4RNRA

Crystal structure of broadly neutralizing anti-hiv antibody pgt130
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
218
Chain Sequence
VQLQESGPGLVKPAETLSLTCSVSGESINTGHYYWGWVRQVPGKGLEWIGHIHYTTAVLHNPSLKSRLTIKIYTLRNQITLRLSNVTAADTAVYHCVRSGGKPHWFSPWGPGIHVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Classes of Broadly Neutralizing Antibodies within a Single Lineage Directed to the High-Mannose Patch of HIV Envelope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PGT130 Heavy Chain
total genus 32
structure length 218
sequence length 230
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rnrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rnrA01
1EFXA 5DJ0B 3GM0A 4JPVL 5C07D 3FT3B 4Q6YA 5EU5B 1MJ8L 3GMRA 4IMKC 4M62L 3ARDD 3V4UH 3B2UC 1XCQB 4DCQA 1CD1A 1LP9E 2IF7A 1PKQE 4FP8H 4NSKA 1H5BC 5HDOA 3M17A 4LCWA 1A5FH 2FB4H 3PXJA 3S36L 3SDXA 4M7ZC 5H94A 2VL5A 2E6PA 5EC1A 4PJ8C 2BRRL 3V6OE 2OL3L 1D5ZB 1FG2B 1H15B 5EIVA 5D1QC 2ICES 5BRZE 5F1IA 2WP3T 3EZJB 3LD8B 4DZ8A 3M1BA 5LWYH 1DSFL 1O7VA 1H5BA 5ISZE 1G7MA 1M05B 4CVXB 4R8WH 1V3MA 4NQSB 3RWHB 5DI8A 5FO8A 3ETBF 4K7FA 1NFDB 3BP7B 4FFYL 1J0ZA 3CVHH 5BQ7A 1HEZA 2X9WA 4GH7B 5C0GB 4LAQL 2PTUA 4LCUB 1U8IA 3K8LA 2EDOA 4JZJA 3N85L 4YHNB 4R4ND 2D31B 4UT9L 2WZPD 5CWSA 1T22A 1CXEA 1SY6H 2YUWA 1FSKC 5GSRA 2ZUQB 2OBGA 4KKCD 1DE4A 3HE6D 3GMPA 1GYAA 3TZVC 4HG4K 2VLKB 3ARRA 3GJFH 4TPRH 4LCWB 1OM3L 4KJWD 1JK8A 2RCSL 3R8BB 4LLYB 4F7PB 2X5PA 3QNXA 5ISZA 4QOKB 1ZA6B 5DJDB 2Q7YB 5GGSY 2OMNA 3ILPB 5AD0A 1OCWL 4UINL 2R15A 1RHHB 3WNNA 4IS6A 3CFJB 3TA3A 1WFUA 5B39B 4WTXA 4L3EE 1XF2A 1Z6JT 4DQOL 2R2HB 4J1UA 5I9QB 5DJXB 5BZWA 4Q97A 4D0DA 1RIHL 3EYUL 2MQCA 3NCEB 2HRLA 2F5BH 5DJAB 3ZYOA 1B3JA 2EDFA 2HMIC 2HFFB 3CSYA 3N0PB 3C5JB 2V9QA 3STBA 3SEPA 5IJVA 4EXKA 3SQBA 4PGJA 5CFHA 4JQIL 2E7HA 1C1EL 4KDTC 3B3IA 2VDLL 2CIIB 2A73A 4L4TE 1CFQA 2YD5A 4JY4A 4M6MH 4S1RL 4OZGE 3PQYE 5F9OH 3VJ6A 1N6QL 1OQOA 1E6JH 3IXTA 4O2CB 1K8DB 1ZHKB 3MJ8B 5TDPB 1PW3A 2X4RA 1FJ1A 3GM8A 4O5LH 1F6AA 5D2LE 3T0AA 3FMGL 4DGVH 2JB5H 4H25B 1NCWH 5BJTA 5ISZB 3KWWA 1KC5L 2PO6B 4HIIA 5EUOB 1A6PA 1S7SB 1MFBH 5LCVL 1S7RB 1F90H 2N7AA 5B3NA 4JAMA 3RVWD 3VXUE 3VFMB 1OARL 1CDHA 1LD9B 5B3JF 4FQ1H 4FS0A 4N9OB 5M7QA 4ZFOL 1E6OL 2F19H 4KI5C 4P57B 2UWEB 3KNBA 4HC1A 1PQZA 3QO0A 2JIXA 3BD3A 4PYGA 2R4RH 1MLBA 3HFMH 2WBJA 1YMMB 4MLIA 3MREA 2W9LA 4JDZA 3MA9H 2L7JA 2MHAA 4OZGA 2XZCL 1OSPH 3TN0A 1XH3A 3HE7C 4PV9B 4Y16B 1DDHB 1BVLB 4NRYB 4GAGL 5ACZA 3NABL 1Y18A 4JKPH 5ACMA 1EO5A 1LQSR 4FFVD 1BD2B 4PYHA 2VLMD 2J6EL 5D7SH 3QFDB 4K94H 3E8UL 1AO7B 4X6BB 3RVUC 1J1OH 4ONFL 3LHPH 3RRQA 4JY4B 5JQ6L 3IFOA 2HKFL 4YDJB 3WS3B 3ZLQC 5LG1A 2PKDA 4XP1L 3H7BB 3WFHA 3LS5L 1ZGLP 5HBBA 1KIPB 4WV1B 1GC1H 4GBXA 3SDCD 1UEMA 2OR7A 3O3UN 3VRJB 2B5IB 3ARBD 1CLZL 1FZJB 2H2SC 4XPHH 3PWLB 1OARH 4NFBA 1WBXA 2NY1C 3AUVA 4I0PC 4M1GH 4L9LA 1CQYA 5IESH 5FDYA 1I9JH 4JFHE 5E03A 4LVNC 4X83A 2EYTB 4RMRA 1NBZA 3TZVA 3ZTJH 3K74B 1NC2A 4FQXB 2EXYC 1S7WA 1EVTC 3C08L 4KK6C 3LV3A 5FHAL 4FZ8L 4LKCB 4X4MA 2VAAA 3I2CL 4H26B 4JG1L 4JPKH 4HBQA 1GXEA 3PWPA 2IWGA 3QEGH 4K71B 4GRLD 4PJXE 4DUVA 1CL7I 2FL5B 4K3JH 1A7RL 1V3JA 2FX7L 2LQRA 3MCLL 3QXWA 5F72S 4HD9A 3G6DH 2W91A 4LCCA 2W9EL 4NJ9L 3RTQA 5AYUL 1A14L 1J1XL 4J4PA 3FN0H 1KCRH 4AH2A 3KYOB 4BZ1L 3MV9A 4P3CH 3BN3B 2VUOA 4GLRI 1RULL 3C5ZA 4OGAD 5EOQL 4LRNH 4ZFGH 4XCEB 3RL2B 3D39E 4QRUA 5D1QA 1MQKH 1UWEL 3J7HA 4ZS6C 5FGBA 1KOAA 4Z7VA 3VXQB 1P4LA 2JB6A 4OFYD 3IRZA 4KRPB 2W92A 1AJ7H 1YYMH 1A2YB 5IM7B 1NGXA 3CLFL 5ABDE 1NPUA 4XCCL 4R90L 1NAML 1IBGH 1G7JA 5E95B 3PWPE 3QCVL 5DD3H 3IF1B 3D85D 4Q9RH 1OPGL 3JWDH 1HYSD 2ZSWA 4N1HB 2MQ0A 5GHWL 2AEQH 4YR6A 3OKOA 1IEHA 5F93C 4PRIE 3TT3L 1FAIH 4U4BA 3W0WA 2J8HA 1F8TH 1A7OH 4TNWK 3TT1L 2D31A 4QLRA 2DQDL 5EZOH 2R2CA 3HUJB 3AM8A 3GMPB 1MCCA 3LKSA 4MXVF 4EDWL 4O5LL 3LEYL 4NN5B 3WSQL 1I1FA 3KXFE 3R8QA 5I1CL 5KOMC 1WSST 1ZTXL 1MJUH 2GTZA 2ZWLT 5J0BA 3VGEA 2P5WE 4I3SL 3MV9B 2XQBH 1EEQA 1DP0A 2LAAA 3RAJL 5ITBH 1T1ZA 3E1F1 3I3DA 2X4QB 3VI4F 4YFLF 4HMEA 2H8PB 5JMOC 3WXWH 1FL6B 1H3VA 2QEJA 4M48H 1J05B 4HCRH 3VWKA 3P4LA 3V4UL 5HD8C 4N0RA 5TF1H 3W0WE 5L2KD 4S1RH 3P9LA 2FCBA 3CD4A 4TUOA 3QIBD 4G7YH 1KELH 1CCZA 4N0CD 3R06A 3CPLA 3PHSA 1HSAA 3MBXH 5C86A 4IRSD 1I3VA 4FA8A 1Q0YH 2V17H 3QZWB 5FK9B 3L7EB 1FFNB 1Z3GL 4MJ5B 1HDMB 2ZSVB 2MKWA 3HUJA 2A6KA 3LQAL 4RA0C 1OTTD 4QTIH 4BQ8A 5JR1L 1YQVH 2Y5EA 3TO4C 4IM8A 4PJGE 2IMMA 5DWUH 2V2TB 1BF8A 5D1XD 5JW5A 2VXUH 4XP9L 4Z8FL 1DFBL 1NCBH 1MCLA 1DBBH 3VGGA 4PV8B 5GRZA 1UCBH 4UTAH 1R3IL 2VE6B 5D4QA 5C0DB 1NMBL 3S6CA 2HJFA 2E9IA 2D9QB 3LMJH 3S34L 2NXZD 4TOYH 2AXHA 3D3VE 3K3QA 4KV5E 5ERWA 3PF2A 2GSIA 1KV3A 1NDMB 5DC9B 3WNLA 3H42L 5D1ZB 2FH8A 3EOYG 2OK0H 4RMQA 2YRZA 2CLVA 4UQ3B 4ZXBD 3S5LB 1D5XA 4POZD 3VXRE 3THMH 4GG8B 1RK1A 5HDQH 4ELKA 3S35H 1ZK9A 4F58L 3LN9A 3GSQA 1CYGA 4XP6L 5I8KH 3BH8B 4PJGA 5L6YL 2OR9L 4PJEB 1E4XL 5ALCH 4EI5C 2LU4A 4YDLB 3O6LL 5T1KA 5D7JA 4N68A 4UNVA 1FC2D 4I4WA 3QUXD 5IHLB 3LH2H 2DLTA 4ODTL 4P4RA 4KKAD 3QDGA 4IRJA 3G6AA 1S9XB 2X4SA 3WFHB 3BUTA 2DLGA 3BUYB 3MOAL 4XX1E 4PJ5E 5CD3A 1ZXQA 1IGIL 5IW6B 3T0WA 4J3XA 3ROOB 4CNIB 4CJ1A 1P2CA 1DFBH 4A6YA 4BFEA 3P4OB 3MOBH 4U1LA 5INCB 3GIVA 5FUZH 1OTTC 3OAUL 5SWZE 4Y4FA 5FUCC 4HK3J 3OZ9H 2DQFB 2VLJD 4N1CA 3UTSB 3JV4B 4XMLL 4Z78A 3G5YB 3VRLE 3DVNB 2EKSA 1MI5A 5C09B 1PZ5A 3H42H 1WZ1L 5IB4A 3LPWA 2Y06L 1D5BA 3EO0A 5FM4A 2BNQB 2ICWI 4ELKB 1Q1JL 1FAIL 2GT9A 4UU9A 3Q6FB 3MA7B 5E00B 3C8HA 3MRJB 1QSFA 1ZT7B 1LO3H 2QADC 1OAUH 3DV4A 4P59H 2XWBA 1FYTE 1GVIA 5CS7A 3DGCR 4TTGA 3LEXA 1E4XH 1G9MC 5ALCL 5BVPL 2Q8AH 4QCIB 4JN1L 1AO7D 4HWZB 5EPMB 4G6KH 1RIUH 3MCG1 4CVWA 2QHRH 3A67H 4WUUE 2PYEB 4IRJC 4DFIA 1WAAF 4P5TD 2OP4L 4UUJB 3LRHA 1I9RH 2HAZA 1B0GA 4QY8B 4S1QL 1AHWC 3JXAA 2XQBL 2CDEB 2JJWA 1IGIH 3V4VL 3LD8C 4NQCA 3WIHA 4HPYL 3ROLB 2GITB 1R24B 5HHNB 4CMHB 3NN8B 4NKOA 1FORH 4NNYB 3GBLA 4LPTA 4P9HC 1NGZB 1XGRB 3UTSA 3H3PL 3QT2A 3D3VB 4OI9A 5EZJB 1G7JB 1G9EA 5AAWA 3RI5K 1IQWL 5C09A 1EDQA 5IOPA 1RZJH 2HVJB 1MCWW 4U0QB 1KCUH 3KPSA 3K4AA 3LEYH 3UTTB 1J1XH 3NFSH 3GSUA 1C12B 5E00A 3KG5A 3MOQA 5K9KA 1NGQH 1MH5A 3C60C 4OSUL 5DS8A 3QDHA 3B5TA 4P59L 1CFNA 1PAMA 3RWFB 3FT2B 2DMCA 2I9LB 3T8XB 4HUNB 1BQHG 3C09C 1S7XA 3B2UD 1MRFH 2QQKH 2FO1A 3HC4H 3VXSD 5FM8A 4RGOL 1Q94B 3EAKA 5DJ0A 3CXDH 1HHGB 4NO0A 2PTTB 4Q9RL 5CJBA 2GI7A 3BO8A 3QNYB 1VFMA 3WD5H 3T0BA 3QO1A 1TJHH 3TT3H 2XTJE 1FH5L 4NPYB 5JIKA 2B4CH 4LARL 5DUBB 5EORH 1KPUB 3CVIL 1EVUA 4LPXA 1JZ3A 4LRNL 1I9EA 3RX7A 3NCCB 4ZO8A 4CADB 4RFEA 1FNEB 3DIFB 1B6UA 2WK2A 5BRZA 2FD6H 2ZOKA 1SM3L 4JB9H 4HXAL 4G9FD 4UZGA 3QIBC 4NQDB 1IBGL 5FECA 3SE9L 3AS0A 5JORB 1CGSH 1BLNB 3L3IB 2R29L 1I1AB 1JGEA 2Z35B 3QEQD 2OR9H 5HVHB 4U33A 4FQXC 2ARWA 1OLLA 3KJ4B 4HUKB 2DIBA 2J6EA 3D2UB 1EERB 1NFDA 5FGSA 3U79A 1F3DH 3CNKA 1ACYL 1AGFB 3ULUF 2VLJB 2VDML 5EOTB 1I1YA 3ULVE 2BC4B 3HE7B 1L0QA 2JJTC 5CWSB 3B5GA 2IBZX 4RIRB 5DJYB 2JTDA 3K2UH 4BSWA 3LDBC 3DBXA 4OCNC 1WF5A 2AK4D 4HGWA 4XZUB 2IANB 5BMFL 1R3HB 5E70A 1ZTXH 4FTVA 2GQHA 3GSOB 1F8TL 1ULVA 2JJVA 5C7XH 2BNRD 1FL3A 3QUXB 1D3CA 2DQDH 4DFHA 1KPRA 3QWRA 4JPWL 3T4YB 3ES6B 1N5YL 5AD0B 4PBVC 4JQXA 4HKBB 1CWVA 2IPKB 3CFJA 4HIEA 1V5JA 4M48L 5ESQA 4YLQT 4PY8J 5KN5A 3MLZH 5I1AA 1DQML 3TBYB 2I60L 5DJXA 1NH6A 4NM8L 1BZ9A 2W9DL 1JGEB 1XGUB 1U8PB 4MJ6B 2Z93A 1T3FA 3SE8L 3CAFA 2QQNL 1CFVH 3ARBB 2H3NA 2DB8A 4Y8AA 1JGLL 1QSEA 5E7BA 1YPZA 1II4E 1K2DA 2R2BA 5T1KB 2HG5B 4CVZB 3STZB 4HAFA 3A67L 2CKBB 5GISH 2MWCA 5CIPH 3QQ4A 4H8WC 4WUUB 4PJCB 3X3GH 3BW9A 2BC4A 1OGTB 3VXMB 1MRDL 4HHAB 3RHWF 2AV1B 3FN0L 4YHPA 1P84J 2FGWH 3GI9H 1K8DA 3QQ3B 4PJIA 5D2LA 2IEPA 4UB0H 5J1AA 1P7HL 4MJ4A 2XKNA 4HKZA 5BJTB 2BHUA 2VN7A 4NM4H 2D7TH 3X14B 4J23A 3W39B 4HW6A 3CLFH 1P4IL 3P0YL 2W07A 4LF3A 5KZCD 1QSEE 3EFDL 4YWGH 4I2XE 2F74A 5HHXH 5SWZB 1DQMH 3HI1A 2KBGA 3JVGA 1U6AH 3VXTB 4U6HA 5I18L 4XCYB 5TFSH 1QR4A 3RGVC 1ZHLA 5AUMB 2AK4E 3NH7H 4MNQA 5FYKE 1T2XA 2R0LL 2QQNH 3GRWH 3U46A 4JDVA 4NT6A 5JLZA 1KB5B 2PW1B 4YEFA 4P4KB 4HXBH 5CSBA 1JRHI 2YD8A 4I0PD 4EN3A 4HFWB 3HNTL 3M07A 2XN9B 3CDFA 4YXHL 2VR5A 1NDGB 3U9PH 2Z8SA 1Q9OA 6CGTA 1C5CH 2NY7L 4M7JL 2Z31C 3RIFK 1HHKA 4GKNB 5HDQL 3U9UA 3DVIA 2VZ1A 4O2EA 1KG0A 4BYHA 3TN0C 3MLSL 5GS1A 1MFAH 1P9MC 3VXNA 1BAFH 2NYYC 1EUUA 2F58H 4MB4A 4G6KL 1EEUA 2P5ED 4ELMB 1FRGH 3QHZH 3AY4C 4NZDA 3C6LC 2WV3A 5F7HA 5DHYB 3QG6B 2BHYA 1RMFH 3ULVD 2PETA 5JOPD 3PJSA 2NY4C 3UTTA 2FIRT 1IM3B 3VXTA 5IMLA 3TCLB 4YHML 3HG1A 1K4CB 4JFDE 1A4JA 3CFIC 4PY8I 4NQDE 1M7IB 2DQTL 5J8OA 4CU6A 1BQUA 1IEAB 4P5KA 1R0AL 5HI3D 5IQ7L 2YD9A 3P0VL 3P73A 1TFHA 5DK0B 5C07A 4EQ2A 3QIWC 5DVKA 4PTUB 5D7IF 5GRJH 2ICWA 4WI2A 2OTWA 3K2MC 4PRHD 4QWWD 5C08D 4Z7OF 1RIUL 4ZAKA 3U9PL 4HS3B 4P5TB 1SM3H 1N5AA 4I9WD 4LMQI 4X6FA 3BO8B 4GKNA 4XNMA 1DBKL 4FNLL 3BT2L 5GGQL 2WSKA 1NKRA 1IKNA 5SV4A 2WAHA 5GS1C 1D6VL 1XAUA 2NYYD 3BKJL 4HPYH 5IV2A 4QHMA 2B5IC 5ILTL 4LLWB 1VADB 1BP3B 3BE1L 3G9VA 4DUXA 3QWRD 3SGDI 1JZ6A 1T0NA 5DHYA 1RZIB 1UA6H 4NQDA 1JYVA 3STLA 2VDPH 5KSUB 1MFEH 2X2YA 1KB9K 4IOIB 3VE0B 4CU8A 3IFLH 4NOBA 4UIKL 1QRKA 4IRZH 3QAZC 2DQJL 2QSQA 4W6XB 2BRRH 1M7IA 3CFCL 4H1LA 3CVIH 1MSPA 3AXLA 2DM7A 3BOVA 2OZ4L 1RUKL 1BJ8A 1WK0A 2ICWB 1AO7E 2FD6L 1MRDH 3RWJB 1KCUL 3QUYB 3LRSA 3DMMB 4JANA 4R8WL 4LVEA 5I17B 2QTEA 3PWVA 5BOZG 4M02A 3BX7C 5EZLA 3BZFA 1CXFA 4Y19D 3IDJB 1NAMB 1U91B 3RGVB 1HKLL 2AABH 2IH1A 5DJ8A 2DBJA 3KXFA 1EAJA 1ZHKA 3MJ8A 3M17B 3BAEL 5CINH 4LLWA 1H3GA 5CGYD 2OTUA 5TJWK 2UUDH 2Q8BL 4HIIB 1YEGH 4KKCC 4JFEE 5T3XD 1OP5H 1D9KB 2VDMH 3CXDL 4M1CC 2ZUYA 3FQUA 1G9NL 4X4XA 3KPMA 3QXAB 2JIXB 1NL0L 3T4AA 1KEML 5INDA 3EYVB 4U1KA 4BJLA 2O5YH 1VFOA 2DTMH 3QHTC 1PX4A 4P2OA 3B9AA 2XY2A 3ESVF 5C0GA 3OR7B 1WBZB 3DX9A 1S9WB 4P2RD 4ZODA 1LDSA 1DDHA 4NRYA 3B9KB 5FB8B 4HV8A 4BH7A 4LLQB 2DQUL 3BW9B 3SDAA 3MACH 4QRQA 4R2GC 3V6ZA 3EIFA 1B2WL 3WFEL 4F57L 5HHMD 2XT1B 2D4FA 3WIFA 4MD4A 2A9ML 4WW2B 4LL9A 2Y9RT 3MTRA 4M7LT 4OGXH 4L8CA 3MLYH 3UXFA 1Q0XH 3FQWA 2A6DA 4Y4HB 5IVNA 2GY5A 4WW2C 1M71A 5F7DB 3HS0A 3SCMD 1JPGA 4ZFFA 2JIXD 1QPXA 3VFVA 3MUY1 1INDH 4QOKE 4HDIA 5IFHL 1KEMH 4GMSH 1YEDB 4GAFB 1ZLWK 1RUPH 4DN3H 4G3YL 5T3ZL 2H9GB 3VXRA 5EA0H 3Q5TA 2W9DH 4QXTB 1EH9A 4FQXA 4ZO6A 3T77B 2R1XA 1XGPB 1UKQA 3VMNA 1S9WA 3DX9B 5B8CA 4QHLB 5I30H 2NY2D 1A6AB 2YSSB 5DFWH 2VAAB 4H26A 3CJJA 4J3OC 4PS4L 3IDIB 1KYOJ 3REWB 5K33A 1X5LA 3BH8A 1JGUH 3WHXB 3KGRA 1BOYA 1RZGA 4ZUUA 4PRHA 3WFEH 1Z9SA 4PRNB 2AGJH 3BFOA 4AEFA 4HIJA 4OF5A 3VWKD 1WCQA 3ARGB 4GRMB 3INUH 3Q3GB 4R7NB 2VOTA 4KI5D 2HFEB 2EICA 3PUCA 2AI0L 4Y1AA 3GBMH 5E6IA 1G6RH 3LKPA 4MNGE 1EXUA 2VLME 3KPRE 4CGTA 3SDDD 2ADJA 3I85A 2V2XB 4AEHL 1P7KB 2J8UB 1TJGH 3MRHA 3QUYC 2XWJA 3BHBB 3TVMB 4E41A 1AXSA 4OLVL 1AGEA 5TGBB 4IRZL 2ORBH 2Y5TA 4ZOAA 5IKCB 3WDIA 1UM4L 3MLVL 4QXTA 4WRLA 4F7MB 4HIXH 4PTTB 4LSSL 4Z7UE 4HZAA 1H0DB 4MCZB 4AENB 4HFUH 3TBSA 3T3PE 4KHXH 5CEYB 2DYPD 3CH1A 3NIFF 4IEFB 1CR9L 1N7ML 4YAQA 3BQUA 1A64A 4DCQB 1JZ2A 4L8SB 1SVCP 3KPRA 2WUBL 5F8RC 2K3TA 3SHSA 4LVNB 4GBXB 5DFVC 3RWEB 5HY9A 2P4AB 3C5ZD 4PB0L 5ENWB 4P5MA 1QLRB 1EMTL 3FTGA 2HVKA 3ROLA 5GRUH 4OZHB 4YZFF 4I77L 1T1ZB 1GAFL 2E7LA 4AEHH 2DI7A 5IB3A 3IU4H 4H5SA 3AAZB 4MHHG 2D3VA 3I50H 2V7HA 3L9RA 4M7JH 1RMFL 3RWHA 2BNRE 3BT2H 3E6HA 3TPUA 1HH6A 1YPZF 3BP7A 1R3KA 2JKXA 3FOMA 3VFNA 1F4AA 2DICA 4B7IA 4ETQA 4ZAKC 2D7QA 2M26A 3W2DL 3TBSB 3PWPB 3CDGB 1ZSDB 1KJ2A 3X17A 3TBVB 1GPOH 2V9RA 4K07A 5SWSD 4WWKD 3NGBB 3D0LB 4OIBA 1J0YA 4K7PX 1L0XA 4BSVA 1BGXH 4NKMA 1F58L 4OZFB 4LCCB 1WTGT 3K1KC 4YXKH 3VFPA 5F9JA 1DBKH 4FNLH 1U42A 2CPCA 4QEGA 2QSVA 1FC1A 3UYRH 5I73C 4GBXC 4BM7A 3U0PB 3SE3A 1P84K 3BD5A 4OGYH 2LU3A 4S1SH 5JOFB 2UY7A 4XBGA 5IB3B 1ONQA 2XKSA 3SCMA 3O45B 4MDIA 5C0BE 3F5WA 5BZWB 3BE1H 2Z8VC 4TULL 2GJ6E 2ZUQC 2IADA 3U4BL 1F13A 3RKPA 2EDTA 3OKLB 1R3JB 3C5JA 3ARDC 4NYLB 5FKAA 3PL6C 1AD9A 1PFCA 2YA2A 1A3RH 3ZDZE 4HQQL 2BY2A 4IRSA 3WL9A 1YNTB 3KPLA 1I1AA 1CD9B 1S7VA 1KJ2B 3BIAX 3GSQB 4JFOA 3B9KD 4JVWA 1QO3B 3RVUD 2VISB 3EJJX 5HGGS 1F11A 2J88H 4WUKL 2H26A 2DWDA 3QPQD 35C8L 4F7EA 4ODXA 2WMPA 1JTTA 2AK1H 3P40A 4ZUSA 2OJEB 1A6TA 3L7FB 3G6DL 4OV5A 3CZFB 4HK3N 4M00A 1DVFA 4LSRL 5IBLC 5JW4R 3V5HB 4Y5VA 1J0KA 4BFIA 4HGWB 1KJ3L 4XZUA 3C8KA 1T7XA 1KGCE 4GOSA 1F3JB 3G9AB 5E8PA 5K9QG 4R96B 2AJSH 2H45A 1KN2H 4F37K 4Y4FB 4JKPL 4XXCC 3VFVB 3H9HA 5A2JH 1FPTH 2IADB 2DL2A 2AEPL 2IAMA 2DBLL 1NAMH 3MV8A 3SKJL 4QKXB 4Y4FC 4EIGB 3BAEH 4KDTA 2EH8L 1KBGL 4QHLA 3WJLA 4NHUA 4NZTL 2COQA 5D70L 3O2WL 1HOCA 3UROR 3QFDA 1T3FB 5AWNL 5I8EA 3H9SA 1FL5A 5GZOD 3X3FL 2ZSVA 3UP1A 2XOTA 4FQ2H 3O2DA 1B4JH 1DEDA 3WS3A 1A3QA 3EOTL 2V2WA 1IC5L 4XPHL 3UPRB 5SX4I 3MYZA 1FYTD 1KTDB 3BGFC 4Z0BL 5JXEA 2K7PA 3UAJD 4AYFA 3BZEB 3ARSA 4LSRH 4RGMB 1YC7A 3K46A 5C8JB 4NRXB 1A6WL 3PXHA 1X6NA 2XQYK 1F3RB 1OM3H 5DGQA 43CAB 2D7PA 4NNYA 5I1KL 2HFGH 1U3YA 4BQ6A 3H9HB 4IOFC 5IW3A 3G5XA 1KIRA 3GK8H 3NGBC 4DN4H 3MRIA 4XBPB 2X4UA 3U7YH 2GTWB 1QFUH 2R0ZH 1YMHB 3QR2A 2DQGH 4U3HA 4DQOH 3PV6A 2GHWB 5HYQA 4K2UH 3NPSC 2EDQA 3EYUH 3W2DH 1CDUA 1I7ZB 5DC0A 2AK4A 1HOCB 4KV5F 4PB0H 3CFDB 3WIHL 1RUQH 5IB2B 2NTSP 4JZOA 3NPSB 2DD8H 1MJJB 2C4XA 1T1WA 3LDBB 5ICXB 4HH8A 1UC6A 2YHGA 4OD2B 3RA7L 3UDWC 2A1WH 3IFPA 2EE3A 2VLRA 4JO2L 4H0HB 1L7IL 3DXAE 1KIQA 5K93A 4FXGB 1UFUA 4NUJA 5IMKB 3ARDB 3H9ZA 5JHDD 1QA9B 4NO3B 2HLFC 4GS7B 1KACB 1NC4B 5IW6A 1F6FB 1GIGH 3C5ZC 3HLAB 5EULV 3K1DA 2NTFA 4LHJB 2D4DA 3NFPA 5DUMH 4XB8A 1DUYB 1FNGA 1RJYA 2NXYB 3HNVL 1IT9L 2R4SH 3AAZA 3PP4L 3BEVA 5EUOF 3GI8L 2CSPA 3QNZA 2IQAA 4M6AA 3ZKMD 4O51A 4R4BB 5J9PA 3BD4A 1DN0A 3DRTA 4MNHB 3U4BH 5HPMA 1CBVH 1NLBL 4YQXL 4OD1H 1JF6A 5IF0A 4G7VH 1XR9B 1R5WB 2P8MA 2YBRA 3NCFB 3TPKA 4K2UL 3OKOB 4XPAL 4UU9B 3MA7A 5A16A 4ONHA 3DXAA 3ECBB 1BBDL 4YPGA 4I0PB 4LSSH 3H3PH 1M6OA 4U0RB 1RZFL 4KROC 1FP5A 5HGHB 2AJ3A 3MV01 5F89A 1A0QL 3G6JF 1PEWA 1CK0L 5F3HB 3WFZA 5A3IC 1EFXB 1FNLA 3LKRB 4PTUA 3NFSL 4U0RC 1QLEL 1LEKB 3T0EC 4Z7WA 2XI9A 3TO4B 4NNXB 4YFDB 3KS0H 1NJ9B 1IMHC 3JV6B 1DVFD 4YE4H 4TN9A 4HAGA 3NA9L 2EH7L 3A6BL 1WICA 3HC3H 4R7DB 1IAIM 4NKOB 5ALBH 1FNSH 4D0BA 2DMKA 4DW2H 1YNLH 4Q74A 6FABH 3F5WB 3X13A 3FZUC 1FL3B 5E99L 2PXYA 2FR4A 3SQOL 1PJ9A 1CBVL 5IFAL 4L8DA 5BCAA 5EO9B 5I1IH 3EJZD 2IFFL 4M5ZH 3I6LE 4CU7A 5DLML 1F5WA 4RGMC 3GMNA 3ZYZA 1RHFA 1M05A 5I1JL 3ARED 1GC1C 1YMME 5CIPB 4JO1L 2CMRL 5LGHL 2BZDA 2PXYC 2HKHH 1CFSB 3MUZ1 4EN3C 1JZ7A 1VGEH 4GJTB 3MMEB 4EUPH 3UTQB 1D9KC 2W60A 2OCFD 4AIZA 1JYWA 1VFUA 1QYGL 2V2TA 3ZDYF 4J4PD 4AQ1B 2P45B 4MA7L 3V2AR 1KTLB 5HXMA 1T5XB 4YXKL 1H8SA 1YYLL 5I8CA 4GG6E 2ESVD 5HYJE 2CRZA 1I9IL 3TYGH 4N8VG 3D25B 5H2BB 5T5FH 3OXSB 3X13B 2A38A 1TZIB 2CRIA 5SX4H 4XP6H 5I8KL 1ZHNA 5C3TA 2JK5B 1BQHB 5GZOC 1YZZA 5EZOL 4ZNEE 2YK1L 4BUHA 1C7SA 3BKYH 3TLRA 3QUZB 5LWYL 4GG8A 3BRGC 4YGVB 5JORA 5EU3B 5CEZL 4KI1A 4YNYB 3B2VL 4UILH 5BS0D 4YBQC 3BIBX 2A74B 4NWTL 1LNUB 1MJ7L 2KZWA 1WJ3A 1UYWH 2BMKB 2CXGA 1MHPL 5E8EA 4OLYH 2RFXB 5BXFA 1G7LB 3QA3A 1VGEL 4XXDA 1IVLA 3VH8B 2XN9A 4H0IA 5FHBH 4CAGA 1SY6L 3DETD 4X7FC 5GRVL 1S7TB 3HPLB 4PJEE 3FQXB 2NR6C 1X5FA 4CNIA 3H9YA 5C0IA 1AE6H 4O02H 2IBBA 4ZYKA 4DTGH 4M6OH 1HHKB 3GRWA 1CU4H 5L8JB 1TJIL 2IH3A 5D70H 5MENB 1N6VA 1FJ1B 4MD5B 4KPHL 1QKZH 1HHJA 3SGEI 1U3HA 1FH5H 3NTCH 4LLUB 5DMIL 4O9HL 3FB8B 4CMMA 1JHLL 2APFA 1U8NA 4HUWA 3O41B 3ILQC 2HT3C 5L2KA 3IDNA 2YA1A 5C9KA 4JPVH 1HWGB 4WDIB 4CW1A 5F8QC 1FPTL 3ZE0E 2GW5A 4R97C 5JHLH 3TFKD 2LU7A 1NAKL 43C9A 2VQ1A 4LVHC 3N9GL 4P9ML 3CFDA 1AR1D 3DV4B 5IROA 4OZFH 5IB2A 4JFFB 5JOPE 3C60B 4Z5RA 3RWDA 1CG9B 2HFGL 3DX7B 4P2QE 3GHBL 4S11A 5FIEA 5TQ0H 1H8NA 1CK0H 4S2SA 2NY5H 1BD2A 4OLXH 2Q86B 1NUFA 1BX2A 4KQ4H 1B4JL 3SKJH 1A7PH 1LO5B 2VMFA 4K3EH 4PP1C 1FYTB 3IAQA 4ZAKB 3RVTD 4HWBH 1IQDA 1GSMA 1XF1A 3F58H 4OGAC 4TVPE 2E6JA 3KPPB 1FNSL 1XIWC 4JRYD 1W0WA 5DFTA 5BS0B 2YUXA 4Z9KB 3Q3GA 4R7NA 1S5HA 3ZKQD 3OG6B 3IAPA 4G8GA 4WV1A 5B4MD 4P2OD 1NCBL 5E99H 5CGYC 4V2BA 2Z8WC 1ROWA 4D9LH 1HHHA 2JELH 3D39D 1C8PA 2DQCL 2H2PC 2NQCA 4P4KC 4ODSL 2X4NA 3MLUH 2XV6B 1TZGH 3MRLB 3RDTD 4DZ8B 5KJRH 2EYSA 3QUXC 4J3SA 1EAPA 1BIHA 3AS3A 2FEEI 4U6HB 4HJJH 1AGEB 2H32B 4YEEA 3QZWG 1ZOXA 5CD5D 1AXTL 2DQGL 2ARJQ 1ZHLB 2ITDA 3KJ4C 5F1KC 1BJ1H 3WEXA 1BAFL 4WEUD 1K4DB 3KLAA 5F7LB 5GS3A 3TZVB 4Z7UA 3T65A 7FABL 5CCKL 2FO4B 3LPFA 2P42B 1C5BL 2AJ3B 5C3LD 1A1NA 2EECA 1CL7H 4MCZA 4PGEB 5DURB 3EYOB 3G5ZB 1OWRM 2P46B 4PP2A 2WW8A 2ADGA 1X5YA 2YEZB 1RZKH 3LB6C 4G8GE 1B90A 4K3GA 3JV6A 2YUVA 1T66D 1NFKA 5CKAA 5HHPA 5KBNC 2NY4B 3FFCA 4Z0XB 5IK3B 3IJYA 1JZ5A 1NC2D 1J88A 2ED9A 3L1OH 4NN5C 2KZ1B 5MEOA 3BP5A 1JK8B 3OXRB 3QDMB 1INEL 2XIDA 5SX5H 1DQQA 3RP1A 4ZMAT 3QNXB 4XPFH 1QEWA 5DA4A 3GO1H 1E4WL 1WZMA 4Z6AT 4LLVB 2ZOKB 4KQ3H 1G6RA 2P24A 4M1DH 4U2YA 1F2XK 2VQUA 1UM6L 1A2YA 4CMHC 2CDFA 3QIWD 2YC1A 2V7HB 3L9RB 3TYFB 4LCCC 2FGZA 4LIQH 4PJAB 4AMKH 3F7QA 3VI4E 3NH7L 1OP3K 4E5XA 5FYJU 5CHNB 4DGVL 3IGAA 2BDNL 5CP7B 1FZOA 1HILA 5HHVH 2NW3A 5KVGH 5SWQB 5E6ID 1NUNB 2UZXB 3D5OF 1UZ6F 1X5HA 1WISA 3TBVA 3ZSTA 5JPMB 3ARFA 2B2XH 5IEKB 4JHWH 1UADC 2ZNWA 3GSNL 1VPOH 4XI5D 1X4YA 5HHPB 5IMMB 1QFWM 2EIZB 1N8ZA 4F37F 2JE8A 4JY6B 2IPTL 3U0TA 4NJ9H 1KN4L 3GUTA 4MAUL 1AI1L 1F6AB 1S78C 4RMVA 4NUGH 4QHMB 5LCVH 5T5NG 5KSVB 1BFTA 5DEFB 4Y4HA 1CI5A 5DRZB 3GSWB 1UB6A 1EEZA 2JJSC 5CLTA 1V7NH 4LLVA 1S7SA 1CFBA 1MELA 1JRHL 2Q7NA 5I2IB 2DJ4A 2J6EH 5D7SL 3VFTA 5C0BA 1VESA 1AGBA 2R4RL 3TBYA 2GJ6A 1ITCA 2BSTB 3N1PC 4QF1B 1QBML 5F9OL 5C2UB 3HNSH 1JIBA 2WM0A 3DETC 4Y5YB 1Q38A 2FJGB 2WBJB 5IR1A 2XWTA 4FXKB 4OIIH 3MJ9H 3CZJA 1MHCA 4K7FB 4AMKL 1T0PB 1K2DB 4KKLD 1AD9B 2HTKD 1W72A 3WIHH 1FZOB 1OW0C 1G0YR 4OLZL 4PJXF 1M7XA 4ZS7L 1ERNA 2XNAA 2YSSA 3I6GA 3QQ4B 1WC7B 3FRUB 3P0VH 5DMGC 2R0KH 1OD7A 3BWAB 1BD2D 2D7TL 3ARFB 3BKYL 5KG9B 1VEMA 1HDMA 3W5NA 2BSSB 5EZLB 2YPKA 4M43H 1K85A 2D0HA 3MLTA 2C3HA 4XC3L 4EUPG 5MENA 2ICCA 4HK0B 5JQHC 2YUZA 4ZTOL 3LKNA 3NCBB 1YYLH 1TLKA 3PP3H 3QULA 4X7TB 2HRPL 1RHHA 3BN9D 4O00A 4PV8A 5ILTH 2LTQC 4G8FB 1EEYB 2I24N 5I19H 5E8PB 1FZMB 5EUKA 4GW4B 3O3DB 3S98A 4G8IB 1OQXA 1YY8B 4M8VA 1U8OB 2O5XH 5JHDB 1RUML 4UOJA 3MNWA 2HKFH 3F12A 3K81A 3PL6B 2OQJB 2CIKA 4J6RL 5DJZA 4HXAH 2IAMB 4JFXB 5J13C 4JFFE 4XVUD 1NC2B 3S4SA 4JPKL 4GW1B 1W72H 4L4JA 3U46B 5E08L 4UILL 3JTSB 3VFGH 2X89A 2N56A 1H3WM 1NEZA 1MIEH 4OLZH 2Z0BA 1HCFX 4FABL 3D9AL 1KCSH 4FZEH 4HS8H 4Z7NF 1LWRA 4LASL 1D5IH 4PJ8D 1XF5A 3L5HA 2BY0A 1K3IA 2PXYD 1LDPH 3E2HC 3ULVL 2CD0A 4PJFA 8CGTA 2LV4A 1FV1A 5T1MB 4FN0A 4XC1L 5DMJB 5AYUH 2EIBA 4MX7A 4GSDH 5IW1A 3QDGB 4P3WA 5F6HI 3B9DA 3BUYA 4H88H 4KDVA 1CVRA 3VXNB 3SE8H 4EI6A 1MCDA 4X7TA 4WW2F 5CUSL 1J12A 2IPUG 2VDLH 4W81A 5FYJE 3QEGL 3BIKB 1RZ7L 1GGCH 1IC4L 2J8UE 4Y4KD 1A7RH 2QBWA 1CXLA 4DTGL 4TSCH 2GTWA 4OCMC 4U7SA 4LCIH 4WFHE 1QFWH 3FMGH 5K59E 1RUAL 3WSQH 3GMLA 2VLKD 3TZVD 5D7KD 3TN0B 3Q48A 1QSED 3N9GH 4P9MH 4N90E 4WTZG 5IP4A 5HPOA 3MRRA 1NGYA 5CSZB 1ADQA 2JELL 3GO1L 4AT6B 1PD6A 3C6LB 4OLEA 1K6QL 3EOBB 5B21A 3VH8G 4ERSL 4XNUL 3VXSB 1F45A 5GGRY 4OF7A 2NY5L 5ICXA 1P6AB 4GUPB 4OLXL 3OAYK 3OX8B 5ANMB 1E4KC 3KPOB 1U6AL 3HAEH 3KPNA 4NKMB 3VWJC 3QUYD 4K9EC 4UUJA 5GIRB 1MVUB 3V0WL 4L3AA 1ZEAH 2DKUA 3C9NB 2V7NA 1MRCH 3IKCB 4Y2DC 4EI5B 4OGZA 3BRDA 1UWXH 5IWLC 1Q0XL 4PG9A 4X6CA 1ZVYA 1T83A 3MRDA 1GC1L 3VCLB 1A02N 2KQNA 4HUVB 1LE5B 3L5WA 2DDQH 3BGMA 3MBED 4JEGB 1NGZA 3DV6B 1RZ7H 2OXHA 1KULA 5I76A 3MLXL 2YC1B 5D7IE 3LQAH 1SBBA 1Q8MA 4MZ3A 1DN0B 1T4KB 2WLZA 4HBCL 1KGCD 4UV4H 3T04D 5IOPB 3T0EB 3WNKA 1JFQL 5IFHH 3LAFA 4L8SC 2Y72A 4TUOB 4R97B 2Z31D 3LKOB 4XVJH 4U1HA 5L9DL 3RNKB 1C5DB 1F00I 2FLRT 1MHPH 2MOVA 5JPNB 5CEYA 4G5ZL 4WWKA 3NPZB 3UTSD 1M6OB 5E2VL 5BVPH 3VXSE 3MLRH 2I9TA 4YAQB 3EGSA 2FH6A 1WFOA 1V8HA 4HCRL 4X6CE 1LHZA 4ZUTB 3S37H 1WFTA 3L3OB 5F3HA 4N9GB 1VDGA 2F8VA 4NO0B 5LBSH 4UDUA 3D85A 5L0QB 3C9NA 1U3HC 1QFOA 4OCSH 3RY5A 1OHQA 4JFQA 2H1PH 3NCYS 4L9LC 5D5MB 5ETUA 5T33H 4P5MB 4GG6F 1FVEA 1AGCA 1EEZB 3VGAB 1FQ9C 3LMJL 3TA3B 4JY5H 4FQHB 1MWAA 4V1DA 1NCNA 5EU6A 5CBEA 3C2AL 3O2VH 4Q9QL 5JXEC 5L7XH 4NKIH 2D7OA 2DRUA 4F33B 2AVGA 5D6CA 4ZD3H 1JMXA 4HKXA 4WFED 5HI5C 2VUYA 3SGJC 3IJHA 2HFFA 2VNCA 3CSYB 1AP2B 1CLYH 3UYOD 4LMQE 3RBGA 2HTKC 3QCTL 3BPCB 3QIBA 1MIEL 1I1AD 3V0VB 2MMXA 1YNKH 3N06B 5H35A 5J6HB 5FYKH 4JN2B 2E7BA 3B9KA 5FB8A 4HV8B 1DBBL 4LHUG 5E6YA 1OF2B 1HI6B 5KANI 5CIPA 4N0FA 2WIIB 3SKOA 4EUPB 4XCFH 1JNJA 3QQ9D 5DSCB 1BFSA 1J9CT 5I1DA 5FEBA 2EXYD 4OF8A 1IGYB 2XZQH 3V79C 3S37L 4HK0A 4V1DE 3OR6B 4DKFL 4NBZB 4HS6A 1I7UB 1I1YB 3UBXB 5F3BA 2AV7B 1NCAL 4YDVA 4IIQA 4OCSL 2B7DT 4RISL 1JGVH 5JUEH 3BEWB 4ODVL 4QHUA 1R3HA 2I25N 3BN9C 1ZLVK 4OTXH 2FBJH 3SDDC 1XR8A 3HS0B 1WUNT 1QP1A 5DVMA 43CAA 3OSKA 4I77H 1PQZB 3GB7A 4L3CB 3B83A 4U6YA 2X7LB 3SDDB 2FZ3B 1SJHA 3QEUB 3O3AA 3RHWK 1DQJA 2ZJSL 5I1CH 4NQVA 2HTLD 3CXHJ 2VDRL 1JHTA 3EOAA 2Q87A 3KLHD 1CGSL 2BNQE 3GSVB 4PJ7E 4LQ1A 1PLGH 4YNYA 4OI8A 1FVCA 4ZFOB 1XF5B 3CFKB 4X4YB 5CUSH 1CXIA 3MQIA 3IS0X 3QXTA 2NR6D 2V17L 4F7EB 3IFOB 4CVZA 1IGYA 4TVPH 1QBMH 5I6XB 1GGCL 2A83A 2GSGA 2A9NH 3VFOB 2FX7H 4MQTB 1RFDL 4RBPH 1PSKL 1NQBA 3FB6A 4L1HA 5B38A 1NCAH 2AJXH 4EI6B 4E42A 4X6CF 2Z31B 4F58H 3G04A 3IU3A 1DANT 3ULSA 5DURD 1LO3L 4HKJA 4FZEL 3N1MC 3OKMA 3O81A 1R3LB 1S78D 2UVEA 2P5EB 4WCYH 2Q8AL 3UAJC 5C0CA 3C09B 1F4HA 4MNHA 1TITA 2Y5TB 1RU9H 3BPOC 1JFQH 3BESR 3VMPA 4I48A 5KSBB 2HVJA 3F8UB 3VXUA 3HRZB 4ZQKB 3U83A 4PTTA 4ZPTA 2OL3A 1XGQB 5D1XB 3ISWA 4XMPL 1R3IH 5EO1B 3E6FA 3TNMB 2MQ3A 4WU5A 4KZEH 5I19L 4U31A 4S0TD 3BPNC 2ATPB 4WWKC 4Y4HD 3SDAD 3C2SA 3UYPA 1RJLB 5L6YH 1KCSL 1EGJA 4P4KD 1Q9LA 1JF1B 5E2UL 5TPWL 3OX8A 3Q2CA 4M7LL 2BFVH 3G6AB 4FQQB 3RIAF 3RTQB 4U1SA 3THML 2E7LC 1FO0A 3HI6H 1RUPL 4EI5A 2F54B 1OOAA 3I75A 4M6NL 5L88H 1OB1A 4XPTL 3FFDB 4JRWA 1XGYL 1KUMA 4FABH 3LQAC 1KNOA 1CGTA 3GHEL 1W0WB 3Q6GL 3D2UD 5BS0A 3RA7H 2X9XA 2JB6B 4OLUH 5I6XC 4JN1H 4X7SH 5FUZL 3FL7A 1NGXB 3Q5YA 4KRPD 5E2VH 1ZANH 4NQUA 4YHKH 4D9RD 2FX9L 1UACL 3CVHB 1IC4H 2XFXB 4JFYA 5I1GL 1BIIB 2C5DC 1A9BA 3VXRD 1TCRA 2BCKB 5CBAB 3AU1A 2VTFA 5I18H 2FJFA 4C56D 4NO5A 1QSFB 1GL4B 2BOBA 2YA0A 4X4ZA 1INQA 1TJHL 5F7FA 2BNRB 4O2FB 5I9QC 3GI8H 2J4WL 3KLAB 1KEGH 4Z7VF 1SYSB 1I85C 5IT2H 3GSXB 1MJJA 1SBSL 2XXMB 2R0KL 2GYSA 4AZ8A 2HWZL 1G7HA 1P7QA 2Q1EA 3QFJE 4ZXBC 3VFWB 5K59F 2V5RA 2NXZC 1OTSD 5CJOL 1YQVL 4M43L 5TDNA 3U6RB 1TTGA 4RGND 5GGUB 2ADGB 3S7GA 5C09D 1RUAH 1UJTA 4XP4H 2F54A 1UEYA 4EZMA 5I16B 5JUEL 3FFCE 5F88A 5L9DH 2D0GA 4OSUH 5IK3A 4V1DB 2XTJC 3U36B 2C26A 3BKCL 1T7VA 4U7MA 1GRWA 1JGLH 1JPFA 1HH9B 4R4BA 3DRTB 2X41A 1N7MH 2A0LC 2DYPB 4APQB 1K5NA 4NZUH 4XI5C 1XZ0A 2J88L 3OKLA 3EJYC 4Q6IA 3IAGC 4RMSA 1MCSA 4HULB 5D7LD 3V0VA 3QBTB 1HSAB 1BZ9B 2J3SA 3FZUD 4GAGH 2B20A 2HT4C 1INQB 3KHQA 1I8LA 1OAXH 1MQ8A 4OBRA 4EUPA 2FNBA 2ZOLA 5B3JE 4LASH 5JIHA 1RUQL 4NNPH 2AJYH 1AQKH 3UBXG 5F89B 2EXWC 3IGAB 4L29B 5CP7A 1ZT1A 3SKNA 2AJSL 4W4OA 1QR1A 1G7LA 3QA3B 2L4OA 4ZXBB 4RGNC 3MRNB 4NOFA 4JRXB 2FWOB 4URTB 4N5ED 1T2JA 1CR9H 2ZJSH 2UZIL 1IM9B 1TIUA 1ZWIB 2EIEA 1VA9A 3CCHA 1QBLL 3BMWA 2WLYA 4G42A 4ZYKB 5IMMA 1X5JA 1XR8B 3RIFF 4A6YH 1BMGA 2EH8H 2HJFB 5K9JH 5F44A 3DSFL 5HGBB 1DBML 4O58L 3RX5A 4NZTH 3OB0K 3T3PF 4MXQC 2GSIB 4PJDA 1ZA6A 1EMTH 1JNHA 4PUBL 3WN5B 3DGGA 1CDCA 3V95A 3R4DA 5IFJB 3VD5A 5DR5L 4DJMA 4CW1B 2LABA 1A4KA 3JWDC 5DQ9B 3HI1B 3LOWA 4X4XB 3Q1SL 3T4AB 3SE9H 1YEKH 4OBSA 2XWTB 4FXKA 3GRWL 2QSCL 4X4YA 2CR6A 3ZKNC 3LY6A 3B9EA 3I02B 1WBYA 2A0LD 1U2HA 1F4YH 4J4PC 1U36A 4YZFE 1JV5B 4QNPF 3QJHA 2YD6A 2ITCA 2V2WB 4X99A 5F7NC 2GSGB 1IAKA 4HFWA 2WP3O 4WY7L 3CU7A 1BEYH 3EKCA 3EFDH 5FO9A 4HF5H 2DKMA 1E0OB 4JDTH 4Z77B 3VJ6B 4LLAA 3QWQB 2CDGB 1T5XA 2DF3A 2FBOJ 4UTBH 5FYJH 2V5SA 4EKXA 4XMPH 5CINL 4JE4B 5BMFH 1UH2A 5FYKU 3PP3K 2DQFA 1FRGL 2VIRB 3QHZL 4F7TB 2ICWJ 2JJSA 4Z78B 2VAJA 5DK3A 2IPKA 1FFRA 3MRFA 2WBJD 4I0KA 1MAMH 2BFVL 1JPGB 5DA0B 3MYJB 2FECI 1I8IB 2NY0B 1U8PA 3FQRB 1WWAX 1G7IA 1EJOH 1IJ9A 1ZS8A 4RQQA 5GZND 3K0WA 3IDGB 1QHPA 3T65B 3OJDB 4XRCA 4XNZB 4OD2A 3O3BA 1KIUA 4XGZB 1OD9A 2RFXA 4YBLC 1UWEH 3HC4L 3TIEA 1WWBX 2NY6B 4LU5L 4MVBD 1SYVA 2E7CA 1FO0B 1U8HA 3HPLA 1UACH 3FQXA 3KAAA 5C08B 3FB7B 4MAYA 1ZGLA 1QSVA 2HT3D 3QDGE 1BM3L 5DD5H 2CH8A 1X44A 4XPAH 3SO5A 2WBKA 2GAZA 4PJ5A 4F7TA 4LSUL 4Y1AB 2EO1A 4MGXA 1EA9C 1HQRB 3QQNA 4NJAH 3EYFB 1D5ZA 1FG2A 2WBJC 4G80B 2IJ0C 4LF3B 1PSKH 2ADJB 1WEJL 4ZD3L 4XHJC 2HYMA 1RZ8A 2J8UA 4PD4J 5SWZA 4GO6B 3RZWA 4ONHB 2JCCE 5L88L 1J8KA 3QG7L 5T3ZH 2YOCA 3HAEB 5HGDA 3FB5A 1QVOA 1VGKB 1KCLA 1ZT4A 1RZKC 4WW1B 3MNVB 3PABB 2AAVA 1S7WB 4D9LL 4PRDA 1HEZB 3RKDC 3VFWA 1RQ5A 4OJFH 1MOEA 4EN3B 2ZKHH 4CJ0A 1D9KD 5CLWA 3LN5B 1YNLL 6FABL 3ARPA 1NGYB 2FX9H 3L3GB 1FYTA 4XNXL 5LAXA 4N8VB 4EVNB 5C08A 2IG2L 3BXNA 4S1DD 5FHBL 3K2UL 3HHRB 4OQTL 4G6MH 4TTDC 3U36A 1CU4L 4EXPX 4XMKL 5DVLA 1NMAH 4LLYA 2MKLC 1A7NL 4TNWF 2NY6C 5DZNA 1UB5A 3ILPA 4O9HH 4OAWA 5LGHH 5DD1L 5DMYA 5ICZA 3L5WB 1L7IH 3VWKC 2RB8A 2CJUL 4F7CA 1XIWA 1DQTA 2H32A 5GGQH 1IAII 1K9TA 4MJ2A 2HLFD 3MRMA 4QGTA 4XBEH 3RVXC 3SDYH 5C08E 3KPSE 5HTSA 1R3KB 5IJVB 1P4BL 4GT7A 4LLMA 2C1PA 3HNVH 3OR7A 4XCNB 4ETQB 4HFUL 3BP4A 3FHAA 3TA3C 3PP4H 1FNHA 3GHBH 5TQ0L 3S34H 1NLDL 5CJXC 4Z7OE 2ADFH 4LLQA 2CIIA 1KPVB 4ZG1A 5GJSH 4QRQB 3DWTA 1LK3L 2F5AL 3T08A 1KT2B 2X1OA 4UIKH 4MD4B 4OCXL 1TETH 2Q20A 1T20A 3MOBL 5BZDB 5T1LB 1TVHB 3D87B 2DQTH 4G3YH 3AFLA 2VL5B 3HMWH 1Z2KA 4QT5B 1UXWB 4JFQB 1JNHB 1CTNA 4NC1C 5ICYB 3VXPA 3UJTL 1QQDB 1EEYA 5EU6E 1GAFH 4JAMB 5C0BD 4UOW1 1PZUB 5DK2A 1JJUA 4WY7H 3ZKXC 4TTDD 3LH2L 4ODTH 1D5MA 1I1AC 4JLRB 5A3ID 2QR0B 1J05A 3VWKB 4DN3L 1F02I 5DHVH 4NRZA 5D71L 4MJ6A 1W8NA 2JJUA 1YEJH 4N0UA 3PL6A 1W2KT 4YE4L 2VWEE 4JDZB 3I02A 4PJBF 1DEEB 5JW3L 4FQJL 3WUWA 1BOGA 3ZTNH 5FKAB 1JV5A 1HZHH 2DQJH 5BQ7B 5E7FA 4NWUL 3STZA 2BXYA 3EW3B 4DZBA 1KJMA 2NW3B 5SWQA 5ACZB 1I3GL 5D2LF 4UV7H 1OGAD 4OT1H 3RWIA 5DSCA 1MHHA 4Y88A 4XPGL 3DNKA 4NCC2 5MI0C 3W5MA 3RVWC 4LNVA 3ABZA 4PJIB 4OCXH 1GZQA 2XPGB 2X4OB 5DRWA 4HS6B 3DTXB 2VH5H 12E8L 4EJ1C 3L1OL 2YD1A 1BBJA 3GMMB 3JV0A 5JW5B 1MLCA 1AQKL 2X1PA 4U1MB 1GGYA 1BFOA 4N0UE 1N3NB 2AXFB 1DLFL 3O6MH 4PJBB 3VRJA 4Z7UF 1NGPL 5C0DA 2IALB 2N4IA 5DK2B 5F70A 4HWEH 2HH0H 3WBDA 5F7YC 1LEGB 5FYLE 4TSAL 1OT2A 4PY7B 5IMOB 2NY0D 3RZCC 5DMGD 3JWDL 2YKLL 2OX5A 4RQQB 4YHIB 1HXMA 3CFBB 4WI7A 1JI2A 4GBXD 3QUKA 4PJ7A 5KAQG 4U1JB 2NPLX 1IAIH 3O3BB 1NUGA 1MNUH 4TOYL 3OBAA 2DLIA 2ZUTA 4Z7QE 1I3UA 4HSQA 1NDGA 5HHQA 4NZJA 1S9VA 1ORSA 1BREA 1EGJH 1LILA 4I1NB 3KPPA 5EZIH 4XP4L 2EXWD 1BEYL 3KPQB 3QUZD 4M5YL 4X0KA 5EA0L 3MRPB 2B4CL 1FYHB 1QFWI 4LK4A 2NXZB 1GHFH 3U30C 3M45A 4JHAL 3TV3H 2AXFA 4Y1AD 4GRLA 1KFAL 3NBNA 2DQUH 2VXSH 4L3EA 1FZMA 4OFPA 4OZHA 4HKJB 5EUKB 1U8MA 3PJSB 3H6JA 5E9DE 1OT1A 1EAPB 1TNMA 4PJAF 1NANH 4WHYH 2V5MA 3LIZL 3IFLL 2YKLH 4YHIA 1A1OA 4JFDB 4KXZI 5GRWA 3T0EA 4XT1C 1IZJA 2R1XB 2ZSWB 3SN6N 3LKOA 3JTSA 2Y6SC 1A14H 1DQDL 3RKDD 1L9NA 3EFFA 4NNPL 1FSKB 3FT3A 3WHXA 2DAVA 4FG6C 4PGBB 4JVPA 3ULUE 3PQYA 2G5BB 3IDMB 3SBWA 1GH7A 2NZ9C 5JZ7C 1A1MB 4LHUA 5T1MA 3O2DH 5EU7C 4ODWB 4OIAA 5F97E 4FQQA 5BW7C 1Z0MA 5SX5K 3X12A 4A2LA 2EDBA 5CJ5A 4UDUB 1FAKT 1NC4A 1HK6A 3W0WD 2BOCA 4M61A 5EBLB 4M6OL 5DJ6A 4LIQL 4LU5H 1U8MB 2NY3B 4U6XB 4DGIL 5HYEA 2ADIB 5KVDH 1U58A 3HI5L 2DM3A 1AIFB 1XIWB 3MV7B 3FCTB 3WDJA 2R0ZL 3SJVD 5KVFH 4JFDD 2H6PB 1HINL 5IKCA 1Z0NA 3IJHB 3VW3H 3P11H 3GIZH 4X80H 4F7MA 5LGJB 1FFPA 2E27H 4QNPE 4A2MA 3ULUH 3UTTE 2IPTH 4GKZB 4XP5H 1AC0A 3HG1E 1C08A 2BOBB 5F7EL 4E0RA 3AS1A 1ZV5A 3S97C 1K8IA 1KPVA 4FFWC 4JPWH 1D5IL 5CAYB 3LQZA 3ARFC 5JXAH 4GFTB 1ED3B 2DI8A 1VHPA 5IVZA 2FGWL 3VDBA 1FBIH 3NCYP 1HHGA 4ORZC 2E9WA 1LO0L 1EJ6A 5KSVA 5CEXB 4HEPG 4G8GD 2BJMH 2HVKB 5I15H 3RJDA 1LE5A 2X4TB 4L4VE 1XFPA 5C0BB 4PJ9C 1NFIB 1BWMA 4D0CA 1D5MB 3HI5H 1U3ZA 3E0GA 5DUPH 2AJZA 5IG7B 5ERWB 1NBVH 3QAZB 4M93B 4Y5YA 3FQNB 3QWOB 4F15B 3BWUC 1SJHB 3QEUA 3O3AB 5D1ZA 5ESVB 3VFUB 1TTUA 1U8LB 2CLVB 3VFNB 4KMQA 4PJFF 5CSGA 5GS2H 2VH5L 1YMMD 5EOCH 1LEIB 4HXBL 5DJCA 4NKDA 1AGDB 5D9SA 4NM4L 4WI4A 4HUXA 3KYNA 4TULH 5D7JB 3BDYL 4PLKC 3UC0L 4I4WB 1AGFA 1XF3A 2AQ1A 4L4VA 3BYYA 3VFPB 4H25A 1HSBA 2DQHH 4KJYA 3AMLA 1MLCB 3ZMRA 2YZ8A 2EH7H 4E42B 3ILQD 3EYQD 2PCPB 1YN6A 5DRXA 2ZCKH 4GKSA 4Z7VE 3UPCA 4JQVA 2PYFA 1LEGA 3U48A 1TJGL 4PJDE 3QUXA 2J8OA 3UJTH 1E4JA 1KIRB 4OFVA 3IDXL 4HH9B 1P7QD 3DGGB 1DVFC 1SEBA 1HNGA 5GGVL 5IB4B 3MV8D 5F6IB 4GW1A 4I0CC 1XGPA 4DEPB 5HYQB 5E5RB 4XWOD 3DRQB 1UM6H 4YGVA 1DQDH 2EZ0C 1R5VA 2OL3B 5FOBB 1QLFB 3P2TA 1WFNA 1A6WH 1XGUA 2AEWA 4TRPH 2A6IA 4FQJH 5DJCB 5ITFA 1OF2A 3I6LD 3QZWA 1NGPH 5E1AB 2AKRB 4M93C 3VGDA 2A6KB 1S9VB 4P2QD 2ITCB 2CKBA 4ENED 3KPQA 4RFNB 1OAZL 3VDCA 1QPPA 2OM5A 2P48B 3ARDA 1UJ3A 1KIPA 2O26U 5D1ZC 3AREB 3IS1X 4HUUA 3WKML 1NC4D 5D7LA 1YEFH 1MCOH 3FFDA 2AJVL 4ODHH 1LO2H 1MCFA 5D8JH 3TIDB 1YN6B 4YO0A 2O61B 5E8DL 1I3GH 2ZG3A 4W68A 1UGNA 3PWPD 4PGZA 3VMOA 4Q0XL 3BZDA 4IDJL 1U3HB 1A9EA 4L9LB 2QADD 3F7RA 3SE3C 2X7LA 3SDDA 2FZ3A 3AM8C 1CT8A 3IT8D 3ZZ1A 2D7NA 1A6UH 4XNQA 3EYQC 1N0XH 4XVSL 4R0LB 1QFPA 2F5BL 2EDYA 1A9BB 2AQ2A 4WJ5A 1MEXH 1OAKH 3CFCH 4PRBA 2DI9A 3WO4B 5CSZA 3D69B 4Z7QF 3TBWB 3MGOA 1MFDH 3C6LA 3F7VA 4AG4L 1T03H 3NACH 1ZVSB 3PQYB 4OCRL 4PLJD 5TDOA 4JO4L 2H2SD 4OKDA 4S2SB 5MEQA 3KPNB 4NZRL 5DJ2B 2OSLA 1CF8L 4RA3A 1FLTX 3A6BH 3QPXL 3SE4C 4KZEL 3OJ2C 3P9MB 4UV4L 1YEEH 3OKDA 4HC1L 3RWGB 3U9UB 1PYWA 5SWSB 4KPHH 4LPYA 4D0BB 1NGQL 2RAMA 1S5HB 2FBJL 3UO1H 1YUHA 1HH9A 1IC5H 2BK8A 4FQIL 4RFEB 5TH2B 4BSJA 1NSNH 5J3HC 4PRID 4PJ8B 3WLWC 1YMHA 4MNGA 4MJIE 5FO7A 4RAVA 1FN4A 4Q9BA 1I3RA 4L8DB 1B0RB 3CK0L 2VABA 1Z9OA 4ZPTB 1IM3A 3V8OA 2XZAH 4GAJH 4LSVL 3MLSH 1G0DA 4GLRH 4P46D 2ITDB 3HC3L 4LDLB 5KANG 5L2JA 4C54A 4JZOB 5DYOA 3LEXB 1HYSC 4PJ7F 3MACL 1IGFH 4WU7A 4PGCB 2VXVH 3R0MA 4NZRH 4X9GA 2YEZA 3BP6A 4X5WA 1IM9A 3P9WB 4LSDA 1FE8L 1OB1B 2DTML 3DBXB 4NQCB 4XNMB 1JI1A 1T5WA 2Y25A 3RWGA 4PBXA 3FFCB 4FQLL 4IHOB 4KK9D 3V52H 1FNGB 1RJYB 3ARYA 4X9HA 4J12A 1YNKL 3LZFL 3MJ9A 1G9MH 1MF2L 2P1YA 1JTPA 1Z9MA 4O51B 1VADA 3P0YH 4WI3A 1H8OA 1MI5E 4LGSB 1I8KB 3MFGB 5I74C 4JJHA 3VFUA 4OCYL 1HXYB 2ED7A 1XR9A 2P8MB 3JWOH 3DPBA 3F65A 3LN4B 5IBUB 2XZAL 2N1KA 1QSFE 3WNPA 2CGRH 2BNRA 2A74A 2UVFA 3EUUA 3VGBA 1CFNB 3RWFA 5DYOB 4JZNA 3VXME 3WYRA 3PDOA 1AKJD 1LNUA 1N0LA 3O9WA 2Z4QA 5T5FL 3ZKXB 1VFBB 3KHOA 2FDBP 4FFZH 5D7JD 4L3ED 4YX2L 1E27B 1CGUA 2QLVB 1TTFA 8FABA 3VG0L 3GSNA 1IAKB 4WI8A 2FJHA 2RBLA 1UXSB 3QXDA 2VYRE 4R9HA 3IDYC 4ZFZB 3IDXH 4BQBA 5CD5C 3H2WA 1RJZA 4MXWL 2VXTL 4YDVB 3HE6B 4HHAA 1YEHH 4NQCE 2VDNH 5FA4B 1BBDH 1JN6B 2I07B 2X40A 3BZFB 3B2VH 3WFCL 4Q0XH 4X9IA 1FZKB 2GFBB 1IZKA 2VXSL 4ZFGL 5IBUG 3CFEA 4CADA 4CDHA 2XTLA 7CGTA 3QXVA 2WNGA 3VI3E 5F96L 1FCCA 3RU8H 4RMTA 5KW9L 2BY1A 5FDWB 4XHJD 3V5DB 5C0JB 1HKLH 2HT2D 3HZYA 5MI0B 3MUGA 5ADPH 2F9BT 4M5ZL 4JRYB 5ITFB 2XZCH 2X09A 5GHWH 4NP4L 5I8EB 1YEGL 4YHOL 2Q3AA 3HC0A 3RNQA 4EDXB 4X9BA 4YGAB 4WHTB 3V5KA 4Y16D 5IB1B 2Z4QB 3SDAC 2ZUXA 1W72B 1PY4A 5HHVL 5MHSD 3DMMD 3SKNB 5IVXE 3ZDXF 3C2AH 3O2VL 5I74B 1KB5A 2PW1A 4AK1A 4DZBB 2OJZL 1Q9KA 3IKKA 2QKIB 4PJEF 2ARJB 5F9WB 2X4PB 1NEUA 2IFFH 3SDAB 2B1HH 4G43A 3HFML 4D2NA 1QD0A 2YPKB 3I9GL 3EDKA 5CZXC 5EOCL 4JR9H 3P4OA 4U1LB 4PJ9D 1O5DT 5CILH 4OUOA 1EO8H 5FCUL 3EO1B 3I6KB 1ORQB 4KKBC 1BBJB 3GMMA 4ZUVA 2PO6A 3WN5A 4RRPG 2LE9A 1FVDB 3MRKB 4NDMA 1U2CA 3WXWL 4JDTL 5ESQB 2QQQA 4Q9QH 4ZQKA 4LP4A 3HNTH 3VI3F 4F9LA 3ARUA 4U1GB 1XGQA 4JG0L 1ZAGA 3E3QE 1KLFA 5TF0A 3U30B 1T7ZA 3T09A 4NQCD 2HLAA 3ARZA 1Z5LB 4WHTA 5HGDB 3V5KB 1KCRL 1S7UB 3LCYA 3QJHB 1FG9C 2PNDA 3D1MC 5FYKL 1YJDC 3PGDA 4OQTA 4PD4K 4OLUL 2ILLA 3OV6A 3BPOB 2B4CC 4ZUWA 4U1SB 2R2EA 1VKXB 3H9SE 4CN4A 4Y0GA 4PRAB 3JTTB 5F1SA 4MB3A 2UZIH 1F4WL 4PJFB 3GJFK 5DWUL 2BERA 4CBPA 3IJYB 2NY4D 4Y5XC 5JIIA 1A5FL 1G84A 1HHJB 1U93B 1B4RA 3MO1A 4MVBC 1P5VA 1WWWX 4RRPA 3RUGF 5H94B 5D8JL 1RVFL 3E8UH 5E8OB 1REIA 3B8YA 5JZ7D 4ONFH 5I75C 4I5BB 1FGNH 5E9DA 1QNZL 1RZIA 4D9RE 1Q72H 3PWLA 5K9OA 1UM5H 3ZO0A 1JWUB 4N1EA 1A3RL 4XP1H 3F58L 1F58H 4F9PC 2R23B 1BQLH 1J8HE 5K9KB 4EDWH 3NIDF 2LVEA 5E1HB 3TYFA 3MODL 1G7IB 2DQEH 2W0LA 3KYMA 5EIIB 3IVKA 3T0EE 5CEZE 2LTQB 3L3HA 1XGTB 1A6VL 1J1PH 4YIQB 1CG9A 3PHOB 4JGUA 1O0VA 4X8JB 3DXAD 4KK6D 4HJ0D 3MRQA 2VXQH 1CLZH 5LXGH 5IQ9A 4IBLT 3BDYH 4ZUWB 32C2A 4FRWA 2OYPA 4L5FH 2VC2L 5C70A 5HHME 5FGCE 3QB7C 5JPMA 1IQDB 1J1OL 2EEDA 4X6EA 4ODUA 5GSRB 4DVRH 5DO2D 2EDDA 2BNUA 2M2DA 1FFOA 1WCBB 3GSRB 1UVQB 1TVBB 2A9NL 4KAQH 5ANMA 3QISA 4IHOA 2Q76B 3FFCD 1T20B 4C56E 1IKFH 4H8WL 5T1LA 1KN2L 2GAZB 2R39A 4C59B 3EDEA 1J8HA 2SEBA 1FNEA 4U6VH 1WAAA 5C71A 3E2HB 3HKFA 1V3LA 4RFOH 2DTSA 4HUVA 2NCMA 4POYA 3HNSL 5LJYH 1ZLSL 5IMLB 2YD2A 1JNLH 3HG1B 5DT1H 25C8L 3TO2B 2BVPB 4MNQE 3HAEA 4JZNB 1DEEA 1AR2A 2GCYB 2FO4A 3MJ7B 3QDJA 2Q6WA 3PHOA 5CKGA 4PS4H 4JJ5A 3C08H 3GSNB 1C5BH 5EOTA 4ODSH 4ESKA 5EU5A 4Q58C 3ULUC 2VKXA 2A73B 4TVSa 5FUOL 1YEIH 4ZPVA 1R5IA 5I8OL 3GSRA 1XCQA 4OCLC 4LSPH 3CUPB 5EFIB 1PKOA 2Q76A 1KENL 4AEIH 4TNVF 1YN7A 7FABH 2NY3D 4BFGA 3SDXB 2VZSA 2BHZA 3T0ED 3FQWB 4Z7WE 1GPOL 1FNAA 4HGKC 3P4MB 4JFZH 4OZ4A 3TBTB 4F9PA 3MRGB 1M71B 4XPFL 2KPNA 2OI9B 5LGKA 5EU6B 5CBEB 1ONQB 4X7SL 3DVGA 3LEVL 4OCWL 4W6YB 2ZPKL 4C83A 5IG7A 2P49B 5T3ZD 3ULVH 5KTEL 4HBCH 2PF6A 3I9GH 4YHYC 3HMWL 1V05A 5E2WL 2MHAB 1LE9A 3LZFH 5DVOA 3FO2A 3WO3B 5DVNA 3WNOA 5ID1A 1Q9KB 1BFVH 3MR9B 4HX1B 5D93B 1MFNA 3MV9D 5IB5A 4RNRB 1HI6A 1OGTA 5FO9B 3S88H 5F6IC 4M9PA 3ZE2E 2H26B 3MNZA 3UDWA 4RMWA 3F6IA 4HWBL 2NZ9D 4PRNA 1MCWM 2AXGA 5EFIA 1FV1B 2DQIL 4JY6A 3U0TB 4HQQH 4HIJB 4G9FB 4MD5A 4MMXC 3EO1A 4LLUA 2HFEA 2HT4D 2VIRA 1DTUA 3ULUD 2O5ZL 4FFZL 2WWMC 4LGPB 1S9YA 2VRAA 2ZUSA 2OR8A 3PIQB 4QXGH 4HUMB 2K7QA 2A6JA 4K8RL 1I7TA 5L7XL 4ISVA 4WGVB 1JRHH 2ID5A 2F53B 4YK4B 1HHIB 3FQRA 2VDNL 1A7BA 3R0NA 2HMID 4JKLA 3IFNL 1ZS8B 3TH4T 1E28B 1AD0A 1QOKA 2BNQD 5L8LB 1EO8L 1WT5A 5GS0C 3DRQA 5CGTA 2YPLB 1CGXA 4TQEL 1QLFA 1CL7L 3AVEA 3SJVE 4EQ3A 3Q0HA 4XAWL 4B5EA 3OAZH 1XF4A 4PGBA 2BSSA 4M7KH 3IXTB 4KMTH 1EHLL 1KCKA 2R56L 3VRIA 4NGHH 1GZQB 3HG1D 5TE6L 3UTPD 1IAIL 1N64L 2ZNXA 1PKQB 3RZCB 4PJ9B 1DL7L 1E4KA 4WENB 5IBTL 4Y2DA 5HI5D 4U1MA 4ELMA 5GGRA 5ENWA 1S7RA 4HS8L 1S3KH 4XCEA 3RL2A 1I7TB 2X4NB 3MLXH 1P53A 3TCLA 3C5SA 3MLRL 5DEGB 5DFVD 5DRNA 4XNXH 3LKQA 1Z9LA 1RURH 4P23C 3O4LB 3AROA 3TPUB 1ZEAL 5B8CB 4QHNB 3OKNB 5KVEL 5D1XA 3TA3D 4TQEH 3ZHLA 3MRJA 1LVEA 1MRFL 3HA0A 4FHBD 1AR1C 3D69A 1A7NH 4R2GD 3RUGA 1XF4B 3MGTB 5EN2A 3FHQA 3MSPA 2BNUB 1QFHA 1ORSB 5TDOB 1PGRB 4ELME 3LKSB 5E8NA 4ZUTA 3KLHC 2Y06H 3ZDYE 4LBEB 5TE6H 2G2RA 1N64H 2K9UA 3BSZH 5EC2A 4DKEL 4G9DB 4GSDL 5F9JB 3QRGH 2GTZB 1U3JA 2GKIA 2D0FA 1QZ1A 1AGCB 2YPLD 15C8H 5HHNA 4N0CC 3BIKA 3NFNB 4WFHD 3ARTA 3LEVH 4Z95H 2C4FU 3OG4B 1DN2A 4F33A 4Y7MA 3OGCB 2IQAB 3QNZB 5IHUL 5EZJA 5FUOH 4BK4A 5EBWA 4HPOH 3NZ8B 1U0QA 5DMKA 4R4FH 5DD0H 1G1YA 2PR4L 4OM1L 3QIBB 1U8IB 3BP4B 5JDJA 3DXAB 3ECBA 3SPVB 1IARB 1T89C 5E94B 5FK9A 3L5JA 3RUGB 4PRHE 3EOBA 3RQ3A 1QBBA 2I9LA 3T8XA 5DF0A 3RPIB 1N5YH 4MAYD 2F53D 2OJEA 1YN7B 3BDBA 3D18A 3O6FD 4XP9H 3BP6B 4X5WB 2OTUB 1NJ9A 3PWUB 4MD0B 5F9WC 5F88B 3MRDB 3VCLA 2V9TA 3VG9B 1F3JA 4KKNA 2ZKHL 4OZFG 4R0LC 5D6DC 4H20L 2HJLB 1TQCB 2GJ6B 4QF1A 1AIFA 3D0VB 3GBNH 2DDQL 4RFOL 4AIXA 1YEIL 2ICEB 5EO0B 5EUOE 1F4XH 1NDMA 3E6HB 1DR9A 2CUMA 3LIZH 1QHOA 4NQVB 3QPQC 3ZE1E 4H8WH 4Q9CA 4YR6B 3WMSA 1BLNA 3L3IA 4GKZA 3QHFL 1L6ZA 2WWKO 5MEPB 5FCSH 3W81A 4I18B 4JFZL 3T1FA 2GUOB 3U4EB 5IIEB 2DD8L 2J4WH 5D72H 3BWAA 1X4XA 4MA8L 1MPAH 3KYAA 3PNWA 4QRTA 5GGTL 5E56A 3NCJH 4G5ZH 4KHTL 3RPIA 1JNLL 2IAMD 5AZEH 2ZPKH 1XEDA 2F19L 4HJ0C 4PRPD 2CJUH 2EO9A 5TDPA 4OZFA 4XC1H 4OZIB 1I1FB 2CR3A 4JGMA 2DOCA 4K3DL 1KTDA 1VENA 2Z92B 4RZCB 5HHXL 5E2WH 1GJIA 4LSPL 4WI6A 2A6DB 4YHLH 4K3HA 4JO1H 3KWWB 3PWUA 4MD0A 4ZO7A 2EDLA 5C8JA 5EUOA 1N3NA 5D7LB 5HHOD 4U1GC 4QOKD 4FTVB 2IALA 3BKJH 1NCDL 1KLGB 1ZHBB 4E9LA 3VFRA 3ALXA 4ALAL 2RJMA 3TJEL 1UZ8A 1C7TA 3GGWA 1OGAE 5DHVA 3NIDE 4E41D 5GJTH 1KPRB 1MUJA 5I8OH 4L4TD 4FQ2L 1HCVA 3WLWD 1PZ5B 1P69B 4KI5F 3S4SB 3HMXA 1D5BB 4KVNL 2IFGA 2XA8L 4FZ8H 1J87A 2E27L 3FONB 5ELIA 5EH1A 3ZKSD 1TQCC 3SDYL 3MGOB 1CE6B 3HC0B 1Z3GH 4ZUUB 2EDRA 3V9FA 1JYNA 1U9KA 1RUKH 1FGVH 4AIOA 5ID0A 2FEDD 3QFJB 4HWZA 5E8EB 1Q9LB 4G6JH 4G8EB 2QV2A 3B9VA 4KTEH 1IILE 2QKIA 3OQ3B 4FXGA 4M8QA 3L7FA 4OV5B 3EDJA 3MFFA 3SKMB 2WIMA 2VSCA 1XGYH 4OF3A 5GGVY 4Z77A 1QBLH 5E2TL 5T3XH 5TFSL 3HTLX 3DARA 1BFVL 4DVBB 5FAAA 3V6BR 1C1EH 1Y6NR 1FZJA 2IH3B 1R6VA 4MA3B 2EE2A 5GISL 3JVGC 3SQOH 1AFVH 1CIUA 2VJXA 3QCVH 2BY3A 5D1XC 5DRNB 3O41A 4ACPA 4MYWB 5J13B 2ZCHH 3NMEA 3PGCA 5CJOH 5DTFA 5IJKC 1JHTB 4J3WA 3KPSB 5KSAA 3MV7D 4QO1A 2BDNH 4MWFA 3U0WH 1JPTH 4FFYH 3MRRB 2RGSA 2E9BA 1GIGL 2V6HA 2VR9A 5AUMA 2Y4SA 1RULH 3PDDA 4O2FA 4FTVD 3CDCA 4JFFA 5L8KB 3V7MA 3OJDA 2P8PB 2ZUUA 1A1MA 2GK0B 4M1GL 5I0ZA 2C3VA 1FLRH 4P4KA 1X5GA 4YWGL 4M1DL 5A43C 4LBEA 5BV7H 1GOGA 1BX2B 3VFSA 4NQED 4JKKA 4AH2B 4M61B 4HUUB 1HINH 1UH4A 5DD0L 5EBLA 3G04B 4EI5D 4X6DA 3VD4A 4MQ7B 5I1EH 4KFZC 4DVBA 1I7RB 4KGJA 4PJFE 5J12B 5JTWA 5FHAH 2FEDC 4QRUB 3BKCH 2UYLB 5DD6B 2NY1B 2YPVH 5AEAA 2ADIA 1U58B 1I1CA 1RI8A 5BVJA 5IT2L 4RSVA 1BJ1J 4TVPL 4UAOB 2ZP0T 4OUUA 4WUUD 1T83C 2AJYL 2WANA 3MRIB 4XWGH 1DLFH 1JPSL 5GRJL 1I8KA 3ZE0F 4XNQB 4JHWL 4OIIL 1HH6B 1VACB 4PRPB 2R8SL 4TSAH 1RZ8B 2W9EH 3K8KA 1X6LA 4N90D 4JM4L 2R29H 4U1HB 4R3SB 1KN4H 1TPXB 3TN0D 4PRBB 2RIKA 4IMKA 1ZSDA 3CGTA 2APXA 3O6KH 3GHEH 1WIOA 3TBWA 4JQXC 5HHOB 1KFAH 2X42A 3D2UA 2RR3A 3P4NB 1TPXC 1OY3B 4PLKD 1ZT1B 3MRQB 3R1GH 5DJ2A 1A21A 1N6QH 3LS4H 5SWZD 3VFSB 2FWOA 4M7LH 1RJZB 2EE6A 2LAGB 1LK2A 4KKLC 4MQ7A 2JB5L 2MPAH 3IJSB 5KS9A 3UPAA 3OAYH 3UTZB 4APQC 2X4QA 1QACA 3G08B 5T1KD 4HIHB 3KYKH 2HJLA 1F90L 4GMTH 5FV1L 2HWZH 4YBLB 5E2UH 5TPWH 1M1SA 5D6CB 4N5UA 4PJDB 3NCJL 1ZHNB 4UAOC 3QWOA 4PB9H 3VA6A 1IQWH 2X70B 4EN3D 3HI6L 1PG7X 5IHUH 1CGYA 2AP2A 4KK9C 5D6DA 1A4KB 4CKVX 5CBAA 4LNRA 2I26N 3MUGB 2NY3C 5CZVH 4B50A 5D2NB 1MH5B 4JRYE 4HIXL 3QIUC 4PFEA 1AKJA 5D9SB 1BZQK 4N0FB 3SBWC 3ARBA 2Y07L 2GCYA 2Q6WB 4XAWH 5CGMA 2YRLA 4HWNA 4ALAH 2DLHA 3QUMA 5HGAB 1MI5D 2IAMC 4FXLA 2UZYB 4YH6A 1SBSH 4MLSA 2NY2C 1NKOA 2ARJA 2EDJA 3WFBL 2Z92A 4XXCA 3RWJA 4KJYB 1MCNA 4K9EL 3V5HA 2P8LA 3FO1A 4POUB 5C0AB 3QUMH 1V7MH 3EYSH 4GMSL 2XA8H 2VE6A 4NPYA 4W6WB 2D03H 1SVZA 3WKNA 5I75B 5C0RH 5JA8B 3VFRB 4TYUA 4LARH 4LQFH 4YX2H 3MXWH 2AJUL 2M1KA 2AXJA 3VG0H 5AG9A 1UXWA 2GJ6D 2PXYB 4ZUVB 2DYPA 1H3UA 2Y1VA 3MRKA 4NDMB 2VXTH 1JGUL 3GBNL 3JUYA 4HJGA 1JTOA 3KJ6H 3EOAB 1IL1B 3AY4A 3K80A 1GGUA 1MCEA 4WHCA 3ZE2F 4H0GA 3KPRD 4JFPA 3MZTA 3FONA 3W9EA 1FVCB 4B7LA 2DKSA 1IGJA 5BO1L 4OD3H 43C9B 2FJGA 2DLEA 4U1KB 5GRYA 3K7UA 2BVUA 4KXZH 4MNQB 1IRAY 3IDGA 4MXVE 4X5XA 1WVZA 2K1MA 4NN7B 4XRCB 4JDVB 1QKZL 5CP3H 4P4RB 1ACYH 3WJJA 5CJQH 4PGDB 3D3VD 2BP3A 2DIJA 4XX1G 5B8CC 5DQJA 5KG9A 3CIQA 1OSZB 1CFQB 1BPVA 4NQDD 1RY7B 4U3XA 3ZL4L 2DWEA 2FECL 2NY5C 3QHFH 2HA1A 4GG6B 1NFDF 3GSOA 1LP9A 1FORL 4C56B 5AAMA 1YDPB 4ZO9A 5HJ3A 3BRFA 5F1NA 1KSRA 3JV4A 3MV7E 5EOCJ 5D7IB 4XBPA 2X4UB 1XT5A 1MIMH 3GJFB 3I84A 1CICC 1S9YB 2OZ4A 3ZTJG 4GKOA 2V5YA 4K3DH 3S9DB 2W1NA 3KJ6L 3HZYB 3HE7D 4YDIH 2A9MH 4EEEA 2F53A 2PR4H 3TVMC 4PRIB 3P77A 3CX2A 4LCYA 4JFHD 1YMMA 1UCBL 4PP1D 3KYMB 1MRCL 5EIIA 3RY4A 1JE6A 3O8XA 4RX4D 4YIQA 2AI0H 1A7OL 3PABA 4KHXL 1JL8A 4JZJC 1XH3B 3O0RL 4PV9A 3RDTC 1A1NB 3IFPB 4YDKL 3P73B 4FQPA 5MEQB 1KIQB 3VH8A 3IDIA 1B9ZA 1W8OA 3KPTA 1UQSA 2EC9T 4KKBD 4J6RH 1WZ1H 4X8XA 4OQTH 4RAUB 5LBSL 1N5AB 3DYMA 3VD7A 4ODUB 2ERJC 3B6SA 2ORBL 2H1PL 4GG6A 3V4PL 1CGWA 3DSNA 4Z0XA 5IEHB 3QYCA 5J1AB 3TO4D 3CSPA 2NY1D 3OHXB 1PX3A 3RVVC 2F53E 3NAAH 3ZSSA 2XQYG 4PJ5D 4B41A 2EIDA 5EWIH 2C9AA 3LPGA 4ZNEA 1S8DA 3I50L 5E9DD 1FN4B 2WUCL 3HPJA 5TF1L 4RGOH 2OP4H 1G6RB 4ENEC 1MAML 4DK6A 3HZMB 4IOIA 1H5BB 3VE0A 2BVQA 3DURA 4UTBL 5FYJL 4WNQB 2X1QA 5DS8B 1CE1L 4BQCA 5D2NE 4ZOEA 4F9LC 5FO8B 1FNFA 4NC2B 1S7UA 3MRMB 4LOUD 4X98A 2VDQH 2XZQL 2XN9E 5J1SC 4ORGB 1UM5L 4PIRF 4UDTB 3VGHA 3RUGE 1UQSB 3Q5OA 3QUYA 4LCIL 3C8DA 3MGTA 3JTTA 5EN2B 5ADOL 1LK2B 1R5IB 2P5WB 1U8KA 3O11B 4AL8H 2P7TB 4ZTOH 5CEZD 5C0RL 3KXFB 1KG0B 1JVKA 2OXGA 5I71B 4JM2B 1CDGA 1MVUA 3V4VH 1JZ8A 3DUHA 1NMBH 5CJ8A 3C6SB 5M95B 3SKUD 3BDXA 3KYOA 1CZ8H 1HQRA 5DJ6B 4PG9B 4XNUH 4L5FL 2CLZA 3U1SL 3T2PA 4UT7H 3QG6A 5B39A 1JHKH 3PQYD 5AYQA 4JO4H 3GK8L 1SMAA 4LRIA 1H3PL 3JSSA 3KR3H 3T2NL 1QRNB 3L5XH 4AY0A 2J8UF 1CLOH 1K4CA 4IOSD 4K8RC 3QPXH 3RGHA 1X5IA 2R8SH 2MPAL 3WEXB 1QSFD 1XCTB 1TVDA 1MHCB 2IGFL 1LE9B 3WJLC 4PRDB 2VZUA 1H3TA 5FF6B 3MMEA 3WIIH 3UTQA 4JCMA 3EYOA 3G5ZA 3QXUA 2I5YH 3VG9C 3W0WB 1WEJH 1UXSA 1MREH 3B3IB 4G6JL 3B43A 3BPNB 1B2WH 4WWKB 5TE4L 1V7NL 4HS3A 4P5TA 5C6PB 3A6OA 2IPUK 4KK5D 3LQZB 3WS6A 2I60H 4MNQD 4XVJL 1XIWD 5IVZB 1Q9WA 1FFQA 2VDOL 4WW2A 4I18C 4S10A 2VLKE 4JM2A 4QRPB 2GFBA 3DTXA 3EO9H 3N1FC 4WEBH 1P4BH 1DQQB 2F54E 5F6HJ 3ES6A 2Z91A 3SDCC 4I3RH 5KVMC 2FX8H 5F1IB 3B8SA 2DJUA 3M1BB 1NFIA 2KL6A 5EG6C 2VDPL 1KENH 4PY7A 1CFTB 3EOTH 3UJJL 3W9EB 4PJCF 4K8RD 5DEZA 5HVHC 4PREA 4QXUH 4RWYL 2R0LH 1WLHA 3K8MA 3T2OA 3QDJB 4WO4A 5CZVL 4JJ5B 3QJFB 1KB9J 2AJUH 2C1PB 4XCNA 3DUSB 3C87A 1HILB 1EO7A 1BVLA 4PGDA 4O4YL 1S7VB 4ERSH 1QO3A 5IEKA 5KTEH 4GRWF 1DE4B 4ZPVB 3X11B 4Y19B 3I3BA 1CTOA 2AV1A 2VC2H 5D71H 4TUJB 4Y5XB 1OLZA 4YHPB 3RGVA 2IH1B 1RUMH 2IAND 3OR6A 4X0KB 3Q6GH