4RMWA

Crystal structure of the d76a beta-2 microglobulin mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKAEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title Conformational dynamics in crystals reveal the molecular bases for D76N beta-2 microglobulin aggregation propensity.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmwA00
3GDBA 1BREA 2VXQH 4K9EC 1RULH 4WIQA 3O6FC 3W5NA 5IJKC 3NA9L 4LLVA 4RDQF 5F1OB 4L9DA 4JDVB 4ZPTB 3LKQA 1FH5L 3O3EA 3QG6A 3M8OH 3LD8B 4ODHL 2H1PH 3C08H 2VLRA 4XCCH 1KPRA 1T20B 1DQJA 5T1MA 2N56A 3SDYH 5EU6A 2C5DC 1DVFA 3A6OA 3FQXB 4ZS6C 4OIIH 1Z5LA 4ZNEE 1KIPB 5IP4A 4GBXD 1MAJA 5ACZB 5D5MB 1BZ7B 1CDGA 2NW2A 5MEQB 3HC0A 1MHEB 2CR6A 2D7MA 2J4WH 1S7VA 2C3WA 1K5NB 1K6QH 5FHAH 1E4WH 4X4ME 1F11A 5GZOC 3GHBL 5IESL 1RK1A 4HGMA 3VDBA 4LAQH 4NNYA 4U6TA 2X4TA 4MQXC 3U9PH 4C4KT 4ZG1A 1AD9A 3TJHD 4NO0B 1MCDA 1ONQB 4JM2D 3T65B 3BQUB 5I66B 1MEXL 1P4LB 4HC1H 3P9MA 5CBEB 2V17H 3IGAA 5HGDB 3VFGH 4GW4B 5GGUB 4G8FA 4FMFA 4LSRH 3WXVH 1EHXA 1BFVL 3OKOB 2ADGA 4LQFL 2X1QA 1MWAB 5JHDA 1TZGH 3BVNA 4L8BB 2X4UA 1GPOH 2R56L 4QHNA 4WWID 4P59L 4P9HH 1FFQA 2BHZA 3RIAF 2LAAA 5EO0A 4O5LH 4G3YH 4HH9A 3CD4A 5E6IA 3UPRB 5D1XB 4WW1B 4HLJA 4M6ML 5IGXL 2VQTA 4KTDH 3MV8A 5KS9E 2ICES 2XPGA 3D25A 2AK4E 3S37L 3VU2A 3I84A 2DQGL 3QHFH 4FRWA 3BPCA 3MQIA 5ALBH 5TE6H 5IB1A 2J88H 3GBNH 2F5BH 1EEQA 3M1BB 5HHMD 5I1KH 1CFQA 2R23A 4X7SL 1HQRA 3QEUB 5FYLD 4YIQA 4NP4H 5ALCH 1PKQB 1H5BA 4X6EB 4OCRL 3DETD 3A0OA 4NZUH 3H3PH 4UTBH 4LLUB 3F8UB 1T22A 3C5ZD 1SJHA 3MV7B 3BKJL 1BD2D 2OCFD 2HH0H 1X5FA 5JW3H 2YWZA 4HXAL 3THMH 1TTFA 5HGAA 1JGDB 4O9HH 3LCYA 4LCCB 4LLYA 4TPRL 8FABB 4OZFA 3SOBH 5BXFA 4Y4KC 3VI3F 4HKZB 3TVMD 4KROB 5T1DH 4FQPA 2DBLL 1KPUA 4IRJC 4X80H 1VENA 3AU1A 2C1OA 4A6YL 4XHQA 3GKWH 4G8GD 3UC0H 3RIAK 2DQHH 4MNGB 1J88A 1HHGA 1CG9A 5I9QB 4F8TA 4OF8A 2MQ3A 3IDYC 4FFZL 4KVCL 4R4FH 4Q74A 3W0WD 3V7MA 1A6TA 3WN5B 3LQAH 1JRHI 2V2XA 4PTTA 4PLJC 1BIHA 1G9NH 4ODTL 5IROC 3VWKA 3CLEH 4LLAA 1CLOH 5FO8A 4OLVH 5HVHB 2H32H 2VL4A 3K74B 1GAFL 4ODXB 5ERWA 2HFGL 5I6XC 5IMLA 4RGND 1IZJA 4YC2B 5IEHB 4DN4H 1DBBH 1XR8A 3PWJA 5C07A 4UOW1 4F2MA 5D71L 5SWZB 4ZUUB 5E4IA 3C87A 4HF5H 5HBBA 4WV1B 4WUKH 1VFAB 3VXMB 2Y06H 5CIPA 1Q0XH 5GISH 3O8XB 2YPLA 1RK0B 1NGXA 3RGVD 4P2RB 3SE4C 3B83A 2E7MA 4X99A 2Q86B 4JHAL 1NGPH 2BRRL 1Z0MA 1NLBL 2AEPL 1YQVL 2O5YL 4TVSa 2Q7YB 4PJBF 3JWOL 3FB5A 1EHAA 3IT8D 5E1AB 1U8IA 5CJ8A 3B5HA 3FOMA 3TJHC 1KJMA 2V5SA 3RDTD 1YA5A 4TSCL 4TUJB 1CE6A 1E4KA 1GJIA 5B21A 4G80B 4KZEL 3TZVD 3MUHL 4NPYB 4D94A 2OYPA 3RX5A 1NL0H 1B0WA 1MJ7H 5FEBA 4MJIE 2ADIA 4PLNC 1BJ1J 4L3CA 5DD6A 2BMKA 5AG9A 1G84A 2WWMC 3B8SA 5E5UB 1PYWB 3KPSB 1FVDA 3BZ4A 4KJPC 4S1DD 3O2WH 5IKCA 3IAQA 3D69B 5DRZB 3TCLB 4FXLA 4KQ4L 4X8XA 1FORL 3P2TA 1LEIB 1G0YR 2ICWA 5J1AB 1QG3A 3DPBA 4HAGA 4X7TA 5IHZA 1U6AH 2FIKA 4QRPB 4UQ2B 1FDLH 2BNRB 3BT2L 5I1IL 1DQDL 3MODH 4ELME 1IC4L 4RFEB 1JF1A 5F3HA 2M26A 1SVCP 5HHOB 3WO4B 5F7HA 2JJWA 1S9KC 3PQYA 4NN5B 1LE5A 4FNLL 5E08H 1G7JA 3TYGL 2CIKA 5SV3A 3MSPA 4X5LA 3K1KC 4YBLB 2VLKA 3KR3H 4ODBD 3E2HC 4PRPB 2Z31B 4QHKJ 3RIFF 2CUMA 1FBIH 4OD1H 4P2QD 3TIDB 3Q3GB 1YYLL 4H88L 3RVXD 2KZWA 2G2RB 3TVMC 1RUKL 4PBXA 1DSFL 4CDGC 4LSTL 3S6CA 3BH8A 4J3XA 1CFSA 4GSDL 3OG4B 3AY4C 4Z76B 3TWCL 3G6DL 1NJ9B 5EG6C 1A9BA 5AD0A 5FK9A 5INDB 4XH2B 3GI9H 1VA9A 1JPTH 4MXWH 2K7PA 1ZKAA 2IH1A 3WFHB 4PFEA 4Z7UF 3AAZA 1MFBL 4ZAKB 3VXPB 5L8LB 1LP9A 5H37H 5D7LB 3ZKSD 3K81A 4WEBH 2MMXA 3GI8L 3X3FH 5I1LA 1SMOA 1D6EA 1UADC 4LPVA 1OAKH 1M6OA 1XIWA 3DOSA 1V7ML 5DJDB 4Y1AB 3QDMD 4WFHE 3V6OE 1QPPA 2XWBA 1E28B 4PGEB 1KLGB 4LPWA 2QJDA 1B9ZA 4YHNB 5J12B 4L9LB 4NZTL 3MREA 4AMKH 3MUGA 3GSWA 5DJ0A 2DJSA 1MRFH 3RIFK 2XKNA 1WQVT 1KT2A 4XAWH 1MCOH 4Q7DA 3UTSA 3RGVC 4PR5A 2ZUQC 1I7ZA 1KELL 3A6BH 3VXRA 1IQDA 2QL1A 3ZKMD 2GFBB 1VHPA 5C0GB 3ULVF 1JV5A 4XAKE 4K2UL 5H2BB 3QDJD 3RPIB 1DJSA 3TA3D 43CAA 5GS1C 1A7NH 2CLRA 4GMTL 1G7MA 2Y5TB 2VMFA 1IC7H 5E2VH 1YEDA 1HSAB 1QSEB 7FABL 5I74B 5SWSA 1NGZB 3S4SG 3TZVC 5BV7B 1D5ZB 5KZCD 1HQ4B 4RGMC 5HDLA 1TQBC 3QFDA 1YJDL 2CSPA 4OLEA 5IG7B 4OLZL 5B39B 1YECL 5I8KL 5SWQA 2UYLB 1CDJA 3TBYA 3U0TA 5DMIL 4R0LA 1Z0NA 3KS0H 1EX0A 2QHRH 5K9QI 1ZHKB 5FIEA 5TQ0L 1FNSL 1F6AB 4ZPVB 4GKOA 4LVNC 4XXCC 2IBZY 2BSED 5HGBB 15C8H 2YZ1A 2RCSL 4BFBD 1JUFB 1JGVH 4XPFH 1MCFA 2ORBH 4G6JL 5EWIH 4WY7H 4MZ2A 4OZ4B 3R8QA 1S9WB 4NZRH 3E6HA 4I18B 3FQNA 1UCBL 3QEQD 1L0XA 4DEPB 4JO1L 4LLMA 2A1WH 1DEEA 1I1YA 1J1PH 3V2AR 3CVIL 4I0PC 3T2OA 3BWAB 4FXKA 2DJUA 2JJTC 1XGYH 2R29H 2DKSA 1SYSB 5FYLH 5E4EC 1BWWA 3S36L 4O4YL 3O3BA 1SJXA 3UZVB 1J0ZA 2X4NB 4U1IA 2W9LA 2DLHA 3Q1SL 4Z77B 5BRZA 5E99L 3D9AL 3X14B 3QIUD 1QYGH 3KAAA 2RIKA 4PJEE 3H3BC 2F54A 5CHNA 5EC1A 1GYAA 3MJ9H 2DQEL 4M8VA 1K4DB 3BGFC 4FABH 3QFJD 1F3DJ 1J05A 5D1QD 1O7SA 5CZXC 4Y4HD 3OL2A 2Z8VC 5DJCA 2ZKHL 3IDIA 3DXAD 1TQCB 3CZFB 4RFNB 1WIOA 1U3YA 3T2NL 1FC2D 3D18A 1CF8L 5BOPA 1FO0B 4Y2DB 1M1SA 2FJFB 3HZMB 1N4XL 4NQCB 1TJHH 3NBNA 3ZTNL 1ZLUK 2EDLA 1QO3B 3FT2A 3VG0L 5I17B 2XQBH 4I1NB 1XR9B 2IF7A 4L1HA 4JFOA 1HCVA 3NOIA 3S34H 4CNIB 2R2EA 3IFNL 3N1GC 5E5MA 1AJ7H 3DBXB 3QH3A 4YUEL 4LVOC 4WNQA 5F7UA 4QRRB 4U1JA 4R3SA 5EBMA 3D87B 3ZKMC 4MJ6B 2NX5B 4X6FB 1MLCB 4Y5XC 5J8OA 4JFFB 4PJFE 1G7HB 2NXYD 5ICZA 3DUUB 5CEYB 4HSQA 1R3HA 1PEZA 5GGRB 1WWAX 5DYOB 3H9YA 1A8JH 1I8KA 1WITA 5ICXB 5D1ZD 3Q2CA 3AREB 1BECA 1R3LA 3QUYB 1H3VA 1KB5H 1C12B 4DN3H 1ZGLA 4WTZA 2HVJB 3LOWA 3JSSA 3O4LD 2HLFD 3VE0B 3VWJA 1FRGH 5I71C 1S5HA 5IOPA 4OCSH 2AJSH 8CGTA 4G5ZL 4ELKA 2CKBB 1Y0LB 3WUWG 4K71C 3DNKA 2EIZA 5EBWB 2AV7A 3H7BA 5EU7C 2GCYB 1Q9WA 1VADB 2Z91A 3ES6A 5D4QA 1F8TH 5LBSH 1A4JA 4WI5A 3SO3C 3JWDH 4U6HA 1Z9OA 5L88L 3AC0A 3V0VB 1D5IL 3PJSA 5DRXB 5TH2A 4JPIB 4OUUB 1T2JA 3R06A 3ZL4L 1EJ6A 4TUKH 4PJBB 1ITCA 1P1ZB 2CXGA 2PETA 4WWKD 2FD6L 2R69H 3F5WA 3VXSD 5DQ9A 5IF0A 3V4UL 2X09A 1MAKA 2B5IB 5C0JB 1KCSL 3OJMB 1H3PH 4HJ0D 1WC7B 1A6VL 5MP6H 4PBVC 3EO1A 5TDNB 3CPLA 1MI5A 3CAFA 4G6AD 3TH3T 5C0AA 4MNQD 3QIUC 3FFDB 1KCVL 3O9WB 1L6XA 1N5YH 1W72L 3AMKA 3ARYA 4F9LA 3GJFH 4YXKH 2IGFH 3VFUB 4H25A 3W5MA 2V9RA 2QSCH 3FN0L 1AR1C 1OTSD 4POZD 2P8LB 4OQTH 4G43A 2UVEA 1CT8B 4OD2B 4NM4L 1YZZA 2VERN 4Y5YA 4PJDB 2X1XR 5TE7L 4PG9B 5HHNA 5D72L 3BPOB 1AE6L 1IARB 4RBPK 4BZ1H 4S1SL 4Y89A 1UM4L 3VRLE 5KSAA 5F7EH 3QZWB 4GKZA 5TFSH 1CGVA 4X5WA 4FZ8H 1JWMA 3EO9H 4WI7A 3UTPE 3ULSB 3FL7A 3RWEB 1RUQL 4X4XB 3G6JE 1E6OH 3OAYK 4KUCF 3ECBA 1I7TA 4ONHA 2XTJB 5GRWA 4K3GA 4UT6H 2OQJB 1I8IA 3DSFL 4ETYA 3L5IA 3GMPB 3P4NA 3V5KA 4D8PA 1KCUH 3G04A 3DLQR 4NSKB 3MGOA 5D7IE 2ESVA 1OP3K 1TVDA 3N50A 4NJAL 1QKZL 4PJ9D 4LLQB 3SE9H 1Q9OB 3CVHH 4KVNL 4HMEA 5D1ZC 3SDXF 4N1EA 3MRGA 3BXNA 5TGBB 1ZLWH 4L8SC 4JFZH 1WBZA 1JGUH 2UZIL 5TDPB 4PJHE 4UNVA 2R1XB 1KTKE 2Z4QA 3ROOA 3BPLB 3P30H 1XAUA 2FO4A 5IV2B 1IEBB 3HN3A 4LPXA 2VLRD 4ZO9A 3UJIL 4HJGA 1VKXA 1J86A 1MPAH 2DYPA 4P5TB 5CD3A 3CIQA 4LCUA 5EU6D 1DVFD 2YD6A 5AYUH 2X1OA 4AEHL 4LRIC 1UVQA 4MVBC 5E00A 3MJ7A 4X98A 3TO4B 5DWUL 5CKAA 3HRZB 4HS6B 1MNUL 5HHVH 4FQXB 4XCYA 3FQTA 3QWOB 4FQCL 4MNHB 4RMVA 1R3KA 1FZMB 4G9FE 5E2TL 4FA8A 4HIIB 5GQBA 1NBVH 3QDHA 1EEYB 3PHOA 4WWKC 1F45A 1G6RA 2NY4D 3ZKND 1A22B 2BVEA 4IRSB 3OG6B 4KPHH 1EGJH 2P24B 3EFDL 2PW2B 4JGUA 2E6JA 2V9TA 3L5WA 3UTZB 1MCWM 3CDGB 3UTTA 3T04D 1OPGL 3GSRA 1KJVA 3C8HA 3MFFA 4GW1B 4TSAH 5GZND 3RP1A 5JHDD 1AD0B 3C5SB 5F93C 1MFDH 2IPKB 2EE9A 3LRSA 1C5DA 4KZDH 5AEAA 4IRZH 4E41E 3SGJC 5E6ID 1S7UA 3MRHB 1XF3A 4OZGA 5DK2A 3SDAC 4WW2C 3MV8D 5DJZA 5FUCC 1OB1A 2EZ0D 3FZUC 4GRMA 4TUOB 1BAFH 3EHBC 1AKJA 4MSWB 1EVUA 3LY6A 2VKWA 3RZCC 1RIUL 3Q5OA 3P4OA 2VH5L 2XWTA 1TETH 1V8HA 1HKLH 2C4FU 1IC5H 2E3VA 4U31A 4IMKC 1ES0B 1X4ZA 4U1SB 3ULUD 4UINL 4ZQKB 4WEMB 5KS9F 2R0ZL 2VXUH 3LKNB 2BVPB 5DJAB 3RTQB 1S9YB 4DTGL 3SO5A 5HGGS 1FZJB 4LVHB 3D48R 1WZMA 3LHPL 1ZT1B 3RQ3A 3VGHA 1E4JA 5I0DA 3WNOA 2R8SH 2XG4A 1ORQB 3S96A 4NN7C 5FOBA 1F4XL 3V5DA 2DTMH 4XP9H 4PYGA 4EUPH 5C9JA 1IZKA 4Y16A 5ADOL 4QNPE 4DFHA 3MA9H 1B0RB 1WICA 1VERA 4F15B 2VUYA 3VWKD 4U1MB 5DA4A 3H9SA 3MA7B 5IVOA 2A6DA 4H5SA 5C9KA 1CXFA 1KTDA 2W9EL 1G7PA 4HHAB 5D2NB 1RAMA 2CXKA 5C07D 2B4CL 3GSQB 3UROR 1NFDE 2FL5A 2DIJA 2IADB 4ZUWA 2YD3A 4IOIA 2EYRA 1I8LA 1OM3H 2AXHA 3IDXH 2Z35A 3DURB 5HHME 4R7NB 2YPLD 4JRYD 1NC4B 5FYLE 1C08B 3B9DA 4WDIB 5I73B 5A2IH 3VFVA 3W9DA 1OCWH 1NMAL 3KPLB 4V1DA 4OM1H 1QOKA 3ZKNC 3DWTA 3DVNA 1UH2A 3CDYA 4I13B 4PUBL 5HYJA 2HVKA 5JOFA 3BZDA 4RGMB 5IMOA 2EYSA 3V4VL 2KUTA 2CRIA 4JDZB 2DKMA 2VIRB 5DJ2B 3G6AB 1BF8A 3WS3A 3LKOA 5DVLA 4K94L 4P3CH 2WMPA 4G8GE 3MX0A 4G6ML 4HEPG 3UMTA 4Z0BL 4XNYL 4S1RL 3IDJA 1TXKA 2EXWD 3H9HB 4LLDA 4OZHA 5FFLA 5D6CA 2NR6C 3ARQA 3QCVL 4QY8A 1NGQL 3T4YB 4FFYL 5HDQH 3RVVD 2NY3C 2EZ0C 2IEPA 4HKBB 1RQ5A 4LCWE 2DM7A 3MRRA 5FKAB 4U6YB 4RGNE 4K9EL 4TNWF 2AVGA 2R0WL 3WBDA 5M95B 2AEIT 1N6VA 1OTUC 5J13B 1XF1A 2QTEA 4X83A 3PQYD 4XBEH 4ORZC 1AXTH 3NABL 3KPRA 1EZVY 4OFPA 4EVNA 1HH9B 1X5AA 2JJUA 1OW0A 5D2LA 1KC5L 3WIHA 4HUKB 2VLKD 3QT2A 2FCBA 5DUMH 3VFSA 3O0RH 3I6LD 3UPCA 4NKIL 1ZSDA 4F8QA 1UZ6E 4ELMF 5D7KD 2OL3L 4URTB 5B3NA 1I85C 1KNOA 4ORGA 4L8DB 4MQ7B 1EO5A 2EC9U 2NY6B 2CK0H 4OF6A 3VCLA 2VDNL 4AIOA 3IFLL 1DLHA 5IBTL 2DMCA 1TIUA 1JCKA 1YEIL 3S4SB 3TC9A 3O3AA 4UUJA 3ZKQD 1TPXC 3EYOA 3T3PE 2NXZD 2VAAA 2FLBT 5DR5H 2F5AH 1TDQA 3B9KC 2GAZB 1FFNB 3K46A 1I9JH 2GY7B 2XTLA 4HBCL 4KMQA 2J5LC 3U7WH 5EUKA 5LWYH 3FCTB 5ENWB 1QR1A 3IJYA 4IHOA 1YEJH 2FX7L 3ARDC 1MHPH 3QO0B 5DEFB 2IH3B 5HYIA 2C7UB 1Z6JT 5HHXL 1XIWD 1UZ8A 2AABH 4WENB 5FO7B 1U0QA 3LKRA 4LIQE 3ZZ1A 1DZBA 1FZKB 3UYPA 2WBJA 4YK4B 1YEHL 4XP1L 1ZANH 1T5XB 1J0HA 2GT9B 3SKJL 1HDMA 3UTSD 1J1OL 2D03H 4OLWL 5F96H 2E9BA 1RMFL 2HA1A 4N0RA 3VXRD 1OAZH 4HUVB 1A7RL 2EH8H 2GY5A 5HHQB 4P2OB 4L3AA 2YEZB 4M8QB 1TCRB 1I7RB 4P2QE 3S5LA 4KDVA 4IIQB 5E8PA 1E4KC 2X5PA 3SDXB 5SWSD 2A73A 4P4RB 4M6AA 2I9LA 1UYWL 4KI5C 2IPTL 2YN3A 2PTVA 2DQJH 1HWGB 3LEVH 2X4SA 2HFFA 4AIZB 2BVOB 2OI9B 2O5XL 1VEMA 2Y36H 4EXPX 1P7KA 1MVUB 4WI4A 4XMKL 3O6LH 3PHSA 1S7RB 3REVA 1TZHB 3T0EB 4HDIA 1HIML 4PRDA 5DRNB 2D7NA 3D1MC 1JN6B 1MJ8L 1NDMA 3VXOA 5BS0A 1U3JA 2R4SH 5JQ6L 2VZOA 3LQZA 5KW9H 4WI6A 2YUXA 3VXTA 1CD1A 5L7XH 3R8BB 4FQHB 2Q8BH 1NEZG 3QDME 2GK2A 5L6YH 5MERA 2OZ4L 4OAWB 5IQ7L 1G6VK 4XCEA 2QSVA 3CLFH 2F8VA 3VW3L 1W0VB 3CSYA 2R1WA 3AB0C 5H35A 3OKMA 3S35H 1CS6A 3DGGB 2Z93B 1UWXK 3TNMA 3U36B 3P11H 1JTTA 5ANMA 2R4RL 4LCIL 5I1DB 1N2RA 4JO4H 5BO1L 2P8PA 4NO3A 1KBGH 1GGIL 4H8WC 4DKFL 3U7AA 3I2CL 4F7TA 1E27B 2LVEA 3CGTA 4YZFE 2R2BA 2NY2C 1OQOA 4RAUB 4WHTB 1S78D 5DQDL 5BRZD 4M61B 4OT1L 3QPQD 1DUZA 4KY1L 3D39A 3MRDA 4HWBA 2CDFA 4RFOH 5CMAA 3VFTA 4Y19E 1S5IL 2VSDA 4HIHB 2X4RA 2DQTL 3KPMB 4HZLB 3TYFB 4CN6A 5F21B 1UKTA 5FYKH 4PJAE 1T7XA 4M6OL 5FGRA 4JFPB 1WFTA 3NCYP 4S1QH 4NQXA 1CICA 3FOLA 4K7PY 3QJHB 4PJEF 1SM3L 4MDIB 2DB8A 4Z7WE 1EAPB 4JFXA 4RNRB 1ZS8A 2FBJL 5GS2D 4MAYB 1Q94A 3EZJB 4H0HB 5KJRH 2GITB 5HSFA 3HNTH 3LS5L 2QKIA 2RFXA 4XPHH 5KS9B 4UNTA 2APVA 2FNBA 4HMDA 2AK4B 1ZWIA 2ADFL 1M7IA 4N0UA 3TNNA 4ERSL 3QEQE 2OK0H 4FTVA 4MDJB 3QXAB 4I0KA 3SPVA 4J6RL 3QXDA 1T04A 2CO6B 3BKML 5F71A 3HPLB 4XHJD 3U1SL 5KOVC 4FN0A 1DR9A 5ITBL 5KSBA 3IJSA 4OF5A 4CMHB 3QA3B 2KZ1B 4N9GA 4U1HB 1NBQA 1RVFH 4GRLD 4JHWL 5CIPH 2N7AA 1T1ZA 3T8XB 5CGMA 5CGTA 4ZTOL 1RZIB 5DVOA 3N85L 3T1FB 3TBSA 5AUMA 4DFIA 2BNQB 5CUSH 4ZFFA 5F44A 2K7QA 5F9JB 4G7VH 5I1CL 4LSUL 2Q7NA 1XGQB 3VH8A 1V7NH 4M1GL 4OF7A 1ZAGA 2I27N 3VWJD 2AERT 1IM3B 4R0LC 5TE4L 4WJ5B 2VR4A 2HMID 3QFJE 5IMKB 1PEWA 1FVCB 3PWNB 3NAAL 3QNYB 4QOKA 5F6HJ 4LEOB 3DXAE 2NY1B 1BFOB 2XY1A 4HFUH 1JI2A 3P9LA 1RZJC 5IB3B 5SV4A 3CUPA 4JPKL 4M02A 5CP3H 2D9CA 4U1NB 4RAHA 1F42A 3DGCR 2PF6A 2R0LL 2EE2A 1F58L 2ICEA 5IM7A 5F1IB 2DM3A 2BOCB 1YY9C 3RRQA 5IR1A 5DVKA 2MPAL 4OGXL 2DWDB 4W4OC 3FRPG 2YN5A 4XNQB 3BDYH 2CRMA 2OJZL 5CD5C 5F7YC 2OTUB 2DQCH 5JPMA 3PL6B 5JIHA 4G6KH 4M03A 4D3CL 3G5YB 4YO0B 3EJJX 4PGDB 3GSNB 2VXTH 1XCTB 2ZUSA 2H26A 2HJKA 2YBRA 5J11C 1A1OA 1MI5D 4PREB 4YDVA 1JPGA 1YEKH 4ZUVB 5C0AD 3FMGH 3PGFH 4QRQA 4DZ8A 2DQDH 4BSJA 2X4QB 2GYSA 2UY7A 1KGCD 1LNUA 4ZFOB 1N0XH 5HTSA 1UM6L 2CLZB 2WSKA 1O5DT 4Y2OA 3JTTA 3PABB 4D9RE 3RU8L 5CCKL 4N8CH 3O4LE 4MJIB 3MLZH 4LSPH 2ITCA 3QUKB 5F7LB 4ZMAT 1O7VA 3QUZA 9CGTA 1H15B 4YFEA 1BBJA 3WKMH 2EEDA 4GRWH 3NFSH 5AG8A 1K3IA 5KSAD 2VB5A 1K8DB 4PJGA 5EU5B 3B5TA 5E8OA 1FLRH 3UO1H 5FB8A 4E42B 4P9MH 2FGWL 4YWGH 1BVLA 1N6QL 4LIQL 2HTLD 3VFNA 5EZJA 2IFFH 4ELMB 4BZYA 3O45A 4N0FA 4XHJC 3VRLF 2A6JB 1FNEA 4PB0L 4MA7L 1T03H 3ARFB 4RMTA 3MRLA 2AEQL 5I1JL 5TF1L 1ZVSA 3VXSE 2ESVD 2W65A 1C1EH 2AK1L 4YHLL 1N7MH 3G6JF 4HK3N 1WISA 2X4OA 3R1GH 1LVEA 1HI6B 5B38A 1VDGA 3KLHD 1PBYA 4NWUL 4JQVA 4TQEH 4XVTL 4Z78B 4MQTB 4PGCA 4MNQE 4YHYB 3ZE1E 4AL8H 3LV3A 3X3GL 1AY1L 4AQ1B 2BNUA 3IU3A 1FJ1B 5I2IA 5D7IF 1NDGA 1ZVYA 3QNXA 2VL5B 1MCWW 1SBSH 1MH5B 2I07A 4JHBA 4X7DC 1YNLL 2HJFB 2HP4A 3JV6B 4GAJL 2DYPD 3D2UB 4PJXA 2APWA 4F7EA 1Z9LA 2Y4SA 3SDCD 5MENA 4PP1D 3MCKB 1HSBB 4PJHF 3BAEL 3KHQA 2WUBH 4PGZA 5D6DA 3SGKC 4JO3L 5ACMA 5DD0H 3IU4H 3O11A 1AO7E 3PWUB 4LEXH 3ZHDA 3F62A 1CGXA 5IFJA 4PJ8B 3RL1A 4C56D 1JNHA 4DCQB 1S8DA 4R97B 1KIQA 5T1KA 3NZ8B 4JR9H 4XC3H 3S97C 3F12A 2OP4H 1DP0A 1UB6A 3GMNA 5IW6B 1JYWA 5C0RL 2GTWB 3TCXA 4D0BB 1FNGA 3DUSA 5FKPB 3UTTD 1EO8L 2D9QB 3HHRB 2H3NA 1LILA 1HEZA 3L3KB 1K4CB 4JAMA 4R4NC 2A6IB 3VA2C 2FRGP 2GSGA 3IDNA 3QUMH 4FQ1L 4OLXH 2VDRL 1GL4B 1S9VA 1A3LH 2NY3B 1UQSA 2FBOJ 4OJFH 4R26H 2JIXB 3ZT6A 1D5XA 1H0DB 2A0LC 4UAOC 5EBLB 4HXBL 4JFYB 5EORL 1AKJD 1DBKH 5JPNA 1CU4L 1KJ2L 5IW1A 1NLDH 4NYLA 2IPUG 2G9HB 3KYKH 3CMOH 1KJ3L 3QPXL 1R5IA 4C54A 1CFBA 5CZVH 4LHUA 4XP4H 3P0YH 3IFPA 4QF1A 3GUTB 4XNMB 5EU6E 4F7CB 1MCPL 1CE1H 2ZG1A 3ARBB 3PV7A 1LO2H 5C0BA 1RZKC 3ZE0E 5MEPB 3T0VA 5JMRA 4P5KA 1PGRB 3VFPA 1MRDH 4CMMB 2X10A 3DMMB 4ONGH 1A6ZB 4XGZB 3OJDA 5HYSA 3HE6A 4K8RD 3CCHA 4O2FB 4Z18A 1H3XA 1I9IL 4LBEB 4NGHL 4NQVB 4NQEA 4K3DH 4PJCE 4G8EB 4G9DB 5ITFB 4E0RA 2VDLL 4G7YH 1NCBL 5J0BA 4M9PA 4K7FA 4HKJA 1JWSB 3F7VB 3F58L 1UGNA 5DFWH 2ZCKL 5EH1A 1T0MA 5DQJA 5F3BA 3FO2B 3KLHC 5D7JC 4OD3L 3W9EB 1NAMH 4Y16D 4BQ8A 4UIKL 3FT3A 4JFDA 5KVFL 5AZ2H 3O2DL 4XNXL 5JHDE 5FGSA 4UDTB 4IJ3C 1ADQA 4TOYH 3PG2A 1RUAL 5HGHA 1YDPB 4JM2F 3QEGH 4JZOB 4L3EA 4P3DA 3H9SD 3U7YL 4PJEB 1F4YH 1RZFH 2DLFH 3EYSL 4PYHA 4HG4K 5IK3B 2BSSB 5BZDA 3MV8E 2BVQB 1NCAH 2ZG2A 4AT6A 4QNPF 5FAAA 4YDKL 5C6WH 2DWEA 5ESQA 4I3SH 5EBGA 3MLRL 2FJGA 1JHLL 4EI5B 3WLBA 1U2CA 4APQC 5C08B 3ARRA 5HYFA 6FABH 4F3FA 2HYMA 3KGRA 5IVXA 1RZ8A 1NMCC 3ULUE 3F7PC 3L7EA 2R2CA 4HS3A 4MS8C 4XCFL 3RNKA 3B2VH 3HZKB 1NFDF 2NY7H 5ETUB 5LG1A 5E56A 5T1LA 2P45B 2AI0H 3MRMA 4JLRA 1D9KC 4PRNA 1K9TA 3B9VA 3DJ9A 3SE3A 1JF6A 4ETQA 4DGIL 4PJFB 4YE4H 3E3QE 2RB8A 2ZNXA 1QLEL 3Q6FB 3ET9F 1IQWH 1I3RB 1WBYA 1NCWL 2A2QT 1F02I 1YEEL 4C58B 4EN3A 4JB9L 3I6KA 1HNGA 4YGVB 2PYFB 4PRAB 4P23C 4ZUSB 4DGVH 1IRAY 1EXUB 2MWCA 5F9DC 5I19L 3W2DL 5J06A 3BE1H 1LO4L 5BQ7A 3CX2A 4ZPTA 5GJSL 4X6DA 3AS0A 1RHFA 3KPRD 3VD9A 5IWLA 5F9OH 1BJ8A 1U9KA 4QCIA 1PQZA 5KG9B 2ITDB 1QBLL 5LGJB 3HA0A 4W6XB 1FCGA 4U0QB 1DUYA 4XX1G 1UB5A 3FQXA 4JRYE 2A9NL 5D5MA 5FUOH 1BZ7A 3WD5L 3MGAA 5E2UL 5MEQA 2VXSH 1MHEA 1J1XL 1BX2A 1RY7B 3QJFA 4PG2A 1K5NA 3HRPA 1JGEB 4OM0H 1HWHB 1UZ6F 1CFNB 3MOQA 1ONQA 3V52H 1KIRB 1P2CB 2VC2H 3BQUA 5JW4Q 1RIVL 4GKSB 2QQNL 1FV1B 2YXMA 4OFVA 2G5BA 1TVHB 4BM7A 4GG6F 4A2MA 5D70H 4M6NL 4LASL 4LGSB 4NZJA 4GW4A 1J0JA 3SKMB 5TJWK 3WFBH 2YOCA 4YHML 1YN6B 5FGBC 3DVFA 5I76B 1YC8A 2A9MH 3T3PF 2H32B 1MJJB 3HAEH 4L5FH 3TN0C 3VMPA 5LJYH 4N1CA 1QPXA 5ILTH 3QWRA 2VLLB 3UPRA 2FYYA 5D1XA 4YDLC 2WBJD 4WW1A 1SEQH 3L1OL 1I8LC 1NEZB 4RIRB 5EN2B 4GXVL 5C0CE 2C3GA 1U42A 3PQYE 4J4PA 5C09A 5BCAA 1IEAB 3KJ4C 2DQFA 2QV2A 3MRIB 5GRJH 3M1BA 4LHJB 1OHQA 4BSVB 2VLKE 1FSKC 1ZT7A 4W70A 1HNFA 2IAMC 3QEUA 3FFCA 3I6LE 4OFKA 1PKQA 4KK5C 3MNZB 4LLUA 1KFAH 5D7KE 2XQYK 1F2QA 4HUWB 3MV7A 4WI3A 4H1LH 2CR3A 3S3SA 4O00A 3OKEB 4LCCA 4NHCH 8FABA 3V8OA 1X5GA 5DJYB 4HKZA 2HWZL 4XVUD 4YHOH 4FG6D 4YHIB 3U30C 1KTLA 3V6BR 2M1KA 1AR2A 3C60A 4GRWE 3MYJB 3EGSB 1INDH 2AW2A 4AM0B 4MNGA 2Q20A 1KPVB 1ZHBB 1DBAL 1KYOJ 2R39A 2YKLH 3KYOA 3V8CA 4JFEE 3VRIB 4CW1A 3WN5A 4PJHB 1NSNL 3BX7C 5GSRA 1A3RL 2OBGA 1AXIB 3HLAA 4OCXH 3RY5A 4LFHD 1TJGH 5KAQG 2ZWLT 4NO2B 1JE6A 2XRAL 3BOVA 2HRPL 3MLVH 5EOCH 1KTRL 5FCUH 3SQBA 2CJUH 3LMJH 1OW0C 3NGBC 3GSVB 3FB7B 3B4NA 3UTSE 1ULVA 4QGYA 5LVEA 1BQLL 4ZUUA 4OZIE 5I1HH 1G9MH 1QFWL 4WV1A 3B6SB 1VFAA 3VXRE 3VXMA 4EBQL 4D9QD 3O8XA 5HD8C 4QRTB 1RK0A 43C9B 4P2RA 4X9GA 2FH6A 2Q86A 2FSEA 3WFEH 4PP2B 4XRCB 3BESR 4FQJH 2Q7YA 4KK9D 5KN5B 4LNRB 5T3ZD 2NY0D 5GRUH 3TPUB 3D39D 1X7QA 5DK0B 4K8RH 5E1AA 4GFTB 4WI8A 5SWSE 3TT3H 3MO1A 1NCNA 1FC1A 3B2UD 2XZAH 5CGYD 3EYUH 5ESAB 4TUJA 4POYA 2FIRT 2GQHA 3OMZA 1WAAA 1J9CT 3NIDE 1MAMH 1A6AB 1W8NA 2D7TL 3IS1X 2VDQH 3FQUB 1VFBA 3PP4L 5MI0C 1CICD 5BW7A 2H2PC 5IUSA 1R3IL 3QIWB 1PYWA 1P5UA 4E41B 3JV4B 2VR5A 5DRZA 1BZQK 3BIAX 3FO0L 1MCJA 1JFQH 4WRLA 2WBJC 4LLWB 5K9JH 1LEIA 4PJAF 5DO2C 1MHHA 4PRHD 3LKSB 4NM8H 5J1AA 5L0QC 4ODVL 2O5ZH 4HK0A 1GVIA 4QRPA 4UQ2A 2F8OA 4FTVD 2BNRA 3WLWC 4Z7WF 2CLVB 2PR4L 4RFEA 2Z8SA 3JV5A 5HHOA 1J10A 3BP4B 4NNPL 1G9EA 3KPQB 3CC5A 3B8YA 3VD3A 5FYJU 7CGTA 5J4MA 2HTKD 1D6VH 4GBXB 4YDIL 4NC1E 2BP3A 2E27L 5HPOA 4JG0H 3ULUL 4OCWH 3RBGA 4ZOCA 3MRQB 4NCC1 4PRPA 2Z31A 5BVPH 1GIGL 1EH9A 1T66C 3Q3GA 3H7LA 5DGQA 3U46B 4OBRA 4Q9QL 2QADC 1QP1A 3N9GH 4XVUC 5DRWB 4KQ3H 2ZUXA 3IYLW 3PGCB 4JM2B 2IBZX 5EZLB 5E8DL 3AM8C 1RURL 3ELAT 5B3JE 2MQCA 5DS8A 4QOKD 4J1UB 5INDA 4WFED 3HMWL 3MJ6A 4FQIH 1GGBH 3I6GB 3VFOB 4M5YH 5FYJL 4IDJH 3UP1A 1FO0H 2EICA 1KF9B 3ROLA 4U6VL 3VXPA 1IGML 5D7LA 5KTEH 1KYOK 4KRNA 1RULL 3AGVA 3WFDL 3GRWA 2NY5C 2V5TA 5DJDA 5TQ2L 2Q8AH 1U92B 4Y1AA 2AJUH 3QIBA 1NFDB 1E28A 4PGEA 1KLGA 5BMFL 1PSKH 3QCUL 4L9LA 2H1PL 4OUOA 5HHMB 3RAJH 4GMSL 4WCYH 12E8L 4PJ7E 2AJXH 2P47B 4IMLB 3SBWA 4NKDA 3BMWA 4OIIL 1EA9C 2UUDK 4QTIH 2COQA 1AC6A 2GFBA 1T0PB 4XMPH 3D0VA 1UCTA 1LO0H 1LD9A 3P4LA 5H2BA 3RPIA 3NN8B 5T5FL 4EIGB 1K6QL 1K8IB 4DVRH 2AJ3B 2Y5TA 2F19H 2ZUWA 2PO6C 5E9DB 1FG9C 1JZ7A 1HSAA 1NC2A 1QSEA 3VRJB 5DJ6B 1NGZA 3MV01 1P4BH 4JRWA 4UNUA 4U49A 1D5ZA 1UENA 4PD4K 2GUOA 4OCNC 4M62L 1K3ZA 5B39A 3QUZD 1NCUA 3CXDL 4R4BB 2Y07L 2UYLA 3BKYH 5F97E 1TLKA 2K1MA 1JZ5A 1ZHKA 4M1DH 5GJTH 3RNQB 4ISVB 1RIHH 1TZGL 4ZPVA 4WU7B 1QFWM 3HMXA 4LCWB 5CS7A 5HGBA 3SE8H 1JUFA 3L9RA 4G3YL 4R9HA 4RGNB 5I1EH 3PUCA 3EOBB 3DV4B 4PS4L 1H3UA 1LK2B 4NN6B 4JZJA 4PRIB 2PTTA 5LCVL 4KTDL 4I18A 5DT1L 4ENEC 4YJZL 4ZFGL 4HGKC 3DRQB 1GCFA 3M17A 4BQ9A 5CBAB 1QD0A 4OCYH 1QFOA 3VFRB 3IKCB 1UJ3B 3UJJL 1ED3A 4KHTL 2NCMA 5FHBH 1FYHB 4CVUA 4HGWB 1P84K 1IVLA 1SYSA 3T77B 5HVFB 5C0AE 1KB5B 4F58H 5ACLA 2XKSA 4XNUL 2WINB 2HH0L 3EDJA 4LP4A 2CPCA 4H8WL 2X4NA 2APFA 1FCCA 1KGCE 3RDTB 4Z77A 2R15A 1KV3A 2ZSWB 3HB3C 3NPSC 1J7VR 4JQXC 5T1DL 4PJ5B 4HIJB 1HILB 1CFVH 4RGOH 1YPZE 1BQHG 1K4DA 2B2XL 4KJYB 2R9HD 3UC0L 3ZE1F 5C92A 4PRBB 1C5CL 1A0QH 4NRYA 3HNVH 3ARGD 4LGRB 2E8YA 3CZFA 3OJVC 3RUGE 3RWJB 1M05A 2X42A 1NMCB 3RWCB 5DZNA 3GSOB 1R5VB 5JXEA 2FJFA 1AGCA 1OAQH 1DLFH 1GGCL 2AJVH 2VXVL 3FN3A 3MV9E 1CLOL 1QO3A 3L3HB 4OLVL 1LE9B 3RX7A 4XCNB 5CFHA 4CNIA 4LMQE 4N8VB 5ADPH 4I5BB 1D9KB 3HR6A 1AGBB 3HCVB 3KLAB 3DBXA 3EJYD 4QRRA 4MD4B 3PHQB 4JDTL 2ESVE 4MA8L 1J11A 2Y06L 4MJ6A 2NX5A 4X6FA 1MLCA 4AK1A 1UFUA 5GISL 4XWOC 2Q6WB 2VABB 1F90L 1MIEL 2IC2A 4P2QB 4LPTA 3OX8B 1FVEB 5GGRA 3GJFB 1MSPA 3MLTA 1EDQA 5DYOA 2ATPB 1HINH 1EIBA 1TJIH 2YRPA 4P23B 5T3ZH 3ZKXC 1QFUL 2C3HA 5E2WH 3QDGE 3QUYA 4HUMB 4R2GD 4DKEL 1C12A 1B0GB 2HVJA 1VPOH 4MAUL 2LVCA 4C83B 4YHKL 3VE0A 5EZIL 1G0DA 1LO3L 1AGFB 2VDOL 3MACL 1BJ1H 1Y0LA 4FFWC 3F6IA 5HI5D 3BP7B 1JPFB 5HDBE 5C0BD 4X6BB 1XGPA 5ESVB 2OL3A 3MZTA 4YQXH 3V79C 1VADA 4GXUM 3VXUD 1RZJL 3D85B 4JKPH 3HE6D 4WVRA 2ZCLH 3OPZH 5D96B 4DUXA 4Q6YA 3QDMB 4ODUA 4XVSL 4C56E 4NQED 1U6AL 3ULVH 4OUUA 1YNKH 3NCJL 2X4PB 4OCLC 4UU9B 3WIFB 1FDLL 5FM4A 3BJ91 2X6MA 4PJBA 3MODL 3CX5J 1U8QB 3K80A 3ZE0F 1QBMH 3TV3L 1KEGL 5E08L 4U3XA 3QNZA 3CVHB 4MCYB 2VDKH 5C0JA 4JFDD 2YRZA 1UACH 1EFXB 1UA6H 3UTTE 2IAND 2FZ3B 1IBGH 4PJCF 1WC7A 2VN7A 3JVGC 5IHUH 3DX9A 3HPJB 3TA3B 5KVGL 2C1PB 1FBIL 4L3ED 1IGYB 4GUPB 4QRUB 3FFDA 5B4MD 3NA9H 4OZGE 1GZPB 3O9WA 4Y19B 5KZCB 1CGSL 4A2LA 4LHUG 1I3VA 2FLRT 4QEGA 1UWGL 1G1YA 2BX5A 2P5EA 3HZVA 1EUUA 4PJAB 2WZPD 2VJXA 1S7TB 1CXHA 1XGTB 1A6WH 3GI9L 2PCPB 4PJDA 4M93B 4RMQA 4Z7WB 1ZLUH 2IALB 1UKSA 2IAMB 2JB5L 4DGYH 3JTSB 3QZWA 4JM4L 3S35X 5T1LD 3GHBH 3BZFB 3ULSA 1OAKL 2IJ0C 4ODSH 1PD6A 3RWEA 4YHZL 3EJYC 4X5XB 3QEQB 2ARJB 3L95B 4LDOB 4YXHL 3TEUA 4KKAD 1MEXH 3OKNB 2FB4L 1MRFL 3WL9B 2OQJA 4HUUA 4JZNB 3ULUF 3NCCB 3GMPA 3SCMB 3A6BL 3BZEB 1BFVH 2VZ1A 4LQFH 3LIZH 3BEWB 1XF5A 3DI3B 3HI6L 4LLQA 5K9KA 1Q9OA 4EN3D 4MCZB 1X44A 5EU3B 4P59H 3CSGA 2ICWJ 5L8KB 5I8CA 1IC7L 3H9SE 1WBXB 3GMMB 4M6MH 5IGXH 4PGJA 1NQBA 5TDPA 1N59B 1BLNB 2OZ4A 5DD5L 4R96B 2R1XA 5D1QB 3ZSSA 4Y4HB 4U1KB 5HI5C 3DTXB 3DXAB 4E5XA 4XP6L 4P5TA 2VDPL 3CH1A 3NCMA 1FNFA 3NH7H 4NQUA 1T1WA 3FT4B 4OCRH 3L3JB 2ZJSL 4FQ2L 3SE4A 3BKJH 5I1GL 4XT1C 3TO4A 5LQBL 4JVUA 3HRZA 4HS6A 2F53A 3L3OB 4KRPC 4FQXA 3QWOA 4MNHA 4NRZB 5GGSB 5AAWA 4ZXBD 2X7LB 3CFIC 4ZO8A 4GG8B 3FQWB 4YNYA 5IMMA 4YR6B 2B20A 2JB6B 4N0CC 4LMQI 4PTUB 2VITB 3H2WA 3BQUD 4A6YH 4I48B 3CFJB 4IRSA 4EUPB 4XBGA 3CX5K 2V2WB 2NXYB 4JCLA 1VCAA 3V6ZB 4XI5C 1Q9LB 1RI8A 2EH7L 2PW2A 4FFZH 4KVCH 2W0FB 5IBUG 4OZHE 3UTZA 3CDGA 4MWFA 4W81A 3WEXB 4GW1A 2WWKO 4ODTH 1AD0A 2AXFB 4EIZC 3C5SA 2IPKA 2E7HA 1GAFH 2HFGH 3O4LB 3QWRD 3MRHA 4UV7L 1QYGL 4GAGL 3QHTC 3RBSA 4WHYH 5I18L 4B0MM 4WFGD 1AGEB 3VGGA 4KRMB 1J87A 4TUOA 4S2SB 1K2DB 1XGRB 2WP3T 3MYZA 4J4PD 4RBPH 3KPRE 4MSWA 2D4DA 5C09D 1IKNA 4YXLL 1MRCL 3FFCD 4JHAH 2BRRH 4K55A 1MFCL 1NLBH 1YQVH 2O5YH 1RJYB 2LE9A 1TENA 4U1SA 3OAYH 4ZQKA 3JWOH 1TJHL 3LKNA 3LSOA 2BVPA 4QLRA 4RMWA 4U2ZA 5I30H 5DJAA 3RTQA 1UT9A 1RZKL 4J7RA 3N06B 4HUXB 3S34L 1FL6B 1T21B 3SE3C 1F6LL 5GGVL 4TSCH 3ZYOA 4KZEH 3NZHL 3VXSB 3WNMA 4XMLL 5CILL 1OP3H 2VRAA 1OARL 3GBLA 2WANA 2SEBA 3GMOB 2MCPL 3VD4A 1JHKL 3C60D 1ORQA 4M48L 2LTQB 3K7UA 1DL7L 4EN3C 5D93C 3C8KB 4U6XB 4LF3B 2JCCA 2BVTA 4KQ4H 5E8EB 1FORH 4MNQB 3MRPA 3S88H 1FFOA 1B0RA 1EZVX 2UZYB 3UYRL 1BM3L 4IS6A 4NBYB 4DN3L 3MA7A 3LD8C 3D0LB 4GRWF 1RUPL 5I1IH 1DQDH 1IC4H 1FRGL 4XB7A 4U1GB 4OCSL 1IAIL 1QBBA 4FNLH 3TYGH 5DSCA 3GSQA 5JNYB 1GHFL 2IADA 2APBA 2CDEB 2OSLB 4BK4A 1G1CA 3QRFM 4P0DA 4J3VA 5T5NG 1D7FA 1AO7B 1NFIB 3U79A 4R7NA 5DD3L 4WTXA 1C08A 4WDIA 2ID5A 1A9EB 1YYLH 1QFPA 4H88H 2VO5A 3OGCB 3WV0A 1RUKH 5K9OB 4KGJA 4WO4C 3ZE2E 3KPLA 4LSTH 5GS1A 2YPVL 1G6RL 3INUL 4OZIF 1CDUA 3TF7C 4TUKL 3BQUC 2PYEB 3TWCH 1JZ8A 5IEKB 3G6DH 4EEEA 3WS6A 1ZGLM 4X7EC 5BJTB 2R69L 1BZ9B 1FFPB 2X2YA 3BYTA 3O3UN 2VIRA 1TVBB 4LU5L 4MA3B 5DJ2A 1DQLL 1IT9H 4EDWL 1HXYB 4PJ9B 3U82B 2DI8A 5HYQB 1H3PL 2CMRL 1MFBH 3OGOE 3AFLA 4AEIL 1CL7I 4XPAL 3M07A 3MOAL 4TSBL 3H9HA 3GI8H 5KVDL 5D1XC 4LLVB 1LEGB 1A4KB 3T4YA 3NIDF 1V7MH 4UTAL 2LFGA 4AJ0A 4W68A 3QG6B 1D5MA 4HKBA 5FKAA 2O93L 1KPRB 2OS7A 1E6JH 5HHOD 5EU6B 1DVFB 1QLRB 3WYRA 3G5XB 3T09A 5J57B 4Y88A 1HH9A 1KENL 1GZQA 2DMBA 3C6LD 1L9MA 3EOYG 3REWB 2EDRA 2DMKA 4K2UH 4D9QE 4TNVF 5TFSL 4GMTH 4XPGL 2L0DA 1F11B 4LCCC 1Y6MR 2NLJB 4P5MB 5T3ZE 4PJCB 7FABH 3D39E 5CP7B 4L8DA 4KROC 2NY4B 3QG7H 2IFGA 1MCEA 2NW3B 5FF6B 1U8OB 2E7CA 4PGBB 4UDUA 1NUNB 1YJDH 4OLZH 2J6EA 3NPSB 3P9MB 2YUVA 5I1AA 1YECH 3W11D 3S4SA 3U0WL 1KCUL 1YQ2A 2EDEA 5DMIH 5I9QC 4G8FB 2EDJA 2GAZA 4M4RA 5TQ0H 3WN5C 1U8LA 1FNSH 5JHDB 3HAEG 3MRKB 1MJUL 1HHHB 5ENWA 5C0ND 4QHNB 2VWEE 4K07A 2RCSH 5EO0B 5MEOB 5HYEA 4HH9B 2YSSB 4G6JH 5E6IB 5HVHC 3QO0A 5DEFA 4JVPA 2IH3A 2XZQL 3MV8B 3HE7D 2XPGB 3ULVE 1Z9SA 4PRHE 4Y1AD 3QIBD 1I3GL 3QAZB 4JO1H 2KDGA 3P30L 3J7HA 5LAXA 2XWJB 2EDYA 4WV1C 4C59B 4TNVK 3MRJB 4JKMA 3CVIH 3B43A 5KSBE 1XF2B 5DHVH 3O8XC 5KVEL 4QRSA 1OP5K 2LQRA 1H5BB 4W4NA 1U91A 1F4AA 4ZNCD 1A7QL 2F15A 2QEJA 3DI2B 1T22B 4DOHE 1SJHB 4H1LG 3S36H 4HUVA 4O4YH 5E8NA 3O6ML 2B1HL 5HHQA 1KXQE 4P2OA 1L4IA 2YEZA 4M8QA 4NCC2 3Q1SH 5E99H 1JTPA 1I7RA 1U93A 2ZSVB 3ZKXB 4PJ7F 1NC2D 1QSED 3SDXA 3PWPD 4K7PX 5EO9A 3TIEA 2DQEH 4P4RA 1KJ2A 3AU1B 1I1AB 2C1OB 2F9BT 5T3XL 4PV8A 3WXWL 2EIDA 5INCB 2ZKHH 4AIZA 1U41A 3SJVA 4QOKE 3LN5B 4M1CC 1IAIM 4WFEE 1FLTX 1CF8H 2N7BA 4O58L 1S7RA 2EDXA 4RRPG 1QBAA 1ACYL 4WU5B 5DRNA 3VWKB 3CFDA 3ZTNH 3U2SB 3VG0H 1MFDL 5FO8B 4OF0A 5ERWB 1T7YA 1EJOL 3IFNH 2W60B 5ID1B 3ESUF 1PVHA 4KTEL 4YUEH 3PWJB 2ZUUA 3WO4C 3EW3B 3T0DA 2Q76B 4NN5C 3WO3B 1X6LA 2I60L 4QXWA 5IB4B 2QQLL 5CIPB 4YBLC 4U7KA 3BPNB 1TETL 2XT1B 3WIHL 4JRYB 3HNSL 4ZNEA 4OFDA 1H3WM 2Z31C 3O2DA 1OF2B 2BXZA 4O2EB 1AXSA 4FS0A 3BRDA 2LAGB 2GKIA 2Z93A 4GAFB 5I1DA 1CN4A 1U8IB 3D6GA 3WDJA 1I8MA 1CI5A 3FOMB 2E8ZA 2EIEA 4F9PA 3WDHA 4WHTA 3T0XA 3V7AE 3MRCB 3STBA 1CE6B 4M61A 4OSUL 5A3IC 4Z7QE 3W11C 3UTQB 4TVPL 4AG4L 4B7IA 1MCQA 1TCMA 2ADIB 2GHWB 3QO1B 4G5ZH 4HIHA 4L3CB 3MRFB 2BMKB 4U33A 3VGFA 4HZLA 1IGJB 4EQ3A 3TYFA 1PX4A 1FVDB 4ZAKC 2MSPA 4XP9L 3WUWA 4JFPA 5SX5K 4NCDA 4GOSA 2BC4A 4PJGE 2V5RA 3QJHA 1INQB 4QXUL 1D5IH 4RNRA 3VXNB 2FIKB 1OGTB 1P7QD 2A83B 3ZL4H 3KWWB 4RZCB 5DLML 5GPRA 3B9AA 5J12C 1B3JA 1U95A 5ISZA 2RHEA 2PUQT 5KS9A 1JF1B 5F3HB 5C0CB 1OSPL 2HT4C 3PQYB 3OV6A 3RUGF 1KOAA 1LE5B 4Z7VE 1G7JB 5L8JB 3SBWC 4QRRD 1G9MC 3HI5L 3V4UH 4EQ2A 4P57B 5F8RC 3HPLA 2NX5D 5F9AC 5GGTA 3QXUA 1P4IL 4NO5B 3AS1A 3VXQB 4P46D 4U1HA 3T8XA 2HN7B 4F57L 3BUYB 3T1FA 1KCVH 1OCWL 1W72H 3QXWA 5I74C 2BNQA 5BV7C 1CFSB 1EEZB 5F9JA 1OGAA 3MLYH 3FN0H 1QA9B 5EZOL 4AIXA 1XGQA 5F89A 2H9GB 3C9NA 3H42L 2NXZB 3OKDB 5DC9B 5AD0B 1QEWB 1FAKT 5LKNA 4NM4H 4BZ2H 1ZTXL 1LGVA 4WJ5A 4GRWB 5TE7H 3TT1L 4O02L 1T7VA 1ZV5A 5D72H 5A40E 1MIML 2IH1B 1AE6H 4GKNB 5IMKA 1FVCA 2YS4A 4S1SH 3QNYA 2Y23A 4YFLI 4JFEB 4LEOA 1UM4H 4ZS6D 25C8L 3BUTA 5CAYB 4LRIA 1BFOA 2WQRA 1RPQA 1CYGA 4E9LA 3MFGB 3PNWB 1D6EB 3GBML 1XIWB 4U1NA 1R3JB 1RUQH 4I18C 4HPYH 1U8KB 2I26N 5DURD 5JW4N 3PIQA 3MREB 3B3IB 3MUGB 5DHYB 4EZMA 1BPVA 3DSFH 1LQSR 4MQXD 5HDBF 5F1IA 3UTSB 3MNWB 2NY5L 3H9ZA 3QHZL 1WWBX 4NQTA 4OZIB 1UWXH 3T1WA 1X5XA 3DVIA 4NJAH 4XNQA 1QKZH 5JDSA 2VOTA 4KVNH 5C8JB 2X1WL 5HPMA 3G5YA 43CAB 3GSNA 3BKCL 2WUCL 5CSBA 1G7MB 4QHKI 4PREA 3F7QA 4ZUVA 1YEDB 4Z95L 2UZIH 3OHXB 5GSVB 5SWSB 3SY0B 4HWBL 3O9WD 2B0SL 2X4QA 2YD2A 4KK6C 4UV4L 3SGJA 3X12A 4ZFOA 5C0EB 4HWZA 2CLZA 4LSVL 5LXGL 2D7QA 3PABA 1ZLVK 3SDAA 1UXSB 2P5ED 3GKZA 3U0TB 4C55A 5DR5L 4NKQB 1TQCC 4MJIA 2LU7A 3MLSH 4RFNC 1U3ZA 4Q2ZA 4Y2DC 4AEHH 3U7WL 4OZGF 3TESA 2WBWB 5JXEC 2YD5A 5L2JB 4M3KB 1A6UH 5DWUH 5C0BE 4I2XE 1MHPL 1A7BA 2R0KH 1MNUH 2IPUK 1K8DA 2DM4A 5FM5O 3PWVB 5EU5A 3C6SB 4FQCH 1FAIL 1OAYL 3E6HB 5E2TH 1U8HB 3K1DA 3VXUE 3FQNB 5KANI 4E42A 4GLRH 4NDMB 3UTOA 3MBEB 5DUPL 3FB6B 1S3KL 5CZKA 4LLMB 4ELMA 4Y4KD 1A1NB 4P48A 5DC0A 1CGWA 3EFDH 4U7SA 3MTRA 4H26B 3LH2L 4ZFZA 2VNCA 1C7TA 5D93B 1OPGH 4JFDE 1AQDB 1HCFX 2IANE 3O3BB 3QUMB 1HI6A 3AREC 4U1IB 5IBUB 3BD5A 3QUYC 4DQOL 4PLJD 1OD7A 4Z78A 3C09B 5CHNB 1REIA 1FJ1A 1AP2B 4PV9B 4HWEL 4ZDHB 1MREL 3H3KA 1J05B 3O2VL 2VL5A 3FB8B 5DJCB 3JUYA 3IDIB 2HJFA 5MHSD 3JV6A 3V4PH 3PV6B 4P5TD 3WNPA 3D2UA 3QZWG 3D18B 4J3WA 3BJLA 3QRGL 1U8MB 3MCKA 3FTGB 3Q5TA 4G42B 5DC4B 1HSBA 5IVXE 4UINH 1R5WB 2BJML 1CLYL 2R0ZH 4LSSH 2NYYC 4JN1L 4JFOB 4DTGH 2F53D 2R2EB 1XCQB 3PWUA 2GTZA 4J12A 4WHCA 3RKDC 4WO4B 5KW9L 3ILPB 4CDHA 4PJ8A 1FGNH 4DCQA 3BH9B 5EBMB 1J5OL 2B5IC 4OGYH 1NAMB 4PJ7B 4BH7B 4MB5A 3VDAA 2YRLA 1WVZA 1F4XH 2JJVA 5IW6A 1R0AL 1BJMA 4GRLB 2GTWA 4D0BA 1I7UA 5JZ7D 5ADOH 2OM5A 2WWMD 3P11L 1QFHA 1JZ3A 1MCSA 1M71A 4KJPD 3O9WC 5JW4M 3L3KA 1K4CA 3PDDA 2APTA 2A6KA 1V05A 2A6IA 2HFTA 3KNBB 4LPCA 3HI1B 3VWJB 1J0KA 3BGAA 2JIXA 1S5HB 1G7QB 1H0DA 5IOPB 4I9WD 4ELKB 5EBLA 5ICYA 2OMBA 2B4CH 4OZHF 5I16B 3F7YB 4X6DE 2EIZB 5EA0L 2DQUL 3BPOC 1U36A 2J1KA 5FYKL 4OFIA 1ZE3C 1JNNL 2BSTA 3BD4A 3GUTA 3ES6B 3K0WA 4XNMA 2BFVL 2X89A 3BGMA 3RJDA 4NT6B 3PJSB 3ARBA 1NMAH 3GNMH 5MEPA 5A16A 5C2BL 2XTJC 4CMMA 1I85A 1T4KB 4XGZA 4J3OC 2DL9A 2VZSA 4PUBH 3L5XL 4BA8A 5D2LF 5FDYA 1OAUL 4LBEA 3V4VH 4G9DA 5DQ9B 5IF0B 1P5VA 4ZYKB 5ITFA 4K94H 1JWSA 4G6MH 3B9KA 4HX1B 4Z0BH 4XNYH 4S1RH 3UZEA 3EO1B 4M5ZL 1TFHA 1DN0B 1RVFL 2EC9T 1IGFL 4LP5A 1YMMB 3U9UA 3QCVH 3OB0K 2VAJA 1NGQH 4FFYH 3ARDA 3EFFA 4UDTA 4DAGL 4JZOA 3FAXA 4QXTB 3BPLC 2VR9A 4PJIB 4K9EH 2R0WH 2VE6A 2BSSA 1BQSA 4P5TC 4WFGE 1YPZB 2ZOKB 5GS3A 4Y5YB 4Z8FL 3NABH 5CJ5A 4Y5VB 1BF2A 4J23A 5C09E 3O6KL 3EYQC 1KC5H 3RUGB 4Q9RL 5C08A 3TO4C 5KANG 4NKIH 3FFCE 1JWMB 4FFVC 2VZUA 2XICA 2YD4A 4FQXC 5ID0B 2OL3H 1UH4A 2Q1EA 3R0NA 3MV9B 3CFCL 3WJJA 3MNVA 2WLYA 2VDNH 3FO1B 4WUUE 2B39A 3HZKA 3IFLH 4JY4B 5ETUA 5IBTH 5HI3C 4KKBC 1I8IB 2W9DL 3P4NB 4ZODA 4IRSC 1YEIH 3OWEA 2BRQA 4K23L 3G04B 1PG7L 4AY0A 3E8UH 3MGOB 4NWTL 4HCRH 2ESVB 3KVQA 5JZ7C 3BDYL 1YUHB 3QEHA 4PJFA 3DROB 3MXWH 3ZE2F 5C86A 3IXTA 3Q6FA 1ETZB 2FX7H 3SN6N 1I3RA 3HAEB 3MUJA 3FMGL 5HHXH 2DD8H 3PGFL 2J7LA 3BEVA 3QDGB 1RJLB 4HT1L 5F9WB 4PY8J 2CIIB 2PYFA 3H8NA 2DDQL 1EXUA 3MR9B 1YEHH 4XP1H 1VKXB 4HJGB 1VGKA 1IKNC 1LEKB 5A2LH 2F58H 3DECA 3NFNB 4HIXL 1J1OH 3SDCB 3BO8B 4OLWH 1RMFH 1MLBB 4I0PD 2ITDA 3EUUA 4X98B 1A7RH 1VFMA 3A6CL 5F6IB 4K3HA 3RTQC 2XN9D 3DV6A 4M7JL 3FQTB 1JK8A 3P73A 1FLRL 1GGUA 1K85A 4H1LB 4LVHC 4C56B 3PHOB 4N5ED 4P9ML 3DX7B 4PY7A 2VN4A 4N68A 5IVZA 4LSQL 5HVGB 1UYWH 5CKGA 2VLJD 3P0VL 2IPTH 1X5HA 3OTTA 4I77H 4JREB 4OCMC 1SJEA 3VGAB 5C3TA 1NH6A 2O5XH 1WAAE 4DKDC 1CFNA 3L5WB 4RWYH 5CZXD 1BOGB 3GSRB 4GKSA 1HIMH 1A14H 1QSFA 4NUJB 1FV1A 4KH2A 4F15C 1MJ8H 1ADQL 3N0PB 2MCG1 4TQEL 1T83A 4WHYG 5JQ6H 1HHIB 4OZGB 5DK2B 1SY6H 3QQ4A 2H32A 1OB1B 1MJJA 5D2NC 4YFLF 4MX7B 4XBPA 3NTCL 5DMJB 1YY8A 2OZ4H 3P4OB 3VG9B 5GGQL 1CXLA 4QXGL 1NEZA 4OKVB 5EN2A 3VW3H 3S7GA 2MHAA 3QQNA 5I73C 4LNVA 1JL8A 3H6JA 1IEAA 5DMGC 4OI9A 2R4RH 4LCIH 3MRIA 5BO1H 1PLGL 4BSVA 1GGIH 1ITBB 4DKFH 3KXFD 5C0DA 3I2CH 1RZ7L 3BRGC 4R90L 4Z5RB 2EIBA 5DQDH 3MNZA 4OT1H 1C8PA 4KY1H 3WS6C 1OAXL 5KSBF 4HUWA 3T08A 3U0PB 5EOQL 2YA2A 1NFKA 2QR0A 2DQTH 1DBML 1JNLL 1X5YA 3S96B 1QRNE 1WEJL 4HUNB 5DJYA 4FP8L 5GHWL 4DVBB 3WSQL 4M6OH 3SJVD 4YHIA 4Y16B 1HOCB 5AWNL 5IJVB 5ABDE 4BUHA 3BW9B 1DQTA 4YAQA 3ZDZE 3MXVL 1SM3H 3NIGE 1FNHA 1CK0H 3MYJA 3OAUH 2D4FA 3EGSA 4X8JB 4AM0A 2FBJH 1QSVA 2ERJC 1YEFL 3OZ9L 4M7ZB 3VRIA 5JORA 1CDHA 3LS5H 1KTDB 1IM9B 2ADFH 4ZS7L 2LV4A 5J13C 4Y1AE 3HC4L 4ERSH 4JY6A 1WFNA 4ZSOE 3BKMH 3MRNB 3U1SH 2Z35B 4W4OA 3GSVA 4MXQC 1HXMA 3FB7A 4CVXB 4JHWH 5JA9A 4ZTOH 5K33A 3V5HB 2GK0B 3HG1B 4N5EC 3VFVB 4KKCC 4YHPB 2NY6C 3DVNB 43C9A 3BDXA 2VLMD 5I1CH 2N1KA 4PP2A 4S0SD 5EU4A 1ORSB 5KN5A 4LNRA 5JOFB 4M1GH 5KSVB 4HFWA 3TPUA 2YMXL 1AHWB 5DI8A 1EK3A 1QSEE 5DK0A 3PWPE 3G9VA 5DXWA 1CBVL 2JF1A 5TE4H 5E0QA 1AR1D 3WS3B 4G7YL 4HV8A 2IWGA 5DJXB 1RZGB 5AAMA 5EFIB 4YFDB 2XNAA 2DLEA 5E6ZA 3NAAH 3IDJB 1A6AA 4OZHB 3S37X 1QZ1A 3TBVA 4Z7QF 3GIVB 5SX4H 4JPKH 2QBWA 4MA1B 1WCQA 3U6RB 3LRHA 1MWAL 2J8UA 3HC3L 3QIWA 4NUGH 2R0LH 1SEBB 3JV4A 1F4YL 4KWUA 2DLFL 5ISZD 4LLWA 4OGAC 4YK4C 4JRXB 1WT5C 5J9PA 3LKSA 5DFTA 3GHEH 4X9BA 4L4VE 3LN4A 2MPAH 4OGXH 4PJGF 5C6TH 3WE6B 3P4MB 3VFSB 1M7DA 3F7RA 3UDWC 4MLSA 3V9FA 4D3CH 4GS7C 3KPQA 4P2OC 4DW2H 6FABL 3FRPA 5JR1L 4GBXA 1CDBA 1KNOB 4IIQC 4Z7VF 2BNQD 2NY7L 3EJZC 1OGAD 1EMTL 3UBXI 4HIEA 3RU8H 5IFHL 5CCKH 4UUJB 3GIZL 2FEEL 3EYOB 2VAAB 5DRWA 1JGLL 2OI9C 4PLOB 4LDEB 2G75B 1I1FA 3JUZA 5B8CB 3T0EC 1KB9J 3MROA 1G7LA 3WHXA 4XPTL 3BP6A 3IJYB 3HTLX 4IHOB 1IQWL 4ALAL 4J1UA 4MVBD 3SGKA 2QLVB 3I6GA 2H2SC 5FA4B 1LDPL 1U8PB 4BH8B 4QHMB 4TTDD 3T0BA 2FGWH 2GSIA 2Y6SC 4LIQH 1JZ6A 4DGVL 2DLIA 3IVKB 4NOFA 4V2BA 3D5OF 4KAQH 4PB0H 1U92A 4MA7H 5HXMA 5I1JH 5DA0B 5TF1H 1OT1A 1TZIB 1M4KA 2AK1H 2DS4A 2B8OT 4LCYB 4YHLH 1FIEA 2OR9L 2NX5E 3LN9A 5HDOA 4IMLA 5EIVA 1B6UA 4EDXB 4NWUH 3S5LB 4XVTH 4F9PC 4QKXB 3ESVF 5FUOL 2A73B 3X3GH 4L8CB 2P4AB 4NRXB 5BOZG 1NANH 1YJDC 4IOFD 3NN8A 5K9QG 2VQ1B 2EDFA 2AJ3A 1YNLH 3E0GA 3FHQA 3SDAD 1P69B 5E9DA 2HFFB 3MCLH 3S98A 4GAJH 5DJ6A 3FZUD 3JWNC 3EHBD 3V52L 3FQRB 3U83A 3RZCD 4PRDB 3BAEH 2AEWA 4R4BA 1ZOXA 4JO3H 1EVTC 4MAYC 2GJ6A 4FQLL 2UVFA 3BN9C 1A1MB 3LQZB 3RNQA 3VXTB 1FIGL 2YK1H 5F7FA 5HY9A 3PP3K 2PW1B 4CRPA 4WU7A 1CD1B 3C2AL 4EI6B 4LCWA 3WJLA 4L4JA 1WK0A 4GLRI 2FEDC 3BMVA 4KK8D 4F7MB 1IGCL 5HVWA 1LK2A 4PRIA 3RPKA 2XI9A 2NNAA 3DRQA 2CO7B 3UZQA 5C0RH 4CMHC 3VD7A 5CBAA 4TRPL 2OJEB 5L2KA 2CD0A 3NCYS 1BEYL 2WQ8A 1XGUA 3VFRA 3IKCA 1UJ3A 1N2RB 2P8PB 5D7JA 2X40A 2C3VB 3T2QA 1IL1B 2VDML 2R2BB 4HGWA 4FQ1H 4Z7UB 4L29B 1V3JA 3D39B 2VDRH 3T77A 1KB5A 1URLA 2XY2A 1QQDB 2WINA 2EDOA 4HXBH 3RDTA 1IAOA 5FM5M 5EORH 2ZOLA 1KJ2H 2ZSWA 2P5EE 3JZ7A 3QPXH 4LOUD 1KJ3H 4YLQT 3U4BL 2QQKL 4PJ5A 4HIJA 1HILA 2NY1C 4UT9L 2RBLA 3TO2B 2YWYA 4KJYA 4PJDE 1MCPH 4APQA 1KB9K 4PRBA 1ZS8B 4TTDC 2JKXA 3SDDC 4XZUB 3RWJA 3MLPA 1T80A 3WNLA 3GSOA 3D3VA 4WFFE 4XPBL 3NMEA 4PRHB 1JWUA 1I9IH 4NGHH 1M7IB 5CEZL 3GRWL 2ZZUT 4GAYA 1LE9A 4XCNA 3WHE0 2H8PB 5IVXF 2VDLH 1NCBH 4POUB 5EOCL 4I5BA 1D9KA 1C7SA 3DO7B 5KSBB 3F58H 1A21A 2CRYA 2ENYA 2MQ0A 5JXAL 3HCVA 2ZCKH 3KLAA 3PL6C 4N9GB 2UUDH 1B90A 4OD3H 4FXGB 4MD4A 3PHQA 4JJ5B 1CDIA 4UIKH 1G9ML 5I1HL 5KVFH 4CJ1A 3O2DH 4XNXH 3UBXG 4XAKD 2X9YA 4N0YL 2Q6WA 4IOFC 2HKHL 2VABA 5FA3B 2NR6D 4P2QA 3ZO0A 3OX8A 3RWIB 1FVEA 3CFEB 3L3IB 3EYSH 3GJFA 1BGXL 2NY3D 2ATPA 3TT3L 4P23A 1RJZB 5CSZB 4NKOB 1P6FA 4OQTA 5BV7L 1B0GA 3EYUL 3DVGA 3QUXB 3G08B 3MLRH 1OTUD 4QOKB 1F4WL 4JN2B 1JHLH 4BUGA 1AGFA 5I8EA 4CVZA 1VESA 5F88B 2X89D 4F33A 3VD5A 5F72S 1CL7L 3BP7A 1JPFA 1YYML 5ESVA 3VMNA 3HMXL 1HHKB 4X6DF 1IGIL 1WJ3A 4JPVL 5GS0C 4KK8C 2F53E 1IKFL 3D85A 3GSUB 3GB7B 5IR1B 3QDMA 1X3DA 3S36X 3ARFC 2X4PA 3WIFA 1BWMA 3RHWK 1ROWA 1CTOA 3IDMA 2XA8L 4DGIH 4P4KB 1KLUA 5BZWB 1WGOA 3B9KD 1QLEH 4Q0XL 2HJKB 5FYJD 3EBAA 1ZMYA 3CVHA 4YDVB 1NCWH 1QUNA 4MCYA 4OIAA 4TTGA 2IQAA 1EFXA 1GRWA 5CLWA 2CDGB 4J2XA 4YHYC 2FZ3A 2K3TA 4OCWL 4DZ8B 3ARDD 4JB9H 2ZPKL 3HPJA 5FGBA 3RWGB 1IAKA 3JTTB 3MC0A 3UPAA 4GUPA 2MJWA 2YXFA 4QRUA 1J8HB 3TN0A 5I19H 1T5WA 3W2DH 5EC2B 4LOUC 4Y19A 2P5WB 4I9WE 2OXHA 1H9VA 3RI5K 1DBJL 4PJAA 1QBLH 3SGDH 1CGYA 4XWGL 4KKLC 1XGTA 5C08D 4PJGB 5CJBA 2BCKB 1GGBL 4XXDB 4M5YL 4Z7WA 5FB8B 5FECA 2A9NH 1FO0L 2IALA 1BD2E 4PJ8C 2IAMA 3AMLA 3RVUC 3V6OC 1BVLB 3WD5H 4MLIA 3O3DB 5KTEL 4R97C 3O45B 5CEXB 4N0FB 3BZFA 5DD1L 4XVJL 2P49B 4Z7VB 4A6YB 2EXYC 4X5XA 1CD0A 4KI5D 3HKFA 2ARJA 1OY3B 3OKNA 1RIVH 2QQNH 3RAJL 2JTDA 3WL9A 2X4OB 4JZNA 2UWEA 4X0KA 5B38B 3FONA 1BFTA 3SCMA 2BY0A 4LASH 4M6NH 3W0WE 3VJ6B 2JCCE 4X6CA 4YHMH 3BZEA 1E0OB 2V2TB 3BEWA 3PXHA 4WGWB 2ERJB 2DIBA 4MCZA 1NDGB 1UEMA 2FECL 3DRTB 1DDHA 1WBXA 3GMMA 3L1OH 3O41B 4AENB 3U4EB 4GXVH 1BLNA 4JPWH 3RL2B 4XNZB 3L3DB 2CKBL 4U1KA 4QWWC 3ARGB 4OI7A 3ARBC 4KMTH 3FT4A 5GJTL 3DMMC 5EO1B 4YDJA 3RFZC 1SMAA 5IFJB 3L3JA 3RL1B 5C0FB 3Q0HA 1AGDB 1QLFB 4GG6E 1MCCA 1Y18B 3BIKB 1NGYB 4P2YA 2NY2D 3ORJA 1Q8MA 4M7LT 4M4PA 1HHJB 3NIFE 2HT2C 4M43L 4NRZA 2H6PB 5GGSA 2X7LA 1E4XH 3GMNB 4GG8A 3FQWA 2D31B 2HWZH 4YR6A 2JB6A 5C6PB 1FNGB 2M8XA 4JFQB 4PTUA 2VITA 4I48A 2H3NB 3CFJA 1QSFD 2V2WA 3RA7H 4JAMB 3T4AB 2W91A 3TJEL 3V6ZA 1DE4B 1DBAH 1OSZA 1Q9LA 1A3QA 4NJ9L 3IDNB 5DFVC 2W0FA 5DVNA 2BY3A 3WEXA 1ZLSL 1A3RH 2I9TB 1WAAF 2AV1A 4R2GB 1ZGLP 5E7BA 2XRAH 2HRPH 5IW1B 3OSKA 3OR7B 4NYLB 3KPTA 5EOCJ 1R5IB 3RVTD 4RMRA 5DVMA 1AGEA 4EI5C 1XH3A 4QF1B 4S2SA 4HW6A 1K2DA 1XGRA 1FYTA 1QFWH 4O51B 5CJQL 2HKFL 5C0BB 4I2XB 4GS7B 4EBQH 3WJJC 1RV6X 4P5KB 2XN9E 3VXUB 3HE6B 5AZEL 1RJYA 3MMEB 3BP5B 1DLFL 2M2DA 3STZB 4NFCA 4D9LH 1SYVA 4RAVB 1KN2L 3J8F7 5JHLL 1FL6A 1T21A 1CIDA 4HKJB 2VLJE 3A67H 3QI9C 3RJQB 5DQJB 3UX9B 3VXSA 2Q87A 3AM8A 1U3HB 2AXGB 2D7TH 4M7LH 1ZT4B 3O4OB 1U8NA 4JFDB 2IANB 2KPNA 2JLLA 4P9HC 3CDCA 3OKKB 1R3IH 5HGHB 3C8KA 3IDUA 4U6XA 1N26A 1EV2E 4KJQD 3FO0H 5F1SA 5E8EA 2OTWB 3RZWA 2Z92B 3MLUL 1HINL 1NMBH 4ODVH 4OLYH 5E2WL 4MD0A 4AT6B 2DWEB 4S11A 3MGTB 3ZDZF 3NIGF 1YY9D 2PKDA 2PR4H 5E94B 5BVJB 3P3YA 3WLBB 4Q6IB 4BFIB 5IB2B 1S7SA 4NNPH 1MFEL 1JBJA 5IVXB 1KEML 4YDIH 5CD5D 1BP3B 5JNYA 2E27H 4J8RB 2CDEA 2OSLA 3ULUH 5K93A 4I8DA 4AH2A 3QDJE 4Y4FB 1AO7A 1NFIA 3RNKB 4Q97A 2DKUA 3KXFE 1EEUA 1WZ1L 1GIGH 3IETA 4QHLA 3GMLB 2A77L 1A9EA 2AKRB 1N8ZB 2DQIL 5F7DB 5JIKA 3OGCA 3OPZL 2F54D 4Q9QH 3CZJA 2EYTB 1XF4B 4OZFH 5K9OA 1FNLA 1U8JA 3CK0L 3WMSA 4V2CB 3RVWC 4OLUL 2PO6A 5E8DH 4ETQB 1C16B 1RURH 2PYEA 4JO2L 5IT2L 5IEKA 5D8JL 2AJYL 3LQAC 1FFPA 3WIIL 2DN7A 3SJVE 3HMWH 2ADJB 1N64L 1TVBA 4MA3A 1G9NC 1T83C 2W92A 3I3BA 1AQKL 5FYJH 3TBTB 4HULB 2FX9L 5HYQA 2QSTA 5SX4I 3I6KB 5EU7E 4U6VH 5IHUL 1IGMH 3QIWD 1X5IA 4HWUA 3KPPB 4NQSB 2ATKB 2BERA 2AJZB 5BQ7B 1LEGA 1A4KA 3WFDH 3RVTC 5TQ2H 2A74B 5J6HB 4X6DB 3IDGA 5BMFH 4QCIB 3QCUH 1A5FL 1PQZB 5DHVB 1IMHC 4GMSH 4MD5A 1L6ZA 2EDDA 5CWSB 12E8H 1DUYB 1A6WL 1Z3GL 1UB5B 4KUZL 2FWOA 1QLRA 4BFEA 3G5XA 3DUHA 3CFKB 4N9OB 3MLWL 4NQDA 3REWA 4DGYL 2R2HB 5CSGA 1BX2B 5CINL 3QJFB 4LARL 5T5FH 1A6PA 1UXWB 2VLME 3HUJA 4ZXBB 4ODSL 2NLJA 4P5MA 1Q1JH 2B7DT 4PJCA 5L9DL 4RQQA 5CP7A 3OXSB 3OKLA 1HYSD 2NW3A 5FF6A 5C71A 1U8OA 1MCIA 3GK8H 3NACL 4ODWB 4PGBA 4HPOL 1MF2L 4M62H 1YMHA 1EO7A 3VDCA 5H37G 5IIEA 3CXDH 5C7XL 4JQXA 2G5BB 2Y07H 1S9XB 5TPWH 1PAMA 2Y7QA 4KJQC 5A43C 5JLZA 4OTXL 4U0RB 1YEGH 4XP5H 5I15L 3LIZL 3SDDB 3MRKA 1WZKA 1HHHA 5FO9A 4K3JL 5MEOA 1VFUA 1B6DA 2PTUA 2YSSA 3CDFA 2FYYB 4I3GA 4PS4H 3C5JB 5LCVH 5ISZE 2XXCB 5DT1H 4ZFGH 3CJJA 5GIRB 4DZBB 1B2WL 1QVOA 3RWHB 1RHHA 1HZHL 5C09B 1XZ0A 2XWJA 2DQFB 1ERNA 3UJJH 3MRJA 2B1AL 1ZT7B 5DZOA 4KHTH 1H8OA 1XF2A 1RFDH 3FFCB 2AGJL 3NH7L 3OXRA 3NPZB 1OTTC 1JHTB 2I24N 4R4ND 4WUUB 3KYMA 1PY9A 2FX8L 4XNUH 4H8WH 2BNQE 3G5ZB 3LS4L 5GGVY 1OGAE 2XZCL 1NANI 1I9RL 1A7PL 2ZSVA 5E9DD 2A0LD 1AFVH 1EHLL 1ACZA 1P53A 1KTLB 4RISL 3UAJD 1NAKL 1I1AA 1CZ8L 2B2XH 3C60B 3ARUA 1QR4A 1C5CH 2IBBA 1VACA 4RMSA 5INCA 2WW8A 2VUOA 3QIWC 1BQHA 3KYOB 3LN5A 3NFPB 3TBWB 3L7FA 4CW1B 4GH7B 2GJ6D 1ZA3B 5GSRB 1T2QL 1KSRA 1NGWA 4WU5A 5T33L 1GGCH 2OR7A 3ZYIA 3HLAB 2VXVH 3U2SA 4LCWD 4D0DB 2QHLA 3N1MC 3GO1L 4LPUA 1JJUA 2P8MB 1LHZA 3AROA 2X44D 1AI1L 2GI7A 2W60A 4MMXC 5ID1A 2NTFA 1Z2KA 4PRID 3X13B 3LDBB 3EDDA 1UM5L 2Q76A 4OV6F 1Q72L 5L2KD 1KLFA 3FHAA 4GBXC 5I8OL 4JDTH 4LK4A 3X11B 5IB4A 2AP2A 4MA8H 2V7NB 1W0YT 3LEXB 3MCG1 2V5MA 4BSWA 5D7JD 4JRYA 2FSEB 2NQCA 1F90H 1MIEH 1W72B 1OF2A 4O2EA 3UBXB 3E6FB 3AUVA 4U4BA 1X7QB 3JVGA 5DMKB 5I30L 1EERB 3OBAA 3MO1B 1NUGA 1HYSC 1QFUH 4JM2C 1NCDL 1YN7B 4DKEH 3EZ8A 2CK2A 3MRCA 2RAMA 4MAUH 2J6EL 4YHKH 5FUCE 4YX2L 3UTQA 1MELA 5EZIH 1LO3H 4PJ5D 2VDOH 3MACH 1VFBB 3QO1A 5E5RB 4P49A 3MRFA 4P99A 3RWDB 1IGJA 4APQD 5DTFA 1FPTL 1JRHL 2ENSA 2JK5B 5DDHA 5CP3A 2XOTA 1LK3L 2QSQA 4F7PB 2IG2L 3S88L 1RZJH 3D3VD 1INQA 1MHHB 4MS8D 1LO5B 2YUZA 3KYAA 4XVSH 6CGTA 3VXNA 4ZUTA 4HK0B 1OGTA 3NCJH 3VFWB 2A83A 3KWWA 4RZCA 4PJDF 5EUOE 1D9KD 5C0CA 2Y1VA 1OP5H 3TV3H 3CC5B 1KEGH 1CLZL 2XQYG 1NUFA 3U4AA 5EIQA 3DETC 3SKUD 4PB9L 4P57A 3WFCL 3ILQD 4NNXA 1RSFA 3C6LB 4JJHA 5FDWA 2BDNL 5AYQA 1JPSL 3C5ZC 4FQQB 2BVYA 5IVNA 1C5BL 1NCCL 2PXYB 1T0NB 4NO5A 5KVGH 3NA4A 3VXQA 5EPMB 2HJLB 3SQOH 1EAJA 1FQ9C 2HN7A 3MRBB 2FJHB 3BUYA 4LVEA 2OMNA 1Q0YL 3I02B 4HQQL 1RUML 1KCRL 4LQ1A 1CGSH 4P23D 1INEH 4FMKA 5M94B 4L4TA 3UAJC 3CU1A 1EEZA 1H3GA 2R1YB 1QRNB 2O61A 1UWGH 4UIMB 4R8WL 3RKPA 1QA9A 2VLRE 2H9GA 5FUZH 5DS8B 3OKDA 1JTOA 1JYNA 2HAZA 1QEWA 3EOAB 4NFBA 1IT9L 1ZA6B 4X4ZA 5EB9A 2JJSA 5EOTB 1I75A 3KJ6L 2FATL 2HG5A 3PWLB 4GKNA 3ROLB 3OJ2C 4UB0H 2JB5H 2D0FA 2FHFA 4JFEA 4XC1L 3WJLC 3WUZA 5GS2H 4JM4H 3K2UL 1FG2B 1V3LA 3MPCA 4RGNC 5JIPA 3PNWA 4N8VG 3HE7B 3D85D 4NN6C 4YHZH 5KBNC 1R3JA 2EO9A 3QIBB 1WIUA 3EYVA 1U8KA 1WUNT 2ARJQ 4ZSOB 2JE8A 3TM6A 4YXHH 3B3IA 5DHYA 2FB4H 1UJ3C 1E6JL 1P9MC 1T1XA 3MNWA 1F00I 5FV2A 4NKDB 1S7WB 4HKXA 5HJ3B 1QTYT 4OZIA 1SQ2N 4K7PH 4HD9A 1N5AB 3HI6H 3G5VA 3D0VB 1EFXD 1MCRA 2VISA 5C8JA 1LD9B 4YPGA 2BOBB 3RDTC 2EKSB 4KFZC 5I75B 1DFBL 1T89A 1NC2B 1IJ9A 3OHXA 3PWPB 5GSVA 3TN0D 3MLXH 3QG7L 3SY0A 2GJZB 1OLZA 4Y19D 5DD5H 2WV3A 2GUOB 5C0EA 1UXSA 3B9EA 4C4KO 3IFOB 4XP6H 5SX5H 4S1DC 3BHBB 2VDPH 3VFMB 3GMQA 3MBXL 3V0WL 3SGDI 3JWDC 1F5WA 4EOWL 4UQ3B 2ZJSH 5L2JA 4FQ2H 1LWRA 4V1DD 2IAMD 5I1GH 3QCTL 5LQBH 3VGBA 3L9RB 4KK5D 4QYOB 1JP5A 3PWVA 3C6SA 5HYJD 2Q3ZA 1G7IB 1KCKA 4JZJB 2X05A 2PTTB 1U8HA 5DZLA 1AH1A 4L4VB 4B5EA 3L6FB 3M17B 1ZXQA 4NDMA 4HS8L 5T3XD 3MBEA 3FB6A 4JG1L 1DQQB 4QT5B 3KLDA 1CTNA 1FN4A 3QI9B 4CUCA 3ILQC 3LKPB 1A1NA 2DM2A 1NKOA 1ED3B 2FH8A 3R0MA 4L1DA 4RX4A 3GGWB 5GGTL 3SCMD 2EH7H 4KJWD 4H26A 5FYJE 1JMZA 4UOW0 3RVXC 1WIPA 3AXLA 3LPFA 1AQDA 3QUMA 4WGVB 3X17A 1ZHLB 4UV7H 4GAGH 5I18H 3HS0B 3GJEB 4ZD3H 4JDVA 5GGSY 3BSZL 4OGZA 2K9UA 4GQ9L 5C07E 2JCCF 2P46B 4ZO6A 1AP2A 4PV9A 1FHGA 4ZDHA 1B4JL 3FO9B 1MY7A 4OB5L 3FB8A 3KHOA 4JY5L 1T20A 4NRYB 3EOTH 2HRLA 3UJTH 2F74B 2YPLE 3PV6A 4GO6B 1RU9L 1M05B 3LEYH 1MRCH 1KIPA 4YXLH 5C08E 1MQKL 5ACZA 1W0WB 1MFCH 1PKOA 1U8MA 4G42A 3FTGA 2F8XC 1AGCB 1R5WA 2VYRE 5HD8D 5D96C 4KRLB 5JOEA 2FR4B 1P7QB 3ZSTA 1RZKH