4RO2A

Crystal structure of cng mimicking nak-etpp mutant cocrystallized with methylammonium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels.
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transport protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4ro2A00
3E89A 5EBMC 3ASOC 3R65A 2Q68A 2A79B 3ABMC 3LDEA 3UM7A 3FB5C 4MVMA 1R3JC 4X89A 5KUKA 2EIMC 5EC1C 1ORQC 3E8BA 5IY5C 1OCRC 3LNMB 3LDCA 4QE7A 3SPHA 4P9PA 3RW0A 3STLC 4MW8A 2Q69A 4P30A 3ZJZA 2JK5C 2BOBC 3E8FA 2ZXWC 4MTFA 3OR6C 4H33A 2X6BA 4MS2A 3RVZA 3OGCC 5BZBA 1R3LC 3EFFK 1QLEC 2BOCC 3K08A 4JTDB 3SPIA 2H8PC 1OCCC 2EINC 3E8HA 3LUTB 4GX1A 1BL8A 3F7VC 4MTGA 4PDVA 3HPLC 3SYCA 4KFMA 4BW5A 2DWEC 3AG3C 4MVUA 4DXWA 4LP8A 2W0FC 5J9PC 2WLHA 2NLJC 2ZD9A 2Q6AA 3K04A 1OCOC 3OUFA 4RO2A 3FB6C 3FB7C 5EBLC 4PA9A 1ZWIC 4XDKA 3F7YC 3X2QC 3JYCA 4GX5A 5EC2C 2AHYA 2K1EA 3SJQC 3OUSA 4PDRA 4HYOA 1KKDA 1OCZC 4GX2A 2X6AA 2WLLA 3PJSK 1XL4A 1V54C 4J9YB 4JTAB 4X8AA 2WLKA 3IFXA 2DWDC 2ITDC 5EK0A 2Q67A 2IH3C 2OCCC 2DYRC 3E86A 4PDMA 3BEHA 4MVSA 3SPJA 1R3KC 3KG2A 4G28B 1M57C 4H37A 4R50A 3GB7C 1J95A 3WG7C 3SYOA 2ITCC 4JTCB 3OR7C 2WLJA 4P9OA 4F4LA 4PA4A 2HVJC 2EILC 5EBWC 5CBGA 2R9RB 3RBZA 2P7TC 4MSWC 3TCUA 3SYQA 3RVYA 1XL6A 2HFEC 5KUMA 5E1AC 3K06A 4RUFA 3STZC 3E83A 4WFFA 3ZRSA 4MVRA 1M56C 3LDDA 4XDJA 5B1AC 4LBEC 4MW3A 4QE9A 5CBFA 3F5WC 1P7BA 1V55C 3TETA 3T4ZA 2WLNA 4QNHB 2QKSA 3VOUA 3SYAA 2WLIB 3K03A 4HZ3A 2EIKC 3SPCA 3AG1C 3AG2C 4MVQA 4R7CA 3IGAC 4OXSA 4UUJC 4WFEA 2YEVA 3K0GA 4PA7A 4ZBMA 3T4DA 1G4YB 4CBCA 1K4CC 4MVOA 4R8CA 3ABLC 4G27B 4RAIA 2DYSC 1JVMA 4GX0A 4PA3A 3ABKC 2ATKC 4P2ZA 4PA6A 2HG5C 3AG4C 3UKMA 5CBHA 3ASNC 4X88A 4XDLA 4I9WA 4LCUC 5B3SC 2IH1C 2WLLB 4R6ZA 2WLMA 2KB1A 2X6CA 3SPGA 4MVZA 2HJFC 3E8GA 4RUEA 3SYPA 2Y69C 2HVKC 2WLIA 2A9HA 4TWKA 4WFGA 5B1BC 2AHZA 2A0LA 3T1CA 1LNQA 4PDLA 1R3IC 1S5HC 2QTOA 1K4DC 2EIJC 3K0DA 3FB8C 4J9ZB 4WFHA 4EKWA 4MTOA 3T2MA
chains in the Genus database with same CATH superfamily
5IWAB 3ASOC 3OT7A 3ABMC 4TV8A 1H2MA 3ABLB 1F23A 1AP6A 5F2VO 2HHHB 2UUBO 2ZXWC 2UXXA 3E22B 3IJ4A 1VEWA 5LGTA 2L6LA 2EZPA 2EINC 4KFMA 1O9HA 1Q43A 1F7YA 4GT1A 3ZRVA 4Z1VA 1L8DA 2LFSA 2QSAA 3T1HO 3RYCA 4JAVA 1CP9A 1I94O 1SA0B 3QG5A 1GMGA 5LYJA 3IFXA 4RWUA 1JJOA 1H2GA 1K92A 4YXWG 1IBMB 4DRXB 3AG7A 3BCCH 1L0NH 5EIBD 1KP3A 1KBHA 1WN7A 4Z2WA 1WJZA 3I55V 3J7AU 4NXMB 2A7WA 2Q8VA 2ZDIA 2DW4A 1H2SB 1HNXB 1Q5OA 3HB3B 4MW3A 4PELA 1P7BA 1XEQA 1FXHA 3ZHQA 3TETA 5LMNB 3JASA 2QA4V 2HEPA 4X1KB 2WSSG 1JPXA 1Q90D 3CCEV 3JD0A 4DR7O 1AJNA 1YEWA 1HDJA 2EJ7A 1YJNV 4X88A 3FX7A 2IH1C 2LFRA 3M8AA 4Q6GA 5CA1A 3ZMZA 3E8GA 2BTQA 1IURA 3JD1A 3QO7A 4I50B 1LUVA 1NKDA 4MTOA 4FJCC 3ZCCA 1FXVA 2Z3YA 1JFFA 3CP1A 4NVPA 4X1YB 1FXKC 4FM0A 1KU9A 3LDCA 2BSKB 4P30A 2WA4A 3JALB 3OGIB 4K3AA 4RQEA 4NTWA 3A0BZ 4LFBO 2O57A 2ZD9A 5A9GA 3J80N 3G80A 5IJ9A 3OUFA 3SJAC 3CMAV 1RSOB 4JI3O 1N4CA 3OTFA 1SQBH 4TUYA 1I5XA 1QQCA 2AZ2A 2GUZB 5CB4B 4X8AA 2IBZH 1MMMA 5EK0A 2QJ1A 4J7ZA 4LF6B 4LWSB 3SPJA 5C93A 2ZNJA 1N0NA 2ITCC 2BE3A 4UCRA 4BIZA 3CMEV 2ZR3A 4LF5O 1YJWV 2ZNIA 4BAYA 4FLWA 2QM7A 1Q8IA 1OHHG 1SZTA 3K59A 5HFLA 1NJIW 4YJ3B 1PNKA 1S76D 2OWOA 1GN4A 1VF6C 4LF7B 3A0RA 1ZX3A 4K8XA 1K4CC 3T1YO 3H01A 2RQ6A 4WFBV 4UCSA 4DYLA 3HKDA 2H3OA 5B3SC 2WLMA 2E5LB 4KXRA 5GONB 3ZMVA 1LNQA 1Y76B 4O2AB 4PDLA 4DV1B 4J9ZB 1G8MA 3L70H 3UT5A 5IYBO 5EYPB 2JGDB 2WAMA 3ML0A 4JI8O 3RYIA 2FKXA 2UXCO 3K9AA 3LDEA 3UM7A 2QWNB 2DMXA 5LHHA 4FIPC 3Q4HB 1AI7A 1AI5A 4P9PA 5IJ0A 5C8YA 1M90W 1XNRB 4DR4B 3RVZA 1G6UA 1MZFA 4X20A 5JVDB 1WP7A 4X1IB 2ADPA 2JRIA 1HNWB 1ZWIC 1FYJA 4FZ0A 1YZBA 5JJJB 4HNAB 2JVDA 1VQKV 3JAMN 4IT5A 1AJQA 1MSDA 1KKDA 3U0ZA 2WLLA 4JYAO 3AG4B 1TUBA 3K5NA 1Y6XA 1FFTB 4MVSA 5LMUO 4I7ZB 4OX9B 3E2EA 4DV0O 3ETQA 3MDSA 3CCLV 3JD2A 4PHZA 4EB6A 3K06A 4WBNA 4UCOA 3N2KA 3FD9A 5A2QN 4NB5A 2VQFB 3CE2A 3JAKB 2YS8A 3T4ZA 2QKSA 2WLIB 2QWQB 2DYRB 2KSDA 4JI7O 4X62O 3JCUZ 3SPCA 4IL6Z 4FLZA 2F4VO 2PTMA 2CDYA 3HKEB 1L1FA 2W6JG 1Y67A 1GH6A 4CBCA 3E35A 4H44B 1PD3A 1F51A 2QKAA 1RM1B 1EN4A 1JX9A 1NVPD 1NI8A 4TV9B 2YICA 1QVFU 2YDEA 5LA6A 2QWOB 1K5SA 2QR4A 3SYPA 2Y69C 1UPGA 1K7DA 3APOA 1VQOV 5KAFZ 1NTMH 2DN9A 1YI2V 2B1GA 3CC7V 2MK3A 3AG1B 3MHSC 3ZRXA 1VQPV 4K0KO 1WNSA 1QU7A 5LOVB 2PZSA 1PNMA 5LP6B 4QE7A 3RW0A 2XTAA 3ABKB 1B3QA 1FJGB 5AG2A 1QCEA 2JK5C 2PI4A 1SQXH 1DF4A 4MTFA 4MS2A 2P06A 5KA5A 2BTOA 1BL8A 3AG3C 5B5EZ 2OIGA 3F5TA 1DTOA 1Q6UA 1D5AA 1WA8B 1Q6HA 3C3TA 4ASUG 2P22C 1SQQH 2F66C 4O4JB 1S77D 4BWAA 2RJZA 4E2LA 1XL4A 1V54C 4NR1A 5B1NA 4DV5O 1GN6A 1J95A 2ZE5A 3OR7C 1BHBA 1HP8A 2EILC 4F6EA 2D2CB 2QGNA 4KL1A 5CA0B 3C90A 4WFAV 1OJHA 1BMFG 1GAXA 1FPOA 3ZEDA 4CS3A 3F5WC 4X65B 3CC2V 2PGGA 1ZLZA 4CH6A 4DR5B 2ZE6A 1U96A 5FLXN 1N32O 2KQXA 5FNVB 1B6QA 3ZN0A 1R6TA 4B3MB 4G27B 1YCIA 1W0JG 1BS3A 4PA3A 4GZRB 4DW1A 3ASNC 4X62B 3FYEB 2N74A 1FXKA 4LCUC 2KB1A 5BMVA 2X6CA 4DV3O 3O65A 1H2LA 1ZL8A 5CN0A 1XNQO 1KECA 4I55A 4JI5O 4GYCB 2VRZA 5EBMC 5KAIZ 4J11A 4O4LA 4GLXA 2NNUA 3I56V 3SPHA 4I4TB 4JI0B 4JI1O 4F6RB 5IWAO 1UFIA 2W6IG 4ZOLB 3CYOA 1RFYA 1GM8A 5IE9A 3F7VC 4TQFA 4LF4B 1D5NA 2E75B 3W7SA 2F1MA 4IIJB 2EIJB 2HHHO 3FB6C 5L3BA 4G2KA 5KX5B 3P32A 4ABMA 3QF7A 4PDRA 4QIWF 4CH4A 3FAVB 3CCVV 5H6QA 3AEIA 1OCRB 4GUNA 4O4HB 1Q6IA 1ZAUA 4DR1B 3RYFA 1VF7A 3CC4V 1VIBA 1VF6A 4HAMA 2WLJA 1MNGA 4EEQA 2R9RB 5HFMA 2CGOA 3B2EE 2YEVB 1JQ0A 5J2UA 3MD0A 3JD4A 2JJ2G 4JYBA 3K3WA 2UU9B 5FL7G 2Z0AA 2HP8A 1RPOA 2YIBA 5B1AC 3D8CA 4ZI7A 4DR3B 2XAFA 1VQ9V 1XDCA 1NTZH 3VOUA 2D3OW 3JARB 1Q7YW 3BY6A 4NXMO 4YJ2A 2A3QA 3KCXA 1B06A 1HNXO 3HR0A 1YHQV 2ATKC 3AG4C 5LMNO 4JZGA 3QO8A 3THOA 5LGUA 1VQLV 3BA9A 1YSCA 5IDJA 5LBQA 1I5YA 3OEHG 1SQVH 2A9HA 4WFGA 2GBOA 2R72A 3TGUH 1XOUA 3B8NA 1SERA 4UVAA 5EZYB 2YXHA 3B40A 4UCTA 3CS5A 3WB0A 4KP4A 1MSWD 3DXRA 1XNQB 1NR1A 4O4IA 1MABG 1XREA 1DK1A 4H33A 2X6BA 2IJHA 5J2TB 1XQ8A 3SPIA 2UUAB 4D7SA 3HKCB 3HPLC 1SS3A 2Q0OC 3CRAA 3HKBB 5H5NA 5ITZA 1NQTA 1PM9A 2ZIMA 2Y0PA 1SZXA 4J42A 4U7NA 2VWKA 1W0KG 3ZHVA 2OCCC 1AVMA 4DR2O 1S72V 2CE4A 1BQZA 1AB3A 1VMGA 4UXNA 4GCZA 1YTFD 3ABUA 5LP6C 2AGAA 5JH7B 1SETA 3JD3A 4OPHA 4LF6O 1AI6A 3VQWA 5H9CA 1AI4A 1BT8A 4FLUA 4XDJA 1WB8A 1OCZB 3TK1A 1KUQA 1K8AW 4UV9A 1XI1A 3RYHA 4PA7A 1YTFB 2HG5C 1K9MW 4YHHB 2YUAA 4LF7O 3ETDA 4JI4B 4R6ZA 3P3PA 2HJFC 3VQXA 2RN9A 5KLVH 1YDXA 3T1CA 1H2KA 3CD6V 2F95B 4EKWA 5KHKA 2Q68A 5D5PA 3B8MA 1QVGU 2E5LO 1JOYA 2M6YA 5KMGB 2FMLA 2JS3A 3ETEA 3PN1A 1R6NA 4PI2A 4DV1O 2VQEO 4U7OA 1X59A 3S3WA 1QLEC 4JI2B 2Q0AA 3LUTB 4NKGB 3OD4A 4LP8A 1M5IA 2WLHA 1BSMA 2Y4UA 5LXTB 3P3NA 1XNRO 2R9IA 2GSMB 4X1YA 3JYCA 1CXZB 4DR4O 1BQ0A 2GV9A 1GRJA 3OUSA 4LH7A 3FFQA 1S5JA 4JF3A 1P49A 2EIMB 5IY5B 1VP7A 4QJFB 1AILA 1J5EB 1Y74A 5CA1B 2ITDC 1K3EA 1EBOA 2Q73A 2BTQB 2XNDG 5K1XA 1HNWO 1PL4A 1U97A 3AK1A 3WU2Z 1IBLB 2HVJC 1RSOA 3CCMV 2P7TC 4MSWC 2XASA 4DR2B 1JFFB 4LNUA 3X2QB 1VQ8V 2GUZA 3LSQA 5E1AC 1H8EG 4LC1A 4OX9O 2XAJA 1M56C 2OYQA 2QM8A 1XUQA 2EULA 2JDIG 2XT9A 1FFXA 2H94A 3L9DA 4HZ3A 4FMTA 4GKKB 3CSXA 4WFEA 3K0GA 5B1OA 5IJ9B 3RT3C 1CPYA 2VQFO 5GW7A 1EZJA 3RGBA 2P5OA 2C2AA 1K73W 2IJIA 4TUYB 4MT8A 4JAAA 4RUEA 4FLTA 5FPRA 3QTCA 1V55B 1S5HC 1SQFA 2P6JA 4ZIBA 2YIDA 4X9QA 2E76B 3J81N 2RCVA 1KQSU 1LR1A 2L35A 1YITV 3RN4A 4B3RB 3B4SA 4JPRA 4LF8B 4FM2A 3ZX6A 3RWRD 4TT3G 2QKCA 1OCCC 2WA3A 2IJKA 3CRCA 2JGDA 2VQEB 1OCOC 3AK2A 4RO2A 1SESA 4PV1B 1FJGO 2UXBB 2DQ0A 2P67A 1VQNV 3HKDB 1GN3A 4J9YB 1X4TA 3IC9A 1ZUQA 4B3SB 2B9ZA 1SQGA 1NTKH 5JVDA 5CMUA 4PDMA 4R50A 4H37A 1PL0A 5EBWC 3SR2C 3UT5B 3NXSA 4O2BB 2F93B 2ZQMA 4FZ1A 3RYIB 4UVCA 2KG7B 3RVYA 1XL6A 4NYKA 4BIOA 4WFFA 3CPWU 4FFBA 4X20B 2MW2B 4Q20A 2ZT9B 2XAGA 5L3GA 2XAHA 3WG7B 1TVKA 4JYCA 3H1KH 3ABLC 1JVMA 2P90A 2HJDA 4P2ZA 5CBHA 4X65O 2PI5A 1D2DA 2WLLB 1IBKB 3WFVA 4DR5O 2QWPB 1TUBB 1HW7A 1F4NA 4TOIA 2WLIA 1YVWA 3GWOA 4I0XB 4B3MO 4DR6B 1K4DC 4FVMA 4UFZA 3T2MA 1K97A 2EIKB 1XHXA 2Q7GA 4WBNB 2Q69A 1Z5VA 4J10A 1CEZA 1PV0A 4U3JB 5BZBA 2BOCC 3E8HA 4PDVA 4DUZB 5H6RA 4DXWA 2Y4TA 3NR7A 2NR5A 5B1BB 4L87A 2XOKG 2N05A 3N27A 3FKSG 1BGYH 4JI0O 1NR7A 4PA9A 3I5DA 1N33B 3KCYA 4GX5A 2ZIOA 5JQGA 3ASOB 3ZHSA 5LP6A 1FS0G 3ABMB 2F23A 1R73A 2ARHA 3TXQA 5KHJA 1NVPB 1F4MA 3W7UA 4LF4O 5H2FZ 5KHIA 5LA6B 2ZXWB 2LW1A 1QR8A 2PY5A 2PYJA 1VQ6V 1WA8A 3UO3A 2EINB 1Y4MA 4LF9B 5EIBC 2DE0X 3N2GB 2HKOA 5K1PA 2V4DA 2DOSA 4DR1O 1E79G 3ABTA 3E83A 2YI8A 4UVBA 2W0XA 3ZIAG 3EXAA 1LUWA 2JJ1G 1ROPA 2LW7A 4MVQA 1Z2GA 3IGAC 5LGNA 2UU9O 4FPPA 1KP2A 4MVOA 2E3CA 5TISZ 4EFBA 4DR3O 2VS0A 3UKMA 2NN4A 4KUMA 1S3JA 4IYHA 3K57A 4MVZA 2A0LA 1GK9A 1R3IC 3KKYA 2AW9A 2Y0IA 1ZSPA 4JI6O 3K5LA 2A79B 3FB5C 3JAWA 2GTSA 1Z5WA 4NTYA 2GDSA 1W2BU 4J7KA 3VQVA 1Q82W 1ORQC 1JJ2U 3BRCA 1BE3H 3STLC 1M9NA 4GKJB 2EZOA 2F43G 2EJRA 4IGGA 2UUCB 1AR1B 4ZHQB 3ZRWB 4MTGA 2HLDG 3SYCA 4DV7B 3WB1A 4EFEA 2NLJC 3BFRA 3JATB 4HBNA 4DK1A 4YY3B 2FL4A 2AHYA 5IYZA 3CCRV 1VQMV 1COWG 2UUAO 2R9AA 3R66A 2B5UA 2Y48A 3PJSK 1FXKB 1FD9A 4UB8Z 5BMVB 1NH2D 1W59A 1WPBA 3CXHF 4H0LB 1K5QA 1N0JA 2WWWA 1ZL8B 4I55B 5KX5A 2LJ2A 2YSUB 5IYDO 2IW5A 3CWBH 3D3QA 1YF2A 4JYYA 3FAVA 3WB2A 2EX3A 1E1QG 4O4LB 4CH3A 3CXCU 1YJ9V 3CCQV 1GTOA 3OTOB 1NH2B 3K79A 3BVOA 3OMAB 3RFRA 3OMNB 2A06H 4CS2A 4IHJA 4WF9V 1SC5B 1BHAA 2YEVA 4ZBMA 1IXMA 3CCUV 5DM6V 4KHPB 2AXTZ 2QTSA 1WB7A 2YIBD 4PD4F 2M7WA 4B3TB 2AHZA 4W4KA 1AR5A 3QNEA 3CX5F 4YHHO 4NTXA 2ZKOA 3K5MA 2ZE8A 4JI4O 4MVMA 5KUKA 2ZINA 3BA8A 5J2UB 5EC1C 2V1DA 3EVKA 3LNMB 4OGQB 4JI6B 2LO1A 2BOBC 1BZKA 4ZI7B 5B3SB 2UXDB 3D36C 4FLXA 3BABA 2V7QG 4C7UA 5EZYA 3W7WA 2XHBA 1FAFA 4YJ2B 1IX9A 1JR9A 5L3DA 1WLEA 5DECA 1A32A 5EC2C 4HYOA 2CH7B 1IDSA 1I7FA 4JI2O 1XILA 1KMIZ 4N23A 1TA8A 2DYRC 4L8JA 1JCHA 1GKFA 2HR3A 1HR0B 3L72H 1DGSA 5JCOC 3DC5A 1RM1C 2P4KA 1J5EO 1IXBA 4ICGA 4K35A 3CJHB 3DXRB 3TCUA 1KYOF 4ZKIA 4O4IB 1XBLA 2BCCH 4MVRA 3ZRSA 3E22A 5CBFA 1IBLO 3ZHRA 4B7KA 5DN6G 2YXLA 4DV6B 1XMQB 4DV4B 3AG1C 5ITZB 4CC5A 5JH7A 4AQYB 4RAIA 3TXSA 4TV8B 3ABKC 1EFRG 2CAZC 4XDLA 1SA0A 4GKKO 2HVKC 1NU1H 4DRXA 2QTOA 3SGIA 3FB8C 3M7MX 2LQTA 4LFCB 4B7EA 5GTIZ 5IYCO 4J41A 1G1XB 1BCCH 3S3XA 3RYCB 4DUYB 4E4EA 4MW8A 1AJPA 1MZEA 3E8FA 3OR6C 4Z1MG 3OGCC 2ZM6B 5LYJB 3K08A 4X1KA 4GX1A 2Y69B 4B3RO 3LNNA 5J9PC 3K04A 4LF8O 5JJEB 3DSQA 5BR8B 1JA8A 1QR9A 3FB7C 2JS5A 1ZTEA 2FB5A 3RYHB 3AG2B 2Q9LA 4X66B 5KMGA 2GHYA 1L0LH 3BAAA 4X64B 2DYSB 3G6EV 2WLKA 2DWDC 2Q67A 3G6BA 1N34B 1E1RG 2PF4E 3KG2A 4G28B 2UXBO 4I50A 3JASB 2IU3A 3VBBA 5L3CA 4JTCB 5LHGA 5LXTA 3IC7A 4LFAB 3QVNA 3AG3B 2DQ3A 4B3SO 2OCHA 1KB9F 1GN2A 4RUFA 2BSKA 4U3FH 4I5SA 3JALA 2LGQA 1V54B 3IAYA 4QNHB 1N36B 3SYAA 2YXYA 4R7CA 4OXSA 4JV5B 2YIAA 2EILB 4QPKA 2FTKA 3MAQA 1URFA 5CB4A 2XUMA 3G71V 4J80A 2N04A 1Y74B 4LWSA 4I9QA 2ODMA 2CTPA 4DO2A 2EIJC 2CGNA 2UUBB 4YIOA 3OMIB 3E89A 3ZS8C 1M4UA 1IBKO 3E8BA 1OCRC 1Q3EA 4LNUB 3T1HB 4DR6O 3ASNB 4YJ3A 1EN6A 1I94B 4JAUA 1XMOO 5LL6Y 1FFXB 1KD1W 2OTLV 4AILC 3GWKC 1GO3F 2K9PA 4D6TH 1GM9A 2B1IA 5EBLC 5KA6A 2GTAA 1EM1A 3SJQC 4UB6Z 4NXNO 5JJNB 4DUZO 4JASA 5GONA 3FYIB 2KKWA 1VARA 2IH3C 1Y76A 4O2AA 3U11A 1R3KC 1N33O 1PP9H 2Z5UA 3SYOA 2CUGA 1S5LZ 5EYPA 2RNBA 4PA4A 5KHHA 1MG1A 3Q4HA 1K34A 2RMKB 1OZ0A 2PYLA 2UXNA 1T5EA 1XHZA 3UO2A 4DR7B 4FM1A 3MHHC 1N8RW 4CH5A 1MA1A 3C3SA 4UV8A 3JCZA 1GM7A 4X1IA 4O2BA 2CTRA 4UUJC 3AK3A 4BR6A 2KG7A 1AROP 4HNAA 4GX0A 1TUEB 3CRRA 5IJ0B 5C8YB 1NBMG 2ETNA 2PUSA 5B1AB 4PJ0Z 4CZZA 3D36A 3G4SV 1ENVA 1M57B 3APQA 1IZ3A 4LFBB 1YXBA 3JSNA 1NT2B 1O9GA 3P30A 1QHTA 3KZIZ 1KC8W 2QM4A 4J7JA 4JI3B 3ZJZA 1QLNA 3JAKA 3QO5A 4I0XA 1SQPH 3EFFK 4LR3A 4CS4A 4FFBB 4DV2O 1US6A 2DWEC 2W0FC 4B08A 3M99B 3HKEA 2QEXV 4GKJO 4AHCA 5JCOA 1TVKB 3SJBC 1HNZO 4XDKA 4EB6B 1XMOB 1VF5B 2K1EA 2UUCO 4TV9A 1OCZC 4JGSA 2X6AA 3JSLA 3L73H 4U3JA 5L3EA 1OV9A 4DV7O 2IU0A 3N2KB 4JZ2A 4LF5B 5CA3A 4NXNB 4YY3O 4OPAA 3GB7C 3VQYA 3L74H 4QPJA 4WCEV 4F4LA 2YC0A 1S0VA 5LOVA 4UCVA 3LSUA 2QWRB 3STZC 4RQFA 1M1KW 1EZVH 2Q7HA 3T1YB 3DC6A 3LDDA 2CK3G 1NZ6A 2OT5A 4BIUA 2OCCB 1WP8A 3AG2C 3N2GA 1MOFA 3EHBB 3T4DA 1G4YB 4BW9A 1P84F 1AR4A 2OIEA 4R8CA 3ZBHA 2DYSC 2ZDIC 4O4JA 2ZE7A 5JQGB 3OTOO 1RP3B 4JI8B 2UXCB 2RDCA 1H2NA 5D5QA 3H9VA 1PNLA 3SDLA 1UJWB 2DJVA 4TWKA 4KHPO 1WPXA 3H1JH 2LGWA 4AI8A 5LHIA 2VWJA 3UQ8A 3SJCC 2LP7A 2CTQA 2IJJA 3R65A 3CHXA 3OM3B 3OW2U 5CA0A 1R3JC 4X89A 2WPDG 3G67A 2EIMC 3BPZA 1AP5A 5IY5C 3CEIA 4B3TO 3TJTA 2X7RB 4TSFG 4DK0A 5DEDA 1I08A 4BW5A 2AZ0A 4JYAB 3DTUB 2XAQA 5FNVA 1R1BA 1QBZA 2JIZG 5LMUB 3X2QC 3F7YC 1PKXA 4DV2B 4XBFA 4DV0B 1VQ7V 3K5OA 2UXDO 2ADQB 4JTAB 3CCSV 3GVMA 1FKAO 3B09A 1HNZB 4ZHQA 1VQ5V 3ZRWA 3E86A 3BEHA 1QLEB 1QNMA 2EBOA 3JATA 5GTHZ 5CBGA 1Q86W 1KKCA 1JMKC 1TGOA 3JAWB 3SYQA 4JI7B 2JEXA 2HFEC 4I4TA 3ZMSA 2F4VB 1HR0O 1DLBA 3ETGA 3ZHUA 4F6RA 1K33A 4LBEC 4QE9A 1V55C 1B04A 4ZOLA 2IM9A 4IYIA 3W7TA 1P7GA 1R6KA 4IIJA 1H8HG 3OE7G 3A2FA 4FK5C 1Q81W 3ZN1A 5BXZA 2P4VA 4PA6A 3BHPA 3OEEG 5IYZB 1V9PA 2R70A 2Q5ZA 4DV6O 4O4HA 1XMQO 4DV4O 4K0KB 4LF9O 1M56B 3OAAG 4AQYO 3L75H 4K8ZA 1WAZA 3K0DA 3ZMTA 4LH6A 2JGUA 2ZCEA 4WFHA 3U10A 1YIJV 1IVSA 2QDOA 2G38A 4LFCO 4PI0A 4FFKA 1R3LC 4QGPA 3B77A 1P4RA 3JARA 4JTDB 2H8PC 1I0HA 1THZA 3LSSA 4TQDA 4D7TA 3RYFB 1Y66A 4DUYO 4MVUA 4IHJB 3H1HH 1HWYA 2Q6AA 2X0LA 3D3IA 2CTWA 4CC6A 5B66Z 3CB2A 4DV5B 3CRQA 3ZHTA 4N21A 2YI9A 3UCSC 2ZM6O 1H38A 3W7XA 1IBMO 3L71H 4GX2A 4UCUA 1SF9A 3A0HZ 1SKVA 5L3FA 2ZR2A 2Q7EA 5BR8O 5E79Z 1RPRA 1M57C 4X66O 3WG7C 3H1LH 1OCCB 4P9OA 3ZMUA 3K9SA 4X64O 5IT9N 3RBZA 1OCOB 2E74B 4FLYA 2CH7A 4H13B 1N34O 3O9OA 3OFNG 3CCJV 2FYUH 5KUMA 1N32B 1PPJH 5JWPA 2JEUA 2OTJV 5J2TA 4LFAO 1TAEA 3ICXA 2WLNA 4A5UB 3HKCA 3HKBA 3H1IH 3K03A 1VQ4V 2EIKC 5BY1A 4DV3B 3CRMA 3A8TA 2Q4PA 3CJHA 5KHGA 3DGEA 1SRYA 4JI5B 4YIPA 5FPOA 1N36O 1DF5A 4I9WA 4FLVA 2QE7G 3SPGA 4DW0A 4JV5O 1NS1A 5B1BC 1EN5A 4W4LA 4MTXA 1M93A 4JI1B 2ILMA 3K58A
chains in the Genus database with same CATH topology
3E89A 1K97A 2EIKB 5EBMC 3ASOC 3ABMC 3E8BA 2NNUA 1OCRC 3ABLB 1F23A 3I56V 3SPHA 2Q69A 3ASNB 1CEZA 2ZXWC 2UXXA 5BZBA 2W6IG 2BOCC 3CYOA 4JAUA 5LGTA 3E8HA 2EZPA 1GM8A 2EINC 4PDVA 1KD1W 3F7VC 2OTLV 4KFMA 5H6RA 4DXWA 5B1BB 4L87A 2XOKG 4GT1A 3ZRVA 1GO3F 3W7SA 2LFSA 1GM9A 2B1IA 2EIJB 3FKSG 3FB6C 5EBLC 5KA6A 5L3BA 1NR7A 4G2KA 4PA9A 3P32A 4JAVA 4GX5A 3ASOB 1CP9A 3SJQC 1FS0G 3ABMB 4PDRA 1R73A 4QIWF 3CCVV 5H6QA 1NVPB 1F4MA 3W7UA 3AEIA 1GMGA 1OCRB 4JASA 3FYIB 3IFXA 2IH3C 1H2GA 1K92A 4YXWG 2ZXWB 1R3KC 3CC4V 1QR8A 2Z5UA 4HAMA 3SYOA 1VQ6V 2EINB 1Y4MA 2WLJA 4PA4A 2R9RB 1KP3A 2HKOA 5HFMA 2YEVB 1JQ0A 1MG1A 3I55V 1K34A 3MD0A 1OZ0A 3JD4A 1E79G 2JJ2G 2ZDIA 4JYBA 3K3WA 5FL7G 2DW4A 2UXNA 3ABTA 3E83A 1RPOA 5B1AC 3HB3B 1VQ9V 2XAFA 4MW3A 4PELA 3MHHC 1P7BA 1N8RW 1FXHA 4UVBA 3TETA 2QA4V 3VOUA 3ZIAG 2D3OW 1Q7YW 2WSSG 2JJ1G 3BY6A 1ROPA 1JPXA 4UV8A 3JCZA 1GM7A 4MVQA 3CCEV 3IGAC 4UUJC 5LGNA 3JD0A 4FPPA 1KP2A 1AJNA 4MVOA 1AROP 1YHQV 4GX0A 2ATKC 3UKMA 3AG4C 1YJNV 1TUEB 4X88A 4KUMA 1S3JA 2IH1C 3QO8A 2LFRA 5LGUA 1VQLV 3ZMZA 4MVZA 1NBMG 1YSCA 3E8GA 5IDJA 1I5YA 5LBQA 3OEHG 2A9HA 4WFGA 5B1AB 4CZZA 2A0LA 3JD1A 1GK9A 3QO7A 3D36A 1R3IC 3B8NA 3G4SV 1SERA 4UVAA 1ENVA 1NKDA 4MTOA 1M57B 4FJCC 3ZCCA 4KP4A 2A79B 1MSWD 3FB5C 1FXVA 2Z3YA 3CP1A 1W2BU 1NR1A 1Q82W 1ORQC 3P30A 1JJ2U 1FXKC 3LDCA 3STLC 1M9NA 1KC8W 1MABG 4P30A 3ZJZA 1QLNA 2EZOA 2F43G 4H33A 3QO5A 2X6BA 2EJRA 3EFFK 2IJHA 4RQEA 1AR1B 3SPIA 3ZRWB 4MTGA 2HLDG 3SYCA 3HPLC 2DWEC 2W0FC 2NLJC 3M99B 1NQTA 2ZD9A 3OUFA 2QEXV 3CMAV 4XDKA 2AHYA 2K1EA 3CCRV 1VQMV 1COWG 4U7NA 1I5XA 1OCZC 2B5UA 2X6AA 2Y48A 3PJSK 4JGSA 1FXKB 4X8AA 5L3EA 2IU0A 1NH2D 1W0KG 5EK0A 2OCCC 5CA3A 1K5QA 2WWWA 3SPJA 5C93A 1S72V 3GB7C 4QPJA 4WCEV 2ITCC 4UXNA 4GCZA 4F4LA 1YTFD 3ABUA 4BIZA 1S0VA 2YSUB 3CMEV 5IYDO 2IW5A 1SETA 3JD3A 2ZR3A 1YJWV 1AI6A 1E1QG 4BAYA 1M1KW 2QM7A 5H9CA 1AI4A 3STZC 4RQFA 3CXCU 1OHHG 3LDDA 1SZTA 4XDJA 1YJ9V 5HFLA 1NJIW 1OCZB 3CCQV 1GTOA 1PNKA 1S76D 2CK3G 1NH2B 3K79A 2OT5A 3OMAB 3TK1A 3OMNB 4BIUA 2OCCB 1K8AW 3A0RA 4WF9V 4UV9A 3AG2C 1MOFA 1BHAA 2YEVA 3EHBB 4PA7A 1IXMA 4ZBMA 3T4DA 1YTFB 1G4YB 1K4CC 4R8CA 5DM6V 3CCUV 3H01A 2DYSC 2ZDIC 4WFBV 2HG5C 1K9MW 3ETDA 5B3SC 4R6ZA 2WLMA 2HJFC 1PNLA 1UJWB 2M7WA 4TWKA 3ZMVA 2AHZA 3T1CA 1LNQA 4PDLA 3CD6V 1WPXA 3QNEA 5LHIA 4J9ZB 1G8MA 4EKWA 5IYBO 2LP7A 2WAMA 2IJJA 3ML0A 3R65A 3K9AA 2Q68A 3LDEA 3UM7A 3OM3B 3OW2U 3B8MA 4MVMA 1R3JC 4X89A 5KUKA 5LHHA 1QVGU 4FIPC 2WPDG 1JOYA 2EIMC 1AI7A 2V1DA 1AI5A 5EC1C 5IY5C 3LNMB 3ETEA 4P9PA 1R6NA 2X7RB 4TSFG 1M90W 4U7OA 2BOBC 3RVZA 5B3SB 1QLEC 2V7QG 3LUTB 4BW5A 3W7WA 4LP8A 2WLHA 3DTUB 2XAQA 1QBZA 2JIZG 5L3DA 1WLEA 1ZWIC 2GSMB 2R9IA 3F7YC 3JYCA 3X2QC 1PKXA 4XBFA 1VQ7V 5EC2C 1VQKV 3OUSA 4HYOA 1AJQA 4JF3A 1KKDA 2EIMB 2WLLA 5IY5B 4JTAB 3CCSV 4QJFB 3AG4B 4N23A 2ITDC 1K3EA 1EBOA 2XNDG 2DYRC 3ZRWA 3E86A 1VQ5V 1JCHA 1FFTB 3BEHA 2HR3A 4MVSA 3E2EA 1QLEB 2EBOA 2HVJC 5CBGA 3CCLV 3JD2A 1Q86W 1RM1C 3CCMV 2P7TC 4MSWC 2XASA 3TCUA 3SYQA 2JEXA 3X2QB 2HFEC 1VQ8V 3ZMSA 5E1AC 3LSQA 4ZKIA 3K06A 1H8EG 1DLBA 3ETGA 4LC1A 2XAJA 3ZRSA 4MVRA 1M56C 1K33A 2QM8A 4LBEC 4QE9A 5CBFA 1V55C 5DN6G 3T4ZA 2JDIG 2QKSA 3W7TA 2WLIB 2H94A 2DYRB 4HZ3A 1R6KA 4FMTA 3SPCA 3AG1C 1H8HG 4WFEA 1L1FA 2W6JG 3K0GA 3OE7G 5B1OA 4CBCA 4FK5C 1CPYA 3E35A 1Q81W 4RAIA 3ZN1A 5GW7A 1PD3A 1EZJA 1F51A 3ABKC 1EFRG 4PA6A 1RM1B 1JX9A 1NVPD 3OEEG 2C2AA 4XDLA 1K73W 2IJIA 4MT8A 1QVFU 1K5SA 4RUEA 3SYPA 2Y69C 1M56B 2HVKC 3OAAG 1V55B 1K7DA 1S5HC 2QTOA 1VQOV 3K0DA 3FB8C 3ZMTA 4WFHA 2P6JA 1YI2V 2B1GA 3CC7V 2MK3A 5IYCO 1YIJV 3AG1B 3MHSC 1KQSU 1YITV 3ZRXA 1VQPV 1PNMA 4JPRA 4QE7A 3RW0A 4MW8A 3ABKB 1AJPA 1QCEA 2JK5C 2PI4A 3E8FA 1DF4A 3OR6C 4MTFA 4MS2A 4Z1MG 3OGCC 4TT3G 1R3LC 3B77A 1P4RA 3K08A 5KA5A 4JTDB 2H8PC 1OCCC 1THZA 4GX1A 1BL8A 3LSSA 2Y69B 1Y66A 3AG3C 2IJKA 4MVUA 5J9PC 1DTOA 2X0LA 1HWYA 2Q6AA 1OCOC 3D3IA 3K04A 4RO2A 1QR9A 3FB7C 1SESA 4ASUG 2DQ0A 3AG2B 4N21A 2P67A 2GHYA 1H38A 1S77D 3W7XA 1VQNV 4GX2A 4E2LA 2DYSB 4J9YB 1XL4A 1V54C 3G6EV 2WLKA 5L3FA 2DWDC 2Q67A 5B1NA 2ZR2A 5CMUA 4PDMA 1E1RG 1RPRA 3KG2A 4G28B 1M57C 4H37A 1PL0A 4R50A 1J95A 2IU3A 3VBBA 3WG7C 5L3CA 4JTCB 5LHGA 1OCCB 3IC7A 3OR7C 4P9OA 3ZMUA 1BHBA 5EBWC 2EILC 3AG3B 3NXSA 2ZQMA 3RBZA 1OCOB 2DQ3A 4UVCA 3RVYA 1XL6A 3OFNG 3CCJV 5KUMA 4WFAV 4RUFA 1BMFG 4WFFA 3CPWU 2JEUA 4I5SA 2OTJV 3F5WC 1V54B 2WLNA 4QNHB 3SYAA 3K03A 1VQ4V 3CC2V 2EIKC 4Q20A 4R7CA 2XAGA 4OXSA 5L3GA 2XAHA 3WG7B 4JYCA 3ZN0A 1B6QA 3ABLC 4G27B 2EILB 3DGEA 1JVMA 1W0JG 2P90A 4PA3A 5CBHA 4P2ZA 4QPKA 1SRYA 2FTKA 3ASNC 3FYEB 2PI5A 1DF5A 3G71V 4I9WA 1FXKA 4LCUC 2WLLB 2KB1A 2X6CA 2QE7G 3SPGA 3WFVA 1F4NA 2WLIA 5B1BC 3GWOA 4MTXA 5CN0A 4DO2A 1KECA 1K4DC 2EIJC 1GKFA 3OMIB 3T2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E89 A;  5EBM C;  3ASO C;  3R65 A;  2Q68 A;  2A79 B;  3ABM C;  3LDE A;  3UM7 A;  3FB5 C;  4MVM A;  1R3J C;  4X89 A;  5KUK A;  2EIM C;  5EC1 C;  1ORQ C;  3E8B A;  5IY5 C;  1OCR C;  3LNM B;  3LDC A;  4QE7 A;  3SPH A;  4P9P A;  3RW0 A;  3STL C;  4MW8 A;  2Q69 A;  4P30 A;  3ZJZ A;  2JK5 C;  2BOB C;  3E8F A;  2ZXW C;  4MTF A;  3OR6 C;  4H33 A;  2X6B A;  4MS2 A;  3RVZ A;  3OGC C;  5BZB A;  1R3L C;  3EFF K;  1QLE C;  2BOC C;  3K08 A;  4JTD B;  3SPI A;  2H8P C;  1OCC C;  2EIN C;  3E8H A;  3LUT B;  4GX1 A;  1BL8 A;  3F7V C;  4MTG A;  4PDV A;  3HPL C;  3SYC A;  4KFM A;  4BW5 A;  2DWE C;  3AG3 C;  4MVU A;  4DXW A;  4LP8 A;  2W0F C;  5J9P C;  2WLH A;  2NLJ C;  2ZD9 A;  2Q6A A;  3K04 A;  1OCO C;  3OUF A;  4RO2 A;  3FB6 C;  3FB7 C;  5EBL C;  4PA9 A;  1ZWI C;  4XDK A;  3F7Y C;  3X2Q C;  3JYC A;  4GX5 A;  5EC2 C;  2AHY A;  2K1E A;  3SJQ C;  3OUS A;  4PDR A;  4HYO A;  1KKD A;  1OCZ C;  4GX2 A;  2X6A A;  2WLL A;  3PJS K;  1XL4 A;  1V54 C;  4J9Y B;  4JTA B;  4X8A A;  2WLK A;  3IFX A;  2DWD C;  2ITD C;  5EK0 A;  2Q67 A;  2IH3 C;  2OCC C;  2DYR C;  3E86 A;  4PDM A;  3BEH A;  4MVS A;  3SPJ A;  1R3K C;  3KG2 A;  4G28 B;  1M57 C;  4H37 A;  4R50 A;  3GB7 C;  1J95 A;  3WG7 C;  3SYO A;  2ITC C;  4JTC B;  3OR7 C;  2WLJ A;  4P9O A;  4F4L A;  4PA4 A;  2HVJ C;  2EIL C;  5EBW C;  5CBG A;  2R9R B;  3RBZ A;  2P7T C;  4MSW C;  3TCU A;  3SYQ A;  3RVY A;  1XL6 A;  2HFE C;  5KUM A;  5E1A C;  3K06 A;  4RUF A;  3STZ C;  3E83 A;  4WFF A;  3ZRS A;  4MVR A;  1M56 C;  3LDD A;  4XDJ A;  5B1A C;  4LBE C;  4MW3 A;  4QE9 A;  5CBF A;  3F5W C;  1P7B A;  1V55 C;  3TET A;  3T4Z A;  2WLN A;  4QNH B;  2QKS A;  3VOU A;  3SYA A;  2WLI B;  3K03 A;  4HZ3 A;  2EIK C;  3SPC A;  3AG1 C;  3AG2 C;  4MVQ A;  4R7C A;  3IGA C;  4OXS A;  4UUJ C;  4WFE A;  2YEV A;  3K0G A;  4PA7 A;  4ZBM A;  3T4D A;  1G4Y B;  4CBC A;  1K4C C;  4MVO A;  4R8C A;  3ABL C;  4G27 B;  4RAI A;  2DYS C;  1JVM A;  4GX0 A;  4PA3 A;  3ABK C;  2ATK C;  4P2Z A;  4PA6 A;  2HG5 C;  3AG4 C;  3UKM A;  5CBH A;  3ASN C;  4X88 A;  4XDL A;  4I9W A;  4LCU C;  5B3S C;  2IH1 C;  2WLL B;  4R6Z A;  2WLM A;  2KB1 A;  2X6C A;  3SPG A;  4MVZ A;  2HJF C;  3E8G A;  4RUE A;  3SYP A;  2Y69 C;  2HVK C;  2WLI A;  2A9H A;  4TWK A;  4WFG A;  5B1B C;  2AHZ A;  2A0L A;  3T1C A;  1LNQ A;  4PDL A;  1R3I C;  1S5H C;  2QTO A;  1K4D C;  2EIJ C;  3K0D A;  3FB8 C;  4J9Z B;  4WFH A;  4EKW A;  4MTO A;  3T2M A; 
#chains in the Genus database with same CATH topology
 5IWA B;  3ASO C;  3OT7 A;  3ABM C;  4TV8 A;  1H2M A;  3ABL B;  1F23 A;  1AP6 A;  5F2V O;  2HHH B;  2UUB O;  2ZXW C;  2UXX A;  3E22 B;  3IJ4 A;  1VEW A;  5LGT A;  2L6L A;  2EZP A;  2EIN C;  4KFM A;  1O9H A;  1Q43 A;  1F7Y A;  4GT1 A;  3ZRV A;  4Z1V A;  1L8D A;  2LFS A;  2QSA A;  3T1H O;  3RYC A;  4JAV A;  1CP9 A;  1I94 O;  1SA0 B;  3QG5 A;  1GMG A;  5LYJ A;  3IFX A;  4RWU A;  1JJO A;  1H2G A;  1K92 A;  4YXW G;  1IBM B;  4DRX B;  3AG7 A;  3BCC H;  1L0N H;  5EIB D;  1KP3 A;  1KBH A;  1WN7 A;  4Z2W A;  1WJZ A;  3I55 V;  3J7A U;  4NXM B;  2A7W A;  2Q8V A;  2ZDI A;  2DW4 A;  1H2S B;  1HNX B;  1Q5O A;  3HB3 B;  4MW3 A;  4PEL A;  1P7B A;  1XEQ A;  1FXH A;  3ZHQ A;  3TET A;  5LMN B;  3JAS A;  2QA4 V;  2HEP A;  4X1K B;  2WSS G;  1JPX A;  1Q90 D;  3CCE V;  3JD0 A;  4DR7 O;  1AJN A;  1YEW A;  1HDJ A;  2EJ7 A;  1YJN V;  4X88 A;  3FX7 A;  2IH1 C;  2LFR A;  3M8A A;  4Q6G A;  5CA1 A;  3ZMZ A;  3E8G A;  2BTQ A;  1IUR A;  3JD1 A;  3QO7 A;  4I50 B;  1LUV A;  1NKD A;  4MTO A;  4FJC C;  3ZCC A;  1FXV A;  2Z3Y A;  1JFF A;  3CP1 A;  4NVP A;  4X1Y B;  1FXK C;  4FM0 A;  1KU9 A;  3LDC A;  2BSK B;  4P30 A;  2WA4 A;  3JAL B;  3OGI B;  4K3A A;  4RQE A;  4NTW A;  3A0B Z;  4LFB O;  2O57 A;  2ZD9 A;  5A9G A;  3J80 N;  3G80 A;  5IJ9 A;  3OUF A;  3SJA C;  3CMA V;  1RSO B;  4JI3 O;  1N4C A;  3OTF A;  1SQB H;  4TUY A;  1I5X A;  1QQC A;  2AZ2 A;  2GUZ B;  5CB4 B;  4X8A A;  2IBZ H;  1MMM A;  5EK0 A;  2QJ1 A;  4J7Z A;  4LF6 B;  4LWS B;  3SPJ A;  5C93 A;  2ZNJ A;  1N0N A;  2ITC C;  2BE3 A;  4UCR A;  4BIZ A;  3CME V;  2ZR3 A;  4LF5 O;  1YJW V;  2ZNI A;  4BAY A;  4FLW A;  2QM7 A;  1Q8I A;  1OHH G;  1SZT A;  3K59 A;  5HFL A;  1NJI W;  4YJ3 B;  1PNK A;  1S76 D;  2OWO A;  1GN4 A;  1VF6 C;  4LF7 B;  3A0R A;  1ZX3 A;  4K8X A;  1K4C C;  3T1Y O;  3H01 A;  2RQ6 A;  4WFB V;  4UCS A;  4DYL A;  3HKD A;  2H3O A;  5B3S C;  2WLM A;  2E5L B;  4KXR A;  5GON B;  3ZMV A;  1LNQ A;  1Y76 B;  4O2A B;  4PDL A;  4DV1 B;  4J9Z B;  1G8M A;  3L70 H;  3UT5 A;  5IYB O;  5EYP B;  2JGD B;  2WAM A;  3ML0 A;  4JI8 O;  3RYI A;  2FKX A;  2UXC O;  3K9A A;  3LDE A;  3UM7 A;  2QWN B;  2DMX A;  5LHH A;  4FIP C;  3Q4H B;  1AI7 A;  1AI5 A;  4P9P A;  5IJ0 A;  5C8Y A;  1M90 W;  1XNR B;  4DR4 B;  3RVZ A;  1G6U A;  1MZF A;  4X20 A;  5JVD B;  1WP7 A;  4X1I B;  2ADP A;  2JRI A;  1HNW B;  1ZWI C;  1FYJ A;  4FZ0 A;  1YZB A;  5JJJ B;  4HNA B;  2JVD A;  1VQK V;  3JAM N;  4IT5 A;  1AJQ A;  1MSD A;  1KKD A;  3U0Z A;  2WLL A;  4JYA O;  3AG4 B;  1TUB A;  3K5N A;  1Y6X A;  1FFT B;  4MVS A;  5LMU O;  4I7Z B;  4OX9 B;  3E2E A;  4DV0 O;  3ETQ A;  3MDS A;  3CCL V;  3JD2 A;  4PHZ A;  4EB6 A;  3K06 A;  4WBN A;  4UCO A;  3N2K A;  3FD9 A;  5A2Q N;  4NB5 A;  2VQF B;  3CE2 A;  3JAK B;  2YS8 A;  3T4Z A;  2QKS A;  2WLI B;  2QWQ B;  2DYR B;  2KSD A;  4JI7 O;  4X62 O;  3JCU Z;  3SPC A;  4IL6 Z;  4FLZ A;  2F4V O;  2PTM A;  2CDY A;  3HKE B;  1L1F A;  2W6J G;  1Y67 A;  1GH6 A;  4CBC A;  3E35 A;  4H44 B;  1PD3 A;  1F51 A;  2QKA A;  1RM1 B;  1EN4 A;  1JX9 A;  1NVP D;  1NI8 A;  4TV9 B;  2YIC A;  1QVF U;  2YDE A;  5LA6 A;  2QWO B;  1K5S A;  2QR4 A;  3SYP A;  2Y69 C;  1UPG A;  1K7D A;  3APO A;  1VQO V;  5KAF Z;  1NTM H;  2DN9 A;  1YI2 V;  2B1G A;  3CC7 V;  2MK3 A;  3AG1 B;  3MHS C;  3ZRX A;  1VQP V;  4K0K O;  1WNS A;  1QU7 A;  5LOV B;  2PZS A;  1PNM A;  5LP6 B;  4QE7 A;  3RW0 A;  2XTA A;  3ABK B;  1B3Q A;  1FJG B;  5AG2 A;  1QCE A;  2JK5 C;  2PI4 A;  1SQX H;  1DF4 A;  4MTF A;  4MS2 A;  2P06 A;  5KA5 A;  2BTO A;  1BL8 A;  3AG3 C;  5B5E Z;  2OIG A;  3F5T A;  1DTO A;  1Q6U A;  1D5A A;  1WA8 B;  1Q6H A;  3C3T A;  4ASU G;  2P22 C;  1SQQ H;  2F66 C;  4O4J B;  1S77 D;  4BWA A;  2RJZ A;  4E2L A;  1XL4 A;  1V54 C;  4NR1 A;  5B1N A;  4DV5 O;  1GN6 A;  1J95 A;  2ZE5 A;  3OR7 C;  1BHB A;  1HP8 A;  2EIL C;  4F6E A;  2D2C B;  2QGN A;  4KL1 A;  5CA0 B;  3C90 A;  4WFA V;  1OJH A;  1BMF G;  1GAX A;  1FPO A;  3ZED A;  4CS3 A;  3F5W C;  4X65 B;  3CC2 V;  2PGG A;  1ZLZ A;  4CH6 A;  4DR5 B;  2ZE6 A;  1U96 A;  5FLX N;  1N32 O;  2KQX A;  5FNV B;  1B6Q A;  3ZN0 A;  1R6T A;  4B3M B;  4G27 B;  1YCI A;  1W0J G;  1BS3 A;  4PA3 A;  4GZR B;  4DW1 A;  3ASN C;  4X62 B;  3FYE B;  2N74 A;  1FXK A;  4LCU C;  2KB1 A;  5BMV A;  2X6C A;  4DV3 O;  3O65 A;  1H2L A;  1ZL8 A;  5CN0 A;  1XNQ O;  1KEC A;  4I55 A;  4JI5 O;  4GYC B;  2VRZ A;  5EBM C;  5KAI Z;  4J11 A;  4O4L A;  4GLX A;  2NNU A;  3I56 V;  3SPH A;  4I4T B;  4JI0 B;  4JI1 O;  4F6R B;  5IWA O;  1UFI A;  2W6I G;  4ZOL B;  3CYO A;  1RFY A;  1GM8 A;  5IE9 A;  3F7V C;  4TQF A;  4LF4 B;  1D5N A;  2E75 B;  3W7S A;  2F1M A;  4IIJ B;  2EIJ B;  2HHH O;  3FB6 C;  5L3B A;  4G2K A;  5KX5 B;  3P32 A;  4ABM A;  3QF7 A;  4PDR A;  4QIW F;  4CH4 A;  3FAV B;  3CCV V;  5H6Q A;  3AEI A;  1OCR B;  4GUN A;  4O4H B;  1Q6I A;  1ZAU A;  4DR1 B;  3RYF A;  1VF7 A;  3CC4 V;  1VIB A;  1VF6 A;  4HAM A;  2WLJ A;  1MNG A;  4EEQ A;  2R9R B;  5HFM A;  2CGO A;  3B2E E;  2YEV B;  1JQ0 A;  5J2U A;  3MD0 A;  3JD4 A;  2JJ2 G;  4JYB A;  3K3W A;  2UU9 B;  5FL7 G;  2Z0A A;  2HP8 A;  1RPO A;  2YIB A;  5B1A C;  3D8C A;  4ZI7 A;  4DR3 B;  2XAF A;  1VQ9 V;  1XDC A;  1NTZ H;  3VOU A;  2D3O W;  3JAR B;  1Q7Y W;  3BY6 A;  4NXM O;  4YJ2 A;  2A3Q A;  3KCX A;  1B06 A;  1HNX O;  3HR0 A;  1YHQ V;  2ATK C;  3AG4 C;  5LMN O;  4JZG A;  3QO8 A;  3THO A;  5LGU A;  1VQL V;  3BA9 A;  1YSC A;  5IDJ A;  5LBQ A;  1I5Y A;  3OEH G;  1SQV H;  2A9H A;  4WFG A;  2GBO A;  2R72 A;  3TGU H;  1XOU A;  3B8N A;  1SER A;  4UVA A;  5EZY B;  2YXH A;  3B40 A;  4UCT A;  3CS5 A;  3WB0 A;  4KP4 A;  1MSW D;  3DXR A;  1XNQ B;  1NR1 A;  4O4I A;  1MAB G;  1XRE A;  1DK1 A;  4H33 A;  2X6B A;  2IJH A;  5J2T B;  1XQ8 A;  3SPI A;  2UUA B;  4D7S A;  3HKC B;  3HPL C;  1SS3 A;  2Q0O C;  3CRA A;  3HKB B;  5H5N A;  5ITZ A;  1NQT A;  1PM9 A;  2ZIM A;  2Y0P A;  1SZX A;  4J42 A;  4U7N A;  2VWK A;  1W0K G;  3ZHV A;  2OCC C;  1AVM A;  4DR2 O;  1S72 V;  2CE4 A;  1BQZ A;  1AB3 A;  1VMG A;  4UXN A;  4GCZ A;  1YTF D;  3ABU A;  5LP6 C;  2AGA A;  5JH7 B;  1SET A;  3JD3 A;  4OPH A;  4LF6 O;  1AI6 A;  3VQW A;  5H9C A;  1AI4 A;  1BT8 A;  4FLU A;  4XDJ A;  1WB8 A;  1OCZ B;  3TK1 A;  1KUQ A;  1K8A W;  4UV9 A;  1XI1 A;  3RYH A;  4PA7 A;  1YTF B;  2HG5 C;  1K9M W;  4YHH B;  2YUA A;  4LF7 O;  3ETD A;  4JI4 B;  4R6Z A;  3P3P A;  2HJF C;  3VQX A;  2RN9 A;  5KLV H;  1YDX A;  3T1C A;  1H2K A;  3CD6 V;  2F95 B;  4EKW A;  5KHK A;  2Q68 A;  5D5P A;  3B8M A;  1QVG U;  2E5L O;  1JOY A;  2M6Y A;  5KMG B;  2FML A;  2JS3 A;  3ETE A;  3PN1 A;  1R6N A;  4PI2 A;  4DV1 O;  2VQE O;  4U7O A;  1X59 A;  3S3W A;  1QLE C;  4JI2 B;  2Q0A A;  3LUT B;  4NKG B;  3OD4 A;  4LP8 A;  1M5I A;  2WLH A;  1BSM A;  2Y4U A;  5LXT B;  3P3N A;  1XNR O;  2R9I A;  2GSM B;  4X1Y A;  3JYC A;  1CXZ B;  4DR4 O;  1BQ0 A;  2GV9 A;  1GRJ A;  3OUS A;  4LH7 A;  3FFQ A;  1S5J A;  4JF3 A;  1P49 A;  2EIM B;  5IY5 B;  1VP7 A;  4QJF B;  1AIL A;  1J5E B;  1Y74 A;  5CA1 B;  2ITD C;  1K3E A;  1EBO A;  2Q73 A;  2BTQ B;  2XND G;  5K1X A;  1HNW O;  1PL4 A;  1U97 A;  3AK1 A;  3WU2 Z;  1IBL B;  2HVJ C;  1RSO A;  3CCM V;  2P7T C;  4MSW C;  2XAS A;  4DR2 B;  1JFF B;  4LNU A;  3X2Q B;  1VQ8 V;  2GUZ A;  3LSQ A;  5E1A C;  1H8E G;  4LC1 A;  4OX9 O;  2XAJ A;  1M56 C;  2OYQ A;  2QM8 A;  1XUQ A;  2EUL A;  2JDI G;  2XT9 A;  1FFX A;  2H94 A;  3L9D A;  4HZ3 A;  4FMT A;  4GKK B;  3CSX A;  4WFE A;  3K0G A;  5B1O A;  5IJ9 B;  3RT3 C;  1CPY A;  2VQF O;  5GW7 A;  1EZJ A;  3RGB A;  2P5O A;  2C2A A;  1K73 W;  2IJI A;  4TUY B;  4MT8 A;  4JAA A;  4RUE A;  4FLT A;  5FPR A;  3QTC A;  1V55 B;  1S5H C;  1SQF A;  2P6J A;  4ZIB A;  2YID A;  4X9Q A;  2E76 B;  3J81 N;  2RCV A;  1KQS U;  1LR1 A;  2L35 A;  1YIT V;  3RN4 A;  4B3R B;  3B4S A;  4JPR A;  4LF8 B;  4FM2 A;  3ZX6 A;  3RWR D;  4TT3 G;  2QKC A;  1OCC C;  2WA3 A;  2IJK A;  3CRC A;  2JGD A;  2VQE B;  1OCO C;  3AK2 A;  4RO2 A;  1SES A;  4PV1 B;  1FJG O;  2UXB B;  2DQ0 A;  2P67 A;  1VQN V;  3HKD B;  1GN3 A;  4J9Y B;  1X4T A;  3IC9 A;  1ZUQ A;  4B3S B;  2B9Z A;  1SQG A;  1NTK H;  5JVD A;  5CMU A;  4PDM A;  4R50 A;  4H37 A;  1PL0 A;  5EBW C;  3SR2 C;  3UT5 B;  3NXS A;  4O2B B;  2F93 B;  2ZQM A;  4FZ1 A;  3RYI B;  4UVC A;  2KG7 B;  3RVY A;  1XL6 A;  4NYK A;  4BIO A;  4WFF A;  3CPW U;  4FFB A;  4X20 B;  2MW2 B;  4Q20 A;  2ZT9 B;  2XAG A;  5L3G A;  2XAH A;  3WG7 B;  1TVK A;  4JYC A;  3H1K H;  3ABL C;  1JVM A;  2P90 A;  2HJD A;  4P2Z A;  5CBH A;  4X65 O;  2PI5 A;  1D2D A;  2WLL B;  1IBK B;  3WFV A;  4DR5 O;  2QWP B;  1TUB B;  1HW7 A;  1F4N A;  4TOI A;  2WLI A;  1YVW A;  3GWO A;  4I0X B;  4B3M O;  4DR6 B;  1K4D C;  4FVM A;  4UFZ A;  3T2M A;  1K97 A;  2EIK B;  1XHX A;  2Q7G A;  4WBN B;  2Q69 A;  1Z5V A;  4J10 A;  1CEZ A;  1PV0 A;  4U3J B;  5BZB A;  2BOC C;  3E8H A;  4PDV A;  4DUZ B;  5H6R A;  4DXW A;  2Y4T A;  3NR7 A;  2NR5 A;  5B1B B;  4L87 A;  2XOK G;  2N05 A;  3N27 A;  3FKS G;  1BGY H;  4JI0 O;  1NR7 A;  4PA9 A;  3I5D A;  1N33 B;  3KCY A;  4GX5 A;  2ZIO A;  5JQG A;  3ASO B;  3ZHS A;  5LP6 A;  1FS0 G;  3ABM B;  2F23 A;  1R73 A;  2ARH A;  3TXQ A;  5KHJ A;  1NVP B;  1F4M A;  3W7U A;  4LF4 O;  5H2F Z;  5KHI A;  5LA6 B;  2ZXW B;  2LW1 A;  1QR8 A;  2PY5 A;  2PYJ A;  1VQ6 V;  1WA8 A;  3UO3 A;  2EIN B;  1Y4M A;  4LF9 B;  5EIB C;  2DE0 X;  3N2G B;  2HKO A;  5K1P A;  2V4D A;  2DOS A;  4DR1 O;  1E79 G;  3ABT A;  3E83 A;  2YI8 A;  4UVB A;  2W0X A;  3ZIA G;  3EXA A;  1LUW A;  2JJ1 G;  1ROP A;  2LW7 A;  4MVQ A;  1Z2G A;  3IGA C;  5LGN A;  2UU9 O;  4FPP A;  1KP2 A;  4MVO A;  2E3C A;  5TIS Z;  4EFB A;  4DR3 O;  2VS0 A;  3UKM A;  2NN4 A;  4KUM A;  1S3J A;  4IYH A;  3K57 A;  4MVZ A;  2A0L A;  1GK9 A;  1R3I C;  3KKY A;  2AW9 A;  2Y0I A;  1ZSP A;  4JI6 O;  3K5L A;  2A79 B;  3FB5 C;  3JAW A;  2GTS A;  1Z5W A;  4NTY A;  2GDS A;  1W2B U;  4J7K A;  3VQV A;  1Q82 W;  1ORQ C;  1JJ2 U;  3BRC A;  1BE3 H;  3STL C;  1M9N A;  4GKJ B;  2EZO A;  2F43 G;  2EJR A;  4IGG A;  2UUC B;  1AR1 B;  4ZHQ B;  3ZRW B;  4MTG A;  2HLD G;  3SYC A;  4DV7 B;  3WB1 A;  4EFE A;  2NLJ C;  3BFR A;  3JAT B;  4HBN A;  4DK1 A;  4YY3 B;  2FL4 A;  2AHY A;  5IYZ A;  3CCR V;  1VQM V;  1COW G;  2UUA O;  2R9A A;  3R66 A;  2B5U A;  2Y48 A;  3PJS K;  1FXK B;  1FD9 A;  4UB8 Z;  5BMV B;  1NH2 D;  1W59 A;  1WPB A;  3CXH F;  4H0L B;  1K5Q A;  1N0J A;  2WWW A;  1ZL8 B;  4I55 B;  5KX5 A;  2LJ2 A;  2YSU B;  5IYD O;  2IW5 A;  3CWB H;  3D3Q A;  1YF2 A;  4JYY A;  3FAV A;  3WB2 A;  2EX3 A;  1E1Q G;  4O4L B;  4CH3 A;  3CXC U;  1YJ9 V;  3CCQ V;  1GTO A;  3OTO B;  1NH2 B;  3K79 A;  3BVO A;  3OMA B;  3RFR A;  3OMN B;  2A06 H;  4CS2 A;  4IHJ A;  4WF9 V;  1SC5 B;  1BHA A;  2YEV A;  4ZBM A;  1IXM A;  3CCU V;  5DM6 V;  4KHP B;  2AXT Z;  2QTS A;  1WB7 A;  2YIB D;  4PD4 F;  2M7W A;  4B3T B;  2AHZ A;  4W4K A;  1AR5 A;  3QNE A;  3CX5 F;  4YHH O;  4NTX A;  2ZKO A;  3K5M A;  2ZE8 A;  4JI4 O;  4MVM A;  5KUK A;  2ZIN A;  3BA8 A;  5J2U B;  5EC1 C;  2V1D A;  3EVK A;  3LNM B;  4OGQ B;  4JI6 B;  2LO1 A;  2BOB C;  1BZK A;  4ZI7 B;  5B3S B;  2UXD B;  3D36 C;  4FLX A;  3BAB A;  2V7Q G;  4C7U A;  5EZY A;  3W7W A;  2XHB A;  1FAF A;  4YJ2 B;  1IX9 A;  1JR9 A;  5L3D A;  1WLE A;  5DEC A;  1A32 A;  5EC2 C;  4HYO A;  2CH7 B;  1IDS A;  1I7F A;  4JI2 O;  1XIL A;  1KMI Z;  4N23 A;  1TA8 A;  2DYR C;  4L8J A;  1JCH A;  1GKF A;  2HR3 A;  1HR0 B;  3L72 H;  1DGS A;  5JCO C;  3DC5 A;  1RM1 C;  2P4K A;  1J5E O;  1IXB A;  4ICG A;  4K35 A;  3CJH B;  3DXR B;  3TCU A;  1KYO F;  4ZKI A;  4O4I B;  1XBL A;  2BCC H;  4MVR A;  3ZRS A;  3E22 A;  5CBF A;  1IBL O;  3ZHR A;  4B7K A;  5DN6 G;  2YXL A;  4DV6 B;  1XMQ B;  4DV4 B;  3AG1 C;  5ITZ B;  4CC5 A;  5JH7 A;  4AQY B;  4RAI A;  3TXS A;  4TV8 B;  3ABK C;  1EFR G;  2CAZ C;  4XDL A;  1SA0 A;  4GKK O;  2HVK C;  1NU1 H;  4DRX A;  2QTO A;  3SGI A;  3FB8 C;  3M7M X;  2LQT A;  4LFC B;  4B7E A;  5GTI Z;  5IYC O;  4J41 A;  1G1X B;  1BCC H;  3S3X A;  3RYC B;  4DUY B;  4E4E A;  4MW8 A;  1AJP A;  1MZE A;  3E8F A;  3OR6 C;  4Z1M G;  3OGC C;  2ZM6 B;  5LYJ B;  3K08 A;  4X1K A;  4GX1 A;  2Y69 B;  4B3R O;  3LNN A;  5J9P C;  3K04 A;  4LF8 O;  5JJE B;  3DSQ A;  5BR8 B;  1JA8 A;  1QR9 A;  3FB7 C;  2JS5 A;  1ZTE A;  2FB5 A;  3RYH B;  3AG2 B;  2Q9L A;  4X66 B;  5KMG A;  2GHY A;  1L0L H;  3BAA A;  4X64 B;  2DYS B;  3G6E V;  2WLK A;  2DWD C;  2Q67 A;  3G6B A;  1N34 B;  1E1R G;  2PF4 E;  3KG2 A;  4G28 B;  2UXB O;  4I50 A;  3JAS B;  2IU3 A;  3VBB A;  5L3C A;  4JTC B;  5LHG A;  5LXT A;  3IC7 A;  4LFA B;  3QVN A;  3AG3 B;  2DQ3 A;  4B3S O;  2OCH A;  1KB9 F;  1GN2 A;  4RUF A;  2BSK A;  4U3F H;  4I5S A;  3JAL A;  2LGQ A;  1V54 B;  3IAY A;  4QNH B;  1N36 B;  3SYA A;  2YXY A;  4R7C A;  4OXS A;  4JV5 B;  2YIA A;  2EIL B;  4QPK A;  2FTK A;  3MAQ A;  1URF A;  5CB4 A;  2XUM A;  3G71 V;  4J80 A;  2N04 A;  1Y74 B;  4LWS A;  4I9Q A;  2ODM A;  2CTP A;  4DO2 A;  2EIJ C;  2CGN A;  2UUB B;  4YIO A;  3OMI B;  3E89 A;  3ZS8 C;  1M4U A;  1IBK O;  3E8B A;  1OCR C;  1Q3E A;  4LNU B;  3T1H B;  4DR6 O;  3ASN B;  4YJ3 A;  1EN6 A;  1I94 B;  4JAU A;  1XMO O;  5LL6 Y;  1FFX B;  1KD1 W;  2OTL V;  4AIL C;  3GWK C;  1GO3 F;  2K9P A;  4D6T H;  1GM9 A;  2B1I A;  5EBL C;  5KA6 A;  2GTA A;  1EM1 A;  3SJQ C;  4UB6 Z;  4NXN O;  5JJN B;  4DUZ O;  4JAS A;  5GON A;  3FYI B;  2KKW A;  1VAR A;  2IH3 C;  1Y76 A;  4O2A A;  3U11 A;  1R3K C;  1N33 O;  1PP9 H;  2Z5U A;  3SYO A;  2CUG A;  1S5L Z;  5EYP A;  2RNB A;  4PA4 A;  5KHH A;  1MG1 A;  3Q4H A;  1K34 A;  2RMK B;  1OZ0 A;  2PYL A;  2UXN A;  1T5E A;  1XHZ A;  3UO2 A;  4DR7 B;  4FM1 A;  3MHH C;  1N8R W;  4CH5 A;  1MA1 A;  3C3S A;  4UV8 A;  3JCZ A;  1GM7 A;  4X1I A;  4O2B A;  2CTR A;  4UUJ C;  3AK3 A;  4BR6 A;  2KG7 A;  1ARO P;  4HNA A;  4GX0 A;  1TUE B;  3CRR A;  5IJ0 B;  5C8Y B;  1NBM G;  2ETN A;  2PUS A;  5B1A B;  4PJ0 Z;  4CZZ A;  3D36 A;  3G4S V;  1ENV A;  1M57 B;  3APQ A;  1IZ3 A;  4LFB B;  1YXB A;  3JSN A;  1NT2 B;  1O9G A;  3P30 A;  1QHT A;  3KZI Z;  1KC8 W;  2QM4 A;  4J7J A;  4JI3 B;  3ZJZ A;  1QLN A;  3JAK A;  3QO5 A;  4I0X A;  1SQP H;  3EFF K;  4LR3 A;  4CS4 A;  4FFB B;  4DV2 O;  1US6 A;  2DWE C;  2W0F C;  4B08 A;  3M99 B;  3HKE A;  2QEX V;  4GKJ O;  4AHC A;  5JCO A;  1TVK B;  3SJB C;  1HNZ O;  4XDK A;  4EB6 B;  1XMO B;  1VF5 B;  2K1E A;  2UUC O;  4TV9 A;  1OCZ C;  4JGS A;  2X6A A;  3JSL A;  3L73 H;  4U3J A;  5L3E A;  1OV9 A;  4DV7 O;  2IU0 A;  3N2K B;  4JZ2 A;  4LF5 B;  5CA3 A;  4NXN B;  4YY3 O;  4OPA A;  3GB7 C;  3VQY A;  3L74 H;  4QPJ A;  4WCE V;  4F4L A;  2YC0 A;  1S0V A;  5LOV A;  4UCV A;  3LSU A;  2QWR B;  3STZ C;  4RQF A;  1M1K W;  1EZV H;  2Q7H A;  3T1Y B;  3DC6 A;  3LDD A;  2CK3 G;  1NZ6 A;  2OT5 A;  4BIU A;  2OCC B;  1WP8 A;  3AG2 C;  3N2G A;  1MOF A;  3EHB B;  3T4D A;  1G4Y B;  4BW9 A;  1P84 F;  1AR4 A;  2OIE A;  4R8C A;  3ZBH A;  2DYS C;  2ZDI C;  4O4J A;  2ZE7 A;  5JQG B;  3OTO O;  1RP3 B;  4JI8 B;  2UXC B;  2RDC A;  1H2N A;  5D5Q A;  3H9V A;  1PNL A;  3SDL A;  1UJW B;  2DJV A;  4TWK A;  4KHP O;  1WPX A;  3H1J H;  2LGW A;  4AI8 A;  5LHI A;  2VWJ A;  3UQ8 A;  3SJC C;  2LP7 A;  2CTQ A;  2IJJ A;  3R65 A;  3CHX A;  3OM3 B;  3OW2 U;  5CA0 A;  1R3J C;  4X89 A;  2WPD G;  3G67 A;  2EIM C;  3BPZ A;  1AP5 A;  5IY5 C;  3CEI A;  4B3T O;  3TJT A;  2X7R B;  4TSF G;  4DK0 A;  5DED A;  1I08 A;  4BW5 A;  2AZ0 A;  4JYA B;  3DTU B;  2XAQ A;  5FNV A;  1R1B A;  1QBZ A;  2JIZ G;  5LMU B;  3X2Q C;  3F7Y C;  1PKX A;  4DV2 B;  4XBF A;  4DV0 B;  1VQ7 V;  3K5O A;  2UXD O;  2ADQ B;  4JTA B;  3CCS V;  3GVM A;  1FKA O;  3B09 A;  1HNZ B;  4ZHQ A;  1VQ5 V;  3ZRW A;  3E86 A;  3BEH A;  1QLE B;  1QNM A;  2EBO A;  3JAT A;  5GTH Z;  5CBG A;  1Q86 W;  1KKC A;  1JMK C;  1TGO A;  3JAW B;  3SYQ A;  4JI7 B;  2JEX A;  2HFE C;  4I4T A;  3ZMS A;  2F4V B;  1HR0 O;  1DLB A;  3ETG A;  3ZHU A;  4F6R A;  1K33 A;  4LBE C;  4QE9 A;  1V55 C;  1B04 A;  4ZOL A;  2IM9 A;  4IYI A;  3W7T A;  1P7G A;  1R6K A;  4IIJ A;  1H8H G;  3OE7 G;  3A2F A;  4FK5 C;  1Q81 W;  3ZN1 A;  5BXZ A;  2P4V A;  4PA6 A;  3BHP A;  3OEE G;  5IYZ B;  1V9P A;  2R70 A;  2Q5Z A;  4DV6 O;  4O4H A;  1XMQ O;  4DV4 O;  4K0K B;  4LF9 O;  1M56 B;  3OAA G;  4AQY O;  3L75 H;  4K8Z A;  1WAZ A;  3K0D A;  3ZMT A;  4LH6 A;  2JGU A;  2ZCE A;  4WFH A;  3U10 A;  1YIJ V;  1IVS A;  2QDO A;  2G38 A;  4LFC O;  4PI0 A;  4FFK A;  1R3L C;  4QGP A;  3B77 A;  1P4R A;  3JAR A;  4JTD B;  2H8P C;  1I0H A;  1THZ A;  3LSS A;  4TQD A;  4D7T A;  3RYF B;  1Y66 A;  4DUY O;  4MVU A;  4IHJ B;  3H1H H;  1HWY A;  2Q6A A;  2X0L A;  3D3I A;  2CTW A;  4CC6 A;  5B66 Z;  3CB2 A;  4DV5 B;  3CRQ A;  3ZHT A;  4N21 A;  2YI9 A;  3UCS C;  2ZM6 O;  1H38 A;  3W7X A;  1IBM O;  3L71 H;  4GX2 A;  4UCU A;  1SF9 A;  3A0H Z;  1SKV A;  5L3F A;  2ZR2 A;  2Q7E A;  5BR8 O;  5E79 Z;  1RPR A;  1M57 C;  4X66 O;  3WG7 C;  3H1L H;  1OCC B;  4P9O A;  3ZMU A;  3K9S A;  4X64 O;  5IT9 N;  3RBZ A;  1OCO B;  2E74 B;  4FLY A;  2CH7 A;  4H13 B;  1N34 O;  3O9O A;  3OFN G;  3CCJ V;  2FYU H;  5KUM A;  1N32 B;  1PPJ H;  5JWP A;  2JEU A;  2OTJ V;  5J2T A;  4LFA O;  1TAE A;  3ICX A;  2WLN A;  4A5U B;  3HKC A;  3HKB A;  3H1I H;  3K03 A;  1VQ4 V;  2EIK C;  5BY1 A;  4DV3 B;  3CRM A;  3A8T A;  2Q4P A;  3CJH A;  5KHG A;  3DGE A;  1SRY A;  4JI5 B;  4YIP A;  5FPO A;  1N36 O;  1DF5 A;  4I9W A;  4FLV A;  2QE7 G;  3SPG A;  4DW0 A;  4JV5 O;  1NS1 A;  5B1B C;  1EN5 A;  4W4L A;  4MTX A;  1M93 A;  4JI1 B;  2ILM A;  3K58 A; 
#chains in the Genus database with same CATH homology
 3E89 A;  1K97 A;  2EIK B;  5EBM C;  3ASO C;  3ABM C;  3E8B A;  2NNU A;  1OCR C;  3ABL B;  1F23 A;  3I56 V;  3SPH A;  2Q69 A;  3ASN B;  1CEZ A;  2ZXW C;  2UXX A;  5BZB A;  2W6I G;  2BOC C;  3CYO A;  4JAU A;  5LGT A;  3E8H A;  2EZP A;  1GM8 A;  2EIN C;  4PDV A;  1KD1 W;  3F7V C;  2OTL V;  4KFM A;  5H6R A;  4DXW A;  5B1B B;  4L87 A;  2XOK G;  4GT1 A;  3ZRV A;  1GO3 F;  3W7S A;  2LFS A;  1GM9 A;  2B1I A;  2EIJ B;  3FKS G;  3FB6 C;  5EBL C;  5KA6 A;  5L3B A;  1NR7 A;  4G2K A;  4PA9 A;  3P32 A;  4JAV A;  4GX5 A;  3ASO B;  1CP9 A;  3SJQ C;  1FS0 G;  3ABM B;  4PDR A;  1R73 A;  4QIW F;  3CCV V;  5H6Q A;  1NVP B;  1F4M A;  3W7U A;  3AEI A;  1GMG A;  1OCR B;  4JAS A;  3FYI B;  3IFX A;  2IH3 C;  1H2G A;  1K92 A;  4YXW G;  2ZXW B;  1R3K C;  3CC4 V;  1QR8 A;  2Z5U A;  4HAM A;  3SYO A;  1VQ6 V;  2EIN B;  1Y4M A;  2WLJ A;  4PA4 A;  2R9R B;  1KP3 A;  2HKO A;  5HFM A;  2YEV B;  1JQ0 A;  1MG1 A;  3I55 V;  1K34 A;  3MD0 A;  1OZ0 A;  3JD4 A;  1E79 G;  2JJ2 G;  2ZDI A;  4JYB A;  3K3W A;  5FL7 G;  2DW4 A;  2UXN A;  3ABT A;  3E83 A;  1RPO A;  5B1A C;  3HB3 B;  1VQ9 V;  2XAF A;  4MW3 A;  4PEL A;  3MHH C;  1P7B A;  1N8R W;  1FXH A;  4UVB A;  3TET A;  2QA4 V;  3VOU A;  3ZIA G;  2D3O W;  1Q7Y W;  2WSS G;  2JJ1 G;  3BY6 A;  1ROP A;  1JPX A;  4UV8 A;  3JCZ A;  1GM7 A;  4MVQ A;  3CCE V;  3IGA C;  4UUJ C;  5LGN A;  3JD0 A;  4FPP A;  1KP2 A;  1AJN A;  4MVO A;  1ARO P;  1YHQ V;  4GX0 A;  2ATK C;  3UKM A;  3AG4 C;  1YJN V;  1TUE B;  4X88 A;  4KUM A;  1S3J A;  2IH1 C;  3QO8 A;  2LFR A;  5LGU A;  1VQL V;  3ZMZ A;  4MVZ A;  1NBM G;  1YSC A;  3E8G A;  5IDJ A;  1I5Y A;  5LBQ A;  3OEH G;  2A9H A;  4WFG A;  5B1A B;  4CZZ A;  2A0L A;  3JD1 A;  1GK9 A;  3QO7 A;  3D36 A;  1R3I C;  3B8N A;  3G4S V;  1SER A;  4UVA A;  1ENV A;  1NKD A;  4MTO A;  1M57 B;  4FJC C;  3ZCC A;  4KP4 A;  2A79 B;  1MSW D;  3FB5 C;  1FXV A;  2Z3Y A;  3CP1 A;  1W2B U;  1NR1 A;  1Q82 W;  1ORQ C;  3P30 A;  1JJ2 U;  1FXK C;  3LDC A;  3STL C;  1M9N A;  1KC8 W;  1MAB G;  4P30 A;  3ZJZ A;  1QLN A;  2EZO A;  2F43 G;  4H33 A;  3QO5 A;  2X6B A;  2EJR A;  3EFF K;  2IJH A;  4RQE A;  1AR1 B;  3SPI A;  3ZRW B;  4MTG A;  2HLD G;  3SYC A;  3HPL C;  2DWE C;  2W0F C;  2NLJ C;  3M99 B;  1NQT A;  2ZD9 A;  3OUF A;  2QEX V;  3CMA V;  4XDK A;  2AHY A;  2K1E A;  3CCR V;  1VQM V;  1COW G;  4U7N A;  1I5X A;  1OCZ C;  2B5U A;  2X6A A;  2Y48 A;  3PJS K;  4JGS A;  1FXK B;  4X8A A;  5L3E A;  2IU0 A;  1NH2 D;  1W0K G;  5EK0 A;  2OCC C;  5CA3 A;  1K5Q A;  2WWW A;  3SPJ A;  5C93 A;  1S72 V;  3GB7 C;  4QPJ A;  4WCE V;  2ITC C;  4UXN A;  4GCZ A;  4F4L A;  1YTF D;  3ABU A;  4BIZ A;  1S0V A;  2YSU B;  3CME V;  5IYD O;  2IW5 A;  1SET A;  3JD3 A;  2ZR3 A;  1YJW V;  1AI6 A;  1E1Q G;  4BAY A;  1M1K W;  2QM7 A;  5H9C A;  1AI4 A;  3STZ C;  4RQF A;  3CXC U;  1OHH G;  3LDD A;  1SZT A;  4XDJ A;  1YJ9 V;  5HFL A;  1NJI W;  1OCZ B;  3CCQ V;  1GTO A;  1PNK A;  1S76 D;  2CK3 G;  1NH2 B;  3K79 A;  2OT5 A;  3OMA B;  3TK1 A;  3OMN B;  4BIU A;  2OCC B;  1K8A W;  3A0R A;  4WF9 V;  4UV9 A;  3AG2 C;  1MOF A;  1BHA A;  2YEV A;  3EHB B;  4PA7 A;  1IXM A;  4ZBM A;  3T4D A;  1YTF B;  1G4Y B;  1K4C C;  4R8C A;  5DM6 V;  3CCU V;  3H01 A;  2DYS C;  2ZDI C;  4WFB V;  2HG5 C;  1K9M W;  3ETD A;  5B3S C;  4R6Z A;  2WLM A;  2HJF C;  1PNL A;  1UJW B;  2M7W A;  4TWK A;  3ZMV A;  2AHZ A;  3T1C A;  1LNQ A;  4PDL A;  3CD6 V;  1WPX A;  3QNE A;  5LHI A;  4J9Z B;  1G8M A;  4EKW A;  5IYB O;  2LP7 A;  2WAM A;  2IJJ A;  3ML0 A;  3R65 A;  3K9A A;  2Q68 A;  3LDE A;  3UM7 A;  3OM3 B;  3OW2 U;  3B8M A;  4MVM A;  1R3J C;  4X89 A;  5KUK A;  5LHH A;  1QVG U;  4FIP C;  2WPD G;  1JOY A;  2EIM C;  1AI7 A;  2V1D A;  1AI5 A;  5EC1 C;  5IY5 C;  3LNM B;  3ETE A;  4P9P A;  1R6N A;  2X7R B;  4TSF G;  1M90 W;  4U7O A;  2BOB C;  3RVZ A;  5B3S B;  1QLE C;  2V7Q G;  3LUT B;  4BW5 A;  3W7W A;  4LP8 A;  2WLH A;  3DTU B;  2XAQ A;  1QBZ A;  2JIZ G;  5L3D A;  1WLE A;  1ZWI C;  2GSM B;  2R9I A;  3F7Y C;  3JYC A;  3X2Q C;  1PKX A;  4XBF A;  1VQ7 V;  5EC2 C;  1VQK V;  3OUS A;  4HYO A;  1AJQ A;  4JF3 A;  1KKD A;  2EIM B;  2WLL A;  5IY5 B;  4JTA B;  3CCS V;  4QJF B;  3AG4 B;  4N23 A;  2ITD C;  1K3E A;  1EBO A;  2XND G;  2DYR C;  3ZRW A;  3E86 A;  1VQ5 V;  1JCH A;  1FFT B;  3BEH A;  2HR3 A;  4MVS A;  3E2E A;  1QLE B;  2EBO A;  2HVJ C;  5CBG A;  3CCL V;  3JD2 A;  1Q86 W;  1RM1 C;  3CCM V;  2P7T C;  4MSW C;  2XAS A;  3TCU A;  3SYQ A;  2JEX A;  3X2Q B;  2HFE C;  1VQ8 V;  3ZMS A;  5E1A C;  3LSQ A;  4ZKI A;  3K06 A;  1H8E G;  1DLB A;  3ETG A;  4LC1 A;  2XAJ A;  3ZRS A;  4MVR A;  1M56 C;  1K33 A;  2QM8 A;  4LBE C;  4QE9 A;  5CBF A;  1V55 C;  5DN6 G;  3T4Z A;  2JDI G;  2QKS A;  3W7T A;  2WLI B;  2H94 A;  2DYR B;  4HZ3 A;  1R6K A;  4FMT A;  3SPC A;  3AG1 C;  1H8H G;  4WFE A;  1L1F A;  2W6J G;  3K0G A;  3OE7 G;  5B1O A;  4CBC A;  4FK5 C;  1CPY A;  3E35 A;  1Q81 W;  4RAI A;  3ZN1 A;  5GW7 A;  1PD3 A;  1EZJ A;  1F51 A;  3ABK C;  1EFR G;  4PA6 A;  1RM1 B;  1JX9 A;  1NVP D;  3OEE G;  2C2A A;  4XDL A;  1K73 W;  2IJI A;  4MT8 A;  1QVF U;  1K5S A;  4RUE A;  3SYP A;  2Y69 C;  1M56 B;  2HVK C;  3OAA G;  1V55 B;  1K7D A;  1S5H C;  2QTO A;  1VQO V;  3K0D A;  3FB8 C;  3ZMT A;  4WFH A;  2P6J A;  1YI2 V;  2B1G A;  3CC7 V;  2MK3 A;  5IYC O;  1YIJ V;  3AG1 B;  3MHS C;  1KQS U;  1YIT V;  3ZRX A;  1VQP V;  1PNM A;  4JPR A;  4QE7 A;  3RW0 A;  4MW8 A;  3ABK B;  1AJP A;  1QCE A;  2JK5 C;  2PI4 A;  3E8F A;  1DF4 A;  3OR6 C;  4MTF A;  4MS2 A;  4Z1M G;  3OGC C;  4TT3 G;  1R3L C;  3B77 A;  1P4R A;  3K08 A;  5KA5 A;  4JTD B;  2H8P C;  1OCC C;  1THZ A;  4GX1 A;  1BL8 A;  3LSS A;  2Y69 B;  1Y66 A;  3AG3 C;  2IJK A;  4MVU A;  5J9P C;  1DTO A;  2X0L A;  1HWY A;  2Q6A A;  1OCO C;  3D3I A;  3K04 A;  4RO2 A;  1QR9 A;  3FB7 C;  1SES A;  4ASU G;  2DQ0 A;  3AG2 B;  4N21 A;  2P67 A;  2GHY A;  1H38 A;  1S77 D;  3W7X A;  1VQN V;  4GX2 A;  4E2L A;  2DYS B;  4J9Y B;  1XL4 A;  1V54 C;  3G6E V;  2WLK A;  5L3F A;  2DWD C;  2Q67 A;  5B1N A;  2ZR2 A;  5CMU A;  4PDM A;  1E1R G;  1RPR A;  3KG2 A;  4G28 B;  1M57 C;  4H37 A;  1PL0 A;  4R50 A;  1J95 A;  2IU3 A;  3VBB A;  3WG7 C;  5L3C A;  4JTC B;  5LHG A;  1OCC B;  3IC7 A;  3OR7 C;  4P9O A;  3ZMU A;  1BHB A;  5EBW C;  2EIL C;  3AG3 B;  3NXS A;  2ZQM A;  3RBZ A;  1OCO B;  2DQ3 A;  4UVC A;  3RVY A;  1XL6 A;  3OFN G;  3CCJ V;  5KUM A;  4WFA V;  4RUF A;  1BMF G;  4WFF A;  3CPW U;  2JEU A;  4I5S A;  2OTJ V;  3F5W C;  1V54 B;  2WLN A;  4QNH B;  3SYA A;  3K03 A;  1VQ4 V;  3CC2 V;  2EIK C;  4Q20 A;  4R7C A;  2XAG A;  4OXS A;  5L3G A;  2XAH A;  3WG7 B;  4JYC A;  3ZN0 A;  1B6Q A;  3ABL C;  4G27 B;  2EIL B;  3DGE A;  1JVM A;  1W0J G;  2P90 A;  4PA3 A;  5CBH A;  4P2Z A;  4QPK A;  1SRY A;  2FTK A;  3ASN C;  3FYE B;  2PI5 A;  1DF5 A;  3G71 V;  4I9W A;  1FXK A;  4LCU C;  2WLL B;  2KB1 A;  2X6C A;  2QE7 G;  3SPG A;  3WFV A;  1F4N A;  2WLI A;  5B1B C;  3GWO A;  4MTX A;  5CN0 A;  4DO2 A;  1KEC A;  1K4D C;  2EIJ C;  1GKF A;  3OMI B;  3T2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...