4RNRA

Crystal structure of broadly neutralizing anti-hiv antibody pgt130
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
218
Chain Sequence
VQLQESGPGLVKPAETLSLTCSVSGESINTGHYYWGWVRQVPGKGLEWIGHIHYTTAVLHNPSLKSRLTIKIYTLRNQITLRLSNVTAADTAVYHCVRSGGKPHWFSPWGPGIHVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PGT130 Heavy Chain
publication title Two Classes of Broadly Neutralizing Antibodies within a Single Lineage Directed to the High-Mannose Patch of HIV Envelope.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 218
sequence length 230
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rnrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rnrA01
1MRDL 4KTEH 4UT7L 2HG5A 1MWAH 4PJXF 4K94H 4FQCL 3BPCA 1JHKH 1ITCA 1FL3B 3PWPA 4L4TE 4OGYH 3MGOA 2OL3A 5IM7A 3C08L 5SWZB 3ZYOA 1EFXA 1KLUB 5DK2B 4QYOB 4X6EB 1TJIH 4KJWC 2DM3A 1CR9H 5E6ZA 1DUYA 2WUBH 4JPVH 2FH8A 1MHPL 3LKOB 3TEUA 1IEBB 4F3FA 5FYKH 1H5BC 4Q9BA 3DX8B 2FWOB 1UXWB 3MGTB 4TVSa 4X6CA 3T3ME 1MH5B 1X5ZA 4NIKB 1RV6X 5JTWA 4XCYA 3GZKA 3C5ZD 3GO1L 4TN9A 4RRPA 2PYFB 4Z95H 1F4XL 3GRWH 4XWGL 5JR1H 5C86A 3MNZB 3B4NA 3RNQB 1Y6KR 2APVA 3ZHKA 2XRAH 3MC0A 1KGCE 3UTTE 5IEKB 1TZIA 1Y6NR 4EDXB 2Y5TA 2NZ9C 2ZP0T 1JGDA 1CDCA 5EU6E 1M05B 1ED3A 4NJ9L 5DJXA 3X11A 1XF5A 2AJSL 4YO0A 3P40A 3CXHK 2IANB 4PG2C 2EDWA 5E00A 3VXOB 1RZIA 3QB7C 4WRLA 1A3RL 3HCVB 3GSNL 3HNVL 1H3TA 2R2EB 4PJ9C 4PRHE 2AK4A 1RURH 2X4PB 3MO1A 2YMXL 2D7MA 5KSVA 5BMFL 1CD1B 5H35A 5DEFB 4ZTOH 1JZ8A 3ARVA 4X4ZA 1BIIB 4GQ9L 1A9BA 4LLYB 3VWJD 3MODL 3VG0H 5CBEA 5KS9F 3GHBH 4G80B 2ZNWA 4YDVA 1CDJA 4XP4H 1AJ7L 4HIHA 4O2EB 2JB6B 1UJ3B 2NY3C 3ZKXB 2VLKB 3OKKB 4XNYL 1NUNB 3EDJA 1ZLWH 3VRLE 5L9DL 4MSWB 1LE5B 1VESA 3UTQA 4GAJH 2BVOB 4YBQD 3GJFA 1S78D 2DWDB 1E27B 1YEIH 2EKSB 4JPKH 2DI9A 1DANU 1INQB 4XNQB 5LBSH 2I9TB 1QVOA 3FT3A 3KYMA 1CE1L 1BQHB 2WW8A 1FAIH 5CGMA 4Z7UA 5MP6H 3I02B 1MFNA 3W39B 2VQ1A 5IBLC 4FP8L 3ZE0E 3MUGA 2FGWH 1OAUL 2YRPA 1AD0B 4XVUC 5HYSG 2O61B 1OW0A 1FNFA 1CLYL 3TJEH 3SGDH 2GK2A 3C8HA 1OP3H 3D18A 1KB5H 1CGWA 4LLDA 1PAMA 3QEQE 4TRPH 3JVGA 5D6CA 5F7FA 3V6FB 1IVLA 3NAAL 3BX7C 3LH2H 5C3TA 1IGFL 2CLRA 4KV5F 4ZUWB 3T3PF 5F7DB 4PPTA 3TJHD 4H8WH 3V6OA 5LAXA 2Q86A 3THML 1DDHA 2Y36H 2BFVH 1L0QA 3MMEB 1CICD 1J86A 1HI6B 1I8KB 1GGTA 1T04B 3BEVB 3QIUD 1MNUL 2JELL 2LE9A 2Y4SA 5CEXA 3TCLB 3VFVB 4JG1H 1RIHL 2RHEA 3REVA 4JCLA 4K9EL 1P84J 4W6XB 3AMLA 4Z5RA 4PJIE 1OW0C 2LU4A 4G6MH 3UO1L 5I1IL 4FQLH 4Z7WE 2V7NA 4X99B 5MHSD 2R0KL 3TWCL 1H3PH 5ILTH 3OKNB 2XZAL 3E6FA 1BM3L 3JVGC 5I75C 3X3FH 4ODTH 5J9PA 3S34H 3VCLB 1I4FB 5IW6B 2QADD 1XGTB 1BFTA 2VDRH 4QOKE 3MBEA 5L0QC 4RFEB 4W4NA 32C2B 4L8CB 3LN9A 3V6OC 3WIHH 1F8TL 5F7EL 4O2FB 5CUSH 1TVHB 5ALCH 3VFGL 4XPAL 4NQCD 5EUOB 3D5OF 2F53E 3T0EA 4JANA 3B9KD 4OLUH 3ZYJA 1IGYA 3TVMD 3OKLA 1D5BA 3GFUA 4DZ8A 2VZUA 3VXMD 5IJVB 1VA9A 2XWJB 4ESKA 3WN5B 3LEYH 5IMLA 5INDA 2CGRL 2BOCB 4JLRB 4C56E 5I1JL 1FNSL 3OKYA 4MQTB 3KPQB 3OQ3B 1UXSA 2H9GB 1T22B 4J7RA 5EIQA 2FJGA 5J13B 4IOIA 1CU4H 2PYEA 5CJQH 3BRDA 3PXJA 4JN2A 4BQ9A 1DBBL 3BD5A 2UV3A 4NQED 3MBEC 5JOFA 4MHHG 1FO0B 2VQUA 3O2DL 1QKZH 2DRUA 1U8OA 2YPVL 4JFDD 3LKSB 3BVNB 1HQ4B 5ICZA 2MWCA 2ED7A 3VG9B 1A7RL 3T0EC 2J8UB 4OI8A 4OKDA 1VPOL 3I84A 4WO4C 4QNPF 2YPLE 3BKCH 3W2DL 3L95A 4D0DB 2D0GA 3V6ZB 3WUWB 2OSLB 2R23A 2VDMH 3GSNA 4XMLH 5E8OB 4S0SD 5FO9A 5IFAL 3F58L 4GMSH 2BNQE 1E4XL 1IAOA 4F7PB 4F58L 4YFEA 5KSAB 3IRPX 2NY5H 2FJHA 3MNVB 4DVBA 1R3KA 3WFHB 3VWKB 3ARSA 3WHE1 4M1DL 1RJYB 1NLDH 3VD5A 4NSKA 5INCA 5ADOL 3D2UD 1Q9WB 3DRTB 2R2BB 2EDYA 2CMRH 1MHEA 4R26L 5CEZH 1JE6A 1JHLH 2HJLA 3KLHC 2LAGB 2YD7A 3DSFL 5GGRY 4R7NB 4QRRE 3GBMH 5DJ2B 3GJEA 5TQ0L 3P77B 4LSRH 4WU5B 2A9NL 4XNXL 4GXVH 1G7QA 4HK0A 5B4MC 5EZJB 1DE4A 4WHYG 3BESR 5T1DL 2HG5B 3K74B 4MCYB 1RIVH 1NL0L 2HT2D 3OB8A 3RTQA 1G7PB 5JIIA 3BPCB 1T0MA 1X5KA 3MGOB 2OL3B 1EUUA 3DX7B 4NKOB 5IM7B 1Z9LA 1J10A 2EICA 4EDWL 2X2YA 1IKFL 4G5ZL 1P4IH 4PR5A 4YHLH 3ARWA 3I9GH 2GTZA 1N2RA 2IG2L 3IT8D 4H26A 4XP6H 4F3FB 2ARJQ 3U83A 4JG0H 3MCLH 2VXVL 1ZKAA 4KAQL 4PJ5A 3PUCA 1NC4A 3LHPH 3KPRE 4X6CB 5GGSA 3UYPA 5EBWB 2GSIA 4JVUA 2ZUSA 2YUXA 1B6UA 2AI0L 3DMMB 1T21B 4XCYB 1KTDA 2WINB 3RTQC 4R4ND 1O0VA 1QSEB 4N0FA 4LKXB 1FGNH 1U8QB 4DAGL 3E1F1 4I0PD 4LQFH 4HMDA 5EIVA 2RFXB 2XNAB 3K8LA 3WXWH 4P2OD 4J23A 1J12A 3GSXA 1RHHB 3HNTH 4LU5H 5FUZL 5SV4A 2EH8L 4UQ3A 1TZIB 2VE6A 2NY3B 1EUTA 1JGDB 1OGAA 1ND0A 1ED3B 3X11B 1LEGA 3RAJL 1XF5B 1ODAA 4N1EA 4G7YL 1KCRL 4YO0B 1OVZA 3MBXH 2W65A 1TVBA 7FABL 2ZNXA 4AQOA 5JHLH 5E00B 4LQ1A 1RZIB 3D85B 1UCTA 2DL9A 2D7NA 4JRWA 5HYJD 4QCIA 2AK4B 1IGJA 4ZXBA 3MO1B 5KSVB 4PRPE 5C0BA 4YUEH 1V3LA 3MZTA 5H35B 4BQ8A 3B5GA 3MLSH 5IR1A 1X5HA 5H2BA 1DQQA 4FQIL 4HIXH 5DRWA 1Q94A 5CBEB 2V7HA 3NTCL 1P1ZA 3W5NA 2X1PA 1QRNB 1KJ2L 3AAZA 5EUOF 2XKUA 1X7QA 1CVRA 4NYLA 4YHZL 2NY6D 3NCJL 4MA8L 4HIHB 4I9WE 1HHHA 1HSBA 3C2SA 2QEJA 3O4LD 4LSTL 4PJFE 5H37G 3O2DA 3UTQB 3UYRL 1E4XI 1X5FA 5EB9A 4LPYA 3MYJA 4G6AC 1QVOB 5DVKA 1JNLH 2J4WH 5GSVA 3BH9A 1JRHH 4ZXBC 1D7FA 2UZIL 3TZVD 2Q7NA 3QDME 4LIQE 3BKYL 4BSVA 2VZOA 2OCFD 1F3DJ 3MUGB 3A6CH 3O2VH 2KPNA 3SOBL 4R0LA 5KSUA 1RZKL 3H7LA 3ALWA 1A7PH 3D18B 1X44A 1INDH 1A1NA 1FYTE 2GSGA 2VXQL 1QFOA 4LLDB 1CLOH 3GIZH 4LCUA 2G2RB 2DQUH 4JM2A 2J8UF 3L1OL 5I75B 3H3KA 4I77H 2I5YH 2WIIA 1RFDL 2DKMA 3WSQL 1XGYL 4UIMA 3BD3A 1IT9H 3UMTA 2CLRB 2V9QA 3MXWL 5B38A 3VFTA 2DJSA 3BH8B 2J6EL 2CRYA 4XC1L 4FRWA 1DDHB 3RY4A 3RIAF 1OAXH 1LP9A 1OGTA 2LTQC 4BZ1L 5B21A 5CEXB 1SEQH 3FN0L 3SGEH 2BDNL 1FO0H 4LSQH 3REVB 4U1SA 5D8JL 2DS4A 1JGVL 1JF5A 3O9WA 2R1WB 4R0LC 5DC0A 4Z5RB 3NBNA 1AKJA 4B7LA 4P2QA 4NBXB 1NMBH 1KNOB 4LLQA 5F9WB 1NAKH 4HH9A 3E6FB 3CH1B 4JM2C 3Q0HA 5GS2H 3AU1B 4QWWD 4HIIA 4LVNC 3S35X 4YWGL 4JO2L 3PWNA 2WZPD 1EV2E 4HLZG 3MBEB 4WNQB 4OLXH 1BPVA 1FIGH 4M7LT 3U48A 4JDVB 2EXWC 2AEPL 1ADQL 3V7AE 4X6FA 3T0EB 1A22B 5BXFA 4JANB 1IGYB 2HLFD 4OKVA 1VFBB 1TNNA 3HI6H 3NVQA 4DZ8B 1SJHB 1KBGL 1JMZA 3ARDA 4U05A 4MCZB 3FONA 1UFUA 2H6PA 3O9WC 5T1LB 1RZ7L 2M26A 1G1YA 1RUKH 1UXSB 3KPSE 2FJGB 3EYSH 1YYLL 4OGZA 4IOIB 5F71A 1T1ZB 5F96L 4YXLH 2P5ED 1HOCB 4JN2B 3UP1A 5E8DL 3RL1B 3BPOB 1FE8L 1LO4L 1LD9A 1P9MC 2IFFL 3GMQB 3RHWF 4B5EA 1U8OB 4X6CF 2DLHA 4HH8A 1B0RA 4PY8J 1VFUA 5C0JA 5GS0H 5ICZB 4NZUL 4ELME 3OKDA 4DVRL 5D7LA 4P46D 5TE6L 3VXRE 3MRRA 2OL3H 1R3IL 3HG1A 1E6OL 2IQ9L 3IAQA 3L95B 3DJ9A 1AFVH 2H1PH 4OIBA 3ARDC 1UM5H 4OGAC 1F3JB 4WUKL 3K81A 5FO9B 1WBXB 1U93A 1TCRA 1IAOB 43CAA 2FJHB 1OY3B 3EKCA 4DVBB 1R3KB 4CJ0A 3BHBA 2MFNA 4NSKB 1ES0A 1XR9B 5FCUH 2PN5A 5INCB 3M17B 4YR6A 2VDQH 4P3CH 4K3EL 1KJ2A 3JV4B 1MHEB 4U0QB 1NBVL 4RWYL 2HJLB 4OZIA 3FMGH 5DJDA 5EO0A 1MLBA 5KANI 1LO5A 3GJEB 2XWBB 1NCAL 4OCYH 3T1FB 4RQQA 4Z0BL 2DQDL 1G7QB 5CBAA 2DDQH 4HK0B 3T0XA 5T5NG 2IBZX 1DE4B 2GCYA 3MQIA 3TC9A 3ROLB 1UC6A 2PW1B 3V79C 3VGFA 1VEOA 3OKMA 1BMGA 5CCKH 4H1LG 1I1YB 1TZGH 2DTMH 3OPZL 4OI7A 3GUTA 1FRGL 5D1XD 3SBWA 3TA3A 1T66C 3C6LD 4OTXH 1PG7W 2CR3A 5FHBL 3LEVH 4DQOH 3LN4B 4OLYL 3JTTA 4M43L 1MQ8A 4PR5B 4WTXA 4QXTA 3NCCB 2GTZB 1FLTX 4ODVL 5D2NA 4H26B 4LAQH 3OX8B 4Y5YC 4ZUUA 2J6EA 4U3HA 1KPRA 4PJ5B 1NC4B 1VENA 3PWUB 5GGSB 2GSIB 2XQBL 1I8LA 1A6TA 4XMPL 4QTHA 1F90L 3R0MA 5F9JB 2YN5A 1KTDB 3KAAA 4JHWL 3H2WA 3A6OA 4KROD 4N0FB 3GB7A 3WO3B 2I25N 3SBWC 1I9IL 5FO8B 4WFHD 1QO3B 1RZKC 4NNXA 3E8UL 3QXTA 3VXUD 3H9SD 3T04D 4UQ3B 2VE6B 4ZO6A 1OGAB 5LWYL 3T1WA 1ND0B 5D2NC 1LEGB 1FFPB 1SQ2N 2B0SL 5FXCH 4FQ1L 3O8XA 3QR2A 3UTPD 1TVBB 1ADQA 4GS7C 2QL1A 5IVXE 1IGJB 1YMME 3HMXL 3QNZB 4ZXBB 3U7AA 1I8MA 1T1WA 1C5BH 4PGCB 5C0BB 4HUUA 3KS0H 5H2BB 1DQQB 1AHWA 3NABL 4X6DA 2HT3C 4PJ8D 3PQYE 3D39A 4XP9H 5DRWB 1Q94B 4EI5C 4NZTL 1WZKA 2V7HB 1MY5A 4V2CB 2AKRA 3RVUC 1QFUH 4I5BB 5F3HA 3AAZB 1X7QB 4NYLB 2J88H 1HHHB 1HSBB 3CVIL 5KSBF 2D7OA 4HSQA 4JFQA 3SDCB 1MRDH 3O8XC 4UT7H 3L5XL 4TQEL 3P30L 4FG6C 3MYJB 1C08B 4L4VA 4IRSA 4PJDE 1MPAL 4FQCH 2XQYK 2IADB 3BH9B 5DO2C 2KL6A 5J0BA 4NQCE 2NXZC 2OTWA 3TH3T 4EBQL 3C08H 3SKMA 1JGEA 1ZT7B 4BSVB 5DMGC 2J5LC 4L3CA 2VSDA 5C9KA 4B50A 4R0LB 2YR3A 2B2XL 4RIRA 1A1NB 4OCXL 4PYHA 4GBXC 1MHPH 4HUXA 4YFDB 2EE9A 3GSRA 2WIIB 3K8MA 1R3HA 4UIMB 5JW4Q 1KC5L 4HIJA 2VIRA 4KK6D 5JQ6L 1ZK9A 3P73B 4G9DA 2BVUA 4UNTA 1RJLA 4JFFA 3Q48A 2JF1A 3GO1H 3SDDD 4N9OB 1MFCH 1NFDB 3ZKMD 2X4NA 2DD8L 4JFDE 3O41A 2BSRA 2ZUYA 2DQJH 1LP9B 1F4XH 1AO7D 1OGTB 4ZS6C 3LV3B 5I8EA 3TCXA 5HHQA 3HZKB 1NCDH 1CDGA 4UQ2A 4NWUH 5GRUH 1PD6A 4Y7MA 5DD5L 4XPHL 3BQUD 3O9WB 1NBZB 2EEDA 3FZUC 1AKJB 1U95B 3U36A 1KYOK 1IL1B 4NJ9H 5T1KA 2AJSH 3HLAA 1JPFA 4E41A 3STLA 4LLQB 1MCQA 4CADB 3QUML 1KF9B 4HH9B 5C0RL 3BZEA 1S9KC 1KTLA 1A3RH 5DMIL 1HKLH 3PWNB 4NGHL 3GSNH 3HNVH 3QRFM 2NX5B 4H1LB 5FDYA 1QBML 4NQUA 2YMXH 5BMFH 5J6GA 5FK9A 4EN3D 4FXGA 4M4RA 1NUDA 1LO0L 3MV8A 1U58B 4OKVB 4AEHL 3BIKB 1OAYL 1ZA3A 4QHMA 3UYOD 4DZBA 1MCSA 1EO7A 2EYTA 2E7BA 4U1MA 3VFMB 3QHTC 4XHJD 3FONB 2H6PB 4WWKA 1AJ7H 2RIKA 4K7PY 3WFCL 5AD0B 5EO9A 2NY7L 4XNYH 3QPQC 5L9DH 4GW1A 1KIRB 4G8EA 2BY0A 5JXEA 1CD8A 1F58L 2O5ZL 2X5PA 4IS6A 3ZHDA 2E9JA 4Z7OE 4ZYKA 3WO4C 2K7QA 3TNMA 5EO1A 4ZSOA 2VJXA 1NDGA 4YC2B 4BSWA 1FFOA 2G60L 3OKDB 1MQKH 4FP8H 3BWAA 1OAUH 4NO0D 1CLYH 4KRNA 3HG1B 5D7SL 3HA0A 2XV6B 5DJ6B 1ZS8A 3NAAH 3HMXA 4I18C 3CDCA 3CFKA 1U93B 1IGFH 2NW3B 3JV0A 1IE5A 3G5VA 5CJ8A 3FHQA 2FGZA 2COQA 3KXFA 3UAJD 5JXEC 5KOMC 1MFAL 3FOMB 3EJYC 4X98A 1ES0B 5GS2D 2NTSP 3SQOL 1MNUH 3HFML 2JELH 1S3KL 3HE6B 4FTVE 2A73A 2A9ML 5EO0B 1RIHH 5FEBA 1E6JL 1WAAA 2E27L 2VXTH 4GRWH 1KFAL 1MHHB 4H88H 1XCQA 4K9EH 2AEQL 3IDNA 3RX8A 2PO6B 2BSTA 1JGUH 4JZOA 5I1IH 5TFSH 1BEYH 2W0LA 5CBAB 3ZL4H 4R6UA 2V17L 3ARPA 2R0KH 3TWCH 4M3JA 3QYCA 2XZAH 3T2NL 1BM3H 5DRZA 4KJWD 4NZJA 3OKMB 4PJAE 1Q38A 2V9RA 3D48R 1NLBH 4NO5A 2XG5A 1JWSA 5F7EH 2VC2L 3TA3B 3D3VE 1PG7X 2IMMA 2G75A 2VLJD 4ZNEE 3AUVA 3JTTB 2GITB 5K9QG 2EDXA 1K2DA 5ALBL 4G6FD 5D2NB 1KPUA 1YPZE 4E0RA 2DMCA 2CGRH 3PWPD 2AABL 5I1JH 8CGTA 1FNSH 5CJXA 4M7ZC 1KPRB 1RI8A 4G8GB 3STZA 2WBJA 1U8JB 4RNRA 2DTSA 2RBLA 1EFXD 2XTJC 1T6WA 2OQJA 4N5EC 3L7EA 2NZ9D 1A6TB 3OJVC 2AP2A 1DBBH 4OF3A 4X9FA 1W0VA 4QTHB 2VLRA 1Q0XL 5MI0B 5E4EB 4PGEA 3S8WA 3O2DH 1UJTA 3ABZA 4GG6E 2Z8VC 2YPVH 1W0WB 1LGVA 3GB7B 4RAVB 5I1AA 1BP3B 4X7CC 4TUKL 1HEZA 3MFFA 3WKML 1A7RH 4NNXB 1H3VA 5MERA 2NXYC 4PJ9D 1ZA6A 2CLVA 4QO1A 1VPOH 3DUSA 1NFDF 4CRPA 3V5KA 1ETZB 1LP9F 3MUJA 5E24E 3W2DH 4FFWC 2EKJA 4KY1L 3O8XB 4ZAKA 5FM8A 1A7NL 3F58H 5IFAH 5CJXC 1E4XH 4F58H 4P3WA 1IGMH 2WBJC 3RWJA 4YE4L 4WV1B 2I07A 1WEJH 4N68A 3CMOH 1X5LA 2NY3D 2R1YA 1RAMA 1I8MB 1T1WB 1F3RB 5AG9A 5ADOH 3BE1L 4X4ME 1J05B 4HUUB 4R97C 1AHWB 4R26H 4WI8A 5CWSA 4X8JA 3L9RA 3D39B 3SCMD 2W60A 3DSFH 5HD8C 3INUL 1MFEL 1OWWA 3MV9D 4P0DA 3DYOA 5GISL 4B41A 1Q1JL 5TQ0H 5F3HB 1IMHC 1E0OB 1TJHH 2A9NH 3WLWC 4XNXH 1T7WA 5GRYA 4TYUA 3GI9L 4P5TA 5IBLD 1WGOA 1H3WM 4KI5C 2EYSA 4JFQB 3CX5J 2XN9E 1G9ML 4ZAKC 5T1DH 3WLBA 1IKNC 3MLUL 1E28A 1NL0H 4L4VB 2O93L 4IRSB 1KULA 2NNAA 5GGQL 5DQ9A 2VAAA 2Y7QA 3QWRA 2OTWB 3SKMB 3T8XA 4HG4J 5I74B 1ZHNA 4EDWH 1IKFH 4G5ZH 1CLCA 1MCEA 1ZV5A 4KUZL 5L8KB 1K4CA 2AERT 4KWUA 1J88A 4HUXB 5ISZD 2VXVH 1L7TH 4KAQH 4KFZC 1R24A 1R3HB 4P5TC 4HIJB 5K33A 2ZSWA 2VIRB 1X3DA 5I1EL 3EYFA 2VDPH 4G9DB 2J8OA 3EOBA 5DJ8A 1JZ7A 3BPLC 1FLRL 4JRXE 2M2DA 2X9YA 4ZUVA 1RJLB 5D4QA 1G9NL 2ERJB 4JFFB 4U3CA 4N8CL 5CP3A 4KMLB 5IKCB 4G6KL 5I8EB 4V1DA 1ZVHA 5E8NA 4UTAL 4DAGH 2JIXA 5LCVL 4UQ2B 3DXAB 1E4KA 2AJYL 1VSCA 2IMNA 3QDHA 1MCOL 5FUZH 2VYRE 2CJUL 2EH8H 1FZMA 2NLJA 4XC3L 3U36B 5L8LB 1UZ6F 5T1KB 2DMBA 3RAJH 3HLAB 3PGCA 4S2SA 1ZHKB 4G7YH 4E41B 1KCRH 1RU9L 5JHDD 3L5IA 7FABH 5HVHB 3LOWA 4HFWA 4IDJL 1YYML 3BZEB 4RWHA 1I3RA 1KTLB 2EECA 4FFYL 2ESVE 1DQDL 4WFGE 3LD8C 1B88A 2FHBA 2XFXA 3V0VB 4F37K 3TBYB 5J6GB 5FK9B 4FXGB 1JF1A 4KQ3L 1IRAY 4OSUH 3UPAA 3MV8B 2HJKA 1ZA3B 4QHMB 3NTCH 3EO0A 3MBED 4U1MB 5IHBA 2YZ8A 4YHZH 3NIFF 3BT2H 4MA8H 3QWOB 4WWKB 2NYYD 5E03A 4LPXA 3UJJL 5C2BL 4IRJA 4LSTH 4L4TA 3T0ED 1BJ1H 4G8EB 1HN1A 2VXSL 4WO4D 4XRCA 3UYRH 4FMFA 3ULVF 4HGMA 5GS3A 1QBBA 3W9DB 4K2UH 3ARBA 3UBXI 3TNMB 3SJVA 1M7DA 5EO1B 1N6QL 4J12A 2UZIH 1NDGB 1FFOB 3BKYH 3K2UL 3CK0H 3VGEA 3FOLA 1BF2A 3BWAB 2PYED 4JFOA 3SOBH 4K7FA 3DARA 3D25A 1FJ1A 4N0UE 4L8BA 1RZKH 3WFDL 4XBGA 2XKNB 3IDUA 5L6YL 4KUCF 1ZS8B 1P7QA 2VXQH 5FIEA 5K59E 2R39A 4F80A 2EDJA 1FZKA 3L1OH 1O5DT 5I8CB 3KLHD 1RFDH 3UROR 3FO2A 3UBXA 3CFKB 1XGYH 3SKOA 3WSQH 2EYRA 3MRHB 3MXWH 5ID1A 4OZHB 1TETH 3BN9C 2CXGA 2PXYA 3L7FA 2HRPL 4XC1H 4L9LA 5E7BA 3NPSC 5D1ZC 5B4MD 3UTTA 1FDLL 4X98B 1GOFA 1UWXH 3QEHA 2HFTA 1G7LA 5D96C 5EU6A 4BZ1H 1EMTL 1F6FB 2DN7A 4ZFFA 3TNNB 4JKWA 1A6UH 3FN0H 2BDNH 2A73B 3WFEH 1K3ZA 3KLAB 4L4JA 5D8JH 1JGVH 3IDNB 4WU7A 3DV4B 2BSTB 4LDOB 2F54E 2FO4A 4HBCL 4PRHA 3DLQR 5EZLA 1WV7T 5BZDA 2VWEE 3SPVA 4YDLB 3G6AA 5DRZB 3DUHA 3IDIA 4HIEB 4DN3L 2B7DT 3OAZH 4J1UA 4JO2H 1TITA 2Z8WC 2F8VA 3K7UA 2R0WL 4NO5B 4Q6IA 2HTKC 2PXYC 4HUWA 2AEPH 3W82A 1ADQH 2ICES 4L9LC 2ZG1A 2G75B 1BFVL 1XR8A 4QRPE 1DSFL 1JTOA 3Q1SH 1PY9A 2IF7A 3UJIL 3N50A 1DVFA 5TF0A 3RTQD 1KPUB 3BGMB 3TH4T 1IQDA 4E0RB 1RZ7H 1D5ZA 1MCWM 5DYOA 4QRQA 4PTUA 3W0WD 1WICA 1G9MC 3STZB 2B39A 4BK4A 3JUYA 4RNRB 1YYLH 3T4YB 5BQ7A 1K8DA 2OQJB 3TO2A 2DLIA 4L8DA 1PSKL 5E8DH 3RJDA 1MJ7L 1W0VB 3GMOA 1FE8H 1LO4H 1SMAA 4Z78A 2IFFH 4Q6IC 2AJZB 5E9DE 2Z91A 2NY0C 1MHCA 1GAFH 1FVEA 2FNBA 3QEQA 4NZUH 4PJ5D 1OLZA 2FZ3A 3MFFB 5ESAA 5HHNA 5TE6H 2CLVB 1IM9D 3DUSB 1LEKA 1R3IH 4S1SH 3LZFL 2IQ9H 1BAFL 4GAYA 1YN6A 5FV1L 5EOCL 4P2RE 5I1CL 4PLNC 4LP5A 4OV5B 2GJZA 1QFWL 3HI5L 1GOGA 1DL7L 4NM4L 2AV1B 2YKLL 5B3NA 2AXFB 2NR6C 1G9NC 1XF1A 4RGNE 4R90L 2ILLA 3DETC 3RWJB 3AM8C 4PBWD 2I07B 3HUJF 1AGBB 5E2UL 5T3ZE 2BZDA 2R1YB 3CFBA 1HH9A 1YEDA 2YWZA 4M00A 5C0AD 1X5YA 4U1GC 4PJIA 1YECL 3VXME 4OZGB 4K3EH 4DKEL 4OFVA 4P5MA 1XGPB 4RWYH 5CWSB 4JREB 4X8JB 4G6AD 3BGFC 3RZCB 3S96A 2W60B 4LRNL 3U4AA 1H8OA 3O3BA 5GZOC 1F4YL 5JZ7C 4Z0BH 4XTRC 2GK0B 2BVQB 2OM5A 1VDGA 2V5RA 4JFED 4YXHL 2A6JA 3WDHA 3ZDXF 2EYSB 1T1XA 2F53A 3BPLB 1K6QH 1E28B 1SVZA 2DQGL 2OX5A 5AUMA 1ZLVK 3ETBF 1REIA 3PIQA 3NACL 4OCWH 1T7VA 4YLQT 1JVKA 2NNAB 3CFEA 3O3DA 5DQ9B 2CIKB 2VAAB 2LVEA 4YZFE 4C56A 1J11A 5FHBH 4JN1H 1ZHNB 1DLFH 4M43H 2ITDA 4FXKB 3BPNB 3NIDE 4S1RH 2Z31A 4ODVH 4ELKB 3QH3A 4J3OC 1K4CB 3P3YA 3ZKQD 5EIIB 4CDHA 5DI8B 5J3HC 5CZXC 1YQVL 4Z7NE 5F6HI 4EVNA 4NOBA 5E6YA 4QLRA 4KI1A 1CD0A 2XQBH 3WMSA 3EYFB 1OTSC 3EOBB 4PJGE 4XPBL 5DJ8B 3ZE1E 4XMPH 1BZ7A 1F90H 1FL6B 2LV4A 5KVGH 3QHFL 2YPLA 4LIQL 4MNHA 4LPUA 4V1DB 4JM2D 5E8NB 1W8NA 4OZHF 5ICXA 2JIXB 1I9IH 1RUQL 1J7VR 4RAHA 1H0DA 3E8UH 3AB0C 3FQNB 3ILQC 4I3SL 2NLJB 5TE4L 4RA0C 3Q6FA 1MFBH 1UWEL 2X1XR 3GSWA 5LWYH 4ZTPH 3BP5A 3PGCB 4S2SB 1KYOJ 2B0SH 9CGTA 4FQ1H 5ITFA 1HDMA 3FRPA 3MUY1 1T89A 3LRSA 4DCQA 4DKAA 1I3RB 5CKGA 2JK5A 3QUKA 4JY5L 1KEGL 2HA1A 1U8KA 3ZTJG 3O9WD 3L5JA 1G0XA 2XFXB 3HMXH 1AKJD 3SE3A 4CW1A 4PJCA 1E4WH 1JF1B 2DM4A 4XI5C 1I9EA 25C8L 4P2QD 4F57L 3QUXA 4PJ7B 2FR4A 4MA7H 3NABH 4R4FL 3S5LG 5ACMA 4XP1L 1I7TA 3R0NA 4NZTH 5FYJE 3ZT6A 5I9QB 3GIVB 3BZ4A 4G3YH 4RFNB 2X89D 5TDNA 3VFRA 4QGYA 3VJ6A 3CVIH 3FT2A 4IRJB 4XGZA 4MVBC 2V9TA 2P8LA 3IJYA 3P2TA 1QFWI 4LEXH 3L5XH 4ODWB 4TQEH 3P30H 4NCC1 4X5LA 5DT1L 1HSAB 1XF2B 1MPAH 3ARDD 5JO5A 1B4RA 4OGAD 4OD2B 3ARBB 3SJVB 1M7DB 2FHFA 3SE3C 4EBQH 3OG4B 5C0DB 1Z0NA 5I19H 5GSRA 4PIRF 3QUXC 3R06A 1S7TA 4I1NB 4JFOB 3WD5L 3D25B 3IYLW 4H0IA 4L8BB 2B2XH 4W6WB 3MTRA 4XBGB 5BVPL 4CJ1A 3GJFK 1KCVL 4OCXH 4JPWL 4UT9L 5IJKA 3DVFA 2NY2C 1P7QB 3NZHL 3C6SB 1FZKB 4FQJL 4ZG1A 3FO2B 5KOVC 4HLJA 3I6KA 3SKOB 2EYRB 2HFGL 4E42A 5D7LD 5JQ6H 4NQVA 3C09C 1GGCL 3OBAA 3DECA 4L9LB 3IDMB 3MXVH 4UV4L 3UTTB 3QEHB 3UZEA 4WI5A 2DD8H 1G7LB 5EU6B 5BS0A 4CAGA 5T3XE 4ZFFB 1BD2E 3GEWB 1KLGB 5DD5H 5DK3A 1XH3B 2RGSA 3CLEL 4XPHH 3WNPA 3VFWA 5DD1L 3MRNB 4WU7B 2FO4B 4OZGF 2Z93A 4NRXA 3JV5A 1IBGL 5EZLB 4JRYE 5MEQA 2V5TA 1J8HB 4PRPA 4U7KA 3SPVB 4OFKA 1ZGLM 4WJ5A 2AK1L 3G6AB 3KJ6L 4J1UB 5C70A 1B2WL 5DMIH 4NGHH 3HAEA 4XNUL 1BF8A 5DSCB 2Y72A 3MLTA 1QBMH 2NY0B 4HUWB 3AY4A 5D5MF 5J12B 3PGDB 4ZOAA 3GKWL 3MRJB 1OAYH 3D9AL 5CP7A 4PJFA 1K9TA 4G8FA 5EZOL 1I1RA 3HHRB 5C07B 1DVFB 1UKQA 1IQDB 4X5XA 3T09A 3TFKC 5BVJA 1D5ZB 3FB7A 1FL5A 2NY7H 4PTUB 4YGAB 1WQVT 5JPNB 5BQ7B 1K8DB 3QDMA 1F58H 1P7KB 2O5ZH 4L8DB 4ODHL 4MJ5A 3RGVD 3TO4A 4AMKL 1CXFA 3NCYS 3GMOB 4FFZL 1XF4A 2Z91B 5ID0A 4MD5A 1FYTA 3AY4C 5D7JC 2Q6WA 4MQXC 1FVEB 2X70A 3QEQB 2G60H 2FZ3B 5IESL 3LDBC 5ESAB 4HJGA 4N0YL 4KRPC 1LEKB 3I6GA 3IU4L 2IH3A 2X44D 2BY2A 4HX1A 5D7SH 5HGBA 1YN6B 3RY6A 1MRFH 3IFLL 4ZFGL 2HT3D 5GGRA 4EI5D 4KTDL 3MX0A 1MCFA 2G5RA 5F1NB 3RVUD 5DJ0A 3IS1X 3FQRA 3RL2A 4D8PA 1MFAH 2VR5A 1TXKA 2ARWA 3CFBB 4AH2A 3TO4C 4RMQA 1HH9B 4JB9H 1F11A 5SX5H 1HXYB 3SQOH 4PJIB 4LLVA 3HFMH 4DWHA 2VL4A 4KPHL 4P5MB 4FG6D 2AJ3A 2A9MH 2B8OT 3C8KB 3CD4A 4I0CC 1BIHA 5CP3H 3U46A 3S96B 3BAEL 1E6JH 2E27H 1KFAH 2NZIA 1JHTA 3O3BB 2AEQH 5DO2D 1OAQL 4PJ7F 1NEZA 1U36A 1IEHA 1QSVA 2NXZD 4FZ8L 1YC8A 1HK6A 4POZC 4D9QE 2V17H 3ZTNL 1VACA 3RY6C 1G0DA 3B2VL 5DMGD 3T2NH 5D7IE 4EI6A 3ZT5A 1BREA 4IMKA 3CVHL 4ODSL 2CIIA 3S35L 3D39D 1JIBA 5KZCD 2GJ6E 2H45A 1FG2A 2VMFA 3F65A 5CZVL 4S1QL 4MS8C 1NGQL 4GBXD 1RULL 1OF2A 4NNPL 3U4BL 2Y6SC 1L0XA 4MJID 1U3YA 1UZ8A 2VC2H 3WNOA 4PGJA 1VKXA 3O3DB 2HFFA 3I85A 4JO4L 5CZKA 1HNFA 4OBRA 3P9MA 1NMAL 3MLRL 2MQ0A 4BYHA 5EBLA 2ITDB 3KPSA 3O6LL 1KB9J 4ETQA 3HMWL 2D0FA 2Z31B 4XBEL 4L4VD 5ALBH 1CIUA 5B3JF 4XCFL 3RWCA 5IHLB 3QH3B 4ZS6D 1K4DA 5DVNA 2Q20A 2AABH 4HDIB 1SBBA 4JQIH 5LGJA 4TTDC 2SEBA 1A6AA 4HWZA 4YHKL 4EVNB 2K7PA 4M6MH 3T3MF 4X7SL 5EFIA 4MA3A 4O02L 3FFCE 2J3SA 4IMKC 4I0KA 3FZUD 4LBEA 1KJ3L 4HS8L 1BZ7B 3ARYA 3VXRA 1Q0XH 2K1MA 4F8TA 4R2GC 2C1OA 5IK3A 1IZJA 4MNHB 4RFOL 1BQLL 1A2YA 3G9AB 5ICXB 4TUKH 3WKMH 3S37L 5I1HL 1H0DB 4OFYA 5C0IA 5CHNB 4NZRH 1AGEA 2I60L 1LEIA 1NANI 4M02A 3P0VL 3GSWB 1TTUA 4Y88A 2DL2A 2GFBA 3V4PL 1C1EL 3QISA 2D2OA 2YA0A 3BP5B 4KY1H 2E7MA 3C5ZA 1ZT4A 5GJTL 1MELA 1YEKL 1A7NH 3LRSB 4JO3L 4DCQB 3ULSB 2JK5B 5I71B 1P2CA 3FB6A 1U8KB 4YE4H 5ANME 1LDPL 1Y18B 4KDTA 4CW1B 4PJCB 3ARXA 3QPQD 3BE1H 3QUXB 3MOQA 5IROA 4MNQB 4X7TA 2FR4B 1W2KT 1QSFE 3PWVA 1TQBC 1I7TB 3HTLX 5A3IC 2AV7B 3INUH 1MFEH 5GISH 3CXDL 1Q1JH 3VD9A 1XIWC 1NEZG 3BZ4B 4XB7A 1EEYA 1S5HA 4RBPH 3WIFA 5TDNB 3VFRB 3VJ6B 3FT2B 3GI9H 4CUCA 3DGGA 4XGZB 3VRLF 1PLGL 3QAZC 2P8LB 3IJYB 5IEHA 4NM8H 3C09B 3C5ZC 1G9MH 3TIDB 5IUSA 1T20B 5D93B 3MLUH 4JJ5A 3VWJA 1OP5H 3SQBA 2VUYA 5JO5B 3CZJA 3KPNB 5F7YC 2Z35A 1BOYA 5IB3B 3VI4E 5SWQB 2MSPA 4KDTC 1A6WH 5GSRB 1S7TB 2I26N 5JXED 3PGFL 3MACH 5GIRA 4KUZH 3EJYD 4NQTA 4CMHC 1F4HA 5K9KB 1S8DB 2CKBB 4M61B 3M07A 1QR1B 3LQAC 5F97E 3W0WE 3IXTA 2NY4C 4HC1L 4MJ2A 2RJMA 4KKBC 2E9BA 3L3KA 4E42B 4PRIE 1MAML 5I1EH 4NQVB 1FLRH 4PV9A 1G9NH 4U1IA 5TGBA 1CQKA 4N8CH 1WIPA 5KG9A 2ZCLL 1OP9A 3QWQB 5BS0B 2MCPH 5J11C 3WE6A 3DNKA 4D2NA 5LGHL 2P49B 2QQLL 3FO9B 4UAOC 2AJYH 4X9BA 1QHOA 3VFWB 1MCOH 2CJUH 3KXFD 2L4OA 5I15L 3BDYL 1EK3A 1INEL 2Y06L 4XC3H 4IJ3B 3CVHA 2CRZA 1YNLL 5IVXA 1YMMA 4PGZA 2UVFA 2X4QB 2Z93B 4EJ1C 1ACZA 5MEQB 1CICA 4PRPB 2CO7B 1XGRA 5GQBA 4WJ5B 1T83A 2W1NA 4IDJH 1YYMH 5DQDL 3L3IB 4HKJA 4FFYH 2JJUA 1DQDH 3HAEB 2H26B 1CIDA 4F7EA 1QR4A 1A1OB 2AJXL 1ZXQA 2EIBA 4KQ3H 4KDVA 3VXPA 1MI5E 4R4BA 5HGGS 2R1XB 2XTJD 3QCUL 4KMQA 4RMTA 4N5ED 4M6AA 1ZAGA 5CP7B 4G8FB 4HK3J 5IGXL 4J3UA 2FYYA 3PL6B 3UTSE 3AFLA 5DUML 3FB7B 3UJJH 5C2BH 4WFFD 3B83A 1FL5B 1FSKC 4Y4FC 2X05A 1HXMB 5KW9L 3QDAA 1A02N 4M62H 3EFDL 2NXYD 2KZ1B 2QKIA 4WWID 4NQCA 4QRUA 2VXSH 2BC4B 5DFVC 3QDMB 3B9KA 3FQWA 1T83C 3TVMA 4FFWD 3TO4B 1UM4H 2BRRH 1U8NB 1DUZA 1MCIA 1XF4B 2C4FU 5C0EA 4PRDA 2G5BA 3JZ7A 1N6QH 3CUPA 4MD5B 3JBG7 1FYTB 4P5KA 4ZQKA 2Q6WB 2X70B 2IALA 2WBJD 1PVHA 1MUJA 3WFDH 5I18H 4CNIA 2VLRD 5HGBB 3WS3B 5L6YH 4GH7B 4PRNA 4Q9QL 1I75A 1G7IB 1HNGA 4JFDA 2YD2A 4POUB 5HD8D 4X4XB 5MENE 5EU4A 3KPLA 3VMPA 3RL2B 4I3RL 1U91A 1Z3GL 3WLWD 4D8PB 1VEPA 1Z2KA 4PV8A 3MROA 4AH2B 1FDLH 3LEXA 1F11B 4KI5D 2KZWA 2YA2A 4LLVB 1ZLSL 1DQLL 4ZOCA 3VDCA 2WBWB 4BJLA 4BZ2H 1FFNA 4ZAKD 4NRZA 5HHME 1TIUA 2X41A 2AJ3B 4JY6A 4KKAC 3U46B 3SE9L 2QSTA 3PP4L 1GC1C 1JHTB 4PJCF 4JY4A 5C1MB 1NEZB 4HBCH 2R8SL 4LCCA 1MCDA 2A6KA 3UCRA 3VFNA 5F21B 1O7VA 1VACB 4RCAA 3O81A 4E9LA 2UZXB 4LPCA 3D2UA 4EI6B 5IOPA 4JVPA 4ORGA 4DN3H 2CIIB 5E6IA 1U8IA 5I17A 4CVXB 3CCHA 4GRMA 4R2GB 3AC0A 1UENA 1OF2B 1SJEB 2Z8RA 5LKNA 4NHUA 3U0PA 2GHWB 1AI1L 3EAKA 2HFFB 3VXSE 4K7PL 2IH1B 4P5TD 1FYHB 4NQDD 3P9MB 1DSFH 1CXIA 3LS4L 2YUWA 2UWEB 1G1CA 3QDJD 3UJIH 4ETQB 3X12B 4AT6A 4HC1A 4PS4L 4WFED 1CGSL 5FO7A 1K4DB 1JTPA 4Z6AT 3JWNC 5DD3H 5LGJB 5IMOA 3MRLA 4LCCC 1OM3L 3I75A 2EDBA 1AXSA 3LN5A 4MA3B 5EFIB 5DHVB 1PSKH 1CT8B 1J8KA 4LBEB 4PJXE 1MJ7H 5E6IC 1YN7A 1Q8MA 2C1OB 5IK3B 4D9LL 3LQZB 5FHAL 1A2YB 5L88L 3FFDA 1T3FA 3ILPA 2V5MA 2AEIT 2EC9U 3V8OA 1AGEB 1LEIB 3LZFH 5I0ZA 1BAFH 2IPKA 2YN3A 2PTUA 4KK5C 3OZ9L 5EOCH 3WYRA 5I1CH 5EN2A 5K9JL 1MREL 2M1KA 4MMXC 3C5ZB 1ZT4B 1HYRC 1QFWH 2WWMC 3WJJA 3VFOA 2JIXD 1DL7H 1JFQL 4NM4H 3U4EA 5FYLD 4YHIA 1P2CB 1WZ1L 4R90H 3FB6B 5D7KD 5JW3L 3RDTA 4P2OA 5E2UH 3FO0L 3E3QE 4DEPB 1IAIL 3BWUC 3P4OB 3ULUF 4Y1AD 1YECH 1N3NA 4DKEH 1A5FL 2AXGA 1UB5A 1J0ZA 3QCTL 3LPFA 1WWWX 2IPUK 3ZLQC 4N0CC 4U7MA 3PWLB 1F4YH 3QRGL 2ARJB 1DQML 1EEYB 1FPTL 4FZEH 3WIFB 5HYJA 3MRCA 2NY4B 3D3VA 1LVEA 5IEHB 5JMOC 4ZNEA 1HE7A 3TBSA 4JJ5B 1RZ8A 1TZHB 2DQGH 3VWJB 3D69A 3K3QA 4HD9A 3NACH 1WITA 4M3KB 3ULUH 1Z5LA 2CK0L 1KIUA 1PG7L 2Z35B 3MRBA 3RDTC 5J11B 5EDXA 2OI9B 5EU3A 3HAEH 3LS5L 5HYQA 3PHOA 4L4TD 3CX2A 1EZVY 2DAVA 5DJAA 1KN4L 3NIGF 2IPTL 5GIRB 2FLRT 3TBWB 5D1ZD 5GS1C 1FC1A 4QY8A 3NGBC 4M5YH 3MRPB 4LSUL 5IMMA 5GRVK 3WNKA 1EXUA 4JKPL 4Q9CA 3VFPA 1A0QL 3O3AA 4GG6A 3IXTB 3L3KB 4QGTA 4F15B 4DGYL 4S11A 2F58L 4P57B 1J1OL 3ZE2F 2BHUA 3S9DB 1U8MA 4U1IB 5TGBB 2B1HL 1C5CH 3QHFH 1CFTB 1ZE3C 1P7QD 4LIQH 2ATPB 3QZWG 5CIPA 4NN7B 1F13A 3NPZB 5KVFL 5FECA 3RWEA 1JGLL 1RUQH 1VGKA 1ZANL 3B8SA 4Y19E 3V2AR 4GRLA 2O5XL 2PXYD 2DQEL 3CMGA 4A2LA 4LP4A 4I3SH 5KAQF 5TE4H 3BYTA 3QBTB 1KGCD 2GJJA 1CQYA 3TV3L 3CVHB 4YAQA 5J6HB 5IVXB 3KS0J 1P4LB 1CICB 4OZFA 1XGRB 1EJOL 4X4MA 1N0XL 3QIUB 3C2AH 5IVNA 4HKJB 1RUPL 1KEGH 4JY5H 4F7EB 4YFLI 4OBSA 1D5XA 1YDPA 3GMLA 4PRHD 2OBGA 3VXPB 25C8H 4F57H 3DVIA 4R4FH 1PW3A 4BFIA 1JWUA 1BGXL 3TT3L 4KC3B 4XPGH 5HJ3A 3LKRB 4WUUE 2XN9A 2FYYB 3IDYB 4TOYL 3VH8G 3DURA 1P53A 4ZPTA 4O9HL 2QADB 4GRLC 3EZJB 3V52H 3P11L 2NY0D 4XVTL 1QPXA 4P23A 4NUGL 3NMEA 1IC7L 1GGYA 2UWEF 3BFOA 1UA6L 4NQCB 4QRUB 2DQHL 1SYVA 2A6DA 3B9KB 1VERA 3FQWB 5EC2A 3TVMB 4OF5A 1I3VA 3MRKA 4HFUL 1NSNL 3RVVC 3RA7H 1DUZB 4FQXA 2Q3ZA 1EEZA 3VD7A 4ETYA 3WHE0 2J8HA 3CUPB 1IAII 3LVEA 3ROOB 2YEZA 4ZQKB 1YJDL 2NR6D 4N0RA 1LK3L 1IZKA 1EA9C 4BH7B 3DETD 1AXTL 2KH2B 1IFHL 2UVEA 1MUJB 3WD5H 4HUNB 4PRBA 3MOAL 4JJHA 3QDGD 5BVPH 1NGWA 4PB9L 3ARGC 3QIWC 4UT9H 4CNIB 43C9A 1Q0YL 4PRNB 4HK3N 1QLEL 4NQEB 3WFZA 4FQJH 4P23C 1U0QA 4JFDB 2HFGH 1PX3A 5F93C 3O6FD 3BP6A 2J1KA 4GAFB 5GZOD 3KPLB 4LVHB 2XXCB 1GGCH 5JZ7D 1U91B 3IS0X 4P46A 3QJHA 4XTRD 4PV8B 4OIAA 3MROB 4Z9KB 4NDMA 1R5WB 3LEXB 4QXUL 5DHVH 3QIBA 3JWDL 4FQXC 1KJVA 3LAFA 2Z8SA 5IQ7L 4XX1E 1D3CA 5CEZE 2QR0A 5DD1H 5TQ2L 4Q58C 3MR9A 4QNPE 1QEWA 5I73B 2ESVA 1QYGL 1RZFH 2HVKA 3FKUS 3H6JA 1UGNA 2A6KB 3T2PA 3VFNB 1IBGH 2EDOA 1IEAB 2PNDA 3EOAB 3VGAB 3BZFA 3MRDA 2ORBH 3MREA 4R8WH 3D2UB 3PDOA 5IOPB 1U8IB 3ARFC 5I17B 5I1DB 1B90A 1LILA 4GRMB 4XNUH 3KR3L 5F9OL 4PUBH 2RAMA 4M6OL 1OD9A 5H94B 4QOKD 3BRFA 4P46C 5CZXD 5I1LA 3EGSA 3U0PB 1R0AL 4P59H 3FN3A 4NUJA 4Y89A 3MV7D 2P45B 5DURD 3AXLA 4CGTA 3QIBC 4MLIA 5HDBF 5EOQL 1OTSD 2F53D 1JN6B 4KMTL 5EZOH 5DEZA 4L29B 1NANH 4AT6B 1G7HA 2VN7A 3TBTA 2NW2B 1D6VL 5HVFB 3MRLB 2A74A 3RWIA 5FYJU 4C56D 3GSVA 3LN5B 1WIUA 4P4RA 5I6XC 3ILQD 4HW6A 1H9VA 3ZDZF 4AMKH 1R5IA 5FGBA 5EOTA 4DGVL 1RK0B 1M71A 1N8ZB 2VLKE 4FFZH 3L3HA 4N0UA 4XXDB 2PW2A 2FEDC 3IJSA 4U1JA 2D4FA 1SBSL 4ZD3H 5IESH 3KPPA 5F1SA 5ACZA 1T3FB 1GZPA 4N0YH 3ILPB 4M7JL 3CFJA 5FUOL 2BVTA 3IU4H 4OCLC 2IPKB 4XI5D 5EZIH 1WWBX 1Q9LA 2YPLD 4PG9A 2IGFL 2JJTA 3IFLH 1JUFA 3HC0A 4ZFGH 3KDMA 3VFOB 4EOWL 3U2SB 5HGDA 2J2ZA 1S7UA 1OPGL 4I0PB 2BNQD 3O11B 4P2OB 2NQCA 3VXUA 3H9SA 4LGRB 5FGBC 2BJML 5B39A 3X3GH 4MVBD 4C54A 5CLWA 3RIAK 3BD4A 1N3NB 3CFIC 4Y4KA 4NP4L 2IBBA 1WK0A 2AXGB 3HC4L 4KPHH 3QUYA 2HRLA 3HS0A 5IW3A 3NGBB 3BAEH 3WXVL 5F7HA 4DOHB 1OAQH 4OUOA 4QRRD 5HYJB 4FZ8H 4KGJA 4MJ4A 3ZTNH 3C5JB 4LPTA 3QUXD 3B2VH 5I8KL 3D3VB 1DN0B 2IAMC 1BVLA 4C58B 2VISA 5GGVL 3CVHH 4ODSH 3S35H 3VDAA 1D9KA 2QV2A 5CZVH 4S1QH 3TBSB 1RZ8B 1A47A 3O3EA 4L1DA 4PJ8A 3IKCA 1NGQH 1PZUB 3D69B 2NY2D 5JIKA 1RULH 4NNPH 3U4BH 1Z5LB 4BUHA 3F7RA 5EPMB 4Z7QF 3MRBB 4CVZB 4OF7A 1X5IA 4JO4H 1PJ9A 5EU3B 2CDFA 2NY6B 2DQFA 5HYQB 1BX2B 2H41A 1MCCA 3QPXL 1NMAH 3MLVL 3O4LB 5FYJL 3VXQA 4Y4KC 1HWHB 4YQXL 5DJAB 3O6LH 4R9HA 4D9RE 4HS3B 4LNRA 3QUYC 4YHML 2VWEC 2P5WE 3LCYA 2ZOKA 4XBEH 1M1SA 2ZG2A 4XCFH 5F72S 5EUOE 1RUML 5IG7B 4D0BB 1EXUB 3CSGA 4XAKE 2Y1VA 3O3AB 5E9DA 4GG6B 1NCBH 4MB3A 4YHKH 4QT5B 4X7SH 3TZVB 4O02H 5D70L 5A16A 3KPRD 4G9FE 1KJ3H 2EDLA 4HS8H 4JDTL 1D9KC 3O6KL 1U8MB 3LKNA 4N5UA 3FJTA 4X80L 3EBAA 2YBRA 5CIPB 4RFOH 3RHWK 5ERWA 2Z0BA 3RWEB 1RZGB 1N5YL 1V3JA 1RSFA 4HEPG 4TSBL 3SKNA 3RGHA 2YC1A 1VGKB 5HHOD 3S37H 5I1HH 5CKAA 1YEEL 3RVWC 3GSUA 1FVCA 2I60H 2GKIA 3OHXA 4G6JL 4NFDA 3G5XA 4KJPC 3P0VH 4K3JL 4W4OC 4YAQB 3F6LA 3V4PH 1C1EH 3U9UB 4A2MA 2J8UE 5GJTH 3SDDA 4OZFB 1FAKT 3VXMA 3VI3F 5IF0A 1OT2A 4JO3H 1WC7B 2D4DA 4MXVF 5ESQA 5DQJB 3FTGA 3TFKD 5EUKB 3JWDC 1LDPH 3BQUA 5JW5A 1ERNA 1YDPB 2R4SL 3GMLB 2AVGA 4NKIL 1J18A 2KBGA 5SX4I 1WSST 3DO7A 5IT2L 5F3BA 1R3LA 2DI8A 3RPKA 4Z77A 1BVKA 4EKXA 4BFIB 1JWUB 4TSAL 1JRHI 3GNMH 5GRWA 4IOSD 4HULB 5IHUH 4G42A 3CXDH 4ZPTB 4FNLL 5ICYA 1B4JL 3MRMA 1UB6A 4RGOL 5E95B 5D7JD 3QQ9C 4P23B 1YNTA 1TQCB 3DUUA 1MJJA 4JO1L 4MQXD 4RGNC 1NMCC 1PLGH 1WJ3A 4I9WD 4KRPD 2D9CA 3EDEA 2A6DB 1EHXA 3RQ3A 1KT2A 5EC2B 3I3DA 1EHLL 4MAYA 3RWDB 2E7HA 2W9EL 3MRKB 4YIQB 4H25A 3GMPA 1YY8A 3D1MC 4XMKL 2YD6A 3U0TA 4PP2A 2C5DC 2YEZB 2Y23A 4O2CA 2APTA 3SHSA 1B6DA 3PGFH 3MLZL 1XEDA 1FQ9C 4J3TA 3TO4D 3KYKL 1NGWB 2P5EB 3W9EA 1VCAA 4JZJC 3F7VA 43C9B 1WBZB 4MAUL 2HAZA 4HC1H 3DPBA 1QRKA 1BFSA 5DJCA 1YQ2A 1J0HA 1JYXA 1CFSA 5A2LH 3G5YA 1EX0A 4P46B 1TDQA 4POZD 1DTUA 1KCKA 1T03L 4MAYC 5E7FA 4NDMB 2APWA 4BFEA 1SY6L 4KVNL 4RMVA 2ICEA 4X6CE 4DGIL 1NPUA 3LRHA 1KJVB 3CDYA 5FAAA 1NUGA 1BQHG 1A4KA 1BJ8A 1TENA 3AS1A 4MS8D 1N0LA 2QR0B 5JW4M 2Y6SD 2EDDA 4P4KC 2JCCA 3MR9B 5I15H 1QEWB 3RUGB 2EDHA 4OQTL 2ESVB 4AENA 1MJ8L 1QSEE 1INEH 2Y06H 4RGMC 5TF1L 1QD0A 2HVKB 1N64L 1YNLH 4JFPA 1IGIH 5I6XB 3MRDB 3MREB 3V8CA 3CDGB 1AR2A 3PDOB 5DQDH 5FYLE 1EAJA 3HI1A 3VE0A 1FZOA 2Y9RT 3ELAT 2AJXH 4TTDD 3VRIA 5I1LB 5J1AA 3L3JB 1BJ1J 4Y1AE 5ESVA 4NUJB 4F2MB 3QCUH 1JZ6A 3E2HC 2R0LH 5E4IA 4UIKH 4AJ0A 4PJEA 4YHPB 2AK4E 1ZTXL 1XF3A 1G7HB 3TBTB 4HZAA 2FSEA 4GKZA 5DUMH 4C57C 4KVCL 3FRUA 5IFHL 5KW9H 4ZS7L 3RWIB 3EFDH 4BKLA 3C6LB 2VLJA 1QRNE 3KPSD 4LOUC 2HKHH 4I4WA 4PFEA 5HGAB 1M71B 2B1AL 2L7UA 3I3EA 3HZVB 3L3HB 4N0UB 1SYSA 4GG6F 2PW2B 3QQ3A 2MHAA 3IJSB 3U30C 5IB2A 4U1JB 2DYPD 3UPRA 2WSKA 3PABA 1OLLA 4H0GA 1GYAA 4OFPA 2CDEA 5ACZB 1IM3A 3QA3A 3CFJB 5IB1A 1UH4A 4K71C 5E8EB 1NKOA 3F6IA 3VXRD 5J1TC 4GXUN 1W72L 4PG9B 4Q9QH 3HC0B 3KDMB 1OAKL 1YUHA 4KROB 5A3ID 4PG2A 3ESVF 4OD3L 1XIWD 4OFYD 4PJBB 1Z3GH 1BD2A 4KQ4H 1H3UA 3MCKA 4FMKA 1DFBL 4PJ9A 1I7UA 3VXUB 3H9SB 5B39B 1KIQB 4HUKB 1ZLSH 1DQLH 1FHGA 1J0IA 3PV6B 5HHPA 4JRYA 3G04B 3SE9H 4GSDH 1HKFA 2YUVA 3PP4H 3DTXA 4P9HL 1KXVC 5CIPH 4WW2A 5I1KH 4GUPA 1OB1A 4U6TA 2R8SH 5F7NC 5D2LA 5DLML 4H20L 4MNGB 4HGWA 3ET9F 5CFHA 4WI4A 2E9IA 1BBDL 3ES6B 3WUWG 2XICA 1CG9A 3U7YL 4PJ8B 4OM1L 4OZFH 3SCMA 1NGXA 3CSPA 1H15A 3MV9A 4TVPE 3WNMA 4A6YL 1AI1H 4K3GA 2NY4D 4KKBD 4J8RA 2DQFB 4RMUA 4BA8A 2YRZA 1L0YA 3VXQB 2YPKB 3LS4H 1DEDA 1NAML 4LNRB 2DLGA 3I50L 1OQXA 2ITCB 4AG4L 2ZOKB 1BZQK 5I66A 1VFMA 3CU7A 4PS4H 4WW2C 1SEBA 5KSBE 1OM3H 4KKCC 2GUOA 1SY6A 2OMBA 3U9PL 3Q3GA 5DHYB 3LKNB 3OXSA 1FC2D 3SCMC 4NO2A 2YBRB 4D9LH 3HB3C 4HJJL 4WHCA 5DR5L 2KUTA 1AQDB 4OQTA 3Q6GL 4F7CB 5ISZA 3O6MH 5M95B 5E56A 3WHXA 3GSUB 1FVCB 3OHXB 3EYOA 3QDGE 4IDLA 2I27N 1IGTA 4CVWA 5C8JB 3OZ9H 4JDZA 5FKAA 1N4XL 5K9JH 5HSFA 3SDDB 1NCUA 2NY1C 3CZFA 4IRZL 4LCYB 1JFQH 1NDMB 3VXMB 1AO7B 4G8IA 4U2YA 2XXMB 3SGJA 1CDBA 2R29L 3G5ZA 3RUGF 1HZHL 2WMPA 1CLZL 1WZ1H 5ESQB 1URLA 2F8OA 3MNWA 5F6IC 2HLAA 1BOGA 3FTGB 4U6HA 4OIIL 5JW3H 1TPXB 2V2WB 3QXAA 4NO3A 3BQUB 3OGCB 1IAIH 4Y4FD 1YMMD 4RX4A 2DQTL 1CVSC 3DO7B 5F7UA 4ONFL 5F3BB 1R3LB 5DFVD 4RRPG 1J9CT 5KJRL 4Z77B 1BVKB 3QCTH 4GLRI 3RWFA 3SE4C 5JHDA 4G42B 3PQYD 4XCNA 2GJ6A 1L7IL 1B3JA 3QRGH 5ICYB 1R5VB 4X6BA 1DQMH 1FPTH 5TH2A 4C83A 5DGQA 3S4SA 4NPYA 4WCYL 4EN3B 3EZ8A 2QQNL 3CFCL 3H3BC 2C4FT 4NNYA 2MKWA 2H2SC 5L7XH 3K46A 1YNKL 2FX9L 2P24B 5GPRA 1KT2B 3BISA 1LNUA 2N56A 3SGJC 1AY1L 2AJVL 4H25B 1MCPL 3GMPB 1YY8B 3U0TB 3B9DA 1PG7H 3VW3L 4PP2B 4OCNC 2BNRE 1O7SA 2K9UA 1I1AC 3LS5H 4WHTA 5DS8A 4C4KO 3MV7E 4O2CB 2BY3A 1AR1C 5SV3A 2DJ4A 3IDGB 1KN4H 4JFHE 1W72A 4MB4A 2IPTH 5ITBH 2P8PA 3FFCA 4WO4A 4XZUA 3W9EB 3F7VB 4JKPH 2W38A 2YD1A 1A0QH 4LVOC 4KKAD 1J1XL 3SO3C 5JLZB 1DJSA 1C12B 3KHOA 4DGYH 1NCWL 2F58H 1ZVSB 5DJCB 1J1OH 3NZ8A 1CFSB 1X6NA 1PEWA 2B1HH 4NO0B 4GO6B 4M6NL 1X5XA 2X10A 4O51B 5KN5A 2ICEB 3TBVB 5KVFH 1IAKA 5EA0L 3T0AA 1JGLH 4YEFA 1A4KB 2EEAA 4PJBF 4M5ZL 4NN5C 4UUJA 2NYYC 5IFJA 3GSOA 3FB8A 2DQEH 2JCCB 4MZ3A 1U6AL 4AENB 3KG5A 3TV3H 5GXBB 1MJUL 4JFPB 5ANMA 3RNKA 3U6RA 1D5MB 2PF6A 5HDOA 5FGRA 1UVQA 5CSZB 4EQ2A 3QNYA 1EJOH 5SWSE 5J1SC 3SDXB 1N0XH 4YEEA 5EWIL 2P48B 3SGKA 4A6YA 3BGAA 1A7QH 1FNGB 1QSFA 1RUPH 3VE0B 4F37F 3LPGA 4TTGA 3V95A 4Z0XA 3VRIB 2OS7A 5J1AB 1NAMA 5ESVB 3ZZ1A 5FB8B 4P9HC 3MFGB 4K8RC 3G6JB 2A83B 1MCWW 4QRSA 4UB0L 1NC2D 4PJEB 2VABA 3TT3H 5E6ID 5DK0B 4TOYH 5C0BE 4O9HH 1U8LA 3P11H 4XVTH 4NUGH 1IC7H 1H5BB 4ONHB 2FEEL 4BKLB 1UA6H 2Z92A 1JWMB 1MRCH 3TH2T 2VLME 2VLJB 2DQHH 3O4OC 4S10A 5DUPL 1F97A 3SGKC 4KK5D 4LHUA 3IB4A 4HFUH 3F12A 4OCSH 1NSNH 4PB0H 1SYSB 4HWNA 3QQ3B 4TUOA 2WWMD 4G6FB 3UPRB 5IB2B 3VGHA 3PABB 3JV6A 3PWPB 1YJDH 5A43C 2CDEB 3W0WA 1IM3B 4L9DA 1CD9B 1AXTH 3QA3B 1OSPH 4L5FL 4PREA 3MOAH 5IB1B 2OR8A 2CUIA 1EFXB 4PRIA 1ZMYA 4PB9H 3KWWA 4JPVL 3RIFF 1GVIA 1C5DA 1Q0YH 2AW2A 3OF6A 1DUYB 1QLEH 5C0CD 4LAJH 1YUHB 4YBLC 2VZVA 5E8PA 4N0CD 4ORZC 2ADFL 4UINH 3QFJD 5T33L 5J7CC 3TN0A 4RISL 2XWTA 4AQ1B 4PJ9B 1GH7A 1I7UB 2FIKA 1IM9A 4XT1C 4QXUH 1A1MA 1S9VA 2VDLL 3O45A 3JWDH 1CK0L 4O4YH 4DFHA 5IQ7H 5HHOE 1KV3A 4FTVD 3CDFA 2X4RA 5EU5A 1U3HA 4WW2B 1NFDE 1S9XA 3RDTD 4GUPB 2N7BA 5E5MA 4YK4C 5D2LB 1G7JA 4MXWL 2Y5TB 4LCIL 1GXEA 2WV3A 5C0AA 1C8PA 5DJXB 5I30H 2PCPA 1MI5A 3BP4A 3BKJL 2ZOLA 3S3PA 2YXFA 1HCFX 4HAFA 4BM7A 3KR3H 3QP3A 3SCMB 3GHEL 4M6OH 2L7JA 1H15B 3MV9B 3TN0C 3IGAA 1R0AH 3UTSA 4M9OA 1II4E 4KHTL 5E70A 4U2ZA 4J8RB 1GGIL 3D3VD 4JFEA 5EOQH 4N90E 1UM6L 2NX5E 1HH6A 5BO1H 3KVQA 4KMTH 3AREA 5DZLA 5DC4B 1A9BB 3EYUH 4JR9H 4X7FC 5I66B 5I8OL 4YHOL 1U3HC 3SKJL 4PGDA 1D6VH 4YDVB 3WNLA 4UOW0 4YDJA 4Z7NF 3B6SA 1S7XA 3SN6N 5GGTL 2GUOB 1YC7A 1YEJL 1ZHBA 3Q3GB 4DGVH 3L3OA 3OXSB 5TDOA 3GJFB 5SX4H 2ATKA 4HCRL 3FT3B 1X5JA 3KYMB 1GL4B 5ISZB 4Z7UB 2FGWL 4M7JH 2DB8A 4HZLA 3WHXB 5F8RC 5FUOH 1SVCP 2VQ1B 1X5AA 4HBQA 3EYOB 5MENA 12E8L 3AREC 3KPMA 4N8VA 4PBXA 5FKAB 2IGFH 4ZOBA 3LIZL 2DJUA 5KVMC 3CSYA 3N1GC 2VN4A 4G8IB 4Q74A 4JHAL 5D6CB 4Q0XL 2JCCF 3MJ9L 4LSVL 4EOWH 3G5ZB 3SDAA 1OPGH 4GRLD 5F70A 5L0QB 4FXLA 2HLAB 1BOGB 4XCCH 2XPGA 2BFVL 4D3CL 2BJMH 5DF0A 4JFYA 5LAXB 2Q86B 1A8JH 3SDXF 5D6DA 3MRFA 1GGUA 5B8CA 4NP4H 3HC4H 4AIZA 3RWFB 5JHDB 4JG1L 4HS6A 3RVVD 3WXVH 4M93C 4XCNB 2GJ6B 4G6ML 4GJTB 1T6VN 4FN0A 3O0RL 1MFDH 4Y4HC 1OTUC 2DICA 1UZ6E 4L3ED 1NCNA 3G6JF 3S4SB 4NPYB 3NOIA 4PJEF 5I8KH 1Y0LA 4NNYB 3VXSA 2V7NB 3X3FL 5GGVH 3RI5K 3S34L 1K5NA 4Q97A 2VDRL 1DBML 3ARGD 3QIWD 2XN9D 5HI3C 3SDAC 5J9PB 1ZT1A 4IMLA 1P9MA 4P23D 5AAMA 1FVDA 4WHTB 5DS8B 2IC2A 4NN5B 2X89A 3JXAA 2ZJSL 3QPXH 5D6DC 4LPVA 3DBXA 4YQXH 4DKFL 5B8CC 2GEEA 1W72B 4G43A 4HUVA 2P8PB 1EERB 4CMMA 4YHMH 3QT2A 3OKLB 1T4KA 1D5BB 4WO4B 3LEYL 1RUMH 2DIBA 1I85A 3NIFE 1JV5A 4FQXD 4PJXA 3C8DA 5DJYA 5IMLB 4OQ1A 5INDB 1MLCA 1ZLVH 1CL7L 5HVGB 1NBQA 1ZEAH 5D70H 4APQC 1AIFA 4UZGA 2DM7A 2FX8L 3ULVE 2PYEB 4JDTH 4ZODA 2XZQL 4X80H 4G8GE 4JRXD 1P6AB 4KHXL 5KN5B 3KNBA 1IAKB 5JOFB 1L6ZA 5TE7L 3UC0L 3MJ8A 4TSBH 3ARFD 4UUJB 5GRVL 5IFJB 1YEEH 1MSPA 1IQWL 4IHOA 3MSPA 1OWRM 3S3JA 3S37X 4K3JH 1HIML 5ANMB 3RNKB 3U6RB 3QIBD 4XMLL 2AJUH 1I85C 3FQUA 4EUPA 2HKFL 3MA9L 3QNYB 4ZUSA 4CVUA 4OAWA 4U0RC 2R23B 3GSNB 4LLUA 5LJYH 4IBLT 4CDGC 5D2LF 5B38G 2ESVD 1NLDL 5EBMA 4WFGD 2R4SH 1NAMB 2C3WA 4NKIH 1PKOA 5JUEL 4YBHA 1A3LL 3RWHA 4TSAH 4QRSB 1WVZA 5DDHA 1P84K 5DTFA 2R0ZL 4P48A 1WFNA 3HN3A 5FOBA 1KG0A 3PHSA 1MIMH 2FEDD 4FNLH 4LEOA 1U8LB 5GGTA 1B4JH 4RGOH 1EGJL 4JO1H 4OFDA 4Y5YA 4LSPL 1I7RA 3AS3A 1OT1A 3AS0A 4XNMA 3E3QC 2Z92B 1QA9A 4NKMA 5HY9A 1EHLH 4HCRA 4JGMA 2BRQA 2W9EH 4LHUB 5JIHA 3F12B 4XMKH 3STBA 2DIJA 4L3AA 3RTQB 4TUOB 3DO3A 1T0MB 5M7QA 2F5BL 4WENB 3QG7L 3W0WB 1T5WA 3MLZH 2JLLA 4PREB 5GJSH 3Q2CA 3I9GL 2VL5A 4LMQI 2VO5A 1WTGT 2F5AH 1ZSDA 3ZKND 3VGGA 4F9PC 4DW2L 3KWWB 4F9LC 3MJ9A 3RGVA 7CGTA 1C5DB 2AGJL 4MA1C 1N2RB 4CL7A 4Z7UF 2R4RL 4MAUH 1GJIA 4MB5A 3QUZA 5E8PB 4UBDC 5C71A 2AQ3A 2QHLA 4XWOD 2IQAA 3TN0B 4BQ6A 4Y19A 2FIKB 1T03H 4GFTB 1IM9B 3QULA 1CDYA 4P49A 1SY6H 2IAMD 3O45B 4NKDA 4X9GA 3G9VA 4DGIH 1U2CA 5DVOA 3LKQA 4GRWB 4JVWA 3GJFH 3HE7A 5HGHA 2RR3A 3OJ2C 4OM0L 1RJCA 4EI5A 3EOTL 2X4RB 1A7BA 5EU5B 1S9XB 3OB0K 4GKOA 4OQTH 4AEFA 1MJ8H 1R3JA 3F5WA 2V2XA 4GXUM 5E5MB 1FP5A 3GSXB 5TF1H 1N64H 4DTGL 1G7JB 5J4MA 4FQHA 2F54D 3RGVC 3DXAE 4Y4KD 5FM5M 3BI9X 5C0AB 4U49A 2AAVA 2PCPB 3BP4B 3QUYD 1CL7I 1GCFA 1AGDA 4U6YA 2W65B 2VITA 3QUZC 1X6LA 2XZZA 3CXHJ 5JORA 5IMKA 3HUJE 1KXQE 2Q8BL 4NWTL 5IBTL 4WUUA 4E41E 1HHKA 5CSBA 2O26U 3IGAB 4QCIB 4GW4A 1GRWA 4PJHA 3QI9D 3D0VA 2WANA 1JPSL 4JFEB 1PZ5A 1HH6B 3J8F7 4J4PD 5E94A 1ZTXH 5IR1B 2DI7A 1CFBA 1ACYL 1D9KD 3S6CA 4QRPD 4YHYC 3HE7C 4ODXA 4UT6L 3RRQA 4X4YA 1P1ZB 4GBXA 5CEYA 3MV8E 5D1QA 4KVCH 3H7BA 5IFHH 4YDJB 4MJIA 3KYOA 3B6SB 1S7XB 4ZS7H 1JZ2A 3GMNA 3JUZA 3OAUL 4H5SA 3B5HA 4M7LL 3RVWD 2XIDA 4YX2L 2XA3A 4IOFC 3H9YA 4KJPD 4XVSL 3VU2A 2B1AH 3L3OB 5TDOB 2QTEA 2J4WL 1FORL 4JGJA 2ATKB 5KANG 1RMFL 3Q5YA 2LTQB 2EDEA 5GSVB 5E9DD 4GLRH 1KLUA 4FQQA 4QYOA 2WIMA 3P0YL 4YHNA 1KACB 2LU7A 2AQ2A 4FHBD 4M8QA 4PLJC 3KPMB 4EXPX 1HILA 5KSUB 1H3XA 1CLOL 3GIZL 1W72H 4UOJA 5HXMA 3DWTA 4I77L 5D1QC 2GSGB 4P2RD 1OAKH 3FQTA 3MGTA 3PP3K 1UWGL 4LCUB 4YPJA 4ALAL 1MH5A 4JM2B 4POYA 4LVNB 1JPTL 4UNUA 5BRZD 4AEEA 5B38B 3QQ9D 4QF1A 4RGND 3VFTB 4AIXA 4Z7VE 1XZ0A 2ADIA 2PYFA 5F6HJ 1PX4A 3MRFB 5T3ZD 5C7XL 5HVWA 1HHJA 1CGTA 5B8CB 4OZHE 1ITBB 4ZOEA 3RNQA 4LDEB 1F4AA 1UEYA 1EGJA 4XWGH 4GKNA 4HS6B 3A6BL 2ZUWA 3FHAA 4X83A 4ZMAT 3RKDD 4U1SB 1M05A 1SJVA 5A40E 5DLMH 4GOSA 3B9AA 4H20H 1BBDH 3HRPA 4P2QB 5KVEL 2GI7A 4WI3A 3UXFA 4P3DA 3U7YH 4LVEA 4OM1H 2R2EA 2MQCA 1FIGL 4PLKC 5HHXL 2IEPA 1ZT1B 4HIIB 4IMLB 1MCKA 2X4PA 4WTZA 5T1MA 1U8HA 1FVDB 4HGKC 1BIIA 4QHUA 1ORQA 1JNNL 3DBXB 3VGBA 4M7KL 4X6FB 1F42A 4K7PX 5BXFB 1NAMH 4HUVB 4GQ9H 4OLZL 5T5FL 1TNMA 3NA9L 1B0GA 1T4KB 3MODH 4MAYD 4AG4H 5AG8A 3EIFA 1JV5B 3BKML 4O2EA 4PJXB 4AY0A 4S1DC 2VLKA 3ARDB 1NEUA 5DC9B 1MLCB 2KKQA 4HHAA 4MSWA 4I18A 2QBWA 3T77A 4E5XA 4P4KD 4YXLL 4ZO9A 1CGUA 2BMKA 4KH2A 5E5RB 2DWDA 3U9PH 1AXIB 1CXLA 4XNQA 5EOCJ 2ZCHL 3GGWA 4F7TA 3HPLA 2ICWI 2FX7L 4HJJH 5DR5H 5E0QA 5GS0L 1LD9B 2FCBA 3MJ8B 1CE1H 1B0RB 5C0JB 4CBPA 4KZEL 2OL3L 4IHOB 5D7LB 3HKFA 5DVMA 1XT5A 3MRRB 4J3XA 3BIAX 5EH1A 1MCBA 1N4XH 2IFGA 4GRWF 5CS7A 1HHGA 4EUPB 5C0CE 4IRZH 4NC1E 1UJ3C 3ZKXC 2ICWA 4ZUSB 4GAGL 2R29H 4ZUWA 3CAFA 1HZHH 5TJWK 1CLZH 4LLUB 4K23L 3QFJE 1TCRB 4OIIH 3MMEA 43CAB 4J3SA 3R1GL 2XT1B 5FCUL 2X09A 1I8KA 4LHQB 3THMH 2VDQL 4HWUA 3BHBB 1T04A 4M03A 4ONFH 5KJRH 3K4AA 3RWHB 4LOUD 4YR6B 3VFVA 3VXNA 1V05A 1KJ2B 5IBUG 4QXWA 5DDHB 5E99L 2FBOJ 5CGTA 4RZCA 5FOBB 4OZIB 5DJDB 1MLBB 5C6PB 5FYJD 4LEOB 5I2IA 1P5UA 4OZGE 1LO5B 2DDQL 1IC1A 3OJDA 4RQQB 4Y5YB 15C8L 1I7RB 3UO1H 5FYLL 4WCYH 3OKNA 2QQNH 3TESA 2MQ3A 1QA9B 2VB5A 1YNKH 2FX9H 3DSNA 1XGTA 2GCYB 5MEOA 5HY9B 4RFEA 1X4ZA 1AY1H 2AJVH 2FHCA 1T5XA 1MCPH 4WTZG 2AEWA 3FB5A 2P5WA 4O2FA 5D5ME 3VW3H 3WDIA 5EUOA 3QCVL 4LF3A 3GUTB 1F8TH 3DRQA 4DUXA 3VFGH 4XPAH 4DQOL 3R8BB 1T5WB 3F7PC 4Z8FL 2VL5B 3OSKA 2XWJA 1JBJA 1ZSDB 2A0LC 4G9FA 4QXTB 2BOCA 4JLRA 2VXUL 3RGVB 1RZJL 2L0DA 3ORJA 4FQ2L 3KPQA 1T22A 1J1XH 4ZUUB 3K4DA 1UQSA 2F15A 1NCWH 5DD0L 1KLFA 4GS7B 3A0OA 1OTTC 2IQAB 3JWOL 3EW3B 3ALPA 4M6NH 1RPQA 3V4VL 1VB9A 4JM2F 3B5TA 3BVNA 5EA0H 1HQ4A 2UUDK 1WFUA 3LKQB 2J8UA 4M5ZH 4PTTA 4YHYB 1OHQA 4TUJA 5T3XD 4EI5B 4QHLA 2BP3A 2LQRA 2FO1A 5C6WH 1N26A 4GW5A 1BD2D 2OYPA 5DMYA 4LRIA 1U6AH 3F5WB 4D0DA 3PXHA 2ZPKL 4YH6A 1MJUH 5JW4R 3QUMA 3WN5C 3S36X 3X17A 3CNKA 3QHZL 4FQHB 1HWGB 1S5IL 5EWIH 4JRYD 5KSAA 5J13C 3OKEA 4NFCA 4U6YB 1IKNA 4WY7L 1WT5A 2XG4A 3T0DA 1KENL 3NCMA 4FFVC 3C87A 4PJHB 4M1DH 2NXZB 2YD4A 4KKCD 3RVXC 3LPWA 5HI4C 4XP9L 5E94B 1JL8A 2J5LB 1DR9A 3VG9C 4X6DB 4ODXB 1CGXA 5KZCB 3MYZA 3UEZA 1CTOA 4PJ7E 3ALXA 3HB3D 3MJ7A 2AKRB 4GBXB 3MLYL 5D1QB 5CEYB 4L3EE 4LRIC 4JFXA 4WTWA 1ZOXA 4MJIB 3KJ4C 4XAWL 3S98A 4H5SB 2I24N 4NQDA 1DANT 5DUPH 4MCYA 5KSAC 4TVPL 2YSSA 1G7PA 1NGPL 3QDJA 5AZ2L 3VWKC 3MOBL 2NY1D 5DD6A 1WT5C 3DX7A 4NKOA 5DWUL 2CK2A 3MV01 3A67L 4MD4A 4Y8AA 4FQQB 4L5FH 5HYSA 4YHNB 1JGEB 3SJVE 4QHKI 3H42L 4L3CB 5B3JE 1JF6A 4M8QB 3Q5TA 1HILB 2VZ3A 2DBJA 4RIRB 2IG2H 1QZ1A 3KPTA 2LU3A 3FQTB 4JFZL 5F1IA 5EBWA 3GSRB 1X9QA 2ADFH 1R6VA 3CFDA 3DMMA 5T33H 3W81A 1T21A 4RISH 4HT1L 4QF1B 4NCC2 3RX5A 4U1KA 2WINA 1MFCL 5GS0C 1XZ0B 2A77L 2ADIB 2AI0H 2VDLH 2DQJL 1QSEA 4LKXA 1HHJB 1U8QA 2H2SD 2BVPA 1CK0H 1NCDL 5HYIA 2X4NB 4NWUL 3QFDA 2RFXA 2BSRB 2XNAA 3O41B 4L8SA 2EE6A 5GRUL 5HHQB 4RMSA 2CXKA 3F7QA 1RHHA 1NJ9A 4GKNB 5IBUB 3ZHLA 4KJYA 2PTTA 5CMAA 2D7TL 4KRMB 5L2JA 2YA1A 3BW9A 1T0NA 1I1AD 4TSCL 1B0WA 4MXWH 5ACLA 4RX4D 4LCIH 1AR1D 4K3HA 5F88A 5FCSH 4D9QD 4Y1AA 3ZDYF 3BKJH 1JPFB 3N9GL 3D85A 3STLB 4OZIF 1V7ML 4P3DB 1HKLL 4EUPH 5ADPL 4DJMA 3GHEH 1BJMA 3RJQB 1WIOA 2GJ6D 3SKUD 3DMMC 5T1MB 1J8HE 1U8HB 3B8YA 1JTTA 1JZ3A 3WO4B 1ZHLA 4KHTH 4QHUB 1GGIH 1ORQB 1UM6H 3L3GA 5I0DA 4U6VL 4FQIH 4MHHI 4L8SC 4M1CC 1B0GB 1QRNA 5GHWL 4DZBB 5I8OH 5F89A 4YHOH 3SKJH 5F7KC 2EYTB 1KJ2H 4ISVA 1OQOA 3QO0A 2HVJA 2I9LA 3NCJH 4HHAB 5C07E 4I18B 3T77B 5EO9B 5GGTH 4E5XB 2ZKHL 5E2TL 1V3MA 2BMKB 1YEJH 4GW1B 3VA2C 2WAHA 3QO1A 3FFCD 3N85L 3GGWB 2V2TA 4F7TB 3HPLB 4IS6B 4TPRL 5D1ZA 3E0GA 1CWVA 4HCRH 4BQBA 4ZYKB 1MQKL 4ZSOB 4BSWB 5GZNC 12E8H 1RZJC 2FJFA 3HR6A 1KEML 3SO5A 1XFPA 4NCDA 5D71L 3LIZH 2G2RA 3KYAA 1HHGB 4K8RD 2ICWB 4JHAH 4Q0XH 4LSVH 3JWOC 3MJ9H 3R8QA 4WW1A 3BH8A 4WGWB 3G5VB 4ZFOL 4D3CH 2J6EH 3H9ZA 1MAKA 4JM4L 3KXFB 2MMXA 3NH7L 3WCYA 2C26A 4GMTL 1SHMA 5GRZA 2DLFL 4KZDL 3VXNB 2JB5L 2VXTL 1QSFD 4H88L 4RZCB 2R1WA 2LVCA 1X5GA 4PJHF 1JGUL 2ZUUA 5I2IB 5TFSL 1BEYL 3O0RH 3QQNA 1XCQB 3ZL4L 3T0WA 3OJDB 2ENYA 4AM0A 1KNOA 4FABL 4JZOB 4M7ZB 2VRAA 3CH1A 4BK5A 4X6DF 2ED9A 3L3DA 3AU1A 2XTJB 5MEOB 4WNQA 1DBMH 1NLBL 1T5XB 3F62A 4JDVA 4YWGH 3FB5B 2P5WB 1QBLL 1JWSB 1KSRA 4LF3B 1H8NA 1EJ6A 3VGDA 3DRQB 1YEFL 2ZJSH 5JNYA 1VFBA 5KSBA 2XA8L 4DKFH 2D7QA 2NXYB 3IDXL 3C5SA 4NN6C 1SJHA 4LHUD 4RA3A 1V3KA 4MCZA 4G9FB 4JEGB 5T1LA 1KBGH 1K2DB 1LO3L 1ZLUK 5A1AA 1CL7H 5F9WC 1T1ZA 1UQSB 5BW7A 1HOCA 2FX8H 1EO5A 2WBJB 4XB8A 3RL1A 3AM8A 4PRID 1DQJA 2XZQH 5F96H 4XNZC 4N1HB 1FV1A 1J0KA 3L7EB 3GMQA 3DYPA 3QDGA 4D0CA 4KHXH 3OF6D 5C09D 4OFIA 2VLRB 4PGEB 1LE9A 2BSSA 5TE7H 4R97B 3UC0H 1J0JA 4PTTB 5IB5A 4TUJB 2FATL 5CSGA 5I1AB 1BZ9A 4QHLB 5EULV 4MD0A 1IQWH 4Y0GA 5L8JB 1HEZB 3IAGC 4DVRH 4ZPVA 4GW5B 3O6FA 5MERB 3MRGA 3TN0D 1P6FA 5FDWA 1GPOL 3VFSA 1ZA6B 3KJ4B 1HIMH 3QUMB 4XPTL 2VDOL 3V5KB 1E6OH 1F3JA 3MA9H 2HKFH 1WBXA 4TNVK 4WUKH 1IGML 3OKEB 4ZAKB 3UBXG 3T2OA 3QEGL 2X1QA 1U3HD 3WKNA 2RB8A 5H8DA 1WEJL 5BRZE 5BW7C 5I1GL 3CMOL 1XR9A 3KYNA 3BPOC 4KK9C 3M17A 2ZWLT 1S9WA 5JUEH 1KTKE 3JV4A 5IKCA 3DOSA 1A3LH 1MI5D 4BH8A 4Z7WA 2R0ZH 5TDPA 1NBVH 2XWBA 4PJCE 3L9RB 3T1FA 1QOKA 1TJHL 4MNQE 3O6FC 3MJ7B 1EGJH 4JFXB 1NCAH 4YGVA 3UTSD 3VMOA 4LSPH 4QOKA 5CJ5A 1Z9SA 2DQDH 3ROLA 2BNRA 2PW1A 1BECA 3MV7A 4P5TB 4NQDB 3ARRA 3ARED 2XOTA 2YSSB 1I1YA 1TMCB 3OGOE 1GHFL 3QDJB 3WLBB 3UZVB 4KK8C 4Y2DD 5DD6B 3OPZH 1T2JA 1FRGH 2YK1L 3TYFA 3WUZA 3U79A 4MD4B 3LN4A 5J06A 2F5BH 4Q7DA 5KVDL 1WUNT 1CFVL 3QG7H 2Y7QB 1PGRB 3ZYZA 1P7HL 5HYSB 3T8XB 4OLYH 3WNNA 4DW2H 5LVEA 3OX8A 2AGJH 3MUHL 1L7TL 2R4RH 4ZFOA 3OMZA 5C08E 3PWUA 5F1IB 5IB4A 4WDIA 2R9HC 2VDPL 1R24B 3CFDB 3RX7A 5A2IH 2ZSWB 3LD8B 5F9JA 4Y4HD 4YPGA 1OTUD 5MEND 2WP3T 4U1KB 5M94B 5JPMA 1OL0A 2R2CA 4ZUVB 4P2CG 5DVLA 2BVPB 4GKSA 5FO8A 1LMKA 4JHWH 3QFDB 1QO3A 4L8SB 2NPLX 5HI3D 5SWSA 4OM0H 3SDAD 5HHMD 1NJ9B 3FN9A 3EOTH 4KJYB 2PTTB 1P69B 5CMAB 3X14A 5L2JB 3BW9B 1T0NB 1JNJA 2WWKO 2BNQA 5BS0E 4LKCA 4DTGH 1TVDA 1FZMB 1FFPA 5F88B 5LXGL 1KXTB 4P9ML 4Y1AB 1GIGL 2C1PA 1WAAF 4HFWB 1JCKA 4LL9A 2W59A 3QNZA 4NWTH 5IBTH 2Q8BH 3WFBL 4PGCA 2GY5A 1ZHLB 1CGYA 3ULUE 4OSUL 3PJSA 4QRRA 1I1CA 5HDQL 1JPSH 4APQD 2EDQA 4HPYL 3VXSD 4K9EC 5LQBL 1QLFA 2BCKA 1Z9OA