4ROXA

Crystal structure of p domain of hawaii norovirus (gii.1)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
305
structure length
299
Chain Sequence
GPGSKPFTLPILTIGELSNSRFPVPIDELYTSPNEGVIVQPQNGRSTLDGELLGTTQLVPSNICALRGRINAQVDHHQWNLQVTNTNGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPNNTCRAHDGVLATWSPKFTPKLGSVILGTWLDLNQPTRFTPVGLFNTDHFDQWALPSYSGRLTLNMNLAPSVSPLFPGEQLLFFRSHIPLKGGTSDGAIDCLLPQEWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norovirus hu/gii.1/7ek/hawaii/1971/usa
molecule tags Viral protein
total genus 72
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4roxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4roxA01
3ASSA 4RPBA 4Z4ZA 5J35A 3Q38A 3Q39A 4OOXA 3PUMA 4WZKA 4QVAA 5IYNA 5BSYA 4RPDA 4RLZA 3ASRA 3D26A 4WZLA 2OBTA 4OPOA 4OP7A 3R6JA 4P26A 2OBSA 4QUZA 5F4MA 3Q6QA 3PUNA 4P25A 2ZL6A 5IYRA 5HZBA 1IHMA 3BY1A 5E6TA 4P1VA 4Z4UA 4X7FA 4RDJA 3SKBA 5IYQA 3ASPA 3LQEA 4P3IA 3Q3AA 5IYPA 2ZL7A 4X7CA 5F4JA 3LQ6A 4QV2A 3R6KA 4X0CA 2ZL5A 4P2NA 4Z4WA 3Q6RA 2OBRA 4X06A 4X05A 4Z4VA 3V7AA 4OPSA 3PVDA 4RDLA 3ONUA 5F4OA 4ROXA 3BY2A 4OPVA 5J3OA 4RM0A 3PA1A 3SEJA 5BSXA 5IYWA 4X07A 4QVJA 4X7EA 4X7DA 4OOVA 4WZTA 3RY8A 4RDKA 4Z4RA 3SLNA 5KW9A 4P12A 3SJPA 4Z4TA 5HZAA 3BQJA 3ASQA 3ONYA 4OOSA 3ASTA 3PA2A 4WZEA 4Z4YA 4Z4SA 3SLDA
chains in the Genus database with same CATH superfamily
2VNIA 4DNRB 1UD6A 1KK2A 2WSSA 1SKQA 4OOXA 2QE7A 2VNHA 5IYNA 3MHPA 2BM1A 3LNNA 2QTLA 1F60A 4RPDA 3ZZUA 2D74A 2WJYA 3CCQB 1K28D 3A8KA 2F1LA 1OGJA 2XZPA 4UZUA 3VO2A 2V7XA 4RD1A 2E1RA 2JJ2A 2OBTA 5EMNA 1BLIA 1VF7A 4UAJA 1JB9A 2XZOA 1R5NA 3W5UA 3CTAA 4ACAA 5DS0A 2P3MA 4G1VA 3CCJB 1JNYA 1OHHA 2CW5A 4G7XA 3CMEB 5IYRA 5HZBA 5E6TA 4Z4UA 1JJ2B 1PJ6A 1EFRA 3U6BA 4B48A 1T5EA 1MABA 5GV7A 2QDXA 3BCFA 1HVXA 4ACBA 3BCDA 1T6ZA 3ES9A 1H8EA 1VLOA 4C43A 1R5OA 3FPPA 2W6IA 1I8DA 4LC0A 4P3YA 4IW3B 4QV2A 3FKSA 3WNDA 3R6KA 3OKXA 2CC2A 4XQFA 2V7UA 5IK2A 4YXWA 2OK8A 4QFMA 4UZFA 4YAFA 3B78A 1D1NA 1YJ9B 4P2NA 2GJKA 1VQMB 2OK7A 4RCZA 2Q6LA 2BN4A 2W6JA 1JA0A 1J9ZA 1P4MA 1VQKB 4X05A 2WR8A 3V7AA 3E20A 4OPSA 1KK1A 4ZGQB 3CCRB 2ZTNA 1SM4A 2V4DA 3OP1A 2GREA 1QVFB 2QEXB 5F4OA 4ZCLA 4ROXA 3I56B 1XB2A 4HE5A 3BY2A 4OPVA 4KKTA 3CPWB 4RD2A 1E1RA 4DK0A 2YWEA 2VBUA 1FNDA 3WNBA 1ELOA 5TV2A 1FX0A 2D3LA 2V7QA 4DQLA 2Z6BD 2NPFA 1VJSA 4Y9RA 4X7DA 4RJLA 1VQPB 4OOVA 4II2A 4XOPA 4ASUA 1W0JA 2YWHA 2B7BA 3RY8A 2VYQA 2WJVA 4YAWA 4H9GA 1VHEA 4XL9A 4LBVA 5HXBA 5H5JA 1YIJB 3VMFA 3AGQA 1N07A 4XD7A 4YAUA 1QG0A 1W34A 1WOPA 1OB0A 4XKVA 4XMYA 3CPXA 1KD1D 4Z4TA 3B8HA 3J81k 3A3GA 4TMTA 4B3FX 5TRDA 4OOSA 3LVBA 1H42A 1VLYA 4TMZA 2JJ1A 2C4TA 2B5OA 3QFRA 4EH1A 4RD4A 4Z4ZA 4YALA 3OE7A 1PJ5A 3VNVA 2C5BA 3OEHA 5BSYA 1YHQB 4YAOA 4MYTA 4RLZA 1QH0A 1GAWA 3D26A 4AVZA 1OB5A 2CRVA 1NBMA 2ZZGA 2JDIA 5FO0A 1COWA 1QGAA 1IJEA 1DARA 1CQXA 4XONA 3GVKA 3GVJA 4RD3A 1YJWB 4XLEA 2X6WA 2CNDA 3OJXA 4Y7CA 1M90D 2OBSA 3Q6QA 2GPJA 3PUNA 4II3A 3CC4B 3W2GA 3I55B 2ZL6A 2XNDA 2QA4B 3BY1A 4M0LA 2ZBVA 4X7FA 1E64A 2Q6IA 4DK1A 3JQPA 3SKBA 1JA1A 1QX4A 1E3ZA 5IYQA 2DETA 1Q86D 2VBSA 3CB4A 1YITB 3GVLA 5FL7A 1G7TA 4P3IA 4LBYA 2XZLA 2R6HA 1GVHA 2ZZEA 4X7CA 1W87A 4FWTA 1H8HA 3ZC3A 3WQZA 4X0CA 4XN3A 1G7RA 1S4MA 2WZPP 1AIPA 3ZPNA 3CC2B 4KKUA 3GSIA 3AVXA 1QGZA 2CF4A 1CNFA 3CXCB 1KC8D 3AGPA 4XOTA 2JN9A 2KVOA 2ZZFA 4G1BA 4FK8A 4PGOA 4B44A 5A88A 2OYNA 3CC7B 2DEUA 4X06A 1E1QA 2XOKA 4Z4VA 1N0VC 1VQ8B 4WWVA 5TR9A 4RDLA 4XN0A 3OEEA 4KKSA 4NNJA 5J3OA 5GV8A 1OB2A 1KTVA 2E1BA 1A8PA 4FXUA 3SEJA 3OZUA 1Y0RA 4AF7A 2Q6OA 5IYWA 1SKYB 3V76A 3LO8A 2DY1A 4TMXA 1T6XA 4XLFA 3AVVA 3OAAA 3ZBUA 1DDIA 4G6IA 4XLAA 3A8IA 3CCEB 5B6IA 1VQ4B 5KNLA 4WZTA 1WTHD 2WPDA 1FDRA 4RDKA 1E43A 3CCVB 2BF4A 2RC5A 3SLNA 2PLFA 4DQKA 1K8AD 1NDHA 1V0FA 2C2WA 1HZEA 2FX3A 3B82A 5JBQA 3CESA 4M4SA 2B7CA 2ZZQA 4R71A 3P27A 1VQOB 3CW2A 2D3NA 1EP2B 1EFCA 3SJPA 3W2HA 1I18A 5HZAA 3ZBTA 3NE5B 1KJZA 1KQSB 2HMAA 3WBJA 3FPKA 2HLDA 2VJJA 4Z4YA 4P22A 1BX0A 1VQNB 2X6XA 4YELA 3Q38A 3Q39A 2XEXA 3PUMA 3AVYA 3JQRA 2VJIA 2OTLB 1ZUNB 2OTJB 3ZUGA 4CQJA 2V7VA 3DDYA 5THXA 2BPOA 3QFCA 3WBKA 3ASRA 2X6YA 1AMOA 2C77A 2EIXA 4L8JA 4YEJA 1NB9A 3ZZ0A 5KSWB 1CNEA 1TTTA 4WZLA 3QE2A 4TT3A 3QFSA 1Q82D 4XR6A 4ZCMA 4GQNA 1KK3A 5DSZA 2X85A 4OP7A 4AC9A 1BQEA 1N06A 5FO1A 4P26A 2AHOA 2QN6A 1H85A 4PC7A 2ZXHA 4NBSA 4P25A 1G7SA 2ZITA 2V31A 4XKWA 1IJFA 3E1YE 1IHMA 3OFNA 3VR6A 1KZLA 3CD6B 4TSFA 3KL9A 1D2EA 4TMWA 5H59A 3ASPA 3LQEA 1WPCA 4QHYA 3T53B 2VNKA 4WQMA 2ZXIA 4XLHA 1YI2B 1N05A 4TKOB 2ZL7A 1KRHA 1Y0YA 3WYAA 1UD5A 1GR1A 1GAQA 2DOGA 4B4DA 1EP1B 4NCNA 3W2EA 2C5HA 1Q9SA 2F1MA 1WU8A 4M53A 1D8TA 1E3XA 1TUIA 2VBTA 2CK3A 1WP6A 3OJWA 1N08A 4LBWA 3KEWA 1BPLA 4RD0A 3U2QA 4Z4WA 4PC1A 1ZM3A 3Q6RA 2XNCA 4AF6A 4B3GA 1QFZA 2GK6A 2R9VA 2YWFA 1EFTA 3PVDA 3W2FA 1ZM4A 3ONUA 1PKVA 1R5BA 2BMWA 2WZNA 2X53S 3VNUA 2DIEA 3PA1A 3OPOA 1I7PA 4K1XA 3QSYA 2ZBUA 2GJRA 5BSXA 2QGGA 2M5SA 1UMKA 2XNJA 3CP2A 4UZEA 4XNFA 4X07A 4B47A 3OW7A 4ZV4A 5HKKA 1BMFA 1PJ7A 4QVJA 3PENA 2X3UA 3CP8A 4M2LA 4MYUA 1NB0A 5A8AA 2BGIA 2BVNA 4TMVA 1XFOA 4N3GA 5DN6A 1XQBA 4Z4RA 3G6EB 1TLLA 3BH4A 1NRKA 1YLOA 1RQRA 1EXMA 3W5VA 2V7WA 1FRNA 1V5VA 3WXMA 1UD8A 1E63A 4B3XA 3BNWA 4ZCIA 1W9XA 2BGJA 2C78A 1WORA 4P12A 3A35A 1QUFA 1ZM9A 2XGJA 3T56B 3G4SB 2V7TA 4N3NA 2VBVA 1N0UA 3ASQA 3ONYA 1K73D 4P9SA 3ASTA 4PC6A 1WSVA 4WZEA 3U6KA 3CCMB 4Z4SA 2DCUA 3SLDA 3ASSA 4PAAA 2BSAA 1G7CA 1WOOA 2PIAA 4RPBA 1WSRA 3MMPA 5J35A 4PABA 4WZKA 1Q81D 2BV3A 4QVAA 4PC2A 4C0SA 2DYIA 2Q6KA 4RD6A 3FJOA 1OGIA 1KK0A 4J0QA 1VQ6B 1VQLB 2GK7A 4Y9UA 1GJRA 3G05A 2GQFA 3T51B 2CBXA 1VQ9B 4BPRA 1N8RD 1EWYA 1HA3A 1YX2A 4X8IA 4B43A 2HDNB 2F43A 4OPOA 1Q7YD 1E79A 3CMAB 1GO2A 3R6JA 1W0KA 3OZWA 4QUZA 3AVTA 5F4MA 5TY0A 1FRQA 1K9MD 2DERA 1ZM2A 1UD3A 3H94A 2D9RA 3QFTA 3VO1A 3MCAA 4P1VA 2PE3A 2PMDA 4RCYA 4RDJA 3CMMA 4FN5A 2I1LA 2JIZA 4LBZA 4HE6A 1FNMA 1U2RA 3ZIAA 2NV4A 2VZLA 3A8JA 3A3BA 2YWGA 3H9NA 3I1FA 3Q3AA 3W2IA 5IYPA 1BJKA 4U9UA 5FA6A 1MRZA 2X8KA 5A89A 1YJNB 5F4JA 1QUEA 1KMHA 1QFYA 3LQ6A 4XLCA 1DDGA 1E62A 1F20A 2ZL5A 4ZGNB 1XE1A 3GIRA 1QFJA 2RC6A 2WYRA 2J7KA 3BC9A 2GJPA 4XORA 1S72B 3ISXA 1EP3B 1M1KD 1WDTA 2OBRA 2EFGA 1QGYA 1NJID 2FVGA 4HIZA 3ZZTA 1UD4A 1RQPA 5AN9A 2ZTGA 3WY9A 5LMZA 4PC3A 4M1KA 3W5HA 4RM0A 4JMQA 1UD2A 3AVUA 4P6YA 3HAGA 3AVWA 3SJZA 1BX1A 1B2RA 3OZVA 1V0EA 1VQ5B 1W35A 2VNJA 2C4UA 5L46A 2LZJA 2X0KA 4G5GA 4X7EA 1EFUA 4YHBA 3JU4A 3CCSB 2QTZA 4DNTB 3OOCA 4TN1A 1VHOA 2BM0A 4G7WA 1S0UA 1WOSA 2F4NA 3G71B 5CDFA 1FNBA 5FIUA 2HCJB 4F7DA 4Q7JB 3JQQA 5FNZA 3CCUB 1T6YA 5KW9A 1IB0A 4Z1MA 4P6VF 3WNCA 1FNCA 3OW2B 2QMUA 1QVGB 1VQ7B 3CCLB 1TVCA 3P26A 3BQJA 4E0FA 3A1PA 1W2BB 3CRZA 3PA2A 3GQBA 1DG1G 1B23P 4XM3A
chains in the Genus database with same CATH topology
3ASSA 4RPBA 4Z4ZA 5J35A 3Q38A 3Q39A 4OOXA 3PUMA 4WZKA 4QVAA 5IYNA 5BSYA 4RPDA 4RLZA 3ASRA 3D26A 4WZLA 2OBTA 4OPOA 4OP7A 3R6JA 4P26A 2OBSA 4QUZA 5F4MA 3Q6QA 3PUNA 4P25A 2ZL6A 5IYRA 5HZBA 1IHMA 3BY1A 5E6TA 4P1VA 4Z4UA 4X7FA 4RDJA 3SKBA 5IYQA 3ASPA 3LQEA 4P3IA 3Q3AA 5IYPA 2ZL7A 4X7CA 5F4JA 3LQ6A 4QV2A 3R6KA 4X0CA 2ZL5A 4P2NA 4Z4WA 3Q6RA 2OBRA 4X06A 4X05A 4Z4VA 3V7AA 4OPSA 3PVDA 4RDLA 3ONUA 5F4OA 4ROXA 3BY2A 4OPVA 5J3OA 4RM0A 3PA1A 3SEJA 5BSXA 5IYWA 4X07A 4QVJA 4X7EA 4X7DA 4OOVA 4WZTA 3RY8A 4RDKA 4Z4RA 3SLNA 5KW9A 4P12A 3SJPA 4Z4TA 5HZAA 3BQJA 3ASQA 3ONYA 4OOSA 3ASTA 3PA2A 4WZEA 4Z4YA 4Z4SA 3SLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASS A;  4RPB A;  4Z4Z A;  5J35 A;  3Q38 A;  3Q39 A;  4OOX A;  3PUM A;  4WZK A;  4QVA A;  5IYN A;  5BSY A;  4RPD A;  4RLZ A;  3ASR A;  3D26 A;  4WZL A;  2OBT A;  4OPO A;  4OP7 A;  3R6J A;  4P26 A;  2OBS A;  4QUZ A;  5F4M A;  3Q6Q A;  3PUN A;  4P25 A;  2ZL6 A;  5IYR A;  5HZB A;  1IHM A;  3BY1 A;  5E6T A;  4P1V A;  4Z4U A;  4X7F A;  4RDJ A;  3SKB A;  5IYQ A;  3ASP A;  3LQE A;  4P3I A;  3Q3A A;  5IYP A;  2ZL7 A;  4X7C A;  5F4J A;  3LQ6 A;  4QV2 A;  3R6K A;  4X0C A;  2ZL5 A;  4P2N A;  4Z4W A;  3Q6R A;  2OBR A;  4X06 A;  4X05 A;  4Z4V A;  3V7A A;  4OPS A;  3PVD A;  4RDL A;  3ONU A;  5F4O A;  4ROX A;  3BY2 A;  4OPV A;  5J3O A;  4RM0 A;  3PA1 A;  3SEJ A;  5BSX A;  5IYW A;  4X07 A;  4QVJ A;  4X7E A;  4X7D A;  4OOV A;  4WZT A;  3RY8 A;  4RDK A;  4Z4R A;  3SLN A;  5KW9 A;  4P12 A;  3SJP A;  4Z4T A;  5HZA A;  3BQJ A;  3ASQ A;  3ONY A;  4OOS A;  3AST A;  3PA2 A;  4WZE A;  4Z4Y A;  4Z4S A;  3SLD A; 
#chains in the Genus database with same CATH topology
 2VNI A;  4DNR B;  1UD6 A;  1KK2 A;  2WSS A;  1SKQ A;  4OOX A;  2QE7 A;  2VNH A;  5IYN A;  3MHP A;  2BM1 A;  3LNN A;  2QTL A;  1F60 A;  4RPD A;  3ZZU A;  2D74 A;  2WJY A;  3CCQ B;  1K28 D;  3A8K A;  2F1L A;  1OGJ A;  2XZP A;  4UZU A;  3VO2 A;  2V7X A;  4RD1 A;  2E1R A;  2JJ2 A;  2OBT A;  5EMN A;  1BLI A;  1VF7 A;  4UAJ A;  1JB9 A;  2XZO A;  1R5N A;  3W5U A;  3CTA A;  4ACA A;  5DS0 A;  2P3M A;  4G1V A;  3CCJ B;  1JNY A;  1OHH A;  2CW5 A;  4G7X A;  3CME B;  5IYR A;  5HZB A;  5E6T A;  4Z4U A;  1JJ2 B;  1PJ6 A;  1EFR A;  3U6B A;  4B48 A;  1T5E A;  1MAB A;  5GV7 A;  2QDX A;  3BCF A;  1HVX A;  4ACB A;  3BCD A;  1T6Z A;  3ES9 A;  1H8E A;  1VLO A;  4C43 A;  1R5O A;  3FPP A;  2W6I A;  1I8D A;  4LC0 A;  4P3Y A;  4IW3 B;  4QV2 A;  3FKS A;  3WND A;  3R6K A;  3OKX A;  2CC2 A;  4XQF A;  2V7U A;  5IK2 A;  4YXW A;  2OK8 A;  4QFM A;  4UZF A;  4YAF A;  3B78 A;  1D1N A;  1YJ9 B;  4P2N A;  2GJK A;  1VQM B;  2OK7 A;  4RCZ A;  2Q6L A;  2BN4 A;  2W6J A;  1JA0 A;  1J9Z A;  1P4M A;  1VQK B;  4X05 A;  2WR8 A;  3V7A A;  3E20 A;  4OPS A;  1KK1 A;  4ZGQ B;  3CCR B;  2ZTN A;  1SM4 A;  2V4D A;  3OP1 A;  2GRE A;  1QVF B;  2QEX B;  5F4O A;  4ZCL A;  4ROX A;  3I56 B;  1XB2 A;  4HE5 A;  3BY2 A;  4OPV A;  4KKT A;  3CPW B;  4RD2 A;  1E1R A;  4DK0 A;  2YWE A;  2VBU A;  1FND A;  3WNB A;  1ELO A;  5TV2 A;  1FX0 A;  2D3L A;  2V7Q A;  4DQL A;  2Z6B D;  2NPF A;  1VJS A;  4Y9R A;  4X7D A;  4RJL A;  1VQP B;  4OOV A;  4II2 A;  4XOP A;  4ASU A;  1W0J A;  2YWH A;  2B7B A;  3RY8 A;  2VYQ A;  2WJV A;  4YAW A;  4H9G A;  1VHE A;  4XL9 A;  4LBV A;  5HXB A;  5H5J A;  1YIJ B;  3VMF A;  3AGQ A;  1N07 A;  4XD7 A;  4YAU A;  1QG0 A;  1W34 A;  1WOP A;  1OB0 A;  4XKV A;  4XMY A;  3CPX A;  1KD1 D;  4Z4T A;  3B8H A;  3J81 k;  3A3G A;  4TMT A;  4B3F X;  5TRD A;  4OOS A;  3LVB A;  1H42 A;  1VLY A;  4TMZ A;  2JJ1 A;  2C4T A;  2B5O A;  3QFR A;  4EH1 A;  4RD4 A;  4Z4Z A;  4YAL A;  3OE7 A;  1PJ5 A;  3VNV A;  2C5B A;  3OEH A;  5BSY A;  1YHQ B;  4YAO A;  4MYT A;  4RLZ A;  1QH0 A;  1GAW A;  3D26 A;  4AVZ A;  1OB5 A;  2CRV A;  1NBM A;  2ZZG A;  2JDI A;  5FO0 A;  1COW A;  1QGA A;  1IJE A;  1DAR A;  1CQX A;  4XON A;  3GVK A;  3GVJ A;  4RD3 A;  1YJW B;  4XLE A;  2X6W A;  2CND A;  3OJX A;  4Y7C A;  1M90 D;  2OBS A;  3Q6Q A;  2GPJ A;  3PUN A;  4II3 A;  3CC4 B;  3W2G A;  3I55 B;  2ZL6 A;  2XND A;  2QA4 B;  3BY1 A;  4M0L A;  2ZBV A;  4X7F A;  1E64 A;  2Q6I A;  4DK1 A;  3JQP A;  3SKB A;  1JA1 A;  1QX4 A;  1E3Z A;  5IYQ A;  2DET A;  1Q86 D;  2VBS A;  3CB4 A;  1YIT B;  3GVL A;  5FL7 A;  1G7T A;  4P3I A;  4LBY A;  2XZL A;  2R6H A;  1GVH A;  2ZZE A;  4X7C A;  1W87 A;  4FWT A;  1H8H A;  3ZC3 A;  3WQZ A;  4X0C A;  4XN3 A;  1G7R A;  1S4M A;  2WZP P;  1AIP A;  3ZPN A;  3CC2 B;  4KKU A;  3GSI A;  3AVX A;  1QGZ A;  2CF4 A;  1CNF A;  3CXC B;  1KC8 D;  3AGP A;  4XOT A;  2JN9 A;  2KVO A;  2ZZF A;  4G1B A;  4FK8 A;  4PGO A;  4B44 A;  5A88 A;  2OYN A;  3CC7 B;  2DEU A;  4X06 A;  1E1Q A;  2XOK A;  4Z4V A;  1N0V C;  1VQ8 B;  4WWV A;  5TR9 A;  4RDL A;  4XN0 A;  3OEE A;  4KKS A;  4NNJ A;  5J3O A;  5GV8 A;  1OB2 A;  1KTV A;  2E1B A;  1A8P A;  4FXU A;  3SEJ A;  3OZU A;  1Y0R A;  4AF7 A;  2Q6O A;  5IYW A;  1SKY B;  3V76 A;  3LO8 A;  2DY1 A;  4TMX A;  1T6X A;  4XLF A;  3AVV A;  3OAA A;  3ZBU A;  1DDI A;  4G6I A;  4XLA A;  3A8I A;  3CCE B;  5B6I A;  1VQ4 B;  5KNL A;  4WZT A;  1WTH D;  2WPD A;  1FDR A;  4RDK A;  1E43 A;  3CCV B;  2BF4 A;  2RC5 A;  3SLN A;  2PLF A;  4DQK A;  1K8A D;  1NDH A;  1V0F A;  2C2W A;  1HZE A;  2FX3 A;  3B82 A;  5JBQ A;  3CES A;  4M4S A;  2B7C A;  2ZZQ A;  4R71 A;  3P27 A;  1VQO B;  3CW2 A;  2D3N A;  1EP2 B;  1EFC A;  3SJP A;  3W2H A;  1I18 A;  5HZA A;  3ZBT A;  3NE5 B;  1KJZ A;  1KQS B;  2HMA A;  3WBJ A;  3FPK A;  2HLD A;  2VJJ A;  4Z4Y A;  4P22 A;  1BX0 A;  1VQN B;  2X6X A;  4YEL A;  3Q38 A;  3Q39 A;  2XEX A;  3PUM A;  3AVY A;  3JQR A;  2VJI A;  2OTL B;  1ZUN B;  2OTJ B;  3ZUG A;  4CQJ A;  2V7V A;  3DDY A;  5THX A;  2BPO A;  3QFC A;  3WBK A;  3ASR A;  2X6Y A;  1AMO A;  2C77 A;  2EIX A;  4L8J A;  4YEJ A;  1NB9 A;  3ZZ0 A;  5KSW B;  1CNE A;  1TTT A;  4WZL A;  3QE2 A;  4TT3 A;  3QFS A;  1Q82 D;  4XR6 A;  4ZCM A;  4GQN A;  1KK3 A;  5DSZ A;  2X85 A;  4OP7 A;  4AC9 A;  1BQE A;  1N06 A;  5FO1 A;  4P26 A;  2AHO A;  2QN6 A;  1H85 A;  4PC7 A;  2ZXH A;  4NBS A;  4P25 A;  1G7S A;  2ZIT A;  2V31 A;  4XKW A;  1IJF A;  3E1Y E;  1IHM A;  3OFN A;  3VR6 A;  1KZL A;  3CD6 B;  4TSF A;  3KL9 A;  1D2E A;  4TMW A;  5H59 A;  3ASP A;  3LQE A;  1WPC A;  4QHY A;  3T53 B;  2VNK A;  4WQM A;  2ZXI A;  4XLH A;  1YI2 B;  1N05 A;  4TKO B;  2ZL7 A;  1KRH A;  1Y0Y A;  3WYA A;  1UD5 A;  1GR1 A;  1GAQ A;  2DOG A;  4B4D A;  1EP1 B;  4NCN A;  3W2E A;  2C5H A;  1Q9S A;  2F1M A;  1WU8 A;  4M53 A;  1D8T A;  1E3X A;  1TUI A;  2VBT A;  2CK3 A;  1WP6 A;  3OJW A;  1N08 A;  4LBW A;  3KEW A;  1BPL A;  4RD0 A;  3U2Q A;  4Z4W A;  4PC1 A;  1ZM3 A;  3Q6R A;  2XNC A;  4AF6 A;  4B3G A;  1QFZ A;  2GK6 A;  2R9V A;  2YWF A;  1EFT A;  3PVD A;  3W2F A;  1ZM4 A;  3ONU A;  1PKV A;  1R5B A;  2BMW A;  2WZN A;  2X53 S;  3VNU A;  2DIE A;  3PA1 A;  3OPO A;  1I7P A;  4K1X A;  3QSY A;  2ZBU A;  2GJR A;  5BSX A;  2QGG A;  2M5S A;  1UMK A;  2XNJ A;  3CP2 A;  4UZE A;  4XNF A;  4X07 A;  4B47 A;  3OW7 A;  4ZV4 A;  5HKK A;  1BMF A;  1PJ7 A;  4QVJ A;  3PEN A;  2X3U A;  3CP8 A;  4M2L A;  4MYU A;  1NB0 A;  5A8A A;  2BGI A;  2BVN A;  4TMV A;  1XFO A;  4N3G A;  5DN6 A;  1XQB A;  4Z4R A;  3G6E B;  1TLL A;  3BH4 A;  1NRK A;  1YLO A;  1RQR A;  1EXM A;  3W5V A;  2V7W A;  1FRN A;  1V5V A;  3WXM A;  1UD8 A;  1E63 A;  4B3X A;  3BNW A;  4ZCI A;  1W9X A;  2BGJ A;  2C78 A;  1WOR A;  4P12 A;  3A35 A;  1QUF A;  1ZM9 A;  2XGJ A;  3T56 B;  3G4S B;  2V7T A;  4N3N A;  2VBV A;  1N0U A;  3ASQ A;  3ONY A;  1K73 D;  4P9S A;  3AST A;  4PC6 A;  1WSV A;  4WZE A;  3U6K A;  3CCM B;  4Z4S A;  2DCU A;  3SLD A;  3ASS A;  4PAA A;  2BSA A;  1G7C A;  1WOO A;  2PIA A;  4RPB A;  1WSR A;  3MMP A;  5J35 A;  4PAB A;  4WZK A;  1Q81 D;  2BV3 A;  4QVA A;  4PC2 A;  4C0S A;  2DYI A;  2Q6K A;  4RD6 A;  3FJO A;  1OGI A;  1KK0 A;  4J0Q A;  1VQ6 B;  1VQL B;  2GK7 A;  4Y9U A;  1GJR A;  3G05 A;  2GQF A;  3T51 B;  2CBX A;  1VQ9 B;  4BPR A;  1N8R D;  1EWY A;  1HA3 A;  1YX2 A;  4X8I A;  4B43 A;  2HDN B;  2F43 A;  4OPO A;  1Q7Y D;  1E79 A;  3CMA B;  1GO2 A;  3R6J A;  1W0K A;  3OZW A;  4QUZ A;  3AVT A;  5F4M A;  5TY0 A;  1FRQ A;  1K9M D;  2DER A;  1ZM2 A;  1UD3 A;  3H94 A;  2D9R A;  3QFT A;  3VO1 A;  3MCA A;  4P1V A;  2PE3 A;  2PMD A;  4RCY A;  4RDJ A;  3CMM A;  4FN5 A;  2I1L A;  2JIZ A;  4LBZ A;  4HE6 A;  1FNM A;  1U2R A;  3ZIA A;  2NV4 A;  2VZL A;  3A8J A;  3A3B A;  2YWG A;  3H9N A;  3I1F A;  3Q3A A;  3W2I A;  5IYP A;  1BJK A;  4U9U A;  5FA6 A;  1MRZ A;  2X8K A;  5A89 A;  1YJN B;  5F4J A;  1QUE A;  1KMH A;  1QFY A;  3LQ6 A;  4XLC A;  1DDG A;  1E62 A;  1F20 A;  2ZL5 A;  4ZGN B;  1XE1 A;  3GIR A;  1QFJ A;  2RC6 A;  2WYR A;  2J7K A;  3BC9 A;  2GJP A;  4XOR A;  1S72 B;  3ISX A;  1EP3 B;  1M1K D;  1WDT A;  2OBR A;  2EFG A;  1QGY A;  1NJI D;  2FVG A;  4HIZ A;  3ZZT A;  1UD4 A;  1RQP A;  5AN9 A;  2ZTG A;  3WY9 A;  5LMZ A;  4PC3 A;  4M1K A;  3W5H A;  4RM0 A;  4JMQ A;  1UD2 A;  3AVU A;  4P6Y A;  3HAG A;  3AVW A;  3SJZ A;  1BX1 A;  1B2R A;  3OZV A;  1V0E A;  1VQ5 B;  1W35 A;  2VNJ A;  2C4U A;  5L46 A;  2LZJ A;  2X0K A;  4G5G A;  4X7E A;  1EFU A;  4YHB A;  3JU4 A;  3CCS B;  2QTZ A;  4DNT B;  3OOC A;  4TN1 A;  1VHO A;  2BM0 A;  4G7W A;  1S0U A;  1WOS A;  2F4N A;  3G71 B;  5CDF A;  1FNB A;  5FIU A;  2HCJ B;  4F7D A;  4Q7J B;  3JQQ A;  5FNZ A;  3CCU B;  1T6Y A;  5KW9 A;  1IB0 A;  4Z1M A;  4P6V F;  3WNC A;  1FNC A;  3OW2 B;  2QMU A;  1QVG B;  1VQ7 B;  3CCL B;  1TVC A;  3P26 A;  3BQJ A;  4E0F A;  3A1P A;  1W2B B;  3CRZ A;  3PA2 A;  3GQB A;  1DG1 G;  1B23 P;  4XM3 A; 
#chains in the Genus database with same CATH homology
 3ASS A;  4RPB A;  4Z4Z A;  5J35 A;  3Q38 A;  3Q39 A;  4OOX A;  3PUM A;  4WZK A;  4QVA A;  5IYN A;  5BSY A;  4RPD A;  4RLZ A;  3ASR A;  3D26 A;  4WZL A;  2OBT A;  4OPO A;  4OP7 A;  3R6J A;  4P26 A;  2OBS A;  4QUZ A;  5F4M A;  3Q6Q A;  3PUN A;  4P25 A;  2ZL6 A;  5IYR A;  5HZB A;  1IHM A;  3BY1 A;  5E6T A;  4P1V A;  4Z4U A;  4X7F A;  4RDJ A;  3SKB A;  5IYQ A;  3ASP A;  3LQE A;  4P3I A;  3Q3A A;  5IYP A;  2ZL7 A;  4X7C A;  5F4J A;  3LQ6 A;  4QV2 A;  3R6K A;  4X0C A;  2ZL5 A;  4P2N A;  4Z4W A;  3Q6R A;  2OBR A;  4X06 A;  4X05 A;  4Z4V A;  3V7A A;  4OPS A;  3PVD A;  4RDL A;  3ONU A;  5F4O A;  4ROX A;  3BY2 A;  4OPV A;  5J3O A;  4RM0 A;  3PA1 A;  3SEJ A;  5BSX A;  5IYW A;  4X07 A;  4QVJ A;  4X7E A;  4X7D A;  4OOV A;  4WZT A;  3RY8 A;  4RDK A;  4Z4R A;  3SLN A;  5KW9 A;  4P12 A;  3SJP A;  4Z4T A;  5HZA A;  3BQJ A;  3ASQ A;  3ONY A;  4OOS A;  3AST A;  3PA2 A;  4WZE A;  4Z4Y A;  4Z4S A;  3SLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...