4RO2A

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with methylammonium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4ro2A00
3PJSK 3FB6C 4OXSA 4QE9A 2DWDC 3OR7C 3F7YC 3TETA 2OCCC 1K4DC 4WFHA 3LNMB 4MVRA 2KB1A 5B1BC 3F5WC 2EILC 3OR6C 4RO2A 4G27B 3K03A 2WLKA 4UUJC 3LUTB 3F7VC 4GX0A 4MS2A 4PDVA 4WFEA 3R65A 3E83A 4XDLA 1R3IC 5B1AC 3IFXA 2BOCC 4PA6A 1ORQC 2H8PC 3FB8C 4GX2A 3TCUA 1KKDA 2ZD9A 2A9HA 4R6ZA 3RVZA 2AHZA 4R50A 1P7BA 3SPJA 2EINC 2A79B 3SYQA 2NLJC 1J95A 2QKSA 4PA7A 3OUFA 3K0GA 3T4ZA 5EBLC 5CBGA 3RBZA 1M56C 2ATKC 4MTFA 5EC2C 3IGAC 2WLMA 4RUEA 4TWKA 2X6BA 3WG7C 4EKWA 3BEHA 5BZBA 5KUMA 3STZC 1OCRC 3SYAA 4HYOA 3GB7C 2ITDC 4J9ZB 1OCOC 2WLLA 3ASOC 2EIKC 4MVMA 1R3KC 4P2ZA 4P9PA 3K06A 2BOBC 1V55C 3AG3C 2HG5C 2IH3C 5CBFA 5EBWC 2EIJC 4GX5A 2X6AA 4F4LA 2WLIA 2P7TC 4GX1A 4X89A 3SYOA 4QE7A 1OCCC 1K4CC 3HPLC 4R8CA 4G28B 2W0FC 3JYCA 3OGCC 5E1AC 1JVMA 1XL6A 4RAIA 2ZXWC 4LP8A 4PDLA 1BL8A 3RVYA 4HZ3A 3OUSA 4MVQA 1QLEC 3SPIA 3T2MA 3X2QC 4MTOA 4MVZA 4PDMA 3FB7C 3SPGA 3VOUA 4MVUA 2Q67A 1G4YB 5EBMC 1R3JC 4J9YB 4PDRA 5CBHA 3SPHA 4PA9A 2Q6AA 2X6CA 4CBCA 1M57C 1R3LC 4LBEC 3UKMA 3E8BA 4I9WA 3E8FA 2EIMC 3LDEA 4ZBMA 4PA3A 5KUKA 4P9OA 2WLJA 5IY5C 4WFFA 1ZWIC 4KFMA 3EFFK 3K0DA 4X88A 5EC1C 3RW0A 4MVSA 2R9RB 4X8AA 4H33A 2Q68A 4RUFA 4MVOA 2YEVA 2HVJC 2DYRC 1LNQA 3AG4C 4MSWC 5B3SC 4MW3A 3UM7A 2JK5C 3K04A 1OCZC 1XL4A 3ASNC 4MW8A 4JTAB 2K1EA 4WFGA 4BW5A 3AG2C 3E8GA 3SYCA 2WLNA 2Y69C 3STLC 4MTGA 3KG2A 3ABMC 3ABKC 2WLLB 3AG1C 4JTDB 4QNHB 2DWEC 2IH1C 4LCUC 4P30A 4H37A 2WLHA 2A0LA 2DYSC 4JTCB 2HJFC 5EK0A 3E86A 2Q69A 2ITCC 2WLIB 3LDDA 4XDKA 3SPCA 4XDJA 3ZRSA 2QTOA 3K08A 5J9PC 4R7CA 3FB5C 3SJQC 3T4DA 2HFEC 4DXWA 1S5HC 3T1CA 3LDCA 2HVKC 3E8HA 2AHYA 1V54C 3E89A 3ABLC 4PA4A 3SYPA 3ZJZA
chains in the Genus database with same CATH superfamily
4OXSA 2BSKA 1RSOA 3FAVB 4DV1O 3M99B 3ZHUA 3R65A 4X65O 1XI1A 1W59A 3CXCU 2NN4A 1YVWA 1KKDA 4GX2A 2OCHA 4LWSA 1YTFD 1FJGB 1W0JG 3C3TA 1BT8A 3M8AA 2Z5UA 1M56C 1MG1A 1S77D 5C8YA 2Y48A 3JD0A 4UB8Z 3JASB 5KAFZ 3ML0A 3BAAA 1MSDA 4CH3A 2IBZH 4WF9V 1S0VA 1M4UA 1YEWA 2P7TC 5IDJA 3HPLC 2PI4A 4NXMB 1K34A 3ASOB 4TUYA 4Z1VA 2HHHO 4PDLA 1JCHA 3T2MA 3SPGA 1XILA 3LSSA 1FXKB 3MDSA 2IJKA 2ZT9B 4H44B 3NXSA 4JI6B 3FAVA 1N32B 5KUKA 1Q6IA 3L73H 1H2KA 3G6EV 2CTRA 1YXBA 3BPZA 5H6RA 4X8AA 4H33A 4NYKA 2JK5C 3K04A 5DN6G 3EVKA 4LH7A 2CK3G 3SYCA 2E76B 3CB2A 2QSAA 2WLLB 4LFBB 4O4HB 4H37A 4FMTA 4HNAB 3JASA 2ITCC 3SPCA 4W4KA 5IYCO 1BCCH 4B08A 3G80A 4DXWA 5B1BB 2HVKC 3HKEB 5EZYB 2UXCO 1SQXH 1AR5A 1FFXB 5KX5B 1PNKA 4RQFA 1UPGA 4O4LA 3NR7A 1JR9A 5B1AC 2GUZB 2V7QG 1WB7A 5B1OA 2PY5A 4UCTA 4DR7O 2B9ZA 2QWQB 2EIKB 4PA7A 2P06A 3ABTA 1YSCA 4DV2B 4J10A 4RUEA 4FFBB 3WG7C 1QCEA 4TQDA 1QLNA 2QJ1A 1H2MA 1L0LH 1XNQO 2WLLA 4JI8O 2AZ2A 2EULA 2ZXWB 4O4HA 2X7RB 4LF5B 2X6AA 4DUYB 2XAFA 4HNAA 1Y67A 2F95B 4X9QA 1WA8B 2DJVA 3BVOA 2V1DA 1EM1A 3G67A 3JYCA 4J7JA 1ENVA 2RNBA 3OEHG 3CCVV 3ABUA 3RN4A 3K59A 1FFXA 5KX5A 2UUCO 2QGNA 2VQEO 4LH6A 1KU9A 2X6CA 1I5XA 4X64O 1U96A 2KG7B 2ZR2A 1KMIZ 3ABKB 5LGNA 2GUZA 2ILMA 1NT2B 1TVKB 2DYSB 2HVJC 2YIBD 4JGSA 4BIUA 5JQGA 2CDYA 2KSDA 1WB8A 2GBOA 3Q4HB 4FFBA 4P30A 4WFBV 4CC6A 4AHCA 4DV6O 3S3WA 1S5LZ 2UXDB 4J80A 3ABMB 3LDCA 4JI5B 1IVSA 4OPAA 1R6TA 5KHHA 1WA8A 3SJAC 5FPOA 1P4RA 2EILC 1K73W 4ZIBA 1XNRB 1M56B 4FIPC 2WPDG 5BY1A 4PA6A 1AJPA 3ZS8C 2H8PC 3ZMSA 3A0HZ 2KG7A 4JYAB 5LMUO 1F4NA 4BW9A 5EC2C 4B3MB 3E22B 2UU9O 3ETDA 5JCOC 2A7WA 1NVPD 3K06A 1R73A 2HG5C 1B6QA 4YHHO 3G71V 1GKFA 1VF5B 1FFTB 1Q90D 2GV9A 1Q43A 1Y74B 2ZKOA 5E1AC 1JVMA 3OTFA 2ZNJA 1RM1B 2BE3A 2UXNA 4UB6Z 4E2LA 4MTOA 3FB7C 4YJ3A 5LYJB 1SQVH 3CRAA 4PI0A 2XUMA 1BE3H 2UXBB 3EHBB 2Q6AA 3ETQA 3AK1A 1R3LC 1QVGU 4TV8B 1H8EG 2VWJA 3DC6A 5HFMA 2Y0PA 3CXHF 4FZ0A 4DR5O 5B3SC 1XHZA 3D8CA 4OX9O 4NB5A 4DR1O 4BW5A 4CH4A 3OTOB 2WLNA 4LFAO 4MTGA 1H2GA 3E22A 1K7DA 3N2GB 1KKCA 3HKCB 1KP3A 4JV5B 5F2VO 5J2UB 4R7CA 2JS5A 3T4DA 1S5HC 2YIDA 1URFA 3SYPA 3CC2V 2Q0OC 1Y74A 5KAIZ 1IXMA 4U7OA 3OGIB 2KB1A 2AGAA 3HB3B 1J5EB 4G27B 5LYJA 1PL0A 3WG7B 4G2KA 3JCZA 4TV8A 2YEVB 3J7AU 3HKDB 3T1HB 4R50A 4D7SA 3CCSV 4JI7O 4FFKA 3ZHRA 1GN6A 2DOSA 5LHGA 1SF9A 4DR2O 1SQFA 2WLMA 4UFZA 2UUBB 5JJEB 1N0NA 3GB7C 4J9ZB 3QG5A 4GKJO 5DECA 1MZFA 3N2GA 4K0KO 5IT9N 3CYOA 2EIJC 3HKCA 5BXZA 2WSSG 1B3QA 2V4DA 5J2UA 4DV0B 2OWOA 3BHPA 4GKKB 1YJNV 1HNZB 1QNMA 1Z2GA 2E75B 2FKXA 3ZRWB 1NI8A 1NJIW 4KL1A 1N36O 1BQZA 1HNXO 2OIEA 1DLBA 1NTZH 3FKSG 3CRMA 5KA6A 1JQ0A 3W7SA 2WLJA 1F4MA 4UVAA 5IY5C 4KHPO 2DQ0A 1N34O 2ZDIC 2IW5A 2YEVA 3GVMA 2PYLA 3HKDA 2W6IG 4FLVA 3AG7A 1VQNV 2YIAA 3JATB 4JYCA 4ASUG 2OT5A 2QEXV 2HR3A 2F66C 3LSQA 4CS2A 3CMEV 1YIJV 5LL6Y 2YIBA 1GAXA 3E2EA 4GLXA 1LUWA 3SJQC 1N0JA 3K5LA 2EILB 1B04A 2AHYA 3E89A 4NXNO 3ZRVA 3OMAB 3A2FA 1COWG 1H2LA 1OV9A 3FB6C 5IYBO 4QE9A 3F7YC 5KHIA 4DR6O 3ZRWA 4NTWA 3LNMB 1VQOV 2JIZG 2IJHA 3CE2A 4JZ2A 1KQSU 1MZEA 4JI2O 2WLKA 3F7VC 4GX0A 3W7XA 3E83A 3FB8C 2ZD9A 4AQYB 4U3FH 1P7BA 3B8NA 4FLUA 2LJ2A 3T4ZA 1XREA 1AP5A 2LW7A 4MTFA 2QM4A 1IBKB 5KUMA 2P4KA 1Q7YW 2QM7A 3QTCA 3JATA 1KD1W 4FK5C 2QDOA 1R3KC 2CTQA 5K1XA 2PUSA 5IWAO 4U7NA 3ZN1A 3S3XA 4DV1B 1Q86W 4LF8O 2P5OA 2NNUA 3RYIA 4X65B 2FYUH 1SETA 2DQ3A 5B3SB 1XMOB 1M57C 4LBEC 4JZGA 1H2NA 5H5NA 5EYPB 1NS1A 4I9QA 4RUFA 2Q4PA 2YXLA 2OTJV 1LNQA 2W6JG 2PGGA 5JCOA 4IGGA 4X1YB 3WB0A 3ASNC 4WFGA 1RSOB 2Q5ZA 3IC9A 3T1YO 1DTOA 1PV0A 3UT5A 3H1LH 5JJJB 3TK1A 2XOKG 1BGYH 5EK0A 1KB9F 4DR4O 1L0NH 1IDSA 3J81N 4LF9B 2HHHB 1Q6HA 5B1NA 2B5UA 3BCCH 5GW7A 1PD3A 2F43G 4DUZO 4UCRA 2M7WA 5C8YB 1ZSPA 1NR7A 1CXZB 4B7KA 4ICGA 4NTXA 4JAAA 2RDCA 1EFRG 3CRCA 3EXAA 3FFQA 3IFXA 2D3OW 2BOCC 3ZMVA 3FYIB 4JF3A 5IJ0B 1MOFA 5EYPA 2JJ1G 2O57A 1IBMB 2P22C 2EIJB 3RBZA 5HFLA 4X1YA 3DGEA 1I94B 3GWKC 2N05A 4WFAV 5H9CA 3TJTA 3JSNA 3ZCCA 3THOA 5LHIA 5L3CA 5EIBC 5LA6B 4YY3O 2UXCB 4GUNA 3SJBC 4F6EA 4F4LA 1KYOF 2L6LA 4IHJB 5FL7G 2CAZC 1TA8A 2GSMB 4NVPA 4RAIA 2F4VB 4MVQA 5IY5B 5LMNO 5CA1B 4HAMA 1F7YA 1VQKV 4UVBA 1Z5VA 2DE0X 3CWBH 4B3SO 4I9WA 1KC8W 4GZRB 2YXYA 5EIBD 1N8RW 4JI0O 2PYJA 4O2AB 3G4SV 4LNUB 4MSWC 4FZ1A 4YIPA 1N4CA 5IJ0A 4JI3O 2CGOA 4O4LB 4TQFA 2RCVA 4CH6A 3KKYA 3O65A 4E4EA 4WBNA 2HJFC 4B3TO 1WNSA 3E86A 2JDIG 4UCSA 3U11A 5LA6A 1NQTA 2QTSA 3ZHQA 2Q9LA 1SQBH 1V54C 2YDEA 3ABLC 4IHJA 3WU2Z 3N2KB 2Q8VA 4YIOA 4FLZA 5JJNB 4J11A 4QGPA 4X64B 1IZ3A 5CA3A 3D3IA 5CA1A 3QVNA 1XMQO 1WAZA 2ZDIA 2B1IA 3LUTB 4PDVA 1PNLA 1W0KG 1KECA 3TCUA 1AJNA 1X4TA 1JPXA 2VRZA 2UUAO 3BA8A 1US6A 3FD9A 5LHHA 3SPJA 3QO7A 4JI1O 5J2TA 4O2AA 2Q7HA 4B7EA 4X66O 2YI8A 2IU3A 4LNUA 2ATKC 2LFSA 2EBOA 2X6BA 3OAAG 4JI4B 1GO3F 3STZC 3SYAA 3DC5A 1YF2A 1CPYA 2JVDA 2ZQMA 4GYCB 2Y4TA 5CN0A 4I5SA 2ZIMA 2ZR3A 3SJCC 2LW1A 5CA0A 1FJGO 5JQGB 5FNVB 4CH5A 2WA4A 2LGQA 3KCXA 3N2KA 4PJ0Z 5L3BA 1RFYA 2VQFB 4PDRA 2G38A 4PA9A 3UKMA 3ASNB 3E8FA 5LMUB 5KHGA 3B2EE 3JD2A 1VARA 1RPRA 2PZSA 4CC5A 4MVSA 3E35A 4EEQA 5E79Z 4ZI7B 2UU9B 4QPKA 3DXRB 4NXMO 3IAYA 2ZE8A 3KZIZ 3W7TA 1GTOA 1IX9A 3AG1C 3SR2C 1N33O 5IE9A 4JTCB 4DV5O 2RJZA 3ZMUA 4CS4A 4XDJA 4JI6O 2Y69B 3B4SA 3FB5C 3HR0A 1K92A 1OHHG 4PV1B 1D5NA 2PI5A 4DV3O 3CX5F 3K5NA 3OE7G 5FNVA 2OIGA 1K4DC 1PP9H 1BHBA 4UXNA 3A0BZ 1SS3A 4MS2A 4XDLA 4LF6O 4LR3A 3L74H 3DSQA 4DR5B 2JS3A 2A9HA 4OX9B 1ZL8B 5IYDO 4OPHA 2EINC 2W0XA 4DR1B 1J95A 1XBLA 2EZPA 5BR8O 4DV4O 4ZI7A 4IT5A 4YJ3B 3DXRA 5JH7B 2ADPA 5L3GA 4LF7B 5FPRA 2N74A 1LR1A 1OCOC 3RYCB 3K79A 4TV9B 4N21A 1EN4A 4X62O 5BMVB 5EBWC 4H0LB 3QF7A 4R8CA 1K4CC 3OGCC 2FMLA 1BL8A 2OTLV 2HP8A 3X2QC 1QLEC 3TXQA 2CTPA 4DV2O 3D36C 3K57A 1WP8A 2EZOA 4PA3A 5FLXN 4JI7B 1SKVA 4FPPA 1VEWA 2ADQB 1GN4A 3CCLV 3WB1A 4ZOLB 4CZZA 5TISZ 1ZL8A 4L8JA 1QR9A 2K1EA 1XDCA 4GKJB 5DM6V 3B09A 3KCYA 1K8AW 1DF4A 1V54B 3ABLB 1V9PA 3JD3A 5JH7A 2EJ7A 2QKCA 2QM8A 3IJ4A 3RYCA 2QTOA 4TV9A 1X59A 3ZX6A 5BMVA 4K8ZA 4DYLA 1P84F 1HNXB 3P30A 4LC1A 1FYJA 2ZM6O 3CRRA 4FJCC 2RMKB 2DN9A 3W7WA 5JWPA 1GN3A 1S5JA 1F23A 4KHPB 4W4LA 1DGSA 2ARHA 1OJHA 3LNNA 3OM3B 2LO1A 1QQCA 4R6ZA 3B8MA 2EJRA 1EN5A 2QKSA 3BA9A 3OUFA 4FVMA 1P49A 5B1AB 4JI5O 3RWRD 3CEIA 3CCUV 5DEDA 4ZOLA 2FTKA 1VQLV 3K9AA 1G1XB 1EBOA 1SA0B 1FD9A 2XHBA 5LP6C 3ETGA 1XNRO 4DV7O 3N27A 2YI9A 4JYAO 3RVYA 3OUSA 2LFRA 1CEZA 1HR0O 3FYEB 4J42A 2Q67A 5A9GA 1S72V 1FPOA 4KP4A 4J7KA 3R66A 3E8BA 3LDEA 1KP2A 4LFCO 1A32A 3JAMN 4P9OA 2Q7EA 3BFRA 1UFIA 3AG1B 5EC1C 1G8MA 2Q68A 1TUBB 2QKAA 1YZBA 3P32A 3L75H 3BABA 2IJJA 3JAWB 4LF4O 3STLC 2RN9A 4BWAA 5IWAB 3B77A 2Y4UA 1SA0A 4AILC 1VQ6V 1Q5OA 2E5LB 2UXBO 3APQA 3T1CA 4BR6A 4O4JA 4LF8B 1THZA 4PA4A 4O2BB 1WLEA 1E1RG 2XT9A 1BS3A 1QHTA 3A0RA 2OCCC 1NKDA 2MK3A 2EINB 3U0ZA 3OW2U 3F5WC 3OR6C 1IBLO 3CCMV 4I0XB 1XEQA 2ZINA 4Z1MG 1Q6UA 4DW1A 1GN2A 5D5PA 5CB4B 2AHZA 1OCOB 2FB5A 1TUBA 2ZE5A 3RYIB 4TWKA 4F6RA 2XAQA 3CD6V 3BEHA 4UCUA 4MTXA 4ZKIA 2PF4E 1OCRC 1PNMA 3JAWA 2EX3A 3ASOC 4JAVA 2P4VA 2ZE7A 1V55C 1QLEB 1J5EO 2CGNA 4GX5A 1YJ9V 1FXKC 4GX1A 3CRQA 1FXVA 3T1HO 1MABG 1K5QA 4HZ3A 3UT5B 1YITV 4O2BA 5KLVH 1WN7A 3CMAV 1G4YB 1PL4A 2Q0AA 1JJ2U 1KUQA 1QR8A 4B3RB 4I0XA 4WFFA 4KFMA 4KXRA 5ITZB 1BZKA 5CB4A 3AG4C 5D5QA 4MW3A 1I08A 4DV0O 1OCZC 4GKKO 2GTAA 1XQ8A 1K97A 1ZTEA 1HW7A 3AG2C 5LBQA 2R9IA 4I55B 2ZE6A 1K9MW 2A0LA 4IYIA 1VQ7V 3LDDA 3BY6A 1L8DA 3ZRSA 2YC0A 5LMNB 1U97A 4YJ2B 3D36A 1H2SB 1K5SA 2BTQB 1GM8A 2QWPB 5C93A 1VF6C 2X0LA 4B3SB 4FLWA 4EFBA 4EB6B 3CS5A 3CP1A 1Y76A 3JD4A 4JI3B 3MAQA 1JX9A 1S3JA 2A79B 5ITZA 4GCZA 4D7TA 1XHXA 1M90W 1OZ0A 5EBLC 5LP6B 1GRJA 1ZUQA 3CHXA 3JAKA 3ICXA 1ROPA 1HNWO 3U10A 1VQ8V 1G6UA 5LOVA 4P2ZA 4I55A 2BOBC 2IH3C 3VQWA 4I50A 1M1KW 1VQPV 4X89A 3H1KH 4H13B 3ZHSA 3ZMTA 2W0FC 1DK1A 1AJQA 4YJ2A 2NR5A 1PKXA 1XMQB 4PDMA 3JSLA 1BSMA 2BTQA 4WBNB 1WJZA 3CC4V 4J9YB 1FXHA 2N04A 5LGTA 2EIMC 2QWRB 3L71H 4ZHQB 4EB6A 4I4TA 4FLTA 3UM7A 1AB3A 4DK1A 2F23A 1JFFB 1ZLZA 5LP6A 3ABMC 4QNHB 2QR4A 4N23A 3O9OA 4DR7B 3RYFB 2Q69A 2WLIB 4Z2WA 1JA8A 4J41A 4K35A 1Q8IA 4DR3O 2OCCB 3OMNB 1XMOO 5K1PA 5J2TB 3E8HA 1BQ0A 2HEPA 1D5AA 3ZHVA 3PJSK 1NZ6A 5H6QA 1TAEA 1XNQB 4JI8B 2AZ0A 1AVMA 3SGIA 3H1HH 1FKAO 2E3CA 4QPJA 3UQ8A 1L1FA 3C90A 2XAHA 1OCRB 4ZHQA 5CA0B 2DMXA 3RYHB 1R6NA 4LF9O 4FLXA 3HKBB 1VQ4V 1V55B 2ZIOA 4OGQB 1N33B 2UUCB 2VQEB 4C7UA 1R1BA 4DV5B 2KKWA 1JFFA 2ITDC 4DRXB 4AI8A 3CC7V 4J7ZA 1NBMG 1RM1C 3H01A 3ZRXA 3RYFA 1K3EA 2WLIA 4DV3B 4DO2A 4QIWF 4QE7A 1OCCC 2LP7A 1QBZA 2XAJA 3CPWU 1MA1A 1VIBA 1VF7A 1PM9A 1IBMO 1TGOA 1YI2V 2CE4A 4LF6B 4DV6B 5GTHZ 3AG4B 1I94O 2QWNB 1OCZB 3CJHB 4ZBMA 3AG2B 1WPBA 3K5OA 3H1IH 3L70H 3RW0A 5BR8B 4DV4B 5AG2A 3VQYA 4MVOA 1M57B 1XL4A 2HLDG 3RYHA 3HKBA 3E8GA 3KG2A 2F4VO 4X62B 2XAGA 1FXKA 3F5TA 1Q81W 4DRXA 2YUAA 1MNGA 1M93A 2E74B 1XUQA 3ETEA 1BMFG 1VQ5V 1HDJA 4BIZA 3D3QA 3ZJZA 1ZAUA 2R70A 4I7ZB 3ZMZA 1SZTA 3IC7A 2HKOA 3K03A 2AXTZ 4JASA 4YHHB 2ZNIA 2M6YA 5CMUA 2P6JA 4DK0A 2F1MA 5LXTB 3LSUA 1ORQC 4X1KB 3CJHA 4YXWG 1N32O 1NH2B 3P3PA 1NR1A 5B66Z 3HKEA 5EZYA 3A8TA 2Z0AA 1EZJA 1E79G 3J80N 4PI2A 4MVMA 4LFBO 1AI7A 1YDXA 1FAFA 4K3AA 2ZM6B 4K8XA 1SZXA 1VF6A 1PPJH 2CTWA 1HP8A 1YTFB 2EIMB 4LFAB 3PN1A 5L3DA 3SPIA 1SESA 1GM9A 2CH7B 5GONB 4IYHA 3RFRA 1GK9A 1MSWD 4NR1A 5EBMC 4JI4O 5A2QN 5KHJA 3JALB 2H94A 1ZWIC 1O9HA 5LXTA 3QO8A 4X88A 4X1KA 2DYRC 3GWOA 3P3NA 2UXXA 4NTYA 3AK2A 2R72A 2Y0IA 1D2DA 1NU1H 4JTDB 2D2CB 2WWWA 4DW0A 1E1QG 3ZBHA 3CCRV 4DV7B 2VQFO 2IJIA 4XDKA 2CUGA 1VQMV 5J9PC 2ETNA 4PHZA 4LF5O 1HR0B 5L3FA 4DUYO 4DR2B 3TGUH 1TVKA 4UCVA 4BIOA 2DWDC 1O9GA 2YSUB 1AI4A 4LFCB 3W7UA 2CH7A 4K0KB 5GONA 3Q4HA 1R6KA 1AR4A 4X20B 4UV8A 4UV9A 4L87A 4JAUA 5GTIZ 3JALA 4Q20A 4ABMA 2AW9A 4LF4B 1N36B 2A06H 3K0GA 3CCEV 3QNEA 4NKGB 1AROP 3IGAC 4JYBA 1OCCB 3MHSC 1Q3EA 5KHKA 2BTOA 1MMMA 3AG3C 4IL6Z 1N34B 2Z3YA 2KQXA 5KA5A 4UVCA 2JEXA 3SYOA 2UXDO 4G28B 1JMKC 5IJ9B 1CP9A 1FS0G 3OT7A 2PTMA 4IIJB 2XASA 1IBLB 3VOUA 1Y66A 4MVUA 1SERA 4A5UB 5CBHA 3SPHA 4CBCA 4JYYA 4LF7O 1S76D 3WFVA 4X20A 3ZN0A 5L3EA 1W2BU 4NXNB 2VS0A 3EFFK 4FM1A 4O4JB 1SRYA 3L9DA 4UCOA 2LGWA 3K3WA 3ZHTA 4DR6B 2Q7GA 4MW8A 5H2FZ 4JI2B 1GH6A 1VQ9V 1JOYA 2DWEC 2IH1C 4LCUC 4B3MO 2WLHA 3CCQV 3H1JH 1VP7A 2B1GA 1AI6A 3C3SA 2LQTA 3ZIAG 3OFNG 5JVDB 1NTMH 2BCCH 4F6RB 5IJ9A 3TETA 4WFHA 4IIJA 4MVRA 1AILA 1EN6A 2MW2B 4WFEA 5B5EZ 4PELA 2HJDA 3K58A 3M7MX 1I7FA 2WA3A 1P7GA 4FM2A 1AI5A 2A3QA 4TOIA 1TUEB 4EKWA 5BZBA 4JPRA 2FL4A 3OTOO 1RPOA 4P9PA 1AP6A 2XNDG 4KUMA 5CBFA 3UO3A 1RP3B 1YJWV 2ODMA 4JV5O 3OMIB 4RWUA 1H8HG 3I56V 1XL6A 3T1YB 3OEEG 1H38A 5JVDA 4GT1A 3MHHC 1M5IA 2JGDB 2C2AA 2DYRB 1R3JC 1F51A 4HBNA 4DR4B 1JJOA 1I0HA 1SQPH 2ZCEA 2OYQA 1YHQV 1NVPB 3X2QB 1B06A 4FM0A 4BAYA 3MD0A 2WAMA 3K0DA 1GM7A 4DUZB 3AK3A 2IM9A 3G6BA 1QVFU 2JEUA 1QU7A 1HNWB 4JTAB 2QE7G 4TT3G 2R9AA 1ZX3A 1Y76B 2UUBO 3JD1A 3ZEDA 2JGUA 3K08A 3CSXA 3RT3C 2RQ6A 2HFEC 5LGUA 1SQQH 4XBFA 1Q82W 2YICA 4QJFB 1DF5A 3OR7C 4X1IB 3JAKB 1HNZO 3I5DA 2JRIA 4PD4F 5LOVB 5B1BC 2XTAA 4Q6GA 4RO2A 4YY3B 4UUJC 3RGBA 4I50B 1IURA 2JGDA 1R3IC 3JARB 3L72H 1T5EA 5KMGB 1SQGA 2F93B 3B40A 3RVZA 3H9VA 3I55V 2E5LO 3SYQA 2NLJC 1VMGA 3AG3B 3AEIA 4O4IB 5CBGA 1LUVA 4EFEA 3VBBA 4HYOA 4DR3B 2EIKC 4U3JB 4JI0B 1YCIA 1EZVH 2QWOB 1M9NA 3K9SA 4I4TB 5IYZB 4MT8A 1BHAA 2BSKB 4TSFG 3FX7A 3SDLA 2ZXWC 4LP8A 3TXSA 4MVZA 3UO2A 4FLYA 2VWKA 4B3TB 4X1IA 2YS8A 1HWYA 2GTSA 2YXHA 4LWSB 1KBHA 1Z5WA 3CCJV 4RQEA 3JARA 2IU0A 1WPXA 2Q73A 1AR1B 2R9RB 5KMGA 2GHYA 4CS3A 3BRCA 4D6TH 4AQYO 1Y4MA 2GDSA 1GMGA 1SC5B 4O4IA 1NTKH 2Y69C 3ABKC 3APOA 3DTUB 3WB2A 2P90A 4WCEV 1UJWB 3QO5A 1WP7A 2H3OA 2DYSC 1IBKO 1IXBA 2JJ2G 2QA4V 2UUAB 1K33A 2K9PA 3K5MA 1NH2D 1I5YA 3VQXA 4U3JA 4JI1B 2DW4A 3JCUZ 2P67A 3OD4A 4X66B 4B3RO 4TUYB 3VQVA 1XOUA 3UCSC 1Y6XA 5IYZA 2L35A
chains in the Genus database with same CATH topology
3FB6C 5IYBO 4OXSA 4QE9A 3F7YC 3ZRWA 3ZMZA 4FJCC 3LNMB 1VQOV 2JIZG 1SZTA 2IJHA 3IC7A 3W7WA 1KQSU 3M99B 2HKOA 1F23A 3K03A 2WLKA 4JASA 3F7VC 4GX0A 3W7XA 3R65A 3E83A 5CMUA 2P6JA 3CXCU 1ORQC 3FB8C 1KKDA 3OM3B 4GX2A 2ZD9A 1YTFD 4R6ZA 1W0JG 3B8MA 4YXWG 1P7BA 2EJRA 1NH2B 3B8NA 2QKSA 1NR1A 3OUFA 3T4ZA 5B1AB 3CCUV 2Z5UA 1M56C 4MTFA 2FTKA 1EZJA 1E79G 1VQLV 1MG1A 1S77D 3K9AA 1EBOA 5KUMA 2Y48A 3JD0A 1Q7YW 2QM7A 1KD1W 4FK5C 4MVMA 1R3KC 3ML0A 4WF9V 1S0VA 1AI7A 3ETGA 4U7NA 2P7TC 5IDJA 3ZN1A 3HPLC 2PI4A 1K34A 3ASOB 1YTFB 2EIMB 4PDLA 1Q86W 1JCHA 5L3DA 3RVYA 3OUSA 2LFRA 3SPIA 3T2MA 1CEZA 1SESA 1GM9A 3SPGA 3FYEB 3LSSA 2Q67A 1FXKB 2NNUA 1S72V 2IJKA 1GK9A 3NXSA 5EBMC 1SETA 2DQ3A 5B3SB 1MSWD 4KP4A 1M57C 4LBEC 3E8BA 3LDEA 1KP2A 5KUKA 4P9OA 2H94A 1ZWIC 3G6EV 3AG1B 3QO8A 4X88A 5EC1C 5H6RA 4X8AA 1G8MA 2Q68A 4H33A 4RUFA 2OTJV 2DYRC 1LNQA 2W6JG 3GWOA 2JK5C 3K04A 5DN6G 2UXXA 3P32A 3ASNC 2IJJA 4WFGA 2CK3G 1DTOA 3SYCA 3STLC 2WLLB 4JTDB 3TK1A 3B77A 2WWWA 2XOKG 4H37A 1E1QG 4FMTA 3CCRV 5EK0A 2ITCC 1VQ6V 2IJIA 4XDKA 3SPCA 5IYCO 1VQMV 5J9PC 4DXWA 5B1BB 3T1CA 2HVKC 5B1NA 2B5UA 5L3FA 5GW7A 1THZA 4PA4A 1PD3A 1WLEA 1E1RG 2F43G 1PNKA 4RQFA 2DWDC 2M7WA 3A0RA 2OCCC 1NKDA 2MK3A 1NR7A 2EINB 2YSUB 3OW2U 3F5WC 3OR6C 1AI4A 3W7UA 3CCMV 1R6KA 5B1AC 1EFRG 4UV8A 4Z1MG 3IFXA 4UV9A 2V7QG 2D3OW 2BOCC 4L87A 5B1OA 4JAUA 3ZMVA 3FYIB 4JF3A 2AHZA 4Q20A 1MOFA 1OCOB 2EIKB 4PA7A 3ABTA 1YSCA 2JJ1G 3K0GA 3CCEV 3QNEA 2EIJB 3RBZA 1AROP 5HFLA 3IGAC 4RUEA 3DGEA 2XAQA 4TWKA 3WG7C 3CD6V 4JYBA 3BEHA 4ZKIA 4MTXA 1QCEA 1OCCB 1OCRC 1PNMA 4WFAV 5H9CA 3ZCCA 3MHSC 1QLNA 5LHIA 3ASOC 2WLLA 4JAVA 2ZXWB 5L3CA 1V55C 3AG3C 1QLEB 2X7RB 2Z3YA 4GX5A 2X6AA 2XAFA 4F4LA 5KA5A 1YJ9V 1FXKC 4UVCA 4GX1A 2JEXA 5FL7G 3SYOA 2V1DA 4G28B 1FXVA 3JYCA 1CP9A 1FS0G 2GSMB 4RAIA 1ENVA 1MABG 3OEHG 1K5QA 3CCVV 3ABUA 4HZ3A 4MVQA 5IY5B 2XASA 1YITV 4HAMA 1VQKV 3VOUA 1Y66A 4UVBA 4MVUA 3CMAV 1SERA 1G4YB 5CBHA 3SPHA 1JJ2U 2X6CA 1I5XA 4CBCA 1QR8A 4I9WA 1S76D 1KC8W 2ZR2A 3WFVA 5L3EA 3ZN0A 4WFFA 4KFMA 1W2BU 1N8RW 3ABKB 3EFFK 5LGNA 1SRYA 3G4SV 2DYSB 2HVJC 3K3WA 3AG4C 4MSWC 4MW3A 1OCZC 4JGSA 4BIUA 4MW8A 1K97A 3AG2C 5LBQA 1VQ9V 2R9IA 1JOYA 2DWEC 2IH1C 4LCUC 4P30A 4WFBV 1K9MW 2WLHA 2A0LA 2HJFC 3CCQV 3ZJZA 1VQ7V 3E86A 3LDDA 3BY6A 2JDIG 3ZRSA 2B1GA 1NQTA 3ABMB 1AI6A 3LDCA 1V54C 3ZIAG 3ABLC 3OFNG 3D36A 3TETA 1K5SA 1GM8A 4WFHA 5C93A 2X0LA 4MVRA 5CA3A 3D3IA 1P4RA 2EILC 1K73W 2ZDIA 2B1IA 4WFEA 3LUTB 4PDVA 4PELA 1PNLA 1W0KG 1M56B 4FIPC 2WPDG 1KECA 3CP1A 1AJPA 4PA6A 2H8PC 3TCUA 3ZMSA 3JD4A 1AJNA 1JPXA 5LHHA 1JX9A 1S3JA 3SPJA 2A79B 3QO7A 4GCZA 1M90W 1OZ0A 1F4NA 2IU3A 5EBLC 1AI5A 2ATKC 5EC2C 1TUEB 2LFSA 2EBOA 2X6BA 3OAAG 1GO3F 4EKWA 5BZBA 3ETDA 4JPRA 3STZC 3SYAA 1NVPD 1ROPA 1CPYA 1VQ8V 4P2ZA 1RPOA 2ZQMA 3K06A 2BOBC 4P9PA 1R73A 5CN0A 2HG5C 1B6QA 2IH3C 2XNDG 4KUMA 5CBFA 1M1KW 1VQPV 4I5SA 1YJWV 3G71V 1GKFA 4X89A 1FFTB 3OMIB 2ZR3A 3ZMTA 2W0FC 1H8HG 5E1AC 3I56V 1JVMA 1XL6A 1RM1B 2UXNA 1AJQA 1PKXA 3OEEG 4E2LA 4MTOA 4PDMA 1H38A 3FB7C 5L3BA 4GT1A 3MHHC 2C2AA 2DYRB 1R3JC 1F51A 4J9YB 4PDRA 3CC4V 1FXHA 3EHBB 2Q6AA 4PA9A 5LGTA 3UKMA 1R3LC 3ASNB 1QVGU 3E8FA 2EIMC 1YHQV 1NVPB 3X2QB 3JD2A 4BAYA 3MD0A 1H8EG 1RPRA 2WAMA 3K0DA 1GM7A 4MVSA 5HFMA 3E35A 1QVFU 5B3SC 3UM7A 2JEUA 4QPKA 4JTAB 4BW5A 2QE7G 2WLNA 4MTGA 3W7TA 3ABMC 1GTOA 1H2GA 3AG1C 4QNHB 4TT3G 1K7DA 4N23A 4JTCB 1KP3A 2Q69A 2WLIB 3ZMUA 3JD1A 4XDJA 2OCCB 3OMNB 3K08A 2Y69B 4R7CA 3FB5C 3T4DA 2HFEC 1S5HC 5LGUA 1K92A 3E8HA 1OHHG 4XBFA 1Q82W 3SYPA 3CC2V 2PI5A 4QJFB 1DF5A 3PJSK 3OR7C 5H6QA 3OE7G 1IXMA 1K4DC 4U7OA 1BHBA 2KB1A 5B1BC 3HB3B 4UXNA 4RO2A 4G27B 4UUJC 4MS2A 4XDLA 1R3IC 1PL0A 4QPJA 1L1FA 3WG7B 4G2KA 3JCZA 2A9HA 2XAHA 2YEVB 3RVZA 1OCRB 3I55V 4R50A 5IYDO 2EINC 3SYQA 3CCSV 2NLJC 1J95A 1R6NA 1VQ4V 1V55B 3AG3B 3AEIA 5LHGA 2EZPA 5CBGA 2WLMA 3VBBA 4HYOA 5L3GA 3GB7C 2ITDC 4J9ZB 3CC7V 1OCOC 1NBMG 2EIKC 1RM1C 3K79A 4N21A 3H01A 5EBWC 1M9NA 3CYOA 2EIJC 3ZRXA 2WSSG 1K3EA 2WLIA 4DO2A 4QIWF 4QE7A 1OCCC 1K4CC 2LP7A 4R8CA 1QBZA 4MT8A 2XAJA 1YJNV 3OGCC 1BHAA 3CPWU 4TSFG 3ZRWB 1NJIW 2ZXWC 4LP8A 1BL8A 2OTLV 3X2QC 1QLEC 4MVZA 1YI2V 1DLBA 3AG4B 3FKSG 1OCZB 1HWYA 5KA6A 1JQ0A 2EZOA 4ZBMA 4PA3A 3W7SA 3AG2B 4FPPA 2WLJA 1F4MA 4UVAA 5IY5C 3CCJV 2DQ0A 4RQEA 2IU0A 1WPXA 2ZDIC 3RW0A 1AR1B 3CCLV 2R9RB 2GHYA 4MVOA 2IW5A 2YEVA 4CZZA 2W6IG 1M57B 1Y4MA 1XL4A 2HLDG 1GMGA 1QR9A 2K1EA 3E8GA 1VQNV 5DM6V 2Y69C 3KG2A 3ABKC 4JYCA 1K8AW 3DTUB 4ASUG 2OT5A 2P90A 1DF4A 1V54B 2HR3A 4WCEV 2XAGA 1UJWB 2QEXV 3ABLB 1FXKA 3JD3A 3QO5A 2DYSC 3LSQA 3CMEV 1YIJV 1Q81W 2JJ2G 2QA4V 1K33A 1NH2D 2QM8A 1I5YA 3E2EA 2QTOA 3ETEA 2DW4A 3SJQC 1BMFG 2P67A 1VQ5V 2EILB 4BIZA 2AHYA 3E89A 3ZRVA 3OMAB 3P30A 4LC1A 1COWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJS K;  3FB6 C;  4OXS A;  4QE9 A;  2DWD C;  3OR7 C;  3F7Y C;  3TET A;  2OCC C;  1K4D C;  4WFH A;  3LNM B;  4MVR A;  2KB1 A;  5B1B C;  3F5W C;  2EIL C;  3OR6 C;  4RO2 A;  4G27 B;  3K03 A;  2WLK A;  4UUJ C;  3LUT B;  3F7V C;  4GX0 A;  4MS2 A;  4PDV A;  4WFE A;  3R65 A;  3E83 A;  4XDL A;  1R3I C;  5B1A C;  3IFX A;  2BOC C;  4PA6 A;  1ORQ C;  2H8P C;  3FB8 C;  4GX2 A;  3TCU A;  1KKD A;  2ZD9 A;  2A9H A;  4R6Z A;  3RVZ A;  2AHZ A;  4R50 A;  1P7B A;  3SPJ A;  2EIN C;  2A79 B;  3SYQ A;  2NLJ C;  1J95 A;  2QKS A;  4PA7 A;  3OUF A;  3K0G A;  3T4Z A;  5EBL C;  5CBG A;  3RBZ A;  1M56 C;  2ATK C;  4MTF A;  5EC2 C;  3IGA C;  2WLM A;  4RUE A;  4TWK A;  2X6B A;  3WG7 C;  4EKW A;  3BEH A;  5BZB A;  5KUM A;  3STZ C;  1OCR C;  3SYA A;  4HYO A;  3GB7 C;  2ITD C;  4J9Z B;  1OCO C;  2WLL A;  3ASO C;  2EIK C;  4MVM A;  1R3K C;  4P2Z A;  4P9P A;  3K06 A;  2BOB C;  1V55 C;  3AG3 C;  2HG5 C;  2IH3 C;  5CBF A;  5EBW C;  2EIJ C;  4GX5 A;  2X6A A;  4F4L A;  2WLI A;  2P7T C;  4GX1 A;  4X89 A;  3SYO A;  4QE7 A;  1OCC C;  1K4C C;  3HPL C;  4R8C A;  4G28 B;  2W0F C;  3JYC A;  3OGC C;  5E1A C;  1JVM A;  1XL6 A;  4RAI A;  2ZXW C;  4LP8 A;  4PDL A;  1BL8 A;  3RVY A;  4HZ3 A;  3OUS A;  4MVQ A;  1QLE C;  3SPI A;  3T2M A;  3X2Q C;  4MTO A;  4MVZ A;  4PDM A;  3FB7 C;  3SPG A;  3VOU A;  4MVU A;  2Q67 A;  1G4Y B;  5EBM C;  1R3J C;  4J9Y B;  4PDR A;  5CBH A;  3SPH A;  4PA9 A;  2Q6A A;  2X6C A;  4CBC A;  1M57 C;  1R3L C;  4LBE C;  3UKM A;  3E8B A;  4I9W A;  3E8F A;  2EIM C;  3LDE A;  4ZBM A;  4PA3 A;  5KUK A;  4P9O A;  2WLJ A;  5IY5 C;  4WFF A;  1ZWI C;  4KFM A;  3EFF K;  3K0D A;  4X88 A;  5EC1 C;  3RW0 A;  4MVS A;  2R9R B;  4X8A A;  4H33 A;  2Q68 A;  4RUF A;  4MVO A;  2YEV A;  2HVJ C;  2DYR C;  1LNQ A;  3AG4 C;  4MSW C;  5B3S C;  4MW3 A;  3UM7 A;  2JK5 C;  3K04 A;  1OCZ C;  1XL4 A;  3ASN C;  4MW8 A;  4JTA B;  2K1E A;  4WFG A;  4BW5 A;  3AG2 C;  3E8G A;  3SYC A;  2WLN A;  2Y69 C;  3STL C;  4MTG A;  3KG2 A;  3ABM C;  3ABK C;  2WLL B;  3AG1 C;  4JTD B;  4QNH B;  2DWE C;  2IH1 C;  4LCU C;  4P30 A;  4H37 A;  2WLH A;  2A0L A;  2DYS C;  4JTC B;  2HJF C;  5EK0 A;  3E86 A;  2Q69 A;  2ITC C;  2WLI B;  3LDD A;  4XDK A;  3SPC A;  4XDJ A;  3ZRS A;  2QTO A;  3K08 A;  5J9P C;  4R7C A;  3FB5 C;  3SJQ C;  3T4D A;  2HFE C;  4DXW A;  1S5H C;  3T1C A;  3LDC A;  2HVK C;  3E8H A;  2AHY A;  1V54 C;  3E89 A;  3ABL C;  4PA4 A;  3SYP A;  3ZJZ A; 
#chains in the Genus database with same CATH topology
 4OXS A;  2BSK A;  1RSO A;  3FAV B;  4DV1 O;  3M99 B;  3ZHU A;  3R65 A;  4X65 O;  1XI1 A;  1W59 A;  3CXC U;  2NN4 A;  1YVW A;  1KKD A;  4GX2 A;  2OCH A;  4LWS A;  1YTF D;  1FJG B;  1W0J G;  3C3T A;  1BT8 A;  3M8A A;  2Z5U A;  1M56 C;  1MG1 A;  1S77 D;  5C8Y A;  2Y48 A;  3JD0 A;  4UB8 Z;  3JAS B;  5KAF Z;  3ML0 A;  3BAA A;  1MSD A;  4CH3 A;  2IBZ H;  4WF9 V;  1S0V A;  1M4U A;  1YEW A;  2P7T C;  5IDJ A;  3HPL C;  2PI4 A;  4NXM B;  1K34 A;  3ASO B;  4TUY A;  4Z1V A;  2HHH O;  4PDL A;  1JCH A;  3T2M A;  3SPG A;  1XIL A;  3LSS A;  1FXK B;  3MDS A;  2IJK A;  2ZT9 B;  4H44 B;  3NXS A;  4JI6 B;  3FAV A;  1N32 B;  5KUK A;  1Q6I A;  3L73 H;  1H2K A;  3G6E V;  2CTR A;  1YXB A;  3BPZ A;  5H6R A;  4X8A A;  4H33 A;  4NYK A;  2JK5 C;  3K04 A;  5DN6 G;  3EVK A;  4LH7 A;  2CK3 G;  3SYC A;  2E76 B;  3CB2 A;  2QSA A;  2WLL B;  4LFB B;  4O4H B;  4H37 A;  4FMT A;  4HNA B;  3JAS A;  2ITC C;  3SPC A;  4W4K A;  5IYC O;  1BCC H;  4B08 A;  3G80 A;  4DXW A;  5B1B B;  2HVK C;  3HKE B;  5EZY B;  2UXC O;  1SQX H;  1AR5 A;  1FFX B;  5KX5 B;  1PNK A;  4RQF A;  1UPG A;  4O4L A;  3NR7 A;  1JR9 A;  5B1A C;  2GUZ B;  2V7Q G;  1WB7 A;  5B1O A;  2PY5 A;  4UCT A;  4DR7 O;  2B9Z A;  2QWQ B;  2EIK B;  4PA7 A;  2P06 A;  3ABT A;  1YSC A;  4DV2 B;  4J10 A;  4RUE A;  4FFB B;  3WG7 C;  1QCE A;  4TQD A;  1QLN A;  2QJ1 A;  1H2M A;  1L0L H;  1XNQ O;  2WLL A;  4JI8 O;  2AZ2 A;  2EUL A;  2ZXW B;  4O4H A;  2X7R B;  4LF5 B;  2X6A A;  4DUY B;  2XAF A;  4HNA A;  1Y67 A;  2F95 B;  4X9Q A;  1WA8 B;  2DJV A;  3BVO A;  2V1D A;  1EM1 A;  3G67 A;  3JYC A;  4J7J A;  1ENV A;  2RNB A;  3OEH G;  3CCV V;  3ABU A;  3RN4 A;  3K59 A;  1FFX A;  5KX5 A;  2UUC O;  2QGN A;  2VQE O;  4LH6 A;  1KU9 A;  2X6C A;  1I5X A;  4X64 O;  1U96 A;  2KG7 B;  2ZR2 A;  1KMI Z;  3ABK B;  5LGN A;  2GUZ A;  2ILM A;  1NT2 B;  1TVK B;  2DYS B;  2HVJ C;  2YIB D;  4JGS A;  4BIU A;  5JQG A;  2CDY A;  2KSD A;  1WB8 A;  2GBO A;  3Q4H B;  4FFB A;  4P30 A;  4WFB V;  4CC6 A;  4AHC A;  4DV6 O;  3S3W A;  1S5L Z;  2UXD B;  4J80 A;  3ABM B;  3LDC A;  4JI5 B;  1IVS A;  4OPA A;  1R6T A;  5KHH A;  1WA8 A;  3SJA C;  5FPO A;  1P4R A;  2EIL C;  1K73 W;  4ZIB A;  1XNR B;  1M56 B;  4FIP C;  2WPD G;  5BY1 A;  4PA6 A;  1AJP A;  3ZS8 C;  2H8P C;  3ZMS A;  3A0H Z;  2KG7 A;  4JYA B;  5LMU O;  1F4N A;  4BW9 A;  5EC2 C;  4B3M B;  3E22 B;  2UU9 O;  3ETD A;  5JCO C;  2A7W A;  1NVP D;  3K06 A;  1R73 A;  2HG5 C;  1B6Q A;  4YHH O;  3G71 V;  1GKF A;  1VF5 B;  1FFT B;  1Q90 D;  2GV9 A;  1Q43 A;  1Y74 B;  2ZKO A;  5E1A C;  1JVM A;  3OTF A;  2ZNJ A;  1RM1 B;  2BE3 A;  2UXN A;  4UB6 Z;  4E2L A;  4MTO A;  3FB7 C;  4YJ3 A;  5LYJ B;  1SQV H;  3CRA A;  4PI0 A;  2XUM A;  1BE3 H;  2UXB B;  3EHB B;  2Q6A A;  3ETQ A;  3AK1 A;  1R3L C;  1QVG U;  4TV8 B;  1H8E G;  2VWJ A;  3DC6 A;  5HFM A;  2Y0P A;  3CXH F;  4FZ0 A;  4DR5 O;  5B3S C;  1XHZ A;  3D8C A;  4OX9 O;  4NB5 A;  4DR1 O;  4BW5 A;  4CH4 A;  3OTO B;  2WLN A;  4LFA O;  4MTG A;  1H2G A;  3E22 A;  1K7D A;  3N2G B;  1KKC A;  3HKC B;  1KP3 A;  4JV5 B;  5F2V O;  5J2U B;  4R7C A;  2JS5 A;  3T4D A;  1S5H C;  2YID A;  1URF A;  3SYP A;  3CC2 V;  2Q0O C;  1Y74 A;  5KAI Z;  1IXM A;  4U7O A;  3OGI B;  2KB1 A;  2AGA A;  3HB3 B;  1J5E B;  4G27 B;  5LYJ A;  1PL0 A;  3WG7 B;  4G2K A;  3JCZ A;  4TV8 A;  2YEV B;  3J7A U;  3HKD B;  3T1H B;  4R50 A;  4D7S A;  3CCS V;  4JI7 O;  4FFK A;  3ZHR A;  1GN6 A;  2DOS A;  5LHG A;  1SF9 A;  4DR2 O;  1SQF A;  2WLM A;  4UFZ A;  2UUB B;  5JJE B;  1N0N A;  3GB7 C;  4J9Z B;  3QG5 A;  4GKJ O;  5DEC A;  1MZF A;  3N2G A;  4K0K O;  5IT9 N;  3CYO A;  2EIJ C;  3HKC A;  5BXZ A;  2WSS G;  1B3Q A;  2V4D A;  5J2U A;  4DV0 B;  2OWO A;  3BHP A;  4GKK B;  1YJN V;  1HNZ B;  1QNM A;  1Z2G A;  2E75 B;  2FKX A;  3ZRW B;  1NI8 A;  1NJI W;  4KL1 A;  1N36 O;  1BQZ A;  1HNX O;  2OIE A;  1DLB A;  1NTZ H;  3FKS G;  3CRM A;  5KA6 A;  1JQ0 A;  3W7S A;  2WLJ A;  1F4M A;  4UVA A;  5IY5 C;  4KHP O;  2DQ0 A;  1N34 O;  2ZDI C;  2IW5 A;  2YEV A;  3GVM A;  2PYL A;  3HKD A;  2W6I G;  4FLV A;  3AG7 A;  1VQN V;  2YIA A;  3JAT B;  4JYC A;  4ASU G;  2OT5 A;  2QEX V;  2HR3 A;  2F66 C;  3LSQ A;  4CS2 A;  3CME V;  1YIJ V;  5LL6 Y;  2YIB A;  1GAX A;  3E2E A;  4GLX A;  1LUW A;  3SJQ C;  1N0J A;  3K5L A;  2EIL B;  1B04 A;  2AHY A;  3E89 A;  4NXN O;  3ZRV A;  3OMA B;  3A2F A;  1COW G;  1H2L A;  1OV9 A;  3FB6 C;  5IYB O;  4QE9 A;  3F7Y C;  5KHI A;  4DR6 O;  3ZRW A;  4NTW A;  3LNM B;  1VQO V;  2JIZ G;  2IJH A;  3CE2 A;  4JZ2 A;  1KQS U;  1MZE A;  4JI2 O;  2WLK A;  3F7V C;  4GX0 A;  3W7X A;  3E83 A;  3FB8 C;  2ZD9 A;  4AQY B;  4U3F H;  1P7B A;  3B8N A;  4FLU A;  2LJ2 A;  3T4Z A;  1XRE A;  1AP5 A;  2LW7 A;  4MTF A;  2QM4 A;  1IBK B;  5KUM A;  2P4K A;  1Q7Y W;  2QM7 A;  3QTC A;  3JAT A;  1KD1 W;  4FK5 C;  2QDO A;  1R3K C;  2CTQ A;  5K1X A;  2PUS A;  5IWA O;  4U7N A;  3ZN1 A;  3S3X A;  4DV1 B;  1Q86 W;  4LF8 O;  2P5O A;  2NNU A;  3RYI A;  4X65 B;  2FYU H;  1SET A;  2DQ3 A;  5B3S B;  1XMO B;  1M57 C;  4LBE C;  4JZG A;  1H2N A;  5H5N A;  5EYP B;  1NS1 A;  4I9Q A;  4RUF A;  2Q4P A;  2YXL A;  2OTJ V;  1LNQ A;  2W6J G;  2PGG A;  5JCO A;  4IGG A;  4X1Y B;  3WB0 A;  3ASN C;  4WFG A;  1RSO B;  2Q5Z A;  3IC9 A;  3T1Y O;  1DTO A;  1PV0 A;  3UT5 A;  3H1L H;  5JJJ B;  3TK1 A;  2XOK G;  1BGY H;  5EK0 A;  1KB9 F;  4DR4 O;  1L0N H;  1IDS A;  3J81 N;  4LF9 B;  2HHH B;  1Q6H A;  5B1N A;  2B5U A;  3BCC H;  5GW7 A;  1PD3 A;  2F43 G;  4DUZ O;  4UCR A;  2M7W A;  5C8Y B;  1ZSP A;  1NR7 A;  1CXZ B;  4B7K A;  4ICG A;  4NTX A;  4JAA A;  2RDC A;  1EFR G;  3CRC A;  3EXA A;  3FFQ A;  3IFX A;  2D3O W;  2BOC C;  3ZMV A;  3FYI B;  4JF3 A;  5IJ0 B;  1MOF A;  5EYP A;  2JJ1 G;  2O57 A;  1IBM B;  2P22 C;  2EIJ B;  3RBZ A;  5HFL A;  4X1Y A;  3DGE A;  1I94 B;  3GWK C;  2N05 A;  4WFA V;  5H9C A;  3TJT A;  3JSN A;  3ZCC A;  3THO A;  5LHI A;  5L3C A;  5EIB C;  5LA6 B;  4YY3 O;  2UXC B;  4GUN A;  3SJB C;  4F6E A;  4F4L A;  1KYO F;  2L6L A;  4IHJ B;  5FL7 G;  2CAZ C;  1TA8 A;  2GSM B;  4NVP A;  4RAI A;  2F4V B;  4MVQ A;  5IY5 B;  5LMN O;  5CA1 B;  4HAM A;  1F7Y A;  1VQK V;  4UVB A;  1Z5V A;  2DE0 X;  3CWB H;  4B3S O;  4I9W A;  1KC8 W;  4GZR B;  2YXY A;  5EIB D;  1N8R W;  4JI0 O;  2PYJ A;  4O2A B;  3G4S V;  4LNU B;  4MSW C;  4FZ1 A;  4YIP A;  1N4C A;  5IJ0 A;  4JI3 O;  2CGO A;  4O4L B;  4TQF A;  2RCV A;  4CH6 A;  3KKY A;  3O65 A;  4E4E A;  4WBN A;  2HJF C;  4B3T O;  1WNS A;  3E86 A;  2JDI G;  4UCS A;  3U11 A;  5LA6 A;  1NQT A;  2QTS A;  3ZHQ A;  2Q9L A;  1SQB H;  1V54 C;  2YDE A;  3ABL C;  4IHJ A;  3WU2 Z;  3N2K B;  2Q8V A;  4YIO A;  4FLZ A;  5JJN B;  4J11 A;  4QGP A;  4X64 B;  1IZ3 A;  5CA3 A;  3D3I A;  5CA1 A;  3QVN A;  1XMQ O;  1WAZ A;  2ZDI A;  2B1I A;  3LUT B;  4PDV A;  1PNL A;  1W0K G;  1KEC A;  3TCU A;  1AJN A;  1X4T A;  1JPX A;  2VRZ A;  2UUA O;  3BA8 A;  1US6 A;  3FD9 A;  5LHH A;  3SPJ A;  3QO7 A;  4JI1 O;  5J2T A;  4O2A A;  2Q7H A;  4B7E A;  4X66 O;  2YI8 A;  2IU3 A;  4LNU A;  2ATK C;  2LFS A;  2EBO A;  2X6B A;  3OAA G;  4JI4 B;  1GO3 F;  3STZ C;  3SYA A;  3DC5 A;  1YF2 A;  1CPY A;  2JVD A;  2ZQM A;  4GYC B;  2Y4T A;  5CN0 A;  4I5S A;  2ZIM A;  2ZR3 A;  3SJC C;  2LW1 A;  5CA0 A;  1FJG O;  5JQG B;  5FNV B;  4CH5 A;  2WA4 A;  2LGQ A;  3KCX A;  3N2K A;  4PJ0 Z;  5L3B A;  1RFY A;  2VQF B;  4PDR A;  2G38 A;  4PA9 A;  3UKM A;  3ASN B;  3E8F A;  5LMU B;  5KHG A;  3B2E E;  3JD2 A;  1VAR A;  1RPR A;  2PZS A;  4CC5 A;  4MVS A;  3E35 A;  4EEQ A;  5E79 Z;  4ZI7 B;  2UU9 B;  4QPK A;  3DXR B;  4NXM O;  3IAY A;  2ZE8 A;  3KZI Z;  3W7T A;  1GTO A;  1IX9 A;  3AG1 C;  3SR2 C;  1N33 O;  5IE9 A;  4JTC B;  4DV5 O;  2RJZ A;  3ZMU A;  4CS4 A;  4XDJ A;  4JI6 O;  2Y69 B;  3B4S A;  3FB5 C;  3HR0 A;  1K92 A;  1OHH G;  4PV1 B;  1D5N A;  2PI5 A;  4DV3 O;  3CX5 F;  3K5N A;  3OE7 G;  5FNV A;  2OIG A;  1K4D C;  1PP9 H;  1BHB A;  4UXN A;  3A0B Z;  1SS3 A;  4MS2 A;  4XDL A;  4LF6 O;  4LR3 A;  3L74 H;  3DSQ A;  4DR5 B;  2JS3 A;  2A9H A;  4OX9 B;  1ZL8 B;  5IYD O;  4OPH A;  2EIN C;  2W0X A;  4DR1 B;  1J95 A;  1XBL A;  2EZP A;  5BR8 O;  4DV4 O;  4ZI7 A;  4IT5 A;  4YJ3 B;  3DXR A;  5JH7 B;  2ADP A;  5L3G A;  4LF7 B;  5FPR A;  2N74 A;  1LR1 A;  1OCO C;  3RYC B;  3K79 A;  4TV9 B;  4N21 A;  1EN4 A;  4X62 O;  5BMV B;  5EBW C;  4H0L B;  3QF7 A;  4R8C A;  1K4C C;  3OGC C;  2FML A;  1BL8 A;  2OTL V;  2HP8 A;  3X2Q C;  1QLE C;  3TXQ A;  2CTP A;  4DV2 O;  3D36 C;  3K57 A;  1WP8 A;  2EZO A;  4PA3 A;  5FLX N;  4JI7 B;  1SKV A;  4FPP A;  1VEW A;  2ADQ B;  1GN4 A;  3CCL V;  3WB1 A;  4ZOL B;  4CZZ A;  5TIS Z;  1ZL8 A;  4L8J A;  1QR9 A;  2K1E A;  1XDC A;  4GKJ B;  5DM6 V;  3B09 A;  3KCY A;  1K8A W;  1DF4 A;  1V54 B;  3ABL B;  1V9P A;  3JD3 A;  5JH7 A;  2EJ7 A;  2QKC A;  2QM8 A;  3IJ4 A;  3RYC A;  2QTO A;  4TV9 A;  1X59 A;  3ZX6 A;  5BMV A;  4K8Z A;  4DYL A;  1P84 F;  1HNX B;  3P30 A;  4LC1 A;  1FYJ A;  2ZM6 O;  3CRR A;  4FJC C;  2RMK B;  2DN9 A;  3W7W A;  5JWP A;  1GN3 A;  1S5J A;  1F23 A;  4KHP B;  4W4L A;  1DGS A;  2ARH A;  1OJH A;  3LNN A;  3OM3 B;  2LO1 A;  1QQC A;  4R6Z A;  3B8M A;  2EJR A;  1EN5 A;  2QKS A;  3BA9 A;  3OUF A;  4FVM A;  1P49 A;  5B1A B;  4JI5 O;  3RWR D;  3CEI A;  3CCU V;  5DED A;  4ZOL A;  2FTK A;  1VQL V;  3K9A A;  1G1X B;  1EBO A;  1SA0 B;  1FD9 A;  2XHB A;  5LP6 C;  3ETG A;  1XNR O;  4DV7 O;  3N27 A;  2YI9 A;  4JYA O;  3RVY A;  3OUS A;  2LFR A;  1CEZ A;  1HR0 O;  3FYE B;  4J42 A;  2Q67 A;  5A9G A;  1S72 V;  1FPO A;  4KP4 A;  4J7K A;  3R66 A;  3E8B A;  3LDE A;  1KP2 A;  4LFC O;  1A32 A;  3JAM N;  4P9O A;  2Q7E A;  3BFR A;  1UFI A;  3AG1 B;  5EC1 C;  1G8M A;  2Q68 A;  1TUB B;  2QKA A;  1YZB A;  3P32 A;  3L75 H;  3BAB A;  2IJJ A;  3JAW B;  4LF4 O;  3STL C;  2RN9 A;  4BWA A;  5IWA B;  3B77 A;  2Y4U A;  1SA0 A;  4AIL C;  1VQ6 V;  1Q5O A;  2E5L B;  2UXB O;  3APQ A;  3T1C A;  4BR6 A;  4O4J A;  4LF8 B;  1THZ A;  4PA4 A;  4O2B B;  1WLE A;  1E1R G;  2XT9 A;  1BS3 A;  1QHT A;  3A0R A;  2OCC C;  1NKD A;  2MK3 A;  2EIN B;  3U0Z A;  3OW2 U;  3F5W C;  3OR6 C;  1IBL O;  3CCM V;  4I0X B;  1XEQ A;  2ZIN A;  4Z1M G;  1Q6U A;  4DW1 A;  1GN2 A;  5D5P A;  5CB4 B;  2AHZ A;  1OCO B;  2FB5 A;  1TUB A;  2ZE5 A;  3RYI B;  4TWK A;  4F6R A;  2XAQ A;  3CD6 V;  3BEH A;  4UCU A;  4MTX A;  4ZKI A;  2PF4 E;  1OCR C;  1PNM A;  3JAW A;  2EX3 A;  3ASO C;  4JAV A;  2P4V A;  2ZE7 A;  1V55 C;  1QLE B;  1J5E O;  2CGN A;  4GX5 A;  1YJ9 V;  1FXK C;  4GX1 A;  3CRQ A;  1FXV A;  3T1H O;  1MAB G;  1K5Q A;  4HZ3 A;  3UT5 B;  1YIT V;  4O2B A;  5KLV H;  1WN7 A;  3CMA V;  1G4Y B;  1PL4 A;  2Q0A A;  1JJ2 U;  1KUQ A;  1QR8 A;  4B3R B;  4I0X A;  4WFF A;  4KFM A;  4KXR A;  5ITZ B;  1BZK A;  5CB4 A;  3AG4 C;  5D5Q A;  4MW3 A;  1I08 A;  4DV0 O;  1OCZ C;  4GKK O;  2GTA A;  1XQ8 A;  1K97 A;  1ZTE A;  1HW7 A;  3AG2 C;  5LBQ A;  2R9I A;  4I55 B;  2ZE6 A;  1K9M W;  2A0L A;  4IYI A;  1VQ7 V;  3LDD A;  3BY6 A;  1L8D A;  3ZRS A;  2YC0 A;  5LMN B;  1U97 A;  4YJ2 B;  3D36 A;  1H2S B;  1K5S A;  2BTQ B;  1GM8 A;  2QWP B;  5C93 A;  1VF6 C;  2X0L A;  4B3S B;  4FLW A;  4EFB A;  4EB6 B;  3CS5 A;  3CP1 A;  1Y76 A;  3JD4 A;  4JI3 B;  3MAQ A;  1JX9 A;  1S3J A;  2A79 B;  5ITZ A;  4GCZ A;  4D7T A;  1XHX A;  1M90 W;  1OZ0 A;  5EBL C;  5LP6 B;  1GRJ A;  1ZUQ A;  3CHX A;  3JAK A;  3ICX A;  1ROP A;  1HNW O;  3U10 A;  1VQ8 V;  1G6U A;  5LOV A;  4P2Z A;  4I55 A;  2BOB C;  2IH3 C;  3VQW A;  4I50 A;  1M1K W;  1VQP V;  4X89 A;  3H1K H;  4H13 B;  3ZHS A;  3ZMT A;  2W0F C;  1DK1 A;  1AJQ A;  4YJ2 A;  2NR5 A;  1PKX A;  1XMQ B;  4PDM A;  3JSL A;  1BSM A;  2BTQ A;  4WBN B;  1WJZ A;  3CC4 V;  4J9Y B;  1FXH A;  2N04 A;  5LGT A;  2EIM C;  2QWR B;  3L71 H;  4ZHQ B;  4EB6 A;  4I4T A;  4FLT A;  3UM7 A;  1AB3 A;  4DK1 A;  2F23 A;  1JFF B;  1ZLZ A;  5LP6 A;  3ABM C;  4QNH B;  2QR4 A;  4N23 A;  3O9O A;  4DR7 B;  3RYF B;  2Q69 A;  2WLI B;  4Z2W A;  1JA8 A;  4J41 A;  4K35 A;  1Q8I A;  4DR3 O;  2OCC B;  3OMN B;  1XMO O;  5K1P A;  5J2T B;  3E8H A;  1BQ0 A;  2HEP A;  1D5A A;  3ZHV A;  3PJS K;  1NZ6 A;  5H6Q A;  1TAE A;  1XNQ B;  4JI8 B;  2AZ0 A;  1AVM A;  3SGI A;  3H1H H;  1FKA O;  2E3C A;  4QPJ A;  3UQ8 A;  1L1F A;  3C90 A;  2XAH A;  1OCR B;  4ZHQ A;  5CA0 B;  2DMX A;  3RYH B;  1R6N A;  4LF9 O;  4FLX A;  3HKB B;  1VQ4 V;  1V55 B;  2ZIO A;  4OGQ B;  1N33 B;  2UUC B;  2VQE B;  4C7U A;  1R1B A;  4DV5 B;  2KKW A;  1JFF A;  2ITD C;  4DRX B;  4AI8 A;  3CC7 V;  4J7Z A;  1NBM G;  1RM1 C;  3H01 A;  3ZRX A;  3RYF A;  1K3E A;  2WLI A;  4DV3 B;  4DO2 A;  4QIW F;  4QE7 A;  1OCC C;  2LP7 A;  1QBZ A;  2XAJ A;  3CPW U;  1MA1 A;  1VIB A;  1VF7 A;  1PM9 A;  1IBM O;  1TGO A;  1YI2 V;  2CE4 A;  4LF6 B;  4DV6 B;  5GTH Z;  3AG4 B;  1I94 O;  2QWN B;  1OCZ B;  3CJH B;  4ZBM A;  3AG2 B;  1WPB A;  3K5O A;  3H1I H;  3L70 H;  3RW0 A;  5BR8 B;  4DV4 B;  5AG2 A;  3VQY A;  4MVO A;  1M57 B;  1XL4 A;  2HLD G;  3RYH A;  3HKB A;  3E8G A;  3KG2 A;  2F4V O;  4X62 B;  2XAG A;  1FXK A;  3F5T A;  1Q81 W;  4DRX A;  2YUA A;  1MNG A;  1M93 A;  2E74 B;  1XUQ A;  3ETE A;  1BMF G;  1VQ5 V;  1HDJ A;  4BIZ A;  3D3Q A;  3ZJZ A;  1ZAU A;  2R70 A;  4I7Z B;  3ZMZ A;  1SZT A;  3IC7 A;  2HKO A;  3K03 A;  2AXT Z;  4JAS A;  4YHH B;  2ZNI A;  2M6Y A;  5CMU A;  2P6J A;  4DK0 A;  2F1M A;  5LXT B;  3LSU A;  1ORQ C;  4X1K B;  3CJH A;  4YXW G;  1N32 O;  1NH2 B;  3P3P A;  1NR1 A;  5B66 Z;  3HKE A;  5EZY A;  3A8T A;  2Z0A A;  1EZJ A;  1E79 G;  3J80 N;  4PI2 A;  4MVM A;  4LFB O;  1AI7 A;  1YDX A;  1FAF A;  4K3A A;  2ZM6 B;  4K8X A;  1SZX A;  1VF6 A;  1PPJ H;  2CTW A;  1HP8 A;  1YTF B;  2EIM B;  4LFA B;  3PN1 A;  5L3D A;  3SPI A;  1SES A;  1GM9 A;  2CH7 B;  5GON B;  4IYH A;  3RFR A;  1GK9 A;  1MSW D;  4NR1 A;  5EBM C;  4JI4 O;  5A2Q N;  5KHJ A;  3JAL B;  2H94 A;  1ZWI C;  1O9H A;  5LXT A;  3QO8 A;  4X88 A;  4X1K A;  2DYR C;  3GWO A;  3P3N A;  2UXX A;  4NTY A;  3AK2 A;  2R72 A;  2Y0I A;  1D2D A;  1NU1 H;  4JTD B;  2D2C B;  2WWW A;  4DW0 A;  1E1Q G;  3ZBH A;  3CCR V;  4DV7 B;  2VQF O;  2IJI A;  4XDK A;  2CUG A;  1VQM V;  5J9P C;  2ETN A;  4PHZ A;  4LF5 O;  1HR0 B;  5L3F A;  4DUY O;  4DR2 B;  3TGU H;  1TVK A;  4UCV A;  4BIO A;  2DWD C;  1O9G A;  2YSU B;  1AI4 A;  4LFC B;  3W7U A;  2CH7 A;  4K0K B;  5GON A;  3Q4H A;  1R6K A;  1AR4 A;  4X20 B;  4UV8 A;  4UV9 A;  4L87 A;  4JAU A;  5GTI Z;  3JAL A;  4Q20 A;  4ABM A;  2AW9 A;  4LF4 B;  1N36 B;  2A06 H;  3K0G A;  3CCE V;  3QNE A;  4NKG B;  1ARO P;  3IGA C;  4JYB A;  1OCC B;  3MHS C;  1Q3E A;  5KHK A;  2BTO A;  1MMM A;  3AG3 C;  4IL6 Z;  1N34 B;  2Z3Y A;  2KQX A;  5KA5 A;  4UVC A;  2JEX A;  3SYO A;  2UXD O;  4G28 B;  1JMK C;  5IJ9 B;  1CP9 A;  1FS0 G;  3OT7 A;  2PTM A;  4IIJ B;  2XAS A;  1IBL B;  3VOU A;  1Y66 A;  4MVU A;  1SER A;  4A5U B;  5CBH A;  3SPH A;  4CBC A;  4JYY A;  4LF7 O;  1S76 D;  3WFV A;  4X20 A;  3ZN0 A;  5L3E A;  1W2B U;  4NXN B;  2VS0 A;  3EFF K;  4FM1 A;  4O4J B;  1SRY A;  3L9D A;  4UCO A;  2LGW A;  3K3W A;  3ZHT A;  4DR6 B;  2Q7G A;  4MW8 A;  5H2F Z;  4JI2 B;  1GH6 A;  1VQ9 V;  1JOY A;  2DWE C;  2IH1 C;  4LCU C;  4B3M O;  2WLH A;  3CCQ V;  3H1J H;  1VP7 A;  2B1G A;  1AI6 A;  3C3S A;  2LQT A;  3ZIA G;  3OFN G;  5JVD B;  1NTM H;  2BCC H;  4F6R B;  5IJ9 A;  3TET A;  4WFH A;  4IIJ A;  4MVR A;  1AIL A;  1EN6 A;  2MW2 B;  4WFE A;  5B5E Z;  4PEL A;  2HJD A;  3K58 A;  3M7M X;  1I7F A;  2WA3 A;  1P7G A;  4FM2 A;  1AI5 A;  2A3Q A;  4TOI A;  1TUE B;  4EKW A;  5BZB A;  4JPR A;  2FL4 A;  3OTO O;  1RPO A;  4P9P A;  1AP6 A;  2XND G;  4KUM A;  5CBF A;  3UO3 A;  1RP3 B;  1YJW V;  2ODM A;  4JV5 O;  3OMI B;  4RWU A;  1H8H G;  3I56 V;  1XL6 A;  3T1Y B;  3OEE G;  1H38 A;  5JVD A;  4GT1 A;  3MHH C;  1M5I A;  2JGD B;  2C2A A;  2DYR B;  1R3J C;  1F51 A;  4HBN A;  4DR4 B;  1JJO A;  1I0H A;  1SQP H;  2ZCE A;  2OYQ A;  1YHQ V;  1NVP B;  3X2Q B;  1B06 A;  4FM0 A;  4BAY A;  3MD0 A;  2WAM A;  3K0D A;  1GM7 A;  4DUZ B;  3AK3 A;  2IM9 A;  3G6B A;  1QVF U;  2JEU A;  1QU7 A;  1HNW B;  4JTA B;  2QE7 G;  4TT3 G;  2R9A A;  1ZX3 A;  1Y76 B;  2UUB O;  3JD1 A;  3ZED A;  2JGU A;  3K08 A;  3CSX A;  3RT3 C;  2RQ6 A;  2HFE C;  5LGU A;  1SQQ H;  4XBF A;  1Q82 W;  2YIC A;  4QJF B;  1DF5 A;  3OR7 C;  4X1I B;  3JAK B;  1HNZ O;  3I5D A;  2JRI A;  4PD4 F;  5LOV B;  5B1B C;  2XTA A;  4Q6G A;  4RO2 A;  4YY3 B;  4UUJ C;  3RGB A;  4I50 B;  1IUR A;  2JGD A;  1R3I C;  3JAR B;  3L72 H;  1T5E A;  5KMG B;  1SQG A;  2F93 B;  3B40 A;  3RVZ A;  3H9V A;  3I55 V;  2E5L O;  3SYQ A;  2NLJ C;  1VMG A;  3AG3 B;  3AEI A;  4O4I B;  5CBG A;  1LUV A;  4EFE A;  3VBB A;  4HYO A;  4DR3 B;  2EIK C;  4U3J B;  4JI0 B;  1YCI A;  1EZV H;  2QWO B;  1M9N A;  3K9S A;  4I4T B;  5IYZ B;  4MT8 A;  1BHA A;  2BSK B;  4TSF G;  3FX7 A;  3SDL A;  2ZXW C;  4LP8 A;  3TXS A;  4MVZ A;  3UO2 A;  4FLY A;  2VWK A;  4B3T B;  4X1I A;  2YS8 A;  1HWY A;  2GTS A;  2YXH A;  4LWS B;  1KBH A;  1Z5W A;  3CCJ V;  4RQE A;  3JAR A;  2IU0 A;  1WPX A;  2Q73 A;  1AR1 B;  2R9R B;  5KMG A;  2GHY A;  4CS3 A;  3BRC A;  4D6T H;  4AQY O;  1Y4M A;  2GDS A;  1GMG A;  1SC5 B;  4O4I A;  1NTK H;  2Y69 C;  3ABK C;  3APO A;  3DTU B;  3WB2 A;  2P90 A;  4WCE V;  1UJW B;  3QO5 A;  1WP7 A;  2H3O A;  2DYS C;  1IBK O;  1IXB A;  2JJ2 G;  2QA4 V;  2UUA B;  1K33 A;  2K9P A;  3K5M A;  1NH2 D;  1I5Y A;  3VQX A;  4U3J A;  4JI1 B;  2DW4 A;  3JCU Z;  2P67 A;  3OD4 A;  4X66 B;  4B3R O;  4TUY B;  3VQV A;  1XOU A;  3UCS C;  1Y6X A;  5IYZ A;  2L35 A; 
#chains in the Genus database with same CATH homology
 3FB6 C;  5IYB O;  4OXS A;  4QE9 A;  3F7Y C;  3ZRW A;  3ZMZ A;  4FJC C;  3LNM B;  1VQO V;  2JIZ G;  1SZT A;  2IJH A;  3IC7 A;  3W7W A;  1KQS U;  3M99 B;  2HKO A;  1F23 A;  3K03 A;  2WLK A;  4JAS A;  3F7V C;  4GX0 A;  3W7X A;  3R65 A;  3E83 A;  5CMU A;  2P6J A;  3CXC U;  1ORQ C;  3FB8 C;  1KKD A;  3OM3 B;  4GX2 A;  2ZD9 A;  1YTF D;  4R6Z A;  1W0J G;  3B8M A;  4YXW G;  1P7B A;  2EJR A;  1NH2 B;  3B8N A;  2QKS A;  1NR1 A;  3OUF A;  3T4Z A;  5B1A B;  3CCU V;  2Z5U A;  1M56 C;  4MTF A;  2FTK A;  1EZJ A;  1E79 G;  1VQL V;  1MG1 A;  1S77 D;  3K9A A;  1EBO A;  5KUM A;  2Y48 A;  3JD0 A;  1Q7Y W;  2QM7 A;  1KD1 W;  4FK5 C;  4MVM A;  1R3K C;  3ML0 A;  4WF9 V;  1S0V A;  1AI7 A;  3ETG A;  4U7N A;  2P7T C;  5IDJ A;  3ZN1 A;  3HPL C;  2PI4 A;  1K34 A;  3ASO B;  1YTF B;  2EIM B;  4PDL A;  1Q86 W;  1JCH A;  5L3D A;  3RVY A;  3OUS A;  2LFR A;  3SPI A;  3T2M A;  1CEZ A;  1SES A;  1GM9 A;  3SPG A;  3FYE B;  3LSS A;  2Q67 A;  1FXK B;  2NNU A;  1S72 V;  2IJK A;  1GK9 A;  3NXS A;  5EBM C;  1SET A;  2DQ3 A;  5B3S B;  1MSW D;  4KP4 A;  1M57 C;  4LBE C;  3E8B A;  3LDE A;  1KP2 A;  5KUK A;  4P9O A;  2H94 A;  1ZWI C;  3G6E V;  3AG1 B;  3QO8 A;  4X88 A;  5EC1 C;  5H6R A;  4X8A A;  1G8M A;  2Q68 A;  4H33 A;  4RUF A;  2OTJ V;  2DYR C;  1LNQ A;  2W6J G;  3GWO A;  2JK5 C;  3K04 A;  5DN6 G;  2UXX A;  3P32 A;  3ASN C;  2IJJ A;  4WFG A;  2CK3 G;  1DTO A;  3SYC A;  3STL C;  2WLL B;  4JTD B;  3TK1 A;  3B77 A;  2WWW A;  2XOK G;  4H37 A;  1E1Q G;  4FMT A;  3CCR V;  5EK0 A;  2ITC C;  1VQ6 V;  2IJI A;  4XDK A;  3SPC A;  5IYC O;  1VQM V;  5J9P C;  4DXW A;  5B1B B;  3T1C A;  2HVK C;  5B1N A;  2B5U A;  5L3F A;  5GW7 A;  1THZ A;  4PA4 A;  1PD3 A;  1WLE A;  1E1R G;  2F43 G;  1PNK A;  4RQF A;  2DWD C;  2M7W A;  3A0R A;  2OCC C;  1NKD A;  2MK3 A;  1NR7 A;  2EIN B;  2YSU B;  3OW2 U;  3F5W C;  3OR6 C;  1AI4 A;  3W7U A;  3CCM V;  1R6K A;  5B1A C;  1EFR G;  4UV8 A;  4Z1M G;  3IFX A;  4UV9 A;  2V7Q G;  2D3O W;  2BOC C;  4L87 A;  5B1O A;  4JAU A;  3ZMV A;  3FYI B;  4JF3 A;  2AHZ A;  4Q20 A;  1MOF A;  1OCO B;  2EIK B;  4PA7 A;  3ABT A;  1YSC A;  2JJ1 G;  3K0G A;  3CCE V;  3QNE A;  2EIJ B;  3RBZ A;  1ARO P;  5HFL A;  3IGA C;  4RUE A;  3DGE A;  2XAQ A;  4TWK A;  3WG7 C;  3CD6 V;  4JYB A;  3BEH A;  4ZKI A;  4MTX A;  1QCE A;  1OCC B;  1OCR C;  1PNM A;  4WFA V;  5H9C A;  3ZCC A;  3MHS C;  1QLN A;  5LHI A;  3ASO C;  2WLL A;  4JAV A;  2ZXW B;  5L3C A;  1V55 C;  3AG3 C;  1QLE B;  2X7R B;  2Z3Y A;  4GX5 A;  2X6A A;  2XAF A;  4F4L A;  5KA5 A;  1YJ9 V;  1FXK C;  4UVC A;  4GX1 A;  2JEX A;  5FL7 G;  3SYO A;  2V1D A;  4G28 B;  1FXV A;  3JYC A;  1CP9 A;  1FS0 G;  2GSM B;  4RAI A;  1ENV A;  1MAB G;  3OEH G;  1K5Q A;  3CCV V;  3ABU A;  4HZ3 A;  4MVQ A;  5IY5 B;  2XAS A;  1YIT V;  4HAM A;  1VQK V;  3VOU A;  1Y66 A;  4UVB A;  4MVU A;  3CMA V;  1SER A;  1G4Y B;  5CBH A;  3SPH A;  1JJ2 U;  2X6C A;  1I5X A;  4CBC A;  1QR8 A;  4I9W A;  1S76 D;  1KC8 W;  2ZR2 A;  3WFV A;  5L3E A;  3ZN0 A;  4WFF A;  4KFM A;  1W2B U;  1N8R W;  3ABK B;  3EFF K;  5LGN A;  1SRY A;  3G4S V;  2DYS B;  2HVJ C;  3K3W A;  3AG4 C;  4MSW C;  4MW3 A;  1OCZ C;  4JGS A;  4BIU A;  4MW8 A;  1K97 A;  3AG2 C;  5LBQ A;  1VQ9 V;  2R9I A;  1JOY A;  2DWE C;  2IH1 C;  4LCU C;  4P30 A;  4WFB V;  1K9M W;  2WLH A;  2A0L A;  2HJF C;  3CCQ V;  3ZJZ A;  1VQ7 V;  3E86 A;  3LDD A;  3BY6 A;  2JDI G;  3ZRS A;  2B1G A;  1NQT A;  3ABM B;  1AI6 A;  3LDC A;  1V54 C;  3ZIA G;  3ABL C;  3OFN G;  3D36 A;  3TET A;  1K5S A;  1GM8 A;  4WFH A;  5C93 A;  2X0L A;  4MVR A;  5CA3 A;  3D3I A;  1P4R A;  2EIL C;  1K73 W;  2ZDI A;  2B1I A;  4WFE A;  3LUT B;  4PDV A;  4PEL A;  1PNL A;  1W0K G;  1M56 B;  4FIP C;  2WPD G;  1KEC A;  3CP1 A;  1AJP A;  4PA6 A;  2H8P C;  3TCU A;  3ZMS A;  3JD4 A;  1AJN A;  1JPX A;  5LHH A;  1JX9 A;  1S3J A;  3SPJ A;  2A79 B;  3QO7 A;  4GCZ A;  1M90 W;  1OZ0 A;  1F4N A;  2IU3 A;  5EBL C;  1AI5 A;  2ATK C;  5EC2 C;  1TUE B;  2LFS A;  2EBO A;  2X6B A;  3OAA G;  1GO3 F;  4EKW A;  5BZB A;  3ETD A;  4JPR A;  3STZ C;  3SYA A;  1NVP D;  1ROP A;  1CPY A;  1VQ8 V;  4P2Z A;  1RPO A;  2ZQM A;  3K06 A;  2BOB C;  4P9P A;  1R73 A;  5CN0 A;  2HG5 C;  1B6Q A;  2IH3 C;  2XND G;  4KUM A;  5CBF A;  1M1K W;  1VQP V;  4I5S A;  1YJW V;  3G71 V;  1GKF A;  4X89 A;  1FFT B;  3OMI B;  2ZR3 A;  3ZMT A;  2W0F C;  1H8H G;  5E1A C;  3I56 V;  1JVM A;  1XL6 A;  1RM1 B;  2UXN A;  1AJQ A;  1PKX A;  3OEE G;  4E2L A;  4MTO A;  4PDM A;  1H38 A;  3FB7 C;  5L3B A;  4GT1 A;  3MHH C;  2C2A A;  2DYR B;  1R3J C;  1F51 A;  4J9Y B;  4PDR A;  3CC4 V;  1FXH A;  3EHB B;  2Q6A A;  4PA9 A;  5LGT A;  3UKM A;  1R3L C;  3ASN B;  1QVG U;  3E8F A;  2EIM C;  1YHQ V;  1NVP B;  3X2Q B;  3JD2 A;  4BAY A;  3MD0 A;  1H8E G;  1RPR A;  2WAM A;  3K0D A;  1GM7 A;  4MVS A;  5HFM A;  3E35 A;  1QVF U;  5B3S C;  3UM7 A;  2JEU A;  4QPK A;  4JTA B;  4BW5 A;  2QE7 G;  2WLN A;  4MTG A;  3W7T A;  3ABM C;  1GTO A;  1H2G A;  3AG1 C;  4QNH B;  4TT3 G;  1K7D A;  4N23 A;  4JTC B;  1KP3 A;  2Q69 A;  2WLI B;  3ZMU A;  3JD1 A;  4XDJ A;  2OCC B;  3OMN B;  3K08 A;  2Y69 B;  4R7C A;  3FB5 C;  3T4D A;  2HFE C;  1S5H C;  5LGU A;  1K92 A;  3E8H A;  1OHH G;  4XBF A;  1Q82 W;  3SYP A;  3CC2 V;  2PI5 A;  4QJF B;  1DF5 A;  3PJS K;  3OR7 C;  5H6Q A;  3OE7 G;  1IXM A;  1K4D C;  4U7O A;  1BHB A;  2KB1 A;  5B1B C;  3HB3 B;  4UXN A;  4RO2 A;  4G27 B;  4UUJ C;  4MS2 A;  4XDL A;  1R3I C;  1PL0 A;  4QPJ A;  1L1F A;  3WG7 B;  4G2K A;  3JCZ A;  2A9H A;  2XAH A;  2YEV B;  3RVZ A;  1OCR B;  3I55 V;  4R50 A;  5IYD O;  2EIN C;  3SYQ A;  3CCS V;  2NLJ C;  1J95 A;  1R6N A;  1VQ4 V;  1V55 B;  3AG3 B;  3AEI A;  5LHG A;  2EZP A;  5CBG A;  2WLM A;  3VBB A;  4HYO A;  5L3G A;  3GB7 C;  2ITD C;  4J9Z B;  3CC7 V;  1OCO C;  1NBM G;  2EIK C;  1RM1 C;  3K79 A;  4N21 A;  3H01 A;  5EBW C;  1M9N A;  3CYO A;  2EIJ C;  3ZRX A;  2WSS G;  1K3E A;  2WLI A;  4DO2 A;  4QIW F;  4QE7 A;  1OCC C;  1K4C C;  2LP7 A;  4R8C A;  1QBZ A;  4MT8 A;  2XAJ A;  1YJN V;  3OGC C;  1BHA A;  3CPW U;  4TSF G;  3ZRW B;  1NJI W;  2ZXW C;  4LP8 A;  1BL8 A;  2OTL V;  3X2Q C;  1QLE C;  4MVZ A;  1YI2 V;  1DLB A;  3AG4 B;  3FKS G;  1OCZ B;  1HWY A;  5KA6 A;  1JQ0 A;  2EZO A;  4ZBM A;  4PA3 A;  3W7S A;  3AG2 B;  4FPP A;  2WLJ A;  1F4M A;  4UVA A;  5IY5 C;  3CCJ V;  2DQ0 A;  4RQE A;  2IU0 A;  1WPX A;  2ZDI C;  3RW0 A;  1AR1 B;  3CCL V;  2R9R B;  2GHY A;  4MVO A;  2IW5 A;  2YEV A;  4CZZ A;  2W6I G;  1M57 B;  1Y4M A;  1XL4 A;  2HLD G;  1GMG A;  1QR9 A;  2K1E A;  3E8G A;  1VQN V;  5DM6 V;  2Y69 C;  3KG2 A;  3ABK C;  4JYC A;  1K8A W;  3DTU B;  4ASU G;  2OT5 A;  2P90 A;  1DF4 A;  1V54 B;  2HR3 A;  4WCE V;  2XAG A;  1UJW B;  2QEX V;  3ABL B;  1FXK A;  3JD3 A;  3QO5 A;  2DYS C;  3LSQ A;  3CME V;  1YIJ V;  1Q81 W;  2JJ2 G;  2QA4 V;  1K33 A;  1NH2 D;  2QM8 A;  1I5Y A;  3E2E A;  2QTO A;  3ETE A;  2DW4 A;  3SJQ C;  1BMF G;  2P67 A;  1VQ5 V;  2EIL B;  4BIZ A;  2AHY A;  3E89 A;  3ZRV A;  3OMA B;  3P30 A;  4LC1 A;  1COW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...