2CK0H 2NX5B 2QQKL 1M71A 2VXQH 2R69H 3AS1A 1KEGH 4NFBA 3L5IA 4X7EC 1T1XB 4TNVF 1BQHB 4WTXA 1BIIB 1RHFA 3OKLA 4PLNC 4L3CA 5BZWA 1J1PH 4N0YL 1TZIB 4QRRB 1CXKA 5DEFA 3T65B 1FE8H 4EEEA 4JQXC 3KAAA 4OT1L 1FYHB 4MX7A 2JCCA 3ETBF 5C0RH 4QNPE 3BPLB 4WO4A 1KIQB 3MNVB 1EK3A 3W0WD 5IBUB 2W65B 1B0GA 5C6WH 1I8LC 3RTQA 4MQTB 5KSUB 4X8XA 4WU5A 1OGTB 3PHQA 3Q2CA 4K8RH 2R1YA 2Z8RA 3PDDA 3QJHB 5CCKH 1DQJA 3HUJA 4TULH 5FUCE 4I18A 3V79C 5B38A 1BX2A 4Y5XC 5H94B 1BFTA 2UVEA 3L3OA 1JPTL 3U46A 2X70B 1V8HA 3BD3A 4W4NA 2DLFL 1CD8A 4CDGC 1HH9A 3MV8E 3TYFA 2FL5A 3RUGB 3MNWA 3HPJA 3RNQB 5DS8B 1HIML 1X5IA 2LV4A 2BSTA 3IJSB 4NM4L 5EZLA 4S1RL 1A0QH 4G6AC 5F9OH 1GC1L 3WFHA 1QKZH 3GSOB 1MFCH 4M5YH 3M17B 5M7QA 1OM3L 2CLRA 1IEHA 5DJXA 2K7PA 3NCFB 5EO0A 4GS7C 5CD5D 4M1CD 3T4AB 5J56B 3MNVA 4Y4HD 2Q7NA 3CFCL 3D2UA 5C8JA 2B1AH 3BUYB 3R1GL 5H94A 3WJJC 3GSNH 4RDQG 3DSNA 1FQ9C 3CDGB 2MPAH 4HLZH 4L3EA 1A6TA 4MHHG 5D4QA 1T20B 4K3JL 5CP3H 4EN3C 4X7SL 5IT2H 5B39B 2E7BA 3UDWA 2P5ED 2FX8H 3HAEG 1LILA 4P2CG 3RVWC 4JKKA 1DQDH 1D9KB 1WBZA 2QHRH 2SEBA 3WIHA 1CIDA 2X9WA 2EIBA 4PLJD 3VWKC 3L3HA 2Y07L 1O5DT 3G9AB 3MA9L 2W38A 4F37K 4LVOB 2EYRA 4RQQB 1A1OB 1AJ7H 4IS6B 4UTAL 3QUYB 3ARSA 2HKHL 3RAJH 3E6HB 3UZVB 1J8HD 4HUXA 5HHVH 3QDMA 5KS9F 1WFTA 3IFLL 4UTBL 5TGBB 4G8GD 3H3PL 3WDJA 4LRIA 5F1IB 1DQLH 5GS0L 5DMGD 1IGTA 1JZ7A 4DCQA 3EFDL 4PJ9B 5I6XC 1NBZB 5IUSA 1IGJA 2ADGB 1T6VN 3P73B 3MRNA 4K8RD 2EYSA 4XWGH 3KYOB 3QQ9D 2FYYB 3O45A 4IOFC 1MCPH 4FFYL 1U36A 3QXAB 3UMTA 5D7IB 1YA5A 5JW4R 4NT6B 1JPFA 3QDMB 1I9IL 2N56A 3HMXH 4PUBL 5T1DL 2R0LH 1G9NL 3E3QC 3S3JA 3H3PH 4WEBL 1T04A 5D72H 5I1GH 2J5LB 1VACA 5D5MA 5C08A 2I5YL 2EECA 1LO2H 2UWEE 4ORGB 5HI5D 1ZT4B 1JGUH 4E41E 1I9EA 3NA9H 1KG0A 2H2PC 1FL5B 5F89B 2ESVB 2O26U 5FF6B 2N4IA 4TVSa 4PJIE 3LCYA 3IDMB 3P3YA 5KVDH 3QCTL 5EOQH 3C08L 1JN6A 1IBGL 3ESVF 3UJJL 4JQIL 3GMPA 3VWKA 3DWTA 5GZNC 4TUJA 3UO1L 1UKTA 4K94C 1EFXB 4L8SC 5D7SL 4NUJB 3DETD 3IF1A 4WUUD 4KRPB 2RQ8A 2VC2L 4I1NB 2B1AL 3GMMB 4XNYH 5FO8A 4PJIF 1EEYA 4GAYA 4WDIA 5ANMB 1EO8L 2AKRA 2ADJB 2GUOA 1ZLSH 2L4OA 4HIJA 4TN9A 3O9WD 2NXZB 5A16A 1WCBA 1PQZB 2UYLA 3OKDB 1MCKA 1G84A 5JQHC 1IEBB 1MFCL 4LSTH 3CMOL 5FM8A 2Y7QB 3D87B 3TBVB 1BD2D 5DK2A 2R0WH 3MNWB 3PWLA 3RWJA 1ZSDB 4NUGL 3SO3C 1GHFL 2DTML 5FXCH 4WFHD 5FFLA 5I1KL 4Q9BA 4IBLT 4GBXB 3LRGA 5E1AB 5DRNB 1UWEH 2OM5A 4IHOA 4DTGL 3VA6A 3GMQB 1F4AA 4M5ZH 1F00I 2VLMD 4X7TB 5BV7B 5DUBA 1MIML 3WFDL 3QUXC 4J12A 3DYPA 4NBXB 5D7KD 4C4KT 5IMLA 1JJUA 2DKMA 2EEAA 5E7BA 2BNUB 3IFLH 4UTBH 1QVOA 4F58H 3CC5B 1EX0A 3DRTB 3VXNA 2E27L 3FO9B 3VG9B 5DMYA 1BF8A 4TVPD 1UG9A 4UOW0 1U3HD 5MENB 3FB8A 1MCRA 5I17A 1BMGA 3RWCB 3QQ4B 4KHXH 4XVTL 1SEQH 3RDTB 1N0XL 5EUOB 3TJEL 4FQHB 1OAZL 2OTWA 4CW1B 2R29H 4ZS6D 5BVJB 4HKZA 5KJRH 3QHTC 2FATL 4OZHE 4Y5VB 4OF5A 3WL9A 5J9PA 2CMRL 3KPPB 1L0YA 5BS0E 1TNMA 1AGFA 3D39A 3ARPA 5D1QD 3U0PB 2IANE 4CN1A 3SEPA 4JM4H 1Z9LA 4ONFH 2MPAL 3OKKA 4KJQC 4KV5F 3VMNA 2X5PA 2J8UA 1KCSH 3QJFB 1E4JA 2XG4A 2IAMA 3WKMH 4N8CH 1Z5LA 2OI9C 2VLJA 3BISA 5C08D 3X12A 4BQ6A 3HCVA 3HN3A 5F7WC 4AJ0A 2WWKT 5EBWB 1S9XB 3LQZA 1ETZA 3NFNA 1KC5L 4JZNA 4MQ7A 2YUVA 4DGIH 1PKQB 2DQTH 4JDVA 1B4JL 2YOCA 3QULA 4UIKH 4Q9RL 4KXZH 4ERSH 1ZANH 3MRCB 2EDOA 4AL8H 3ZDZF 1W0VA 1G7LB 4XTRC 5D71H 5EZIL 2JB6B 4S1QL 5BMFL 1R3KA 4JFHD 3X17A 1FO0A 2YEZA 4OF6A 4YEFA 1JPTH 5C07A 2YPVL 4U1IA 3WN5A 2NLJA 5DJDB 3GMRB 3A0OA 4BKLA 3NTCH 1K6QH 4LGRB 5SWZD 5BO1H 4BH7B 2YC1A 5ACLA 1C08B 4TVPH 5ITBL 3FQUA 2QSCL 3BPOB 2HTKC 5C9KA 4HPOL 2PYFB 1MCJA 1RMFH 3CIQA 3VI3E 5ALBL 4M62H 1JFQH 1Y0LA 3UYRH 1F58H 4MCZA 2VXVL 2X4OB 3KPRD 2ZWLT 5DI8B 1FGVH 4N5EC 4I3RH 1IEAB 4LK4A 2RFXB 3C6LB 1UXWA 2J4WL 4X0KB 2EDJA 4OM0L 3AXLA 2PKDA 4XMLH 3RZCD 2MJWA 5JZ7C 3MTRA 2XZAH 4FQIH 4X80L 1GRWA 4MA3B 5B38B 2QKIB 1QZ1A 4XAKE 3KWWA 3U46B 3QIUD 4LCCC 5FKPA 3UXFA 4QGYA 5I8OH 3NAAL 4XXDA 2PO6B 4ZQKB 4Z7QE 3HRZA 2C4FU 2E7LA 3U0WH 3QHZH 2HFTA 2HJLB 4KDTA 5ACZA 5IF0B 2PYEB 4OLYH 4DKAA 4N5UA 5KANI 3TIDB 4WENB 2WSKA 3S5LG 1FAIH 2DYPA 2NY6B 3QDHA 3C5SB 1U8JA 4OGXL 4AQOA 4PJDB 5E95B 4JZJB 3VXOA 3U4AA 3CH8A 1HSAA 4GRMB 3IT8D 1HILA 3D3VB 3HA0A 4NQCE 1BWWA 3LN5B 1ZA3B 1IAMA 3T0ED 1F6AB 3ZE1F 3OKOB 1X5ZA 2HFGH 1YEIL 3QWOB 4Y2OA 4O51B 4YHYC 1OCWH 1N5AB 1IGYA 3O0RH 1ZGLB 1IKFL 2FEEL 4P2QE 4D0BB 1QR4A 3NFSL 4EI6B 2C3GA 4RMWA 1XMWA 1AY1L 4LMQI 3O3AB 2OJZH 1YPZE 2OL3A 2FNBA 1BVKB 5I1IH 1CFTB 2AJUH 1RJLA 2W0FA 3QCUH 4O51A 1LWRA 4WRLA 5D96C 3VFGL 5DD5H 3GJFK 4XPAH 5DO2D 4KRPC 5EU7E 5DGRA 5KVFH 5IROA 2C1PB 1DQML 5LWYH 1YNKH 4Y7MA 2X1WL 1FN4A 1QNZH 4PPTA 4JE4B 5DC9B 5DJ0B 1CFBA 1KIPB 4N8PA 4P48A 5IMOB 2XTLA 1A6AA 3GSQA 1ZHBA 4PJCB 4MA7L 2FEDC 1P84J 3R0NA 3TZVB 4WIQA 3TZVC 5CD3A 1HI6B 1ND0B 3H42L 1BZ7B 3FB5B 2PW2B 1RIHH 4PGZA 5FGBA 1A3RL 1OP5H 4PRHD 1SMAA 2ITCB 4TUKL 3LKQB 3W39A 5I8CB 4TVPE 4QRRE 4HJGB 2AERT 3SDAA 3P11H 5EU5A 1CWVA 1RUQH 5DTFB 3D18B 3OR6A 1M7XA 1FH5H 2BHZA 2IPUK 2X4TB 2AK1L 5CEZH 4PRIE 4JRXB 4YE4H 3B83A 3GFUA 4MAUH 5GRZA 3SDDB 15C8H 1HDMB 5AZ2L 3MJ7A 2VR5A 3CK0L 4MA1C 3HNTH 3FB7A 2X44D 3U9UA 1ZVSA 2H3NB 2PCPA 4N8VA 3V7AE 3P40A 3WXWH 4DFHA 5KN5B 3FQUB 2F58L 3LAFA 2XKSA 2Q8BH 2F53B 1I8LA 5CJBA 3IDIB 1V7NH 4FZEL 4U1NB 3TC9A 2JELL 2K1MA 1A7OH 3MRLB 4OD1L 3UPCA 4AYFA 2GITB 3HAEH 5SX4I 4KTDL 4DTGH 4I9WE 3FONB 4QRQB 5GSRB 5AG9A 4PJEF 2A9NL 4OGAD 4NCC1 4G8EA 2YRZA 1NH6A 2PCPB 5KN5A 1ZGLA 3VRLF 4CL7A 2P5WB 4C56A 2L7UA 3TNNB 4LU5H 3UBXB 3MJ6A 3DHMA 4F7TA 5KSUA 3M1BB 4LNRA 3SDDA 4JFXA 5B4MC 3VXSA 3RWHB 1G9MC 5FGRA 4KUZL 4MDIA 5FCSH 1ONQA 4XP4H 3W9DA 3W82A 4PG9B 1ZWIB 1QFHA 4K9EH 2ICEA 1KCRL 2FR4A 1I8MA 1S7SA 3B9KB 1DL7H 3HNVH 2Y07H 4X7FC 5BRZB 4HWBA 43CAA 3CFJB 5J8OA 3QUZA 1YY9D 4MLIA 2X4PA 3SBWC 1JRHL 2XY1A 4U0RB 5I18H 2EH8H 5CSBA 2XTJE 2BNQD 4AEIL 4WJ5B 4U1GB 4P23D 2A73B 3O2DL 1X4XA 4P9ML 2BVEA 3U4EA 5CP7B 3QDJE 3KYMB 3VRJA 1FYTB 3ARFA 1MWAB 5T1LB 5EN2A 5EOQL 3QDAA 5HGHA 1PZ5B 4Z78B 1AC0A 2BDNH 4PJ8B 4L4JA 1F97A 2GJZA 1XT5A 1KCRH 2IPTL 4MJID 2IH1A 2V2TA 1VFAB 3EW3B 4X99B 4Y4FD 1NSNL 5KG9A 5D1ZB 1HKLH 1RIVL 1DQMH 3KXFE 3LQMA 3QEQB 1I1AD 3HZYA 1KPRB 4JFHE 3S4SA 3GK8H 3G6DH 4ZXBB 5CIPA 1DTUA 5I71B 2J3SA 4HKBB 4RMTA 4UDTA 3GI9L 3K46A 1N0LA 1BECA 2AXFB 3AUVA 4KMQA 2F54D 5B3JF 3GRWH 2CRZA 2ZZUT 3TYGL 1KT2B 5FV1L 1JZ5A 4LVNB 3MMEB 2DQCL 4KKCC 3B9KA 4L3EB 3ULSA 2AABH 4Q9QH 5I8EA 1OQXA 3EZJB 4XHQA 3V6FB 2KUTA 4U1JA 1TENA 3E6FA 4XPHL 1QR1B 4OCRH 4F33B 5DJYA 2CDFA 5DJ8B 1RZKC 4EOWL 1C5BL 3MV11 1VGEH 4G6KL 3WNKA 3CK0H 3D85B 3TN0A 3UTTE 2OI9B 5D2LF 4MVBD 1L0XA 4S11A 2Y7QA 2EE3A 1XFPA 4Y4HB 4X4YB 5ESQA 4YE4L 4Y2DC 1CLOH 2FCBA 1EAJA 3QEGH 1O7SA 4WY7L 5L2JB 4GXVH 4ZAKA 4HF5L 4WU7B 4X83A 3QG7L 5FGCE 2WQRA 4Z0BH 1XF2B 3O3DA 1MCFA 3MGOB 3MO1B 3MUZ1 4OQ1A 4HFWB 4QF1A 2VTFA 4KMTH 1U93A 1R5VB 5HHOA 4C83A 2EC9T 2DL2A 5C0FB 4GG6A 3LQAH 4NUJA 5D71L 2MWCA 2P5WE 1I4FA 2HWZH 1K9TA 3OKNB 4AQ1B 4AH2B 3NCEB 2HKFL 3T1WA 3JV6A 2Q87A 5GS0C 2FLBT 4HKJB 4OI8A 4IRZL 4MNQE 3LHPL 3IDYB 3SQOL 1GH7A 5I1AB 2YKLH 4GAYB 1I9JH 3HZKB 3D69A 5ANME 4LPVA 2ZUTA 5GGRY 2IMMA 3NZHL 1VFUA 1X5GA 3VMPA 1AXSA 1E28A 5CGYD 3VFPA 3VXTB 3LSOB 5FK9B 5DJ8A 3O6FD 3MCLH 4N0CC 4OLXH 3L6FB 1KTLB 2YA1A 3ARUA 4R4ND 1D7FA 4Z6AT 3SGKC 3T2NH 4ZUUB 3W2DL 1EFXA 4F7TB 4I77H 2VIRA 1OSPH 4AM0B 3BWAB 4GRLC 1SYVB 2LVCA 1KJ2L 2UUDH 2WK2A 5JA9A 3TFKD 1T4KA 4TNWF 1FLRH 1NAMH 2ICCA 2W0KA 1M6OB 3SO3B 2Q7YB 5E99L 1R0AH 2IAND 4P2QA 3FOMA 3U79A 3C09C 2VIRB 2NPLX 1WAAA 1DUYB 1U8LA 4PJBF 5HYFA 5D1QA 5C0BB 3IU4L 3QZWB 3HE7B 1OSPL 2NR6D 2R9HD 1LP9A 3OBAA 1WWAX 4POUB 2O5YH 2D03H 3VFPB 2E8ZA 3V7AG 4IJ3B 4U49A 1X44A 5EOCH 4M9PA 2HTLD 4OD2A 4WTWA 3T8XB 2GY7B 1NFDB 1T0MB 2WINB 4ZG1A 2Z35A 3IFNL 5EIVA 3G5YB 4L1DA 4NNYB 1AGBB 4JR9L 5F3BA 4NM8H 3TO2A 1R24B 5E8NB 1UH3A 4L8CA 1OAXL 4G80B 5KS9E 2ADIB 5HYJA 4WUKH 3GMMA 2DQCH 5GRWA 4P5KB 3OF6A 4WWID 1NANI 4MDJB 3TO4D 5IFJA 1MHCA 2OK0H 4DZBA 1MHPL 3HFML 4HKZB 5T1MB 1S7RA 1H9VA 1ZTXH 1A7RL 2FO4A 1GHFH 2WIIA 4R97C 1S7VB 4LSSL 3WO3B 1AD0B 1QD0A 1N4XH 2L7JA 3MRBA 4X6CA 3ES6B 3MBEA 3L3DA 4P5TA 3SJVB 3P30H 2AJVH 3PNWB 4P2RA 2I60H 1HYSC 4KKAC 2BSRB 3WLWD 4JCMA 4XMKL 1C12A 4P9HH 3G6AA 1VPOL 4YBQC 4P2OB 2KL6A 4E41A 1E4WL 1UT9A 2CO7B 3VJ6A 1L7IL 3FO0L 2VH5H 2BSRA 2HKFH 1I1YB 3E6FB 1I8IB 1NLBH 4OLUL 2J12B 4ENED 5IP4A 4HIEB 5KVEH 3FB6B 3GJEA 5GRJH 5I18L 2FEEI 4TNVK 5F9AC 1Q94B 3B43A 2H26B 3JTSB 4YHMH 1NDGA 4GRLB 1F4YL 2I27N 4HD9A 3D85D 4HCRL 4NN5C 3QDGE 1MQKH 5FYKL 3H3KA 1T7WA 32C2A 3QIBD 4ZDHA 4GFTB 4Z7UA 3O3BB 4TNWK 1Z9SA 4LAJH 1UM6L 2XTJB 1BQLL 2NTFA 3TPKA 5DI8A 5EH1A 4I77L 5GS3A 1TQBC 1CGSL 3MOAH 1MCCA 4TSBH 1FBIL 1H3VA 2R0KH 3GK8L 3T2PA 5EZLB 3LN5A 3ROOB 2GK0B 1I9IH 4JFED 4MB5A 4RWYH 4U7KA 4W70A 2Z92B 2BHYA 4OB5L 1XGUB 5D7LA 1RV6X 3PV6A 4HS8L 4ONGH 1JF6A 3HNSH 5GS1C 1S7XB 2IADA 5GS1B 1MFNA 5E8PB 3RDTC 2R8SH 2HJLA 3G5XA 4Z18A 3SKMA 4X9HA 5IESL 5F7NC 5JXEA 1C5DB 3VGGA 5J6HA 5KSBF 5JOPD 3ELAT 4G8FA 1V7MH 1MJ7L 2D7PA 4RIRA 2R0ZH 4NHCL 2OR8A 4ZUVA 1S8DB 4L3EE 3ALWA 1P6AB 4RGNB 4JZNB 1OAZH 3SJVE 4XP5H 3IDGA 4RAVB 3U6RB 2BJML 3NA9L 3ARYA 1OAKL 1AXIB 4U6YA 4YR6A 3OKYA 1DQTA 3VGHA 5BV7C 5SWSB 2JCCB 1U91A 3QO1A 4NIKB 4DN4L 5KANG 4L4TD 3QXWA 1DLHB 4GBXC 4OCMC 3TBSA 5E5RB 1YEKL 3EDKA 4P49A 1A3LH 1CGUA 1BVKA 1AQDB 2OJEA 3N1PC 4NQXA 2YS4A 1FFRA 4P57B 1XF1A 4PB9H 2JJVA 3MRHB 1A6WH 3RHWK 4EI6A 5FA3A 4JO4H 4BSWB 2NYYD 1CE1L 1J05B 2FIRT 2YPKA 1NGWA 3BKJL 1I1RA 4GKNA 3VXRA 1Q9WB 1B0WA 3NIDE 2R1WA 3TBWA 3BP5A 2XWBB 3I3BA 3RA7H 3V4UL 3WV0A 5TQ2H 3GI9H 2P8LB 1HXMB 1P2CB 4OLZL 3SDAD 4GKOA 3TH4T 4EDWH 3ESUF 4ZFGL 4NO5A 2Q6WA 4HK0B 2C4FT 1AGDA 4XCCH 3SDYH 5SX4H 4OCYH 3WBDA 3BDBA 3EFFA 2VYRE 2IPTH 1AFVL 2P8PA 4M7LH 2P8LA 1KPUA 3WUWA 1MH5B 4WV1C 2IG2L 1FZMA 9CGTA 4KRLB 1WUNT 1L7TL 2ATKB 4HS6A 5MI0C 2IQAA 1FZJA 1BIHA 1MJUL 3WD5L 2DIBA 3ZMRA 5JLZA 4GKNB 3QWRD 4L4VA 3VGEA 3VXRB 5C0GB 1F90H 5IKCA 1DQDL 3MRGB 1GGCL 1J05A 4HXBL 5J11C 4LLMB 1G0DA 4YUEL 5IHUH 5D1QC 5T33H 5CD3B 4XHJD 2W0PA 4YHOH 3CZJA 5E2VL 2HFEB 4X7SH 2X1PA 1RIHL 5ETUA 3GI8L 5C8JB 1JGLH 4ZO9A 2FO1A 2A77H 5F7MC 4F7MB 1ZAGA 2VLLA 1QBAA 2Z0BA 1T6WA 2Y06H 2HAZA 4I48A 4UBDC 2EEDA 5LGJA 1D6EA 3D5OF 1PZUB 5HHPB 4CVZA 5H2BB 5CZXC 3RVUD 3GSRA 1G9ML 4NFCA 5FO8B 5HJ3A 3N85L 2IH1B 2XFXA 3DVIA 5IIEB 4JPIB 2W59A 3W0WB 3U6RA 5IM7B 3HC4L 1J0HA 1WFUA 2OLDA 2R15A 4RISH 1LK3H 5F44A 4UILL 3UTSB 4JHZA 1KSRA 2EZ0D 1FJ1A 3RPKA 5HGHB 1S78D 2HJKA 1RZIA 1MI5A 1T89C 4D8PB 1KJVA 4BFEA 4B0MM 3P9MB 2V2WB 1E6OH 1BX2B 5DK0B 3BD5A 2BXZA 1QLEH 1KN4H 1PD6A 2AEQH 1NJ9B 1XH3A 3HMXA 3VFOB 4EUPA 5FF6A 2BSSB 4KPHL 4ZPTB 3KPMB 2FDBP 1MWAH 2A6JB 2RBLA 4NKMB 3H9HA 3SE8L 3P9MA 1CXIA 1AGCB 1MI5B 1QYGL 2HTKD 4M1GH 4XPBH 1L0QA 4J1UB 1AD9A 4GSDH 2BERA 4JHAL 2R0KL 4PRDA 5DVKA 3WSQL 3GUTB 3EKCA 4YPGB 1K4CA 3CSYB 1ONQB 5CILH 4O2EB 2DI8A 4EIZC 4KWUA 3V5KA 1QSED 4NBYB 3JWNC 2YUZA 5T5NF 3WE6A 5HHPA 1OVZA 4M43L 5ECJE 3Q3GB 3QI9D 4OT1H 3CLFL 1RZKL 1UWGL 4LDEB 1XGYL 3RKDC 3OTTA 4LSQL 5GGSY 3UAJD 3S34L 1FNGB 1INQB 3CFBB 3QIUC 1BQHA 1NMCB 3RBGA 3RUGF 4QRPB 1IKFH 4U6HA 3TGXA 4OAWB 1YZZA 4K3JH 4KGJA 4OLUH 4I13B 3CVHB 4YHKH 2PYED 1LDPL 2PUQT 1MY7A 4P46A 1UM4L 1A14H 2XZAL 4FQIL 4HPYL 3C5ZA 1XF2A 1FNAA 3JUZA 3VE0A 4LHQB 4LLDB 2DQHH 2AEPH 4W6WB 1KG0B 4MNHA 1C5CL 3IS1X 5F9JB 1A7QH 3UBXG 1N3NA 2IF7A 4S2SB 4UAOC 3GSNA 4OZGE 5D2NE 5JA8B 5LWYL 1DCLA 2CR6A 4HV8B 3K4ZA 1AC6A 1JGVL 3RGVC 1NEUA 4GW1A 5HD8C 1GAFL 2VLLB 2R56H 4MJ6B 2WUCL 5DR5H 3ZYJA 4U1JB 4Q6IC 5BQ7B 3QIBB 2EO1A 3MCKA 5L6YH 1S9VA 4F33A 5CUSH 4E9LA 1X5JA 5TF1L 1XF4B 2VXSH 5I71C 3E3QE 1K4DB 3N1FC 3ULVE 5J3HD 5AWNH 4XGZB 3ALXA 2YD5A 3BEVB 3QUYC 3MCKB 5C07E 3NFSH 1KPUB 3WUWB 1IC4H 1M05A 5GSVB 5BOZG 3OJ2C 3KXFD 2MCPL 2X40A 1SJEA 1DE4A 3HZYB 4JY4A 1CICC 1IEBA 1X9QA 4WTZA 1JTPA 5A16B 4X8JA 1C5BH 4IIQB 4EVNB 2EYTA 1LNUA 3E8UL 1WLHA 4JY5L 3UTSE 4NDMA 3BKYL 2IAMB 3OGCB 3BGMB 1SY6H 1QBLL 1KXTB 4DWHA 5JOPE 1MWAA 1INDH 2LTQB 2XN9A 2X7LA 4DQOH 4U6XA 3P2TA 3VU2A 3PG2A 1PZ5A 5D1XC 4EUPH 3TZVD 4QXUL 4XAKD 5AG8A 4RGND 2YRLA 2X4UA 5AAMA 2DYPD 1G0YR 1V3JA 1JI2A 2VDNH 1UA6L 2CKNA 1KXQE 2BOBB 3EYOA 4J3XA 4KJYA 3DBXB 4PRBA 4DZ8A 1XGTB 2ZCKL 5F8RC 4DW2L 1P84K 3QPXH 4LAQL 3IKCB 5D5MF 4JREB 1KV3A 4HQQH 3VXPA 4BQCA 2AP2A 2IMNA 4C55A 2ZSWB 2Z93B 5C08B 5IMKB 4D94A 5CHNB 2CXGA 4Z77A 3VXTA 3BI9X 1FNEA 2JIXD 4FQLH 1NC2D 1A5FL 3S4SG 4F58L 3CCHB 1XGTA 5FO7B 3O2WL 1QRNE 3CPLB 4G6KH 3OMZA 1YN6B 3IKCA 4N90D 3GSXA 1OF2A 4H1LH 5LGHL 1RD6A 3CMGA 4YHOL 5E2VH 3SE8H 5EU3A 4OV5B 2HRPH 5ILTL 4UOW1 4HJ0D 2BOBA 2DWEA 3RU8L 3S34H 4CNIB 4I0PC 5DC0A 4FFZH 2NNAA 3SDDC 1QRKA 3UC0L 3CXHK 3FN0H 1IT9H 1EAPA 1CLZH 1PSKL 1SEBA 2X4SB 1TZHB 4WUUE 1ZSDA 4K07A 5TQ0L 3BPLC 3BHBB 1JHKH 2DQJL 3FOLA 1FVCB 1GVIA 2ZUYA 4LKCA 5B4MD 4KKBC 2MQCA 3CDFA 4P5TD 2K3TA 3VD5A 4OFDA 3WKNA 1KJ2B 3V6ZA 3SDXB 3BZ4A 2XA8L 3QUZC 3HI1B 2NW2B 4OF7A 4NN6C 1IILE 4HAGA 4OJFL 4PRPD 1P7QD 4QOKB 2W1NA 1JMZA 3BKJH 1WICA 2LU4A 2A83A 3I75A 5T33L 3DUUA 4G8IA 1K5NA 3RIFF 1DN0A 2E9WA 1A2YB 1UVQA 5DD1H 1CF8L 4ZTPH 5ICXB 5F9DC 1LDPH 1AO7E 4M6AA 4P5TB 1YEGL 4ELKA 2W60A 5C07B 4RNRA 4CJ0A 1XZ0B 4P23C 4N1HB 1HHGA 4HUUB 1NBVL 4Y8DC 4I9WD 3C60A 4F2MB 5J6GA 3DRQA 4LHUA 2G9HB 2D7TH 1KB5B 5E5MA 3QIBA 2NX5A 3DUHA 1S5IL 3LRSB 4FG6C 4XH2A 3T0WA 2Y5TB 2X4NA 4YBHA 4JRYD 1Q72H 5C1MB 3C2AL 3I50H 4YDLC 4K9EL 1RY7B 3WXVL 1WITA 2BDNL 1TMCB 3SDXF 3O6LH 4R3SB 2UWEA 4ZXBD 3L3GB 5DK3A 1FNSH 2B0SL 5EWIL 1ZS8B 3P0GB 3MRDB 4CU6A 2NY3C 1J1OH 2FO4B 3IAPA 4XPTH 2QLVB 5SWQA 1IAKA 2H32B 4PGCB 5DDHA 4BZ1H 2WV3A 5GPRA 5I2IB 3D0VB 3MLVH 4G9DB 1KELL 4WW2B 1A3QA 5IV2A 4P0DA 3RZWA 3QJHA 5SWSD 1ZLUH 1YN6A 5IMMA 2VAJA 4Z7VF 1IGYB 4B50A 3IXTB 1NFDA 1T0MA 1D5XB 1FSKB 2OMBA 1H0DB 4UV7H 4MQXC 4YGVB 4ZAKC 3TJHC 5E8EB 1MLBB 2R2EA 4WHTA 5DMKB 1IAIM 4YEEA 1NGYA 4G6FB 3FO9A 1FVDA 3RWEA 2OQJA 4LCCB 4MSWA 2MTPA 1N64H 1OD9A 2BMKB 4YC2B 1F2QA 5F3HA 5BJTA 3O3EA 3RL1A 5K9QI 4YK4B 2OZ4A 3FCTB 1I85A 1W8OA 2FX7L 4H20H 3FQNA 3T0XA 4WW1A 4DUVA 4HWEH 2R2BB 5I75C 3WUWG 4AEIH 2R23B 4AT6B 1YEDB 4GLRH 1AGEB 1KTKE 4H0GA 2XNAA 2OXHA 1VEMA 3GSWB 1NGXB 4UT6H 1LQSR 1B90A 3D2UB 3P9WB 5LBSL 2A6IA 1NGPH 3FKUS 3OZ9H 3SCMA 2VE6A 5BW7A 2R1XA 4HIIA 3B5HA 4Z7VA 2AJSL 1HZHL 2CIKA 7CGTA 1NAKL 1HOCB 2BJMH 3R06A 4B7IA 2EE9A 1YMMA 3FRPA 3GSRB 2J88L 3FQRA 4V2BA 4HS3A 2EDFA 4M6OH 4GMSL 3C6LD 4ZTOL 1RUMH 4X5LA 3UX9B 4XCNA 3ARBD 4GRLD 4QHKJ 4H0IA 4OIIH 1KCKA 1MIEL 1A8JH 2V5YA 4JREC 4LLMA 1FGNH 3HR5A 3LKQA 2F54E 3BN9C 2EIZA 1SJXA 2XNAB 3MLSH 4JFPA 5I6XB 3RHWF 4PJIA 4R7NA 2CK0L 5DJ2B 3QWRA 5A3IC 2NLJB 3FZUD 4KTDH 1YPZF 4X80H 4J3VA 1AY1H 1HI6A 1ND0A 1FO0B 5F7LB 1N2RB 4XPFL 3PE9A 4JY6A 1RHHB 4NP4L 1MELA 2ED8A 4AG4L 1L6ZA 4R90L 4G8IB 2NY4C 1DFBL 5F8QC 5D5ME 2XXMB 3V52L 4ELMA 1OD7A 4X9IA 3HI5H 3ORJA 1DSFH 1UCBL 1XR8A 1IAIH 1DBMH 3NACL 3L1OL 2A6DA 2B0SH 2YPLE 4LLUB 1HINL 1J5OH 1JK8B 1KN2L 1T5WB 4XBGA 2IAMC 3WXVH 5HHOD 2XI9A 3U0TB 1DQQA 1ETZB 1WV7T 4LP4A 3SKOA 5D6DC 4P4RB 4TTDC 2P5EE 3GHEH 5EBMB 2Z31D 3MA9H 4Z9KB 1TDQA 2ZG1A 5ALCL 2ZUQB 5D7IA 4DVRL 3WO4B 4OFYD 3MR9A 3ZDXF 1X5HA 4C54A 1PBYA 1SJVA 3IDUA 3P30L 4OM1L 1QLFA 3MBEC 1QPPA 5E2WL 3PL6A 1MI5D 3KJ6L 1KYOK 3O3AA 4WWKB 4BFIA 1NBVH 4MAYD 5MEPA 2B2XH 5GGVY 2VLKD 3SKUD 3V6OA 3RRQA 5E08H 2VDMH 5CJ8A 4QT5A 1YEEH 3GHBL 3W2DH 4CUCA 4PGEB 3U1SH 1L7IH 3FO0H 3QO1B 2LU3A 2CQVA 5ERWA 1WC7B 2IBZY 2RR3A 4W4OA 5I1DB 5GGQH 5IGXH 4ODBD 4E0RA 2FJFA 5AD0A 5TGBA 3P4NA 2Q20A 3DSFH 3KPLB 4JB9L 2OSLA 2VE6B 1CBVL 1FPTL 3ULVF 4R7DA 4XC3H 4NQED 1T3FA 3Q6FA 4POYA 3VXSB 1YYLH 5DFVC 4EN3A 5E8DL 1A7RH 1G7JB 2WBJA 5C7XH 3ZKNC 4PB0H 4PTTB 5TE7H 3HC3H 4HWZB 3FONA 3KWWB 2F5AH 1CVRA 2YD2A 3PHOA 4NCC2 3EYFA 4U3HA 4PRAB 1OCWL 4Z5RA 5E8DH 1HWGB 4I0KA 1MCDA 3UYRL 3QPQC 1MI5E 1HINH 4KY1H 1O0VA 35C8L 1S7WB 3C5ZD 3MCLL 1HNFA 3ZE0E 1AI1H 2NY6D 3KPOA 1S9YA 3F62A 5CBEB 4Z8FL 3OV6A 2QHLA 5EBGA 3MV8A 1RZFH 2DI9A 3ARBA 1XF3A 3BZFB 1RJCA 2ADFH 5GS2D 4NP4H 1JWUB 1VERA 5JXEC 5FUOL 4Z7WE 2R39A 5EFIB 2F5AL 3KPRE 1KBGH 4P2RD 3EYFB 5K93A 3D3VD 3FQWA 3K2UL 1Y6MR 5GISH 1R3JA 3VFSB 5B3JE 1FGNL 3HZMB 3MGTA 1JN6B 1BFOA 4GG8A 2NY0D 4OTXL 1A7PH 1XEDA 3V4PL 3NPZB 2FX9H 1BOGB 3T0AA 1CXLA 3C9NB 4D9LL 1U92A 1UQSA 3ROLA 2ARWA 1NUGA 2BNRE 1OGAB 4J6RH 3RVXC 2VN4A 5KBNC 5JNYB 1G9NC 2GSGA 5HGAB 4BQBA 3L5JA 3WDIA 1RJZB 1CLOL 1KXVC 4HGMA 3GMOB 3LQAC 1KOAA 2VLJE 1R3IL 2CDFB 4UU9B 2FJFB 1NMBL 1MEXL 3GM0A 4YHPB 4PJ9C 3HE6A 5MHSE 2DJSA 4NT6A 5DHXB 5EA0L 4MNGA 4OKVA 3O4LB 3FO1A 2VLKA 4G8GE 3HB3D 4NN7C 1UJ3A 2APWA 2MOVA 1GOFA 4J23A 4L8CB 3GSVA 1RFDH 4IRSD 4FTVA 3HMWH 1IGTB 4ZODA 5T3XH 1U41A 3QDJD 3LKNA 5DT1H 3QHFH 1HEZA 5D7LD 3JV4B 4HUXB 2AXHA 3W9EA 4MJIE 3WE6B 1C7TA 3LKRB 3OGCA 1EDQA 4PJHA 5KG9B 2V2TB 1VGEL 4G5ZH 2EIDA 1HCFX 2OS7A 5GRVK 2UWEB 3QXVA 3BMWA 4YXHH 1I3RA 3BH8B 4PRAA 4PRPE 5EOCJ 3VDAA 2I9LB 4QY8B 3O6ML 4LPYA 4A2LA 4OZ4A 1BZ9A 2PW1A 1NUFA 4HBQA 4CNIA 2MQ3A 1H5BA 1IL1A 1JUFA 4Y4KB 2UZYB 3M07A 4Y4KC 4OFKA 5I73C 4ZPTA 2D4DA 3V5HA 2C3WA 4G6JH 4JVPA 4A6YB 3GB7A 4AM0A 5DJAB 3C60B 1HCVA 1JP5A 1HHKB 2IGFH 3LQAL 4KJWC 1RUML 3QFJB 2Y9RT 3CAFA 5E2WH 5GGTH 1UEMA 2JJTC 3C08H 3VFSA 2HFFA 5F96H 2EDNA 5FYLL 3VFWB 4DN4H 1RZKH 1UWGH 2YR3A 1CD1A 1A2YA 1UVQB 1FZOB 5C0EB 1OAKH 1DP0A 1AFVH 4M7LL 3QB7C 5JIPA 3HE6C 3JWOC 1RAMA 4U4BA 3QEQE 4L4TE 4HUWB 4DN3H 4Q2ZB 3HZKA 3CSBA 2ATPA 2YPLB 3CZFB 5TH2B 3EYVA 5C07D 3KJ4C 4AY0A 3MRMB 3RNKA 2IH3A 2EH7H 5E9DB 3ZT7A 2ERJC 5GQBA 5IW6A 1C08A 5IESH 3PP3K 3SDCC 1QFWM 3IF1B 1OWWA 4GAFB 4K9EC 1NCBH 3H9SB 3IDYC 4NJ9L 5IB2B 4XNQB 4LKXA 4R0LC 3MOBH 3N1GC 2D9QB 1LEGB 4G7YH 3GJEB 5TDOB 2XPGA 4WWKC 2CKBL 3QDGA 1AHWA 3OB8A 4OJFH 2HLFC 1HQ4B 1AIFA 1ZHLB 4PRHE 3OX8A 2YPLA 3EDJA 3CZFA 4PJAF 5TH2A 1RZGB 5B3NA 3BEWB 1SQ2N 4M5YL 3BW9B 1CDYA 3VDBA 3ARFC 4KTEL 5KOMC 3PDGA 1T0NA 3O6LL 5T1LD 2VDOH 1FFQA 5E2UL 3VFGH 5CKAA 3MLTA 1NGYB 3HS0A 1I3UA 4AK1A 1A9BA 1NAKH 4TUOA 4DEPB 3CVHL 4DGVH 5F7DB 4KAQL 4LFHD 2V9QA 4JPWL 5DUMH 1RIUH 4M61B 3IXTA 1CXFA 1S7QB 2NTSP 5B22A 1S5IH 4XPGL 2OJZL 3WN5C 1MFAL 4JO4L 1E27A 3MREB 4I5BA 3EO0B 4X9BA 4ODXB 4HIHA 3MXVL 4FQJH 4KXZI 2AJXH 4DAGL 4FZEH 4LLVA 4X5XB 1QO3B 5D70L 2O61A 3C2SA 3ILQD 4OZ4B 1MCLA 5HYJB 2CLVA 1DDHA 1JHLH 4L4VE 3MZTA 5IB1A 5ICZA 4NQXB 4YDKL 3S7GA 4LMQE 1R24A 3FJTA 4HDIA 4JGMA 4HT1H 3R1GH 3ZYOA 3NFNB 4XI5D 3HE7D 4JFDB 4LGPB 3QEUB 3QEHA 5IW3A 3MLZL 4CVUA 3ZTNH 3LRHA 4ONHB 1Z5LB 4K3DH 1OM3H 1EUTA 4M4RA 4CVZB 2QHRL 1OTSD 3ZLQC 1XIWA 5E6IB 1Q0XL 3T3PE 3GBLA 4WO4D 5FB8B 2OCFD 1F3RB 4G7VH 4JM2C 4BSVA 1YJDL 2BHUA 1IAOB 3PWPB 3KG5A 1S7TA 5HDOA 3F7QA 5EOTA 4MXQC 3QFJE 4KDTC 3NVQA 4O02L 3V0WL 2R4SH 1B9ZA 1U8KA 4JPVL 1JGEB 3T0EB 3G5XB 2KQNA 5E8OB 1U8HB 2CPCA 5K59F 5JHDD 3F7YB 4ZPVB 2A83B 1RUKH 3STLA 5BS0D 3K8MA 4PRIB 4R4FH 1F3DH 1LMKA 1FL3B 2XY2A 4D0CA 4YX2L 3SY0B 4BQ9A 4K23H 5F70A 5GHWL 1NDMA 3VXUA 3F5WA 4PREB 1XR8B 2D03L 4CVXA 1F4XL 7FABL 1T7XA 4YH6A 1U8JB 2E6JA 2YD4A 3H7BA 1AHWB 3I50L 1GL4B 4XAWL 3G6JA 4M6MH 1INEL 5K9JH 2XWTB 4D0DB 2FB4H 4C56B 1VKXA 3HRZB 4YNYB 4N0UA 4P46D 1YQ2A 3I02B 5H37H 4IIQC 4PJIB 4R7NB 3JV0A 5F21B 5J06A 1F4YH 2EIZB 4Z7UF 5FEBA 1F42A 4ZS7H 1A9EA 3VWJD 4JLRB 1EBPA 2AEWA 4OAWA 5BZDB 5K9QG 4NQVA 4HS3B 4LQFH 3MJ7B 3ZHKA 4FFWC 3F7PC 4LL9A 1B88A 4GLRI 5IROC 2H3NA 3REVB 4YWGH 1NPUA 5INCA 2A6KA 3G6JB 4G6FD 4OGYH 5EPMA 2H32H 1KB5L 3X11A 4E41B 1Q0YL 3K1DA 3U9PH 5E00B 4HAFA 2RIKA 5MHSD 5DYOB 1C1EL 1PYWA 4X6CE 35C8H 5I1HH 1FBIH 2ZCKH 4Y16D 4PR5A 2AQ1A 4PJGB 4AT6A 2EICA 2IWGA 1H0DA 4R8WH 1XZ0A 5JQ6H 2Z31A 1MHEB 3DTXB 1K8DB 1C8PA 4RBPK 1I1AB 1NUNB 4OFYA 3SDDD 5I19H 1J8HA 3EYQC 4OBRA 3PWUB 2ZG3A 3MLYL 5AWNL 3ULUE 2F15A 5C0CA 3VFTA 2VLKE 4G8GA 4RZCA 4ODWB 1PEZA 2YA0A 1G7MB 5EC1A 3MRCA 1WZKA 3O2VL 4CBPA 4WY7H 4KKBD 4R8WL 2A0LD 5CILL 2RHEA 1R3LB 4NQEB 1OTTC 3O8XA 1CFSA 1J18A 3QIUB 1ITBB 1KCVL 1GAFH 1NCWL 3T3ME 1PG7X 2OXGA 3QUZD 3ZHLA 1DLFH 1S9WA 1P4IH 1BQUA 2XXCB 4OFPA 4Y4HC 3SKJH 3O4OB 1V05A 3QIWD 5TF0A 4L4TB 4P23A 4UQ2A 4PJAA 3UTTD 4L8DA 1I7ZA 3O45B 3KYMA 4LDLB 2P5EB 2AXGB 2R4SL 4N68A 5EUOE 2D0HA 1KN4L 2YXFA 5D7JB 4H1LA 4PB0L 5D7JC 1ITCA 4WWKA 4BFIB 1Y18A 4EN3D 1T2QL 1OW0C 3ECBB 1QSEE 5FUZH 1TJIL 1QPXA 4D0BA 1WK0A 3KJ6H 3BXNB 3OKEA 2UZIL 1EMTH 4OLVH 3CXDL 3U36A 3RWFB 1VFBB 4Z76A 5AEAA 5C2BL 4F9PA 2XYCA 2GTZB 4RWHA 4TQEL 3UTTB 1JZ3A 5EO1B 1DQQB 1QLRB 4HJJH 4OQTH 1WWWX 1MF2L 4POZD 1MHHA 1Q0YH 1F6LL 4QWWC 4BZ2H 1R3HA 3EO1A 1ZLVK 2X9XA 5L9DH 2XZQH 4GXVL 2XZZA 4QRTB 3G6JE 1G7IA 1FGVL 4ZMAT 4KK6C 4KQ3L 1F4XH 5FCUH 7FABH 1MFEH 5CJQL 5HTSA 2YMXH 5KAQG 4I2XE 3L1OH 1Z9MA 4NO3A 4HWNA 4UT7H 3VXUE 2BX5A 2DICA 2NY0B 3LKOB 3VWJA 4RX4D 2NQCA 3VFRB 3IRZA 3NTCL 2XN9E 4FOMA 3CVIH 3VFMB 5DVOA 4BSWA 2ZCLL 5DUML 1NAML 1FLRL 1NL0L 5EORH 1F13A 1I7RB 3GSUA 1X5FA 3DARA 1GZQA 3FN9A 5MEOB 5CBEA 2DTMH 3TJHD 2XQBL 1KCUH 3BDYL 1FYTE 4R2GD 1D5MB 2DJUA 4OLXL 1ULVA 5JR1H 1K4CB 3LH2H 4WHYG 3OB0K 1X6LA 5MI0B 2DQDH 1WWBX 2Y36L 4LU5L 4PJGE 2WWKO 4YFEA 5KOVC 5I9QB 3TPUA 3CFEB 3HI6H 1FV1B 3QG6B 4OGZA 3VDCA 4Z77B 5DVMA 1GCFA 1HH9B 5AYQA 1RVFL 2ENSA 1JVKA 4LHUD 4F3FA 2P48B 5DZOA 3ARRA 1X4ZA 2N7AA 1R5IB 2NZ9C 4XWGL 3BKCH 4O02H 4P3CH 3PHOB 3SOBH 1PY9A 1AO7D 5C0CD 4C59B 2NX5E 3AB0B 4PYHA 2VDRL 2DAVA 1F45A 5BQ7A 3MV7B 3GSXB 2J6EL 5D2NC 3VXME 3PXHA 5DJAA 3V5DA 5IHUL 1QQDB 3CLEH 1ZHBB 1DQLL 4PJCA 5EO9B 4NN6B 4GW5A 2BP3A 2VQTA 4LSQH 2I9LA 4QY8A 2D0GA 3TCLA 5C3LD 4FTVD 1JYXA 2UZXB 4L5FL 2BVUA 2EE6A 1ZK9A 4PJXF 1QTYT 3NIGE 1JNJA 3ARDA 4RFEA 5CIPB 5BXFA 3ARGD 4XCYA 4P59H 4EZMA 1FH5L 4LLDA 5KTEH 1YEFL 5ENWA 3S3PA 4WI9A 1TCMA 3UTTA 3OR7B 4IIQA 5HDBE 3OAYH 1VENA 3HMXL 4R4FL 3INUH 4I2XB 1HEZB 3UO1H 1K8IA 1X5AA 2DJ4A 4GQPH 1UB5B 2EYSB 3ZE2F 4KVNH 5KSAC 5JW3L 1IQWH 1TIUA 3LEYH 1UCTA 1YNTA 2BY1A 3BEVA 2V9RA 4XNMA 4YXKL 3QUML 5DURB 2BXYA 3ZDZE 3B2VH 1W0WB 4OZHB 2BY2A 3CFJA 2VXTH 2VITB 5F6HJ 1ORQA 3SGJA 5BRZD 3U2SB 4WNQB 1LO2L 2DQIL 3UPAA 3DGCR 1J1OL 3LB6C 2GKIA 1Q0XH 1GGBL 4GKSA 4NZRH 4X8JB 1U8QB 4YHIA 4M6OL 4XPAL 3TO4A 1HHHB 2V17L 4HV8A 43C9A 4K94L 3PWJB 2BFVH 4YAQB 4FA8A 3ILPB 2DQUL 2F8VA 4UTAH 4HZLB 4PJFF 3MLUH 5IMLB 4O5LL 5GSVA 1U8LB 2BRQA 3O41B 3F58H 4UIMA 1MJJB 4PRPB 3UBXA 1TVHA 1RZJC 3MFGB 5KSBB 4IHOB 2PR4L 4JFEE 5IQ9B 5E1AA 3NCMA 3ARQA 1RK1B 3PABB 3KYNB 3B3IA 4MAYC 1CFQA 4J3TA 1REIA 3UTQB 2F58H 3NABL 4KJQD 3VFUA 4AMKL 3PWVB 3PDOB 4DZBB 5F7HA 4LVHC 4E41D 2W9DH 1CTOA 4JZOB 4U1MA 4LNVA 3TBVA 4LSVH 4Y1AE 3C09B 3TM6A 1G7QA 1MJUH 3WD5H 3C6LA 5F9WC 3N9GL 1MCQA 4Y88A 2ADIA 4TOYH 4K2UH 5DK2B 2HYMA 5KTEL 1S9YB 4HIJB 1KYOJ 5HHMB 3BZFA 4NQEE 1KIRB 3OJMB 1DBAH 2NY1B 1GXEA 5FA4B 2WBJC 5D72L 4PJCE 3TVMC 4XX1G 5DQDH 3GSUB 3JUYA 3IDGB 3MOAL 4FNLL 3MRIB 4XNXL 4PJFA 4UOJA 1RJYB 4M3JA 5FUZL 3RA7L 3GMPB 1BEYL 3T77B 1W72H 4XMPH 5GISL 3AS2A 3QI9B 4TUJB 3RL1B 4PTUB 4ZTPL 1NCCH 1MQKL 5FYKH 3T0EA 1MCOL 3V8OA 5GGSB 4L3AA 4OD1H 4LSUH 4LDOB 4F7CA 4JFYA 1P4LB 1NCDH 3HUJE 4XVSL 5IR1A 5K9KA 3QPQD 1RJYA 4O00A 5KVEL 2DLTA 3QSKB 3RQ3A 4KHTH 3ARTA 3KLAB 2OR7A 4RMQA 2PYEE 1S9XA 3FRUB 3UJTL 1MFEL 2DS4A 3MJ9H 3PL6D 1ZHNA 3S5LA 4UMGA 3U2SA 1QR1A 1CLYH 2DTSA 5JXED 4LEXL 5EZOH 1Z0MA 2F53E 3F6LA 4GKZB 1G7HA 1XGQB 2X1OA 3D3VE 4NQCB 3L3KA 4WI4A 1P9MC 3G5VB 2DLFH 4HIXL 5C9JA 2VB5A 4N1CA 3BPOC 1F8TL 2J8UE 3DI3B 3GSVB 3RJDA 3V4VH 3M45A 1WJ3A 4ZD3L 1YNLL 1LEIA 4U6TA 2ED7A 1YYLL 3D25B 2YD9A 4B7LA 3ULVD 3O2WH 4NQCA 1CLCA 3PABA 3MO1A 2EDEA 3RVTD 5I17B 3TNMB 4QXUH 5JLZB 4XC3L 4UB0L 1F3JA 4MA7H 4XWOC 1N26A 3GIVB 1VKXB 3BD4A 4HG4J 1FCCA 5F6HI 2C7UB 1ZHNB 4PFEA 3NBNA 4DKEL 5L9DL 4KZEH 5CEYB 3CC5A 3ZHDA 5IOPA 3JWOL 4NJAH 5ISZA 3EOTH 3VXUD 4GXUM 4PJGF 2DLHA 4PRNA 2VDPL 2Y72A 4PJ9D 4U6VH 4UT9H 4XP1L 1KCUL 4HGKC 5IF0A 4X7TA 5B39G 5I8CA 2CIIA 5GJSH 1KLGA 1B2WH 3HB3C 4O2FA 4IOIA 5E6IC 3JXAA 3G08A 4HUUA 1D3CA 1HHGB 3JTTA 5F1OB 1TVBA 2YPVH 2NY2B 5D1XA 4R2GB 2H41A 3UYOD 2G2RA 4WUUB 5FUOH 3KLDA 2Q86A 5C2UB 1WZ1H 2A38A 3TV3H 4EI5D 5EIQA 3RKPA 5L6YL 4I3RL 1J8KA 4UT7L 4UZGA 4L8BA 1KJMA 5E00A 3R06B 1MFDL 3TH3T 3BZ4B 1H8OA 2DQTL 3MRKA 1JNHA 2ESVD 3V6ZB 2NY2D 1T03H 1CZ8H 4MD5A 4HIIB 5GGTA 4QOKE 1K2DB 4U6YB 5D9SB 5C0CE 4DUWA 4URTB 4PIRF 1FAIL 4QRQA 1NC2B 3GGWB 1VFOA 5GSRA 2YC1B 4JFDA 1CL7L 4Y16A 4Y4KD 3AB0C 4TRPH 2JJSC 4D9LH 1UWEL 2AV1B 4KRMB 5JW4Q 3U1SL 3TYGH 1LK2B 2P4AB 2ZOLB 2AK4E 1G6RH 4X9FA 4PV8A 3HUJB 4PJ5D 3IKKA 2QQQA 5B8CB 3RJQB 3S35X 1LK3L 2KDGA 2GJ6D 2C9AA 4MB3A 4I18C 2ORBH 4BFBD 2WBWB 1B6UA 3DXAA 2G5BA 1CBVH 1LO3L 3CFKB 4DFIA 3T1FA 4JRXA 1OY3B 2OP4L 5IK3B 3WIIH 3QULB 1Y6KR 4NM8L 4ZSOE 3HE6D 5TFSH 3ZKXB 4WU5B 2BNQA 3S8WA 4PLKC 4KKLD 4TUOB 1HILB 3QIWB 3S36H 1D5BB 2CJUH 4HJGA 1KIQA 1SHMA 3BE1L 4RAHA 4IRSA 2O93L 5DEZA 3U4BL 4NKMA 2QQLH 1I1FB 3F6IA 5J6HB 3QDJA 5DD6B 5DEFB 2YSSA 4LLYA 4QHMB 3ECBA 4QT5B 5LCVH 2ZNXA 4M7JH 1JWMB 4K3EL 3NCJL 3D0LB 4JFEB 3RTQD 5E8PA 2FGZA 1CGWA 3VCLB 3VXRE 1T22B 5IFAH 1HHIA 1NBZA 2BC4A 4ISVA 3PL6B 3RWDB 5J0BA 2FBJH 4M43H 1U58B 3F58L 1X5YA 2DB8A 3L3IA 4YO0A 1OT1A 1JTTA 1JF5A 2V9TA 2F54A 3UDWC 5F9WB 3OR7A 4K7PY 4JDTL 3B9KD 3V7MA 1YECH 4A2MA 2J88H 1EHAA 2FJHA 3V4UH 1DFBH 1G9MH 4I48B 3QT2A 1RJZA 4NNPL 4ZUWA 5GGRB 3WEXA 4IM8A 4XCFH 5B38G 4ELMB 4X5WA 5KVGL 5I75B 3D9AH 3AREA 3OKMA 3B9EA 2DQEL 4U05A 3T2OA 4Y5YB 4IDJH 5E1HB 1ZHKB 2FWOB 3LZFL 3DTXA 2H1PH 2DQGL 2AJZB 3AU1B 5JW5B 3AREB 4A6YA 5E4EB 4H25B 4DAGH 1JZ8A 4PLOB 1F90L 1BBDL 4RDQF 1I85C 4WI8A 4WI7A 1B0RA 5KVDL 2X1QA 1XIWC 5IMOA 4MJ6A 3MJ8A 2ZUVA 1GZPB 4HXAL 1U9KA 5CBAB 4EIGB 3CVHH 3I2CL 1MOEA 2VLRD 3EOYG 5D1ZA 2HJFB 1HOCA 1SM3L 1IARB 2MSPA 2BSTB 1BBDH 2WP3O 3TCXA 4PP2B 3EJZC 1TFHA 5DQ9B 2FLRT 5IT2L 5D70H 4MXQD 5HDLA 4YUEH 4MWFA 3HG1B 3IDNB 5CEXA 4LSPH 3MXWL 4LCIH 2ZP0T 5T3XD 4NGHH 5I8KL 2VL5A 4HZAA 3CSPA 3WHE0 1CK0H 4RRPG 3S37H 4M03A 1OF2B 4MGXA 5GJTH 5J57B 1I3VA 1FFOA 3CH1A 5C08E 3BSZL 3O3UN 3T8XA 4Y5XA 4ZFOB 3L3JB 1EXUA 5CZVL 3RIAK 1U6AH 4Q6IA 1P4BH 1BBJB 1BF2A 3L3JA 3VW3L 5GZOC 2AJSH 2HT2D 1KENH 4QTIL 3WFEL 3UJIL 3VXPB 1GOGA 3O11A 2Z91A 3T1FB 4L5FH 2Q7YA 1U95B 1KIUA 1NGZB 4PTTA 3QUMA 5JW3H 5GGTL 1ADQL 3VXMA 4F37F 2PXYC 4IDLA 1FJ1B 5DK0A 4JFZL 2J8HA 1IRAY 3HZMA 3MGTB 4PS4L 1YEGH 1OSZB 2VZVA 2P24A 4G6AD 3WNPA 1TVDA 3FQWB 4OD3L 2CJUL 3GMNB 4HUKB 3ZKMD 2IG2H 4J3UA 4AEEA 4H5SB 5KS9A 5T5NG 3Q0HA 4AEHH 3AAZB 1BFVH 4NWUH 5MERA 2PTVA 4KQ4L 3O6FC 4RWYL 1LO3H 1K3IA 4KU1A 1B6DA 3F7VA 1ZGLP 1QKZL 1T5WA 2AKRB 4WW2C 1JV5A 4RA3A 2Y5TA 2A73A 3U4EB 3VGFA 1I7RA 1O7VA 1UENA 4S1RH 4KI1A 3OXSB 3UBXI 3QNXB 2J6EH 1HKFA 2DQIH 1X6NA 1SJEB 2C26A 4FXKB 3LMJH 5KSVA 4GJTB 4OCSH 1QSFD 4IDJL 5CZKA 4XCEB 3FO1B 4NRXA 2M2DA 4ZOEA 4PLJC 1P5UA 1DBJL 1MRCH 1WIOA 4WU7A 3L9RA 4M7JL 1Z9OA 2ADFL 5DD3L 2I07B 1BQSA 1I3GL 3LKSA 1MJJA 4PRPA 4CGTA 5KSAA 2XRAH 2DMCA 3DV4A 1P6FA 5D1ZD 4PRNB 3UTPD 1QSZA 1CQYA 3D85A 3B6SB 3TN0B 4NO2A 4ORGA 4CN6A 1FNSL 3L7EA 3WFCH 43C9B 4QTHB 1JPSL 3E0GA 4J2XA 4PJHF 3SBWA 1T0PB 3DO3A 3GO1L 2NW3B 4MJ5A 1PX4A 2OP4H 4OUOA 1VA9A 4CJ1A 4NC1E 4J3WA 4RMSA 5D7JD 5E99H 4PGJA 2NY7H 4GBXA 1HSBB 4NRZA 1KT2A 5BRZE 2DD8H 3OKKB 5H35B 3ULVL 5GJSL 1CG9B 1LEIB 4QXGH 4Y5VA 3WL9B 2VZ3A 1OLLA 4Y8AA 4G80A 1MEXH 2BNRB 1F11B 3SKNB 4ODXA 4MS8D 1TTFA 1Q9OA 4LCUA 3QNYA 4POZC 3EOTL 4J4PD 5D7LE 4HULB 1N5YH 4KDVA 1CGYA 5I15H 5SWZE 4YQXH 3TIEA 2X09A 2ZSVB 3NMEA 4QRPD 2H2PD 4O4YH 3OG6B 3WNLA 4D0CB 1QA9B 1ERNA 4DK3A 4LAQH 2Z93A 3I6LE 5IW1A 2MKWA 4Z7QF 3W0WE 2FJGB 4CU7A 5F1NA 4OTXH 3QO0B 2M26A 5CLWA 3AGVA 3AC0A 4MJ4A 4I0PB 5CD5C 4RIRB 4G3YL 4GW5B 4Z7UE 5J13B 3V4VL 4PGBB 5GIRB 2E3VA 3SE9L 3PQYD 3TVMA 2VO5A 3QIBC 1K8DA 2X4UB 4PTUA 1XCTB 4FQPA 2E6PA 5FB8A 2WIMA 1RURL 2FJGA 1B2WL 3MRJA 3BH9A 1TPXB 3S35L 2ARJB 2VABB 2Y25A 3NA4A 4Q6YA 3RVWD 1UH4A 2EXWC 2VQUA 1CR9H 4WCYH 4G6ML 1KCVH 3BZDA 1IAII 1V5JA 3C5JA 4YGVA 3SGKA 3QQ3A 3MV01 1A6UL 3BRFA 1LDSA 4KI5D 4NHUA 1LP9E 3SQBA 2NTFB 3THML 4FZ8L 2ID5A 2JCCE 3WFDH 3D0VA 4HJJL 3KR3L 4YK4C 3B4NA 3RDTD 3PUCA 3RWIA 3WLBB 1IVLA 5HYQB 4QHKI 5DMGC 1J86A 4OCSL 1EVUA 3UYPA 1H3PH 1MAMH 3BIKB 1CYGA 1YMMD 1VADA 4K8RC 4YHZL 1YEHH 2CK2A 4XBEH 3RVVD 5DA0B 3V8CA 1KBGL 2P1YA 3ARGC 4BK5A 1TQCC 2AV7B 4WTZG 5L2JA 1OAXH 4JGJA 2OX5A 4JKMA 1QBLH 4NC0B 5HPOA 2AS5M 1BFVL 5F7EL 4NO5B 2Q6WB 1AR1D 4PJ7F 3IU3B 3IFNH 2H9GA 4RX4A 3TIDA 4OV6F 3MSPA 3SY0A 2YK1L 1IC5H 4NKDA 2DIAA 1E0OB 2WWMC 4GSDL 4ETYA 1M1SA 3GZKA 4ORZC 3PNWA 1A1NB 5FHAH 5HI5C 3QXTA 4CN4A 1YYMH 2CXKA 3ZYZA 4ZS7L 5IFJB 4HUNB 1QFWH 4OZHF 2VWEE 3IDXL 4JCLA 4LSUL 4ZO7A 3REWA 1S7TB 3HNVL 3DUUB 1TJHH 1XR9A 5D7IE 4DGVL 5E6IA 5IHZA 1UM5H 3BP4B 4X6DF 5SWZB 3DETC 5E8NA 1CDHA 3V0AC 4GKZA 1AGBA 2CUMA 5LGKA 4LPUA 4QHUB 3P9LB 3LEVL 1NFIA 4ONHA 3TA3B 4E42A 4XP9H 4K23L 3QNZA 1ZT1B 3PWNA 1J7VR 5FAAA 2XRAL 3PF2A 1FL6B 5C0NC 1IM9D 5TPWH 4OF0A 1T1WB 4JN1L 1KB5H 4WI5A 4MAYA 4XVSH 1NAMB 2YWZA 4Q74A 3VFVB 5JO5A 3QH3B 1HH6A 1MIMH 1CK0L 2ARJA 2VABA 3BMVA 2HT3C 3AVEA 4RAVA 3P0VH 2IALA 2O5XH 2YEZB 4FHBD 2VAAB 2J5LC 1EO7A 4JO2H 1CDUA 3AROA 3KPMA 4XHJC 5GGSA 4PJ7E 3KNBB 4XP6L 1BEYH 1NJ9A 4AZ8A 4X7CC 2HMIC 2PO6A 5J1SC 2Z31B 3OXRB 3CDGA 4YDIL 1MJ8L 4YFLF 2VQ1B 4HMCA 4LCCA 4MSWB 4V1DE 1NSNH 1HQRB 3QG7H 1ACYL 4KAQH 4N5ED 5FHBH 3VXOB 3FFCB 5IIEA 4AEHL 3X12B 3EDFA 1YY8B 5I1DA 2YBRB 2GAZA 3TLRA 4TOYL 2WBJD 2Y23A 3MJ9L 1XCQA 3K1KC 3KYKH 5D8JH 2PYEA 4ODTL 5AZEL 5JZ7D 3T65A 1L9NA 4KUCD 3FT3A 4WGWB 4Q0XL 1QSVA 3DURB 1S78C 2EDKA 2YD7A 1QRNB 1EV2E 3HPJB 2M1KA 2XQYG 4JRYB 3CDCA 1QEWA 3QWQB 1ZLVH 4LVOC 1M05B 4PJBA 4OZIF 1EPFA 4XZUA 1A4KA 4NWTL 2GHWB 1CE1H 4LARL 1JHTA 4FRWA 5I76A 3PGFH 2GTWB 4JO1L 4P3WA 3STZA 2AJ3B 1TJGH 2XZCH 4KK5D 3MV9B 3IDMA 5I66B 2XA3A 2DQUH 2EDHA 4OCYL 4NNXB 2XT1B 1FZMB 2I5YH 4U1LB 4WHCA 4EDWL 1S5HA 1G7IB 3DVGB 4M8QA 5KAQF 4NZTL 1G9NH 1AGDB 3PP4L 4LSTL 2VZOA 5L2KE 1IGMH 3FHQA 5HHNA 2G60L 3VD3A 5DUPH 4NWUL 3MRQA 4FFVD 1KPVB 1W72B 1FFPB 4BH8A 2PO6C 4K2UL 3PGFL 3BP5B 1A02N 4D3CH 5ERWB 1NBYA 5J11B 5FYLH 2LTQC 4LSVL 1Z2KA 3S96A 1K4DA 5IFHH 3W5MA 5CIPH 5I1CH 3GBML 1QFOA 4KK9C 3RUGE 1BGXL 1ZHKA 2FWOA 4OZGF 1BHGA 5I1JL 2EEBA 1M7DB 3OB0H 3PWPD 2DQGH 2HLAA 5MEQA 1I7ZB 4KI5E 4H1LB 4MYWB 4FXGA 1CF8H 3VFNB 4XPGH 3IJHB 1J88A 1CS6A 1L7TH 3FQTB 1DLHA 4HWUA 1N7MH 4M7KL 5DSCA 3S4SB 2LFGA 3AY4C 1GGIH 2C1PA 3DLQR 3DVNA 1SJHA 3MRFB 4OSUL 4Z78A 4LGSB 1SYSA 2VDOL 1GYAA 4MZ3A 2XTJC 1EBAA 2OL3H 4LLWB 1ZEAL 2VJXA 5A43C 2FX9L 1WF5A 1ZV5A 5A40E 4YO0B 4HKXB 4JQVC 3C6SA 3MGAA 3VRJB 2G75A 1H3PL 1MAML 1UM5L 4JDZB 4C57C 1D5ZA 5I30L 1T2QH 4Z7WB 3RZCC 1J8HB 4JVUA 1T5XB 1I1AA 1GGTA 3BKCL 2AI0L 2BSSA 4XGZA 2MHAA 1G7JA 3D9AL 2DBLL 3MXWH 4LCIL 3QQ4A 3O6MH 4PYGA 1FL5A 4MNGE 5C0AB 3K4AA 2D7OA 3BUYA 3WNMA 2Q76B 2VLJD 2XIDA 3BVNA 3HR5B 3I84A 4XPTL 3MV9E 1YNKL 5AUMA 2AGJL 3MA7A 1EO5A 3I6KB 5HHQB 3GJFA 3MFFA 2NXYC 4HHAB 1R5WA 4LHJB 4Q0XH 3WHXB 4J1UA 1OAQL 3P4NB 3QCUL 3UTSD 3TNNA 3RWHA 1OGAA 1IC7H 3O2VH 1SBSL 4U1LA 1UWXH 3C2AH 2PNDA 3JVGC 5T3XL 5DQJB 4ZO8A 3VE0B 4XP5L 3W5NA 5L0QC 4DW2H 2W91A 5CJOL 3NZ8B 1IGJB 4OGAC 4ZOBA 3VFMA 1G7PA 3MUY1 4DCQB 4G3YH 5T3ZE 4OCLC 5IB5A 2BOCA 5HHOB 1YC8A 3B3IB 4HFWA 1ZMYA 3MUGA 4P3CL 1FYTD 2H6PA 2C3HA 3LPGA 5DQ9A 3CSGA 5IWLA 4PD4K 3MLRL 3MV8B 2YN5A 4XMLL 3EYVB 4F57H 2EYTB 4ZAKB 1PEWA 4BZ2L 1IFHL 4MJIB 2DQDL 4YGAB 5IBLC 4QRTA 3P4LA 1MCBA 1MFBL 5CKGA 4N90E 1DN2A 5JHDE 3TBYA 2LE9A 2NY1D 3MUJA 4LQFL 4WI3A 1H8NA 1R5WB 2CRYA 2FSEB 5LQBH 3P4MA 2VDNL 4HJ0C 5FYJE 1S9KC 12E8H 3H9HB 5KJRL 5JW5A 2P7TA 1U3ZA 1RU9H 4JAMA 2VXQL 5IQ9A 1KEGL 1U3JA 3ULSB 4L3ED 5ID1B 4EN3B 1INDL 5F89A 2VNCA 1ZT4A 4ELMF 4BSVB 1BJ1J 3D48R 1I75A 3B9KC 4ERSL 3ARWA 3BYTA 5IM7A 3ZE0F 4LF3B 1IAIL 5I74B 4HWBL 4FQXD 5L88L 1ORQB 1NUDA 4PJHB 1DJSA 4PJ5A 4P3DB 5JOFB 3T08A 4DJMA 5ISZE 4B53A 1EAPB 4L8SB 2H2SD 3IRPX 4HQQL 4XNZC 3QDMD 1AKJB 2VDKH 3V0WH 2AJVL 1AGEA 1QLEL 3IFPB 1XR9B 1UB5A 4Y2DA 3V6OE 4YHZH 2EDLA 2GI7A 5HYIA 2C3VA 1NCTA 1YEEL 3DGGA 4OLVL 3CU7A 3EDEA 3OAZH 4HIHB 1C5DA 2FD6H 3ULVH 4M7LT 1B3JA 2FATH 3SKMB 1OL0A 5EUOA 3BWAA 3QXDB 3QWOA 5HHOE 3IJYA 4IRJC 1IC1A 3QA3B 1XIWD 3RGVA 3OF6D 4JFQB 4MVBC 4DQOL 1S3KL 4BA8A 4WFFE 5JTWA 2NXYB 4Q6IB 3OGOE 4KZDL 1I9JL 4OZGA 5D2NA 4JRXE 1FVDB 1SBSH 4ZFZB 4XCYB 2A74B 4BELD 3BKYH 2O5ZL 4Z8FH 5HXMA 4PG9A 4DGYL 2GK0A 4KI5F 3MLXL 4TPRL 3OX8B 2HH0L 3EJZD 3UJTH 1MCIA 2J7LA 1JZ4A 2O5YL 4EOWH 1QYGH 4G42B 5JXAL 3S35H 2ICWB 1N59A 1ZHLA 1T83A 1JPGB 3DX7B 4PRHA 5HGBA 3JWDC 4HH8A 1ADQH 4XT1C 1DBJH 4Y16B 1S7XA 2IADB 1CICA 4OFVA 5GS1A 1R0AL 2PR4H 1AKJA 5GS0D 1BD2B 1YY9C 1EHNA 1TCRA 1E4XI 4GRLA 1JMXA 1IEAA 4LASH 4LSRL 4PRHB 5HGBB 4H0HB 1MIEH 4EI5B 4JGUA 2ARJQ 5LQBL 3AXLB 2ATPB 2W07A 4JFOA 5SV4A 4XRCA 5I1HL 1L4IA 4N0CD 1AE6L 5ESQB 1J87A 4U33A 5EZJA 5GGUB 3RWGB 5C0EA 1RSFA 3BKMH 4KQ4H 1X7QB 4RFNC 5EC2A 5IBUG 4CADB 2I26N 3OPZL 4FFYH 4U1GC 3LHPH 2A9NH 1KB5A 3HHRB 4YZFF 4YXKH 4LFHG 2UVFA 1RZ7L 2A1WH 1BFSA 5HVFB 4LRNL 1EEQA 2ZJSL 1W8NA 1AD0A 4UINL 5D1XB 3ZO0A 2CIIB 2K7QA 3WUZA 2ICES 5I1JH 1CDIA 5EOTB 4TYUA 2CO6B 1UACH 1SMOA 3ME0A 3HKFA 4Y2DB 4EBQL 1W0VB 2IBGA 3VXSD 3ZKMC 1BZ9B 2PW1B 4PJCF 1B0GB 1OLZA 1MVUA 3E1F1 3NIDF 1PFCA 5DLML 3KPQA 3B5GA 5DFTA 5K9OB 4DVBA 3DI2B 2C7UA 4KROB 3QEGL 5C6TL 4WFEE 3TWCL 5MP6H 1GPOL 2UWEF 3BGFC 1OP5K 4YDIH 1N6QH 2CKBB 4EBQH 3WSQH 5LBSH 5DRZA 2IJ0C 5T1KA 2JLLA 1F3JB 4Y2DD 3O8XB 5A2FA 2VZ1A 3O6FB 4KJPC 4U1HA 2CRMA 1RJLB 3FN3A 5IHZB 5TE6L 5EC1B 3C87A 1BLNB 1L9MA 1JCKA 2X4QB 4BUGA 4M5ZL 3DIFB 5D2LA 2DN7A 2E7HA 4HS8H 4QTIH 3MLSL 4OKDA 2MFNA 4LCWA 2B1HH 2IANB 5ICYA 5E24E 5D1ZC 3UTOA 1IGML 1Q9KA 4YBQD 2PF6A 3A6OA 4Y4FA 4PJGA 3DMMB 1AE6H 3FRUA 5C0BD 5F7YC 4PRDB 2IAMD 3S5LB 2B8OT 4XBGB 3BESR 3KYKL 5D8JL 3H9SD 2GK2A 3C5SA 5HSFA 3UTZA 1MREL 1JHKL 1SVZA 2WBKA 3G5ZA 5IHLB 3OJDB 2Z31C 4PJ8D 5D6CA 3BEWA 3ULUL 1UADC 3I6GB 4ZNEE 5INCB 4R9HA 1WEJL 1Q38A 4RAUA 2DYPB 5GGVL 5IVXF 1ZA6A 3Q5OA 3DRQB 4A6YL 1MUJB 1UH2A 1KNOA 1TPXC 1F3DJ 1T4KB 4JHWH 4XC1L 2V2XB 4Z0XA 4AMKH 5I16B 3MV8D 1RZIB 5EU6E 5FECA 4HXBH 1NCUA 1YEJL 4NSKB 4LEOA 4HK3N 4GH7B 3VH8G 4AENB 5J13C 5DHVA 3WFEH 3HI1A 3HZVA 3DO7A 4NZUL 3DURA 4EQ3A 3ULUH 4V1DB 4NPYB 3MRKB 5GRUH 1CN4A 2XA8H 3PGDB 3BN3B 4Y1AA 4APQD 4JPKH 4L1HA 3H3BC 4LEOB 4YPGA 3AAZA 1A64A 4LIQE 4XBPA 1JNNH 1KF9B 1P7QB 3D1MC 4PY7B 5HDQL 3GUTA 4OZIB 2HTLC 3RNQA 1GZQB 3LEVH 5MEOA 1XF5A 1V7ML 4L29B 1NDMB 1HK6A 2W92A 4AENA 5CEZD 2Z4QB 3NAAH 4I0CC 4X9GA 1MHPH 4NQDB 3ZKND 1A6ZB 3PQYB 3JTTB 3T4YB 5GRXG 4G7YL 1WZMA 1TJHL 3EJYD 2FECI 4U1SB 2R8SL 2H26A 3JTSA 2KH2B 3V0VB 3JZ7A 3CVIL 2PW2A 2O5XL 4D0DA 4FFZL 3K0WA 4NWTH 3S6CA 4QNPF 4U7SA 5K33A 3PWPA 2V5RA 3GSQB 4CMHB 1RZFL 1YYML 1KIPA 2QV2A 2F5BL 5C0DA 1UC6A 3QZWG 1HWHB 3QDME 4GOSA 4U1KA 5GS2H 5DURD 3RY5A 2NY6C 1E4XH 2JF1A 4GBXD 1EVTC 4KKAD 3X3FL 4QOKD 4JN2B 1MHHB 4MAUL 3U48A 2IFFL 5L2KB 2FH8A 3B2UC 3I2CH 1WZ1L 3TV3L 2MCPH 5EBLB 5DT1L 2QSVA 4JFFB 5E4IA 5JUEL 1W0WA 1K6QL 1A1MA 5I76B 1FVEA 1OPGH 2FGWL 4HCRH 5IV2B 3OKLB 2VL5B 4K3EH 4RSVA 3L5WA 5EZIH 25C8H 5E94B 5DJZB 3O6KH 5FO9A 3H42H 2HN7A 1CDCA 4XB8A 3X3GH 2Q8AH 4LBEB 3T0BA 1PG7W 3C8HA 1KC5H 3E6HA 1MPAH 3H8NA 4PJDE 1N6VA 3QUYA 1AXTL 1KCLA 1UXSA 2FZ3B 4S1DD 1A1MB 3M8OH 1FFPA 4BH8B 3EOBA 4PJAE 4PJ8A 3AMLA 1A21A 5C09E 2QR0B 3F7RA 5C0DB 4PJDA 5JR1L 1D9KA 2NXZC 4MDIB 3DECA 5T5FH 1A6VH 4LP5A 1QQDA 3B6SA 5DD5L 3FAXA 3ZSTA 3TT1H 4FTVE 5I66A 2AJYL 1H8SA 4H8WL 1MVFA 4FP8H 3QDGB 4GG8B 4NYLA 1YPZB 1ZLWH 1EJ6A 2BCKB 5FA3B 3KR3H 2RAMA 4M9OA 3CFDB 2ZCHH 3MRQB 2AK4D 3CFEA 3QG6A 1A6ZA 1D6VH 4X4MA 3RVUC 1JPSH 3BT2L 3ARZA 2V7HB 4ONOA 1D5IL 3D6GA 1A6VL 4B41A 5DJXB 4PJEE 4DGIL 5CFHA 3M17A 5HHXL 1MFBH 5C0ND 3W81A 3IXAA 1U91B 4JG1H 1S7WA 5INDA 2LAGB 1NMCC 4H5SA 3PWPE 3G04A 2GJZB 2D4FA 4N8CL 4YPJA 3MYJA 3WIFB 1NCCL 1A4KB 3L5HA 1RU9L 4FQQB 1MCWM 3ARFB 5T1LA 1G7PB 2BCKA 3TA3C 2HMID 1A4JA 3QFJA 2AXJA 3MRGA 4KJWD 1HHKA 4JM2A 2CMRH 2ED9A 3MYZA 3HFMH 4PGBA 5C0AD 4KMTL 4FNLH 3FB5A 3ZKSD 2EKSB 1U8MB 2BK8A 3TZVA 1WBXB 2GEEA 5FGBC 2KZ1B 1S7SB 4OSUH 4CMHC 2W9LA 2DDQH 4ZFZA 4JDVB 5F1SA 1FIEA 1VACB 4MNQA 4LEXH 5EZOL 3MJ8B 2GSIB 3THMH 4F7PB 4JFFE 1KJ3L 4OUUB 4HPYH 5EDXA 4LHUG 2BVQA 3DJ9A 2HFFB 2ZSWA 3L3DB 3NFPB 4GAGH 3RKDD 3IFOA 3NCBB 1QLRA 2Q8AL 1PKQE 5GHWH 2ZNWA 4P4KC 2Q76A 1G6RB 3TP4A 5D7SH 1P53A 3SDCD 1AQKL 1JGEA 5BS0B 3DGGB 3W11C 4PGEA 1RURH 3LKNB 3RP1A 1DBKH 3RWIB 4GG6F 3OWEA 1TQCB 1CDBA 2FB4L 4YDVA 2HLFD 2APBA 3LMJL 3QFDA 4UUJA 5HGGS 4P2OC 2BFVL 4HCRA 3C60C 4X6DE 2VUOA 3FB6A 5EUKB 1OAQH 4YZFE 4U3XA 5CSZA 4KUZH 4NDMB 3RGVD 3ZSSA 5HD8D 1ZOXA 5J1AA 4XVJL 1UYWH 1DBML 3NACH 3SE3A 1LNUB 4RGOL 1I7TB 1OHQA 1YDPA 2YA2A 4ODVH 5T3ZD 3L7EB 1BOYA 4IRJB 4Q7DA 8FABA 3VRIA 1I3GH 4ODSL 5D1QB 3IU3A 1OAUH 1OAYH 3VGBA 2CKBH 4FTVB 5D93C 5KSBE 5HI3D 4D9QE 4OCXH 5K9KB 1MNUH 2VC2H 3L3HB 1ED3B 4HT1L 1A7NL 2E7CA 3FTGA 4V2CB 3LOWA 2VLKB 3C9NA 4BSJA 5EU6A 3RPIB 3V95A 1DVFD 1LE9B 2B5IB 4OIIL 1GSMA 3BYYA 5F1NB 3SGDH 4ZUUA 3U7WL 3GBMH 2CLZA 4K71B 4ELKB 1CICD 3IGAA 5DD0H 3G9VA 5HYQA 5F7DA 1YN7A 4ZYKB 5T3XE 5D96B 3RWJB 4GW4A 4GRMA 1WEJH 5HYEA 1JWUA 3FQXA 2HP4A 1H15B 1WBYA 2AV7A 2Q1EA 5JPNB 1Q9OB 3WFBH 2PTTB 3PJSB 3C5JB 4OD3H 2RCSH 1NGPL 2H8PB 2HRLA 5D1XD 4MD0B 3BPNB 3EYUL 5DD0L 4WO4C 2R0LL 2JCCF 1P1ZB 5IEHB 4UV4H 3SE4A 4H88H 3QFJD 5FKPB 4EI5A 4NQVB 5HI4D 1EIBA 1NCDL 3L95B 4H20L 3MODH 3WLBA 3O3DB 2W9EH 2B20A 1Q94A 2Y6SC 4P4KB 1DZBA 3GIZH 1BREA 1M6OA 3BZEA 1T83C 1BD2E 4HIEA 4N8VG 3K81A 1AQDA 4JZJC 5IEHA 4YIQB 5EU3B 3L3KB 4I0PA 4MCZB 4CVXB 2NXYD 4RISL 5I1GL 4X6DB 1W0YT 1GGUA 2OL3L 5TJWK 1E4KA 1C12B 1I1CA 4IOSD 4MQ7B 1QA9A 3KGRA 3BH9B 3LD8B 2HKHH 3QR2A 2C5DC 4YJZL 4P5MB 5GRUL 1BQLH 1IM9B 2BVPB 2QADD 5GJTL 4P2RB 1URLA 1TJGL 1Q72L 4X6CB 1P7HL 2X89A 5IK3A 3N9GH 3W39B 3QXAA 5IMMB 2J8UB 5T1KD 3IJYB 1U8HA 4KVNL 5GIRA 1BJMA 4YHML 1JGLL 3DIFA 5KSVB 5DRWA 3U0PA 3Q5YA 4HFUH 1A3RH 1CL7I 1BIIA 3CUPA 2IALB 4EJ1C 4J8RB 4QF1B 1IAKB 3BQUC 2QKIA 1Z3GL 5F72S 5D7LB 4CW1A 3R0MA 5EULV 5F3BB 1MNUL 4ZFFA 1FN4B 3LQZB 1FL6A 5DXWA 3TIEB 3OPZH 5IVZA 5C0BE 1OAUL 1OAYL 3BRDA 1UXWB 3OQ3B 4X0KA 5DUPL 3DX8A 4PJ5B 3GIVA 4LCYA 3P9LA 3LPWA 3TNMA 4X98B 4Y16C 1GIGL 4LLQA 1WFNA 3JV5A 5IB1B 5ICZB 2D7TL 3QFDB 5T1DH