4ROXA

Crystal structure of p domain of hawaii norovirus (gii.1)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
305
structure length
299
Chain Sequence
GPGSKPFTLPILTIGELSNSRFPVPIDELYTSPNEGVIVQPQNGRSTLDGELLGTTQLVPSNICALRGRINAQVDHHQWNLQVTNTNGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPNNTCRAHDGVLATWSPKFTPKLGSVILGTWLDLNQPTRFTPVGLFNTDHFDQWALPSYSGRLTLNMNLAPSVSPLFPGEQLLFFRSHIPLKGGTSDGAIDCLLPQEWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norovirus hu/gii.1/7ek/hawaii/1971/usa
molecule tags Viral protein
molecule keywords Capsid protein VP1
total genus 72
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4roxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4roxA01
3ASRA 4P3IA 5HZAA 3SKBA 3BY2A 3ONUA 4X0CA 4OPOA 4ROXA 3RY8A 2OBSA 3ASQA 4OOXA 3SEJA 5HZBA 4WZKA 3R6JA 4Z4SA 4WZTA 3PVDA 3D26A 4RLZA 5J3OA 4WZLA 4QVJA 4RM0A 2OBTA 4OOVA 4Z4RA 3ASTA 2ZL5A 3LQ6A 4Z4TA 3PUNA 3LQEA 5F4OA 3PUMA 3ASPA 4P1VA 4X06A 3PA2A 5IYNA 4RDLA 4QVAA 3PA1A 4WZEA 1IHMA 4RPBA 4Z4UA 3SLDA 3Q6RA 5E6TA 3Q3AA 4Z4YA 5IYWA 3ASSA 4OP7A 4P26A 2OBRA 3ONYA 4QV2A 4P25A 3BY1A 5BSYA 3Q38A 2ZL7A 4X7FA 5KW9A 4OPSA 4P12A 4X7DA 5F4JA 4QUZA 3Q39A 3SJPA 5BSXA 4X7CA 4X7EA 3R6KA 3V7AA 4Z4WA 3BQJA 3Q6QA 4OPVA 5J35A 4RDKA 5IYPA 4Z4ZA 2ZL6A 4Z4VA 5IYQA 4X05A 5IYRA 4RPDA 4P2NA 4RDJA 4X07A 3SLNA 4OOSA 5F4MA
chains in the Genus database with same CATH superfamily
2RC5A 3ASRA 1Q86D 1COWA 1VQ6B 1FRNA 3BCFA 2X6XA 3GQBA 3AVWA 3T53B 1FRQA 3OAAA 5THXA 1VQ7B 1NDHA 3ONUA 4P6YA 3VO1A 4X0CA 4R71A 3OP1A 3KL9A 5FL7A 3ASQA 3QE2A 2WJVA 1E1QA 4YEJA 5FNZA 3WNBA 4WZTA 1KK0A 2VZLA 2XGJA 1V5VA 4C43A 4XMYA 1BPLA 4HIZA 4WWVA 4TT3A 4KKSA 3AVTA 1TUIA 2Q6KA 4M2LA 1RQRA 1BX0A 1G7CA 2V7UA 5JBQA 2ZZFA 2Q6OA 4WZLA 1Y0RA 1YIJB 3I1FA 1QUFA 4TKOB 4RD6A 1WSVA 3BH4A 1FX0A 2OBTA 2QDXA 4YXWA 2CRVA 2GREA 4Z4RA 3W2IA 1VQ8B 3ZPNA 1QFYA 1Q9SA 4MYUA 3VNUA 3ZBUA 3G4SB 4XLFA 1VQNB 2WSSA 3PUMA 3W5HA 1M1KD 3ES9A 3VO2A 1WP6A 2V4DA 1YLOA 2YWFA 1QFZA 2V7XA 2WZPP 4YALA 4ZGNB 1NJID 2M5SA 1ZM3A 3QFTA 1OB2A 2F4NA 3WY9A 1DDIA 2AHOA 1YX2A 3FPKA 2LZJA 4PC3A 5FA6A 2XZLA 1QVFB 1EFCA 1QX4A 4X8IA 1V0EA 4UZFA 2B5OA 1OHHA 1VHOA 4Z4UA 3BC9A 1QH0A 2QGGA 2XNJA 4Y9UA 4N3GA 5E6TA 1VQ4B 4DK1A 3B8HA 1FNCA 2FX3A 3ASSA 4TMXA 2VJIA 1N07A 5KNLA 3E20A 2OBRA 3LVBA 3ONYA 4MYTA 4QV2A 4XLAA 3OW2B 1K9MD 1UD6A 2ZBUA 1UD5A 2JJ1A 1E79A 4PC6A 4BPRA 3CC7B 2ZL7A 4ZCMA 1EP1B 4FXUA 4GQNA 4II2A 4YAFA 1Q81D 2VNIA 3WYAA 1H85A 2W6IA 4DNRB 2FVGA 2XNCA 3W5VA 1BLIA 3VMFA 2X6WA 2F43A 4XOTA 1YJNB 1H8HA 1SKQA 3V76A 5BSXA 1G7SA 1VLYA 4X7CA 4H9GA 1XB2A 3CCQB 3CCRB 2CNDA 1Q7YD 5DS0A 1VQMB 1IJEA 1SM4A 1ZM4A 3A8KA 4G7XA 2Q6IA 3FKSA 1YJ9B 4RCZA 1IB0A 2C5BA 3U6BA 2VNHA 4YAOA 1JA0A 2P3MA 4B43A 4Z4VA 3CC2B 1GVHA 3I55B 4P2NA 3T51B 3VR6A 1DARA 2VYQA 5TRDA 2BVNA 1UD2A 5DN6A 3WBKA 5HZAA 2Z6BD 2DCUA 5H59A 4HE5A 3JQRA 3SKBA 3CCMB 4XOPA 1W0KA 4QFMA 1VF7A 2BV3A 2V7QA 3BY2A 4IW3B 3RY8A 2NV4A 1OGIA 1DDGA 2VBVA 1QVGB 1VJSA 3GVKA 1OB0A 2OBSA 3MCAA 3CMMA 4B3XA 3WNDA 4OOXA 3SEJA 4RD3A 1T5EA 3P26A 4WZKA 2C77A 2DIEA 1WOOA 3CRZA 4UZUA 4ACBA 4Z4SA 1NB9A 1SKYB 4RJLA 5HKKA 1VQPB 1YHQB 4II3A 4LC0A 4RD2A 1IJFA 4PC7A 2ZZQA 4EH1A 1VQKB 1EFTA 3OJXA 4XKVA 2Q6LA 1EWYA 2CBXA 1VQLB 3ZIAA 1R5OA 2EFGA 1OB5A 4AF7A 2ZZGA 1YITB 4YELA 5EMNA 1TVCA 3DDYA 3CD6B 5TR9A 2XEXA 1YI2B 3CW2A 2EIXA 1CQXA 2PMDA 1N8RD 1WPCA 4AF6A 1TLLA 4P1VA 4C0SA 1D8TA 5AN9A 4RDLA 2GPJA 2QEXB 1GAQA 3OEEA 1MABA 3JU4A 1T6YA 2HLDA 4QVAA 2CK3A 4FN5A 3J81k 1KD1D 2DEUA 4RPBA 3OZVA 1D2EA 4XR6A 2XZOA 3CMAB 5GV8A 3AGPA 3MHPA 1S4MA 3SLDA 2R9VA 5LMZA 3JQQA 3OKXA 1B2RA 1UD8A 3FJOA 3PENA 3CCVB 3QSYA 2BGIA 4OP7A 4TMVA 3GVJA 4P25A 1ELOA 4N3NA 1XE1A 5CDFA 1HA3A 4M4SA 4ACAA 2X6YA 5BSYA 1FDRA 2E1RA 4FWTA 4XNFA 3CCUB 1KK3A 3OE7A 2VBTA 3W2HA 5KW9A 2I1LA 4Q7JB 2QA4B 4X7DA 2DOGA 3U6KA 1T6XA 3CPWB 2X8KA 1VHEA 2PIAA 1GJRA 3OW7A 5A8AA 4NNJA 1W0JA 1R5BA 5HXBA 1V0FA 2C5HA 4ASUA 3AVVA 5FO0A 1GAWA 4Z4WA 2GK6A 3AGQA 5FO1A 3CB4A 3H9NA 4OPVA 4XD7A 5J35A 2ZTNA 1U2RA 4Z4ZA 2F1MA 3VNVA 4PC1A 2D9RA 2F1LA 1D1NA 1VQ9B 3CP2A 4TMTA 1KTVA 1OGJA 4X05A 1WDTA 2GJPA 2J7KA 3GVLA 1QG0A 3QFRA 4RDJA 4OOSA 4X07A 4P6VF 1KMHA 1S0UA 1W35A 4KKTA 4XONA 3A1PA 2WJYA 2ZXIA 5TV2A 4HE6A 4NBSA 1KC8D 1M90D 3CXCB 4NCNA 2BM0A 3U2QA 4G6IA 1I8DA 3GSIA 2OTJB 3H94A 3CCLB 4M0LA 4ROXA 1KK2A 4PC2A 1EP2B 1PJ6A 4KKUA 5HZBA 4YAWA 2C4TA 2CC2A 1DG1G 1S72B 3G71B 5DSZA 1BQEA 1I7PA 1ZM2A 2X3UA 1I18A 1W34A 1RQPA 4B44A 2R6HA 3AVXA 5B6IA 3CESA 4Z1MA 3CCSB 5TY0A 4RLZA 1N0VC 4TMWA 4ZCIA 4G7WA 4TSFA 5J3OA 4FK8A 3MMPA 4DNTB 2XOKA 1W2BB 1PJ7A 4U9UA 2PE3A 3ASTA 2C78A 3LQ6A 4Z4TA 5A88A 2B7CA 3OFNA 3B82A 1H42A 2DYIA 4L8JA 2QMUA 3LQEA 1AIPA 3BCDA 3ASPA 1E62A 1G7TA 4RD4A 4XL9A 1F20A 2OYNA 4X06A 1KK1A 1Q82D 1EFUA 2ZITA 4PGOA 1KQSB 1E3XA 1ZUNB 3PA1A 2E1BA 3E1YE 4WZEA 5H5JA 1IHMA 2GK7A 4XN0A 2KVOA 3CCEB 1G7RA 2V7TA 3ZUGA 3SJZA 1HVXA 2RC6A 3Q6RA 2JDIA 3Q3AA 4Z4YA 5IYWA 4XORA 1F60A 2BGJA 4PAAA 4TN1A 2CW5A 1H8EA 3LO8A 1GR1A 4RD0A 2VJJA 1JNYA 3HAGA 1E43A 4G5GA 2DETA 2VNKA 1EP3B 2BN4A 4X7FA 4LBZA 2WYRA 4OPSA 4P12A 1BMFA 5F4JA 2BM1A 4B3FX 1CNFA 4QUZA 3Q39A 3SJPA 1BX1A 1N0UA 1VQOB 2HCJB 2OK8A 1JB9A 3B78A 2BMWA 1WOSA 3ISXA 4PABA 1TTTA 2OK7A 5A89A 3V7AA 1MRZA 2QN6A 2OTLB 2W6JA 3KEWA 4TMZA 5IK2A 2QE7A 3G6EB 1NBMA 5IYPA 5KSWB 3CP8A 2WZNA 3P27A 1N06A 4B4DA 2GJKA 1K8AD 5IYQA 1ZM9A 2X53S 5IYRA 4XLHA 2BF4A 3QFSA 2X85A 2C2WA 4RPDA 1FNDA 1W87A 4P3YA 1KJZA 1E64A 2BPOA 1UD3A 4UZEA 5F4MA 3OEHA 4YAUA 4P3IA 1KRHA 3CCJB 4XQFA 3WXMA 2X0KA 2HDNB 2ZBVA 3WQZA 3W2GA 4B3GA 4AVZA 4CQJA 4OPOA 4LBVA 2C4UA 3A3GA 3CPXA 3ZBTA 4DQKA 2XNDA 2D74A 2WR8A 4XN3A 3ZZ0A 3ZZTA 1K28D 2YWHA 2YWEA 4B48A 3R6JA 4RD1A 1YJWB 4LBYA 1P4MA 2JIZA 3PVDA 4G1BA 2VNJA 3OOCA 1N05A 3D26A 1B23P 3OZUA 1E63A 1EXMA 1BJKA 4ZV4A 1WOPA 4F7DA 4ZCLA 1CNEA 4JMQA 4QVJA 5GV7A 4RM0A 4DQLA 3FPPA 2WPDA 4QHYA 4OOVA 2ZL5A 1XQBA 3A8JA 2NPFA 3A35A 1NB0A 3PUNA 1WORA 2ZXHA 5F4OA 2B7BA 4XLEA 4B47A 3QFCA 3A8IA 3WBJA 2GQFA 2V7WA 1R5NA 4M53A 3PA2A 3CC4B 3AVYA 2XZPA 1PKVA 5IYNA 3GIRA 2QTZA 3LNNA 2D3NA 1KZLA 1EFRA 3W5UA 3CMEB 4P9SA 4WQMA 1XFOA 2V31A 2DERA 2HMAA 1QGYA 1WU8A 1VQ5B 1WSRA 1UMKA 4Y7CA 1FNMA 2BSAA 3CTAA 4P26A 1HZEA 1WTHD 3BNWA 4G1VA 3OJWA 4J0QA 2PLFA 3BY1A 1N08A 1GO2A 3JQPA 3Q38A 4LBWA 1E3ZA 3OPOA 4Y9RA 1W9XA 1UD4A 1NRKA 3OZWA 3G05A 2QTLA 1QGZA 1J9ZA 4XLCA 3WNCA 1QGAA 3ZC3A 5FIUA 2D3LA 4UAJA 4AC9A 2YWGA 1FNBA 1K73D 2VBSA 3A3BA 4X7EA 1JA1A 4E0FA 1AMOA 2VBUA 3R6KA 4ZGQB 3AVUA 3ZZUA 4DK0A 3I56B 2CF4A 3BQJA 3Q6QA 4P22A 4YHBA 1VLOA 5L46A 3NE5B 3W2EA 1A8PA 2ZZEA 2JJ2A 4XM3A 1QUEA 2ZTGA 4XKWA 4RDKA 2DY1A 1QFJA 1JJ2B 1PJ5A 4RCYA 2ZL6A 4M1KA 2GJRA 2V7VA 3W2FA 3SLNA 4K1XA 3T56B 1T6ZA 1E1RA 1Y0YA 2JN9A
chains in the Genus database with same CATH topology
3ASRA 4P3IA 5HZAA 3SKBA 3BY2A 3ONUA 4X0CA 4OPOA 4ROXA 3RY8A 2OBSA 3ASQA 4OOXA 3SEJA 5HZBA 4WZKA 3R6JA 4Z4SA 4WZTA 3PVDA 3D26A 4RLZA 5J3OA 4WZLA 4QVJA 4RM0A 2OBTA 4OOVA 4Z4RA 3ASTA 2ZL5A 3LQ6A 4Z4TA 3PUNA 3LQEA 5F4OA 3PUMA 3ASPA 4P1VA 4X06A 3PA2A 5IYNA 4RDLA 4QVAA 3PA1A 4WZEA 1IHMA 4RPBA 4Z4UA 3SLDA 3Q6RA 5E6TA 3Q3AA 4Z4YA 5IYWA 3ASSA 4OP7A 4P26A 2OBRA 3ONYA 4QV2A 4P25A 3BY1A 5BSYA 3Q38A 2ZL7A 4X7FA 5KW9A 4OPSA 4P12A 4X7DA 5F4JA 4QUZA 3Q39A 3SJPA 5BSXA 4X7CA 4X7EA 3R6KA 3V7AA 4Z4WA 3BQJA 3Q6QA 4OPVA 5J35A 4RDKA 5IYPA 4Z4ZA 2ZL6A 4Z4VA 5IYQA 4X05A 5IYRA 4RPDA 4P2NA 4RDJA 4X07A 3SLNA 4OOSA 5F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASR A;  4P3I A;  5HZA A;  3SKB A;  3BY2 A;  3ONU A;  4X0C A;  4OPO A;  4ROX A;  3RY8 A;  2OBS A;  3ASQ A;  4OOX A;  3SEJ A;  5HZB A;  4WZK A;  3R6J A;  4Z4S A;  4WZT A;  3PVD A;  3D26 A;  4RLZ A;  5J3O A;  4WZL A;  4QVJ A;  4RM0 A;  2OBT A;  4OOV A;  4Z4R A;  3AST A;  2ZL5 A;  3LQ6 A;  4Z4T A;  3PUN A;  3LQE A;  5F4O A;  3PUM A;  3ASP A;  4P1V A;  4X06 A;  3PA2 A;  5IYN A;  4RDL A;  4QVA A;  3PA1 A;  4WZE A;  1IHM A;  4RPB A;  4Z4U A;  3SLD A;  3Q6R A;  5E6T A;  3Q3A A;  4Z4Y A;  5IYW A;  3ASS A;  4OP7 A;  4P26 A;  2OBR A;  3ONY A;  4QV2 A;  4P25 A;  3BY1 A;  5BSY A;  3Q38 A;  2ZL7 A;  4X7F A;  5KW9 A;  4OPS A;  4P12 A;  4X7D A;  5F4J A;  4QUZ A;  3Q39 A;  3SJP A;  5BSX A;  4X7C A;  4X7E A;  3R6K A;  3V7A A;  4Z4W A;  3BQJ A;  3Q6Q A;  4OPV A;  5J35 A;  4RDK A;  5IYP A;  4Z4Z A;  2ZL6 A;  4Z4V A;  5IYQ A;  4X05 A;  5IYR A;  4RPD A;  4P2N A;  4RDJ A;  4X07 A;  3SLN A;  4OOS A;  5F4M A; 
#chains in the Genus database with same CATH topology
 2RC5 A;  3ASR A;  1Q86 D;  1COW A;  1VQ6 B;  1FRN A;  3BCF A;  2X6X A;  3GQB A;  3AVW A;  3T53 B;  1FRQ A;  3OAA A;  5THX A;  1VQ7 B;  1NDH A;  3ONU A;  4P6Y A;  3VO1 A;  4X0C A;  4R71 A;  3OP1 A;  3KL9 A;  5FL7 A;  3ASQ A;  3QE2 A;  2WJV A;  1E1Q A;  4YEJ A;  5FNZ A;  3WNB A;  4WZT A;  1KK0 A;  2VZL A;  2XGJ A;  1V5V A;  4C43 A;  4XMY A;  1BPL A;  4HIZ A;  4WWV A;  4TT3 A;  4KKS A;  3AVT A;  1TUI A;  2Q6K A;  4M2L A;  1RQR A;  1BX0 A;  1G7C A;  2V7U A;  5JBQ A;  2ZZF A;  2Q6O A;  4WZL A;  1Y0R A;  1YIJ B;  3I1F A;  1QUF A;  4TKO B;  4RD6 A;  1WSV A;  3BH4 A;  1FX0 A;  2OBT A;  2QDX A;  4YXW A;  2CRV A;  2GRE A;  4Z4R A;  3W2I A;  1VQ8 B;  3ZPN A;  1QFY A;  1Q9S A;  4MYU A;  3VNU A;  3ZBU A;  3G4S B;  4XLF A;  1VQN B;  2WSS A;  3PUM A;  3W5H A;  1M1K D;  3ES9 A;  3VO2 A;  1WP6 A;  2V4D A;  1YLO A;  2YWF A;  1QFZ A;  2V7X A;  2WZP P;  4YAL A;  4ZGN B;  1NJI D;  2M5S A;  1ZM3 A;  3QFT A;  1OB2 A;  2F4N A;  3WY9 A;  1DDI A;  2AHO A;  1YX2 A;  3FPK A;  2LZJ A;  4PC3 A;  5FA6 A;  2XZL A;  1QVF B;  1EFC A;  1QX4 A;  4X8I A;  1V0E A;  4UZF A;  2B5O A;  1OHH A;  1VHO A;  4Z4U A;  3BC9 A;  1QH0 A;  2QGG A;  2XNJ A;  4Y9U A;  4N3G A;  5E6T A;  1VQ4 B;  4DK1 A;  3B8H A;  1FNC A;  2FX3 A;  3ASS A;  4TMX A;  2VJI A;  1N07 A;  5KNL A;  3E20 A;  2OBR A;  3LVB A;  3ONY A;  4MYT A;  4QV2 A;  4XLA A;  3OW2 B;  1K9M D;  1UD6 A;  2ZBU A;  1UD5 A;  2JJ1 A;  1E79 A;  4PC6 A;  4BPR A;  3CC7 B;  2ZL7 A;  4ZCM A;  1EP1 B;  4FXU A;  4GQN A;  4II2 A;  4YAF A;  1Q81 D;  2VNI A;  3WYA A;  1H85 A;  2W6I A;  4DNR B;  2FVG A;  2XNC A;  3W5V A;  1BLI A;  3VMF A;  2X6W A;  2F43 A;  4XOT A;  1YJN B;  1H8H A;  1SKQ A;  3V76 A;  5BSX A;  1G7S A;  1VLY A;  4X7C A;  4H9G A;  1XB2 A;  3CCQ B;  3CCR B;  2CND A;  1Q7Y D;  5DS0 A;  1VQM B;  1IJE A;  1SM4 A;  1ZM4 A;  3A8K A;  4G7X A;  2Q6I A;  3FKS A;  1YJ9 B;  4RCZ A;  1IB0 A;  2C5B A;  3U6B A;  2VNH A;  4YAO A;  1JA0 A;  2P3M A;  4B43 A;  4Z4V A;  3CC2 B;  1GVH A;  3I55 B;  4P2N A;  3T51 B;  3VR6 A;  1DAR A;  2VYQ A;  5TRD A;  2BVN A;  1UD2 A;  5DN6 A;  3WBK A;  5HZA A;  2Z6B D;  2DCU A;  5H59 A;  4HE5 A;  3JQR A;  3SKB A;  3CCM B;  4XOP A;  1W0K A;  4QFM A;  1VF7 A;  2BV3 A;  2V7Q A;  3BY2 A;  4IW3 B;  3RY8 A;  2NV4 A;  1OGI A;  1DDG A;  2VBV A;  1QVG B;  1VJS A;  3GVK A;  1OB0 A;  2OBS A;  3MCA A;  3CMM A;  4B3X A;  3WND A;  4OOX A;  3SEJ A;  4RD3 A;  1T5E A;  3P26 A;  4WZK A;  2C77 A;  2DIE A;  1WOO A;  3CRZ A;  4UZU A;  4ACB A;  4Z4S A;  1NB9 A;  1SKY B;  4RJL A;  5HKK A;  1VQP B;  1YHQ B;  4II3 A;  4LC0 A;  4RD2 A;  1IJF A;  4PC7 A;  2ZZQ A;  4EH1 A;  1VQK B;  1EFT A;  3OJX A;  4XKV A;  2Q6L A;  1EWY A;  2CBX A;  1VQL B;  3ZIA A;  1R5O A;  2EFG A;  1OB5 A;  4AF7 A;  2ZZG A;  1YIT B;  4YEL A;  5EMN A;  1TVC A;  3DDY A;  3CD6 B;  5TR9 A;  2XEX A;  1YI2 B;  3CW2 A;  2EIX A;  1CQX A;  2PMD A;  1N8R D;  1WPC A;  4AF6 A;  1TLL A;  4P1V A;  4C0S A;  1D8T A;  5AN9 A;  4RDL A;  2GPJ A;  2QEX B;  1GAQ A;  3OEE A;  1MAB A;  3JU4 A;  1T6Y A;  2HLD A;  4QVA A;  2CK3 A;  4FN5 A;  3J81 k;  1KD1 D;  2DEU A;  4RPB A;  3OZV A;  1D2E A;  4XR6 A;  2XZO A;  3CMA B;  5GV8 A;  3AGP A;  3MHP A;  1S4M A;  3SLD A;  2R9V A;  5LMZ A;  3JQQ A;  3OKX A;  1B2R A;  1UD8 A;  3FJO A;  3PEN A;  3CCV B;  3QSY A;  2BGI A;  4OP7 A;  4TMV A;  3GVJ A;  4P25 A;  1ELO A;  4N3N A;  1XE1 A;  5CDF A;  1HA3 A;  4M4S A;  4ACA A;  2X6Y A;  5BSY A;  1FDR A;  2E1R A;  4FWT A;  4XNF A;  3CCU B;  1KK3 A;  3OE7 A;  2VBT A;  3W2H A;  5KW9 A;  2I1L A;  4Q7J B;  2QA4 B;  4X7D A;  2DOG A;  3U6K A;  1T6X A;  3CPW B;  2X8K A;  1VHE A;  2PIA A;  1GJR A;  3OW7 A;  5A8A A;  4NNJ A;  1W0J A;  1R5B A;  5HXB A;  1V0F A;  2C5H A;  4ASU A;  3AVV A;  5FO0 A;  1GAW A;  4Z4W A;  2GK6 A;  3AGQ A;  5FO1 A;  3CB4 A;  3H9N A;  4OPV A;  4XD7 A;  5J35 A;  2ZTN A;  1U2R A;  4Z4Z A;  2F1M A;  3VNV A;  4PC1 A;  2D9R A;  2F1L A;  1D1N A;  1VQ9 B;  3CP2 A;  4TMT A;  1KTV A;  1OGJ A;  4X05 A;  1WDT A;  2GJP A;  2J7K A;  3GVL A;  1QG0 A;  3QFR A;  4RDJ A;  4OOS A;  4X07 A;  4P6V F;  1KMH A;  1S0U A;  1W35 A;  4KKT A;  4XON A;  3A1P A;  2WJY A;  2ZXI A;  5TV2 A;  4HE6 A;  4NBS A;  1KC8 D;  1M90 D;  3CXC B;  4NCN A;  2BM0 A;  3U2Q A;  4G6I A;  1I8D A;  3GSI A;  2OTJ B;  3H94 A;  3CCL B;  4M0L A;  4ROX A;  1KK2 A;  4PC2 A;  1EP2 B;  1PJ6 A;  4KKU A;  5HZB A;  4YAW A;  2C4T A;  2CC2 A;  1DG1 G;  1S72 B;  3G71 B;  5DSZ A;  1BQE A;  1I7P A;  1ZM2 A;  2X3U A;  1I18 A;  1W34 A;  1RQP A;  4B44 A;  2R6H A;  3AVX A;  5B6I A;  3CES A;  4Z1M A;  3CCS B;  5TY0 A;  4RLZ A;  1N0V C;  4TMW A;  4ZCI A;  4G7W A;  4TSF A;  5J3O A;  4FK8 A;  3MMP A;  4DNT B;  2XOK A;  1W2B B;  1PJ7 A;  4U9U A;  2PE3 A;  3AST A;  2C78 A;  3LQ6 A;  4Z4T A;  5A88 A;  2B7C A;  3OFN A;  3B82 A;  1H42 A;  2DYI A;  4L8J A;  2QMU A;  3LQE A;  1AIP A;  3BCD A;  3ASP A;  1E62 A;  1G7T A;  4RD4 A;  4XL9 A;  1F20 A;  2OYN A;  4X06 A;  1KK1 A;  1Q82 D;  1EFU A;  2ZIT A;  4PGO A;  1KQS B;  1E3X A;  1ZUN B;  3PA1 A;  2E1B A;  3E1Y E;  4WZE A;  5H5J A;  1IHM A;  2GK7 A;  4XN0 A;  2KVO A;  3CCE B;  1G7R A;  2V7T A;  3ZUG A;  3SJZ A;  1HVX A;  2RC6 A;  3Q6R A;  2JDI A;  3Q3A A;  4Z4Y A;  5IYW A;  4XOR A;  1F60 A;  2BGJ A;  4PAA A;  4TN1 A;  2CW5 A;  1H8E A;  3LO8 A;  1GR1 A;  4RD0 A;  2VJJ A;  1JNY A;  3HAG A;  1E43 A;  4G5G A;  2DET A;  2VNK A;  1EP3 B;  2BN4 A;  4X7F A;  4LBZ A;  2WYR A;  4OPS A;  4P12 A;  1BMF A;  5F4J A;  2BM1 A;  4B3F X;  1CNF A;  4QUZ A;  3Q39 A;  3SJP A;  1BX1 A;  1N0U A;  1VQO B;  2HCJ B;  2OK8 A;  1JB9 A;  3B78 A;  2BMW A;  1WOS A;  3ISX A;  4PAB A;  1TTT A;  2OK7 A;  5A89 A;  3V7A A;  1MRZ A;  2QN6 A;  2OTL B;  2W6J A;  3KEW A;  4TMZ A;  5IK2 A;  2QE7 A;  3G6E B;  1NBM A;  5IYP A;  5KSW B;  3CP8 A;  2WZN A;  3P27 A;  1N06 A;  4B4D A;  2GJK A;  1K8A D;  5IYQ A;  1ZM9 A;  2X53 S;  5IYR A;  4XLH A;  2BF4 A;  3QFS A;  2X85 A;  2C2W A;  4RPD A;  1FND A;  1W87 A;  4P3Y A;  1KJZ A;  1E64 A;  2BPO A;  1UD3 A;  4UZE A;  5F4M A;  3OEH A;  4YAU A;  4P3I A;  1KRH A;  3CCJ B;  4XQF A;  3WXM A;  2X0K A;  2HDN B;  2ZBV A;  3WQZ A;  3W2G A;  4B3G A;  4AVZ A;  4CQJ A;  4OPO A;  4LBV A;  2C4U A;  3A3G A;  3CPX A;  3ZBT A;  4DQK A;  2XND A;  2D74 A;  2WR8 A;  4XN3 A;  3ZZ0 A;  3ZZT A;  1K28 D;  2YWH A;  2YWE A;  4B48 A;  3R6J A;  4RD1 A;  1YJW B;  4LBY A;  1P4M A;  2JIZ A;  3PVD A;  4G1B A;  2VNJ A;  3OOC A;  1N05 A;  3D26 A;  1B23 P;  3OZU A;  1E63 A;  1EXM A;  1BJK A;  4ZV4 A;  1WOP A;  4F7D A;  4ZCL A;  1CNE A;  4JMQ A;  4QVJ A;  5GV7 A;  4RM0 A;  4DQL A;  3FPP A;  2WPD A;  4QHY A;  4OOV A;  2ZL5 A;  1XQB A;  3A8J A;  2NPF A;  3A35 A;  1NB0 A;  3PUN A;  1WOR A;  2ZXH A;  5F4O A;  2B7B A;  4XLE A;  4B47 A;  3QFC A;  3A8I A;  3WBJ A;  2GQF A;  2V7W A;  1R5N A;  4M53 A;  3PA2 A;  3CC4 B;  3AVY A;  2XZP A;  1PKV A;  5IYN A;  3GIR A;  2QTZ A;  3LNN A;  2D3N A;  1KZL A;  1EFR A;  3W5U A;  3CME B;  4P9S A;  4WQM A;  1XFO A;  2V31 A;  2DER A;  2HMA A;  1QGY A;  1WU8 A;  1VQ5 B;  1WSR A;  1UMK A;  4Y7C A;  1FNM A;  2BSA A;  3CTA A;  4P26 A;  1HZE A;  1WTH D;  3BNW A;  4G1V A;  3OJW A;  4J0Q A;  2PLF A;  3BY1 A;  1N08 A;  1GO2 A;  3JQP A;  3Q38 A;  4LBW A;  1E3Z A;  3OPO A;  4Y9R A;  1W9X A;  1UD4 A;  1NRK A;  3OZW A;  3G05 A;  2QTL A;  1QGZ A;  1J9Z A;  4XLC A;  3WNC A;  1QGA A;  3ZC3 A;  5FIU A;  2D3L A;  4UAJ A;  4AC9 A;  2YWG A;  1FNB A;  1K73 D;  2VBS A;  3A3B A;  4X7E A;  1JA1 A;  4E0F A;  1AMO A;  2VBU A;  3R6K A;  4ZGQ B;  3AVU A;  3ZZU A;  4DK0 A;  3I56 B;  2CF4 A;  3BQJ A;  3Q6Q A;  4P22 A;  4YHB A;  1VLO A;  5L46 A;  3NE5 B;  3W2E A;  1A8P A;  2ZZE A;  2JJ2 A;  4XM3 A;  1QUE A;  2ZTG A;  4XKW A;  4RDK A;  2DY1 A;  1QFJ A;  1JJ2 B;  1PJ5 A;  4RCY A;  2ZL6 A;  4M1K A;  2GJR A;  2V7V A;  3W2F A;  3SLN A;  4K1X A;  3T56 B;  1T6Z A;  1E1R A;  1Y0Y A;  2JN9 A; 
#chains in the Genus database with same CATH homology
 3ASR A;  4P3I A;  5HZA A;  3SKB A;  3BY2 A;  3ONU A;  4X0C A;  4OPO A;  4ROX A;  3RY8 A;  2OBS A;  3ASQ A;  4OOX A;  3SEJ A;  5HZB A;  4WZK A;  3R6J A;  4Z4S A;  4WZT A;  3PVD A;  3D26 A;  4RLZ A;  5J3O A;  4WZL A;  4QVJ A;  4RM0 A;  2OBT A;  4OOV A;  4Z4R A;  3AST A;  2ZL5 A;  3LQ6 A;  4Z4T A;  3PUN A;  3LQE A;  5F4O A;  3PUM A;  3ASP A;  4P1V A;  4X06 A;  3PA2 A;  5IYN A;  4RDL A;  4QVA A;  3PA1 A;  4WZE A;  1IHM A;  4RPB A;  4Z4U A;  3SLD A;  3Q6R A;  5E6T A;  3Q3A A;  4Z4Y A;  5IYW A;  3ASS A;  4OP7 A;  4P26 A;  2OBR A;  3ONY A;  4QV2 A;  4P25 A;  3BY1 A;  5BSY A;  3Q38 A;  2ZL7 A;  4X7F A;  5KW9 A;  4OPS A;  4P12 A;  4X7D A;  5F4J A;  4QUZ A;  3Q39 A;  3SJP A;  5BSX A;  4X7C A;  4X7E A;  3R6K A;  3V7A A;  4Z4W A;  3BQJ A;  3Q6Q A;  4OPV A;  5J35 A;  4RDK A;  5IYP A;  4Z4Z A;  2ZL6 A;  4Z4V A;  5IYQ A;  4X05 A;  5IYR A;  4RPD A;  4P2N A;  4RDJ A;  4X07 A;  3SLN A;  4OOS A;  5F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...