4ROXA

Crystal structure of p domain of hawaii norovirus (gii.1)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
305
structure length
299
Chain Sequence
GPGSKPFTLPILTIGELSNSRFPVPIDELYTSPNEGVIVQPQNGRSTLDGELLGTTQLVPSNICALRGRINAQVDHHQWNLQVTNTNGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPNNTCRAHDGVLATWSPKFTPKLGSVILGTWLDLNQPTRFTPVGLFNTDHFDQWALPSYSGRLTLNMNLAPSVSPLFPGEQLLFFRSHIPLKGGTSDGAIDCLLPQEWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norovirus hu/gii.1/7ek/hawaii/1971/usa
molecule tags Viral protein
total genus 72
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4roxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4roxA01
3PUMA 4Z4WA 3R6KA 4RPBA 3ASSA 5J3OA 5IYQA 4QVAA 3BQJA 4Z4TA 5F4JA 4OPVA 3ONUA 5IYRA 4RM0A 4OP7A 2ZL5A 3SLNA 3PA1A 3Q38A 3SKBA 5BSYA 4Z4VA 2ZL7A 5J35A 4X05A 5HZAA 5KW9A 3Q6RA 4Z4RA 5F4MA 3ONYA 4X06A 4OPSA 4P12A 4WZKA 3ASQA 3PVDA 4P3IA 4RPDA 3Q3AA 5IYPA 4RDJA 4RDKA 4QVJA 4P1VA 5BSXA 4X7DA 4X07A 4WZLA 3BY2A 3PUNA 5HZBA 2OBTA 4P25A 3Q6QA 3V7AA 4WZTA 3ASTA 4Z4SA 4X0CA 4Z4YA 4P2NA 4X7EA 3PA2A 3SLDA 2OBRA 3SJPA 3ASRA 5IYWA 4RLZA 3Q39A 4QV2A 4WZEA 3LQEA 4Z4UA 3BY1A 4OOXA 2OBSA 4X7FA 3D26A 5IYNA 3R6JA 3LQ6A 4OPOA 4Z4ZA 2ZL6A 5F4OA 4P26A 4OOVA 4QUZA 4RDLA 3ASPA 1IHMA 4ROXA 5E6TA 3SEJA 4OOSA 4X7CA 3RY8A
chains in the Genus database with same CATH superfamily
3KEWA 4Z1MA 3JQRA 3CXCB 3R6KA 5H5JA 1ZUNB 3MHPA 3QFTA 2D3LA 4HE5A 4ZGQB 4MYTA 5JBQA 2XNJA 1W9XA 1KMHA 5EMNA 3A3BA 3T53B 4NNJA 3OPOA 1I18A 1QUEA 4QFMA 4XR6A 2OYNA 2GPJA 2ZXIA 3CMEB 1SKYB 3OAAA 3PA1A 3AGPA 3VO1A 1FRNA 2W6JA 4PC1A 4LBYA 1WSRA 1KQSB 2F1LA 4RCYA 1JJ2B 3FPPA 4JMQA 2W6IA 4M4SA 1Q7YD 1WPCA 4G1VA 4NBSA 3WNBA 1E1QA 3FPKA 3CRZA 2BPOA 4DQLA 4R71A 4P9SA 3Q6RA 3CPWB 4YAOA 2VBSA 2WJVA 1XB2A 1COWA 5TY0A 1NJID 2X53S 5FNZA 3W2HA 3ONYA 3W2GA 1W2BB 3WNCA 2V7QA 3ASQA 1EP3B 2E1BA 3PVDA 1VQ8B 2OTLB 1HVXA 1S72B 2PLFA 1E1RA 1XQBA 1UD5A 3CP2A 2QGGA 1VQ4B 2WZPP 1IJFA 4RPDA 4TMXA 4B43A 1HZEA 1G7TA 4RD3A 5IYPA 1E64A 4QHYA 1QFZA 1SKQA 1BX1A 4XN3A 5DS0A 5BSXA 2V31A 4MYUA 2GJPA 4P3YA 5HZBA 1AIPA 3ZZUA 4PC3A 3ZZ0A 2VYQA 5LMZA 4RD6A 4PGOA 1RQPA 3V7AA 1U2RA 2R6HA 4WZTA 3OP1A 2NPFA 4Z4YA 1QUFA 3VR6A 1FX0A 1K8AD 1P4MA 3E20A 2C4TA 3BC9A 3GVKA 3PA2A 4XOTA 3B8HA 3U6BA 2OK7A 1W87A 3HAGA 1PJ5A 1KK0A 4ACAA 3OW2B 2V7TA 3Q39A 3JQPA 4FN5A 3U6KA 4XKWA 1T6ZA 1Q82D 4WZEA 4YHBA 4YEJA 2VJJA 3BY1A 4AF6A 3A3GA 3BH4A 3B78A 3JU4A 4ZCMA 5IYNA 2WZNA 1JNYA 2DIEA 1A8PA 2WYRA 1BLIA 2CRVA 1CNEA 1HA3A 4B4DA 2Q6KA 1D1NA 1VQLB 2X3UA 1N05A 1Y0YA 2WR8A 1WTHD 4RPBA 3W2FA 2BGIA 3OZWA 5J3OA 3P26A 3OZVA 5IYQA 2V7WA 1GR1A 3OKXA 4UZFA 4TMVA 3I55B 3GSIA 1G7CA 2C4UA 3QFCA 2D3NA 2I1LA 3BQJA 2CBXA 2V7VA 3ONUA 2J7KA 4OPVA 5F4JA 2QEXB 3CCRB 2XGJA 1WP6A 4RM0A 2ZL5A 3SLNA 3ZC3A 3G4SB 2HDNB 3CTAA 5HKKA 3Q38A 1JA0A 4ZCIA 1UD4A 2CC2A 4DK1A 1WOSA 4XLAA 3VO2A 5GV7A 1ZM4A 1YJ9B 3V76A 4UZEA 1N06A 1ZM2A 5HZAA 1I8DA 4WWVA 1OB5A 4XKVA 2VNHA 1K73D 1TUIA 1VHOA 1G7RA 4B48A 1N07A 5B6IA 4TKOB 1E43A 1OGIA 1R5OA 5AN9A 2XEXA 4PABA 4ZCLA 3WBJA 1QFYA 5F4MA 1N0UA 1DDIA 1XE1A 4OPSA 2ZTNA 4XONA 1YHQB 3GVJA 2GK6A 2WSSA 2Q6OA 4XORA 4LBVA 5TR9A 2EIXA 1MRZA 1V0EA 2F43A 4P1VA 2RC6A 1BJKA 1Q9SA 4X7DA 1WSVA 1EFRA 4C0SA 1F20A 2XNDA 1KZLA 3JQQA 3PUNA 4KKSA 1M1KD 4RD1A 1G7SA 1S0UA 3Q6QA 5A89A 5DSZA 5GV8A 1UD6A 3ISXA 3FKSA 4RCZA 2VNJA 4Z4SA 4X0CA 3W5UA 3LNNA 2VJIA 1T6XA 3CCSB 4X7EA 2BF4A 4XLHA 3QSYA 1H8HA 2VZLA 1YJNB 1Y0RA 3G05A 5H59A 1W34A 1NRKA 3SLDA 2F4NA 4XOPA 4FWTA 4ACBA 5TV2A 3SJPA 2CW5A 1YIJB 2YWEA 4B44A 4U9UA 1ZM3A 4F7DA 4ZV4A 2DETA 3CC4B 1E3XA 4G7XA 2VNIA 2B7CA 1FDRA 1KC8D 3QE2A 3AGQA 3AVXA 1W35A 4X7FA 5HXBA 2C78A 3BCDA 3LO8A 3LQ6A 1OGJA 3W5HA 3A8JA 1QX4A 2VBVA 4GQNA 3VMFA 3ASPA 1FNBA 1IHMA 3CCEB 2YWGA 3CP8A 4ROXA 3CPXA 2X6YA 5KNLA 2PIAA 5E6TA 2M5SA 1EWYA 2GREA 3P27A 2GJKA 1QH0A 2X0KA 4X7CA 1CQXA 5A88A 1VHEA 4XD7A 3PUMA 1ZM9A 2YWHA 4Z4WA 1E63A 3MCAA 1NB9A 4L8JA 5FIUA 2F1MA 2C5HA 1VLYA 4M2LA 1R5BA 2C5BA 4X8IA 1ELOA 1IB0A 4ASUA 2FX3A 2NV4A 2CNDA 3G6EB 2HLDA 4K1XA 3CC2B 2Q6LA 3I56B 1H42A 1GAQA 5IYRA 3W5VA 5CDFA 4XLCA 3CCLB 2DYIA 2X8KA 2X85A 3W2IA 1YITB 1QG0A 2DY1A 1WOOA 3AVUA 1YJWB 2PE3A 3B82A 2C77A 2RC5A 1WU8A 3CCQB 5BSYA 2EFGA 1VQNB 2B7BA 4PAAA 4Z4VA 2D9RA 2ZBUA 5DN6A 4M0LA 4LBZA 1QVFB 4RJLA 1VQ7B 2QMUA 3T51B 4RD2A 2OTJB 4AVZA 2JIZA 1S4MA 1WORA 2Z6BD 5KSWB 1D2EA 5KW9A 1KJZA 3A8IA 1NB0A 1IJEA 3J81k 2ZBVA 3I1FA 2BM1A 2ZITA 3CCVB 4TSFA 4DK0A 3ZBTA 2BMWA 3MMPA 2HCJB 4P12A 3ZUGA 3A35A 4P3IA 4B3FX 1QGZA 1VQKB 2DEUA 2GQFA 1H8EA 2Q6IA 2PMDA 4LBWA 1QVGB 1FNCA 1TVCA 3CC7B 3VNUA 1YLOA 4QVJA 2BVNA 2D74A 1JB9A 1VQ5B 1BMFA 4P22A 4BPRA 2VBTA 3QFRA 3BY2A 1UMKA 4KKTA 1GAWA 2B5OA 5L46A 3OJWA 3CMMA 1T5EA 1YI2B 1TLLA 4CQJA 4G5GA 4XLFA 1V5VA 3W2EA 4G1BA 1M90D 3OOCA 4E0FA 3A8KA 2VNKA 3A1PA 3GQBA 3WY9A 3WQZA 1RQRA 3CESA 2ZZEA 4RD0A 1UD2A 2OBRA 1VQPB 1E62A 4II2A 4ZGNB 2ZZQA 3ASRA 5IYWA 4RLZA 1F60A 3GVLA 4QV2A 1VF7A 4TMTA 5FO0A 4Q7JB 4HE6A 4XM3A 2R9VA 3CCUB 4YAUA 2XNCA 2BN4A 3OFNA 1VQ9B 2GJRA 4TMZA 3WBKA 4YXWA 4OPOA 4Z4ZA 4P26A 1J9ZA 3OJXA 1OB0A 1DDGA 2AHOA 1QGYA 1N08A 1PJ6A 1XFOA 1PJ7A 4XL9A 4XQFA 3AVYA 2P3MA 3OE7A 4B3XA 4LC0A 3SEJA 4OOSA 1N8RD 3RY8A 1R5NA 1YX2A 4TMWA 1VLOA 4AC9A 4XLEA 2DCUA 3LVBA 3U2QA 4DQKA 3ASSA 4FK8A 1K28D 3ZIAA 1EFTA 2BM0A 1Q86D 1K9MD 1QFJA 2JN9A 4QVAA 4WQMA 1EFCA 1KRHA 4H9GA 4Y9RA 2WPDA 1Q81D 4Z4TA 2X6WA 4OP7A 3SJZA 2V7UA 3KL9A 2CK3A 1W0KA 1VQ6B 3VNVA 2WJYA 4TN1A 2JJ2A 2OK8A 3DDYA 4DNTB 4UAJA 2ZZFA 3H9NA 4N3GA 3SKBA 4KKUA 2V4DA 2ZZGA 2JJ1A 4YAWA 3WNDA 2ZL7A 1KK1A 3ZBUA 2HMAA 1UD8A 5J35A 2QTLA 3QFSA 4X05A 4P6VF 4RD4A 1VQOB 4B3GA 1EP1B 1DARA 2QDXA 4P6YA 2X6XA 5THXA 1OHHA 4HIZA 2QN6A 2VBUA 5FL7A 2BSAA 1EFUA 3FJOA 1D8TA 4Z4RA 4II3A 3AVTA 1T6YA 1GJRA 2XZLA 4X06A 4WZKA 4IW3B 4PC7A 5TRDA 4C43A 1JA1A 4PC2A 4YELA 4DNRB 2GK7A 1W0JA 3CD6B 4M1KA 3ES9A 3CMAB 3Q3AA 4XMYA 1VQMB 1H85A 1KTVA 4RDJA 4RDKA 4Y7CA 1QGAA 5FA6A 1BX0A 4EH1A 2JDIA 3OW7A 2DOGA 4Y9UA 2YWFA 2ZTGA 3OEEA 2DERA 1B2RA 3T56B 4X07A 4WZLA 1AMOA 2OBTA 3ZZTA 4P25A 3CCMB 1FNMA 3H94A 1NDHA 1B23P 4G6IA 4UZUA 4J0QA 3ASTA 1NBMA 4M53A 2QA4B 3OZUA 2C2WA 4TT3A 1KK2A 4AF7A 2XOKA 4P2NA 2QE7A 1E3ZA 1GO2A 3NE5B 1DG1G 1V0FA 1OB2A 3BNWA 1KD1D 1EP2B 3AVWA 3E1YE 3CW2A 3CCJB 4N3NA 1GVHA 3AVVA 3PENA 2FVGA 1CNFA 1BQEA 1E79A 3LQEA 1PKVA 2CF4A 3WYAA 5FO1A 1EXMA 2V7XA 4Z4UA 2E1RA 4NCNA 1TTTA 4XN0A 4FXUA 4YALA 4OOXA 2OBSA 2LZJA 3D26A 1UD3A 1KK3A 1WOPA 3BCFA 3OEHA 4YAFA 3R6JA 2BV3A 3WXMA 2ZL6A 4XNFA 5F4OA 2BGJA 2QTZA 4OOVA 4QUZA 1I7PA 1FRQA 4RDLA 4B47A 5A8AA 4G7WA 1FNDA 3GIRA 4PC6A 2KVOA 2XZPA 1SM4A 1WDTA 2XZOA 1BPLA 3ZPNA 1MABA 1VJSA 3CB4A 1N0VC 3G71B 5IK2A 2ZXHA
chains in the Genus database with same CATH topology
3PUMA 4Z4WA 3R6KA 4RPBA 3ASSA 5J3OA 5IYQA 4QVAA 3BQJA 4Z4TA 5F4JA 4OPVA 3ONUA 5IYRA 4RM0A 4OP7A 2ZL5A 3SLNA 3PA1A 3Q38A 3SKBA 5BSYA 4Z4VA 2ZL7A 5J35A 4X05A 5HZAA 5KW9A 3Q6RA 4Z4RA 5F4MA 3ONYA 4X06A 4OPSA 4P12A 4WZKA 3ASQA 3PVDA 4P3IA 4RPDA 3Q3AA 5IYPA 4RDJA 4RDKA 4QVJA 4P1VA 5BSXA 4X7DA 4X07A 4WZLA 3BY2A 3PUNA 5HZBA 2OBTA 4P25A 3Q6QA 3V7AA 4WZTA 3ASTA 4Z4SA 4X0CA 4Z4YA 4P2NA 4X7EA 3PA2A 3SLDA 2OBRA 3SJPA 3ASRA 5IYWA 4RLZA 3Q39A 4QV2A 4WZEA 3LQEA 4Z4UA 3BY1A 4OOXA 2OBSA 4X7FA 3D26A 5IYNA 3R6JA 3LQ6A 4OPOA 4Z4ZA 2ZL6A 5F4OA 4P26A 4OOVA 4QUZA 4RDLA 3ASPA 1IHMA 4ROXA 5E6TA 3SEJA 4OOSA 4X7CA 3RY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUM A;  4Z4W A;  3R6K A;  4RPB A;  3ASS A;  5J3O A;  5IYQ A;  4QVA A;  3BQJ A;  4Z4T A;  5F4J A;  4OPV A;  3ONU A;  5IYR A;  4RM0 A;  4OP7 A;  2ZL5 A;  3SLN A;  3PA1 A;  3Q38 A;  3SKB A;  5BSY A;  4Z4V A;  2ZL7 A;  5J35 A;  4X05 A;  5HZA A;  5KW9 A;  3Q6R A;  4Z4R A;  5F4M A;  3ONY A;  4X06 A;  4OPS A;  4P12 A;  4WZK A;  3ASQ A;  3PVD A;  4P3I A;  4RPD A;  3Q3A A;  5IYP A;  4RDJ A;  4RDK A;  4QVJ A;  4P1V A;  5BSX A;  4X7D A;  4X07 A;  4WZL A;  3BY2 A;  3PUN A;  5HZB A;  2OBT A;  4P25 A;  3Q6Q A;  3V7A A;  4WZT A;  3AST A;  4Z4S A;  4X0C A;  4Z4Y A;  4P2N A;  4X7E A;  3PA2 A;  3SLD A;  2OBR A;  3SJP A;  3ASR A;  5IYW A;  4RLZ A;  3Q39 A;  4QV2 A;  4WZE A;  3LQE A;  4Z4U A;  3BY1 A;  4OOX A;  2OBS A;  4X7F A;  3D26 A;  5IYN A;  3R6J A;  3LQ6 A;  4OPO A;  4Z4Z A;  2ZL6 A;  5F4O A;  4P26 A;  4OOV A;  4QUZ A;  4RDL A;  3ASP A;  1IHM A;  4ROX A;  5E6T A;  3SEJ A;  4OOS A;  4X7C A;  3RY8 A; 
#chains in the Genus database with same CATH topology
 3KEW A;  4Z1M A;  3JQR A;  3CXC B;  3R6K A;  5H5J A;  1ZUN B;  3MHP A;  3QFT A;  2D3L A;  4HE5 A;  4ZGQ B;  4MYT A;  5JBQ A;  2XNJ A;  1W9X A;  1KMH A;  5EMN A;  3A3B A;  3T53 B;  4NNJ A;  3OPO A;  1I18 A;  1QUE A;  4QFM A;  4XR6 A;  2OYN A;  2GPJ A;  2ZXI A;  3CME B;  1SKY B;  3OAA A;  3PA1 A;  3AGP A;  3VO1 A;  1FRN A;  2W6J A;  4PC1 A;  4LBY A;  1WSR A;  1KQS B;  2F1L A;  4RCY A;  1JJ2 B;  3FPP A;  4JMQ A;  2W6I A;  4M4S A;  1Q7Y D;  1WPC A;  4G1V A;  4NBS A;  3WNB A;  1E1Q A;  3FPK A;  3CRZ A;  2BPO A;  4DQL A;  4R71 A;  4P9S A;  3Q6R A;  3CPW B;  4YAO A;  2VBS A;  2WJV A;  1XB2 A;  1COW A;  5TY0 A;  1NJI D;  2X53 S;  5FNZ A;  3W2H A;  3ONY A;  3W2G A;  1W2B B;  3WNC A;  2V7Q A;  3ASQ A;  1EP3 B;  2E1B A;  3PVD A;  1VQ8 B;  2OTL B;  1HVX A;  1S72 B;  2PLF A;  1E1R A;  1XQB A;  1UD5 A;  3CP2 A;  2QGG A;  1VQ4 B;  2WZP P;  1IJF A;  4RPD A;  4TMX A;  4B43 A;  1HZE A;  1G7T A;  4RD3 A;  5IYP A;  1E64 A;  4QHY A;  1QFZ A;  1SKQ A;  1BX1 A;  4XN3 A;  5DS0 A;  5BSX A;  2V31 A;  4MYU A;  2GJP A;  4P3Y A;  5HZB A;  1AIP A;  3ZZU A;  4PC3 A;  3ZZ0 A;  2VYQ A;  5LMZ A;  4RD6 A;  4PGO A;  1RQP A;  3V7A A;  1U2R A;  2R6H A;  4WZT A;  3OP1 A;  2NPF A;  4Z4Y A;  1QUF A;  3VR6 A;  1FX0 A;  1K8A D;  1P4M A;  3E20 A;  2C4T A;  3BC9 A;  3GVK A;  3PA2 A;  4XOT A;  3B8H A;  3U6B A;  2OK7 A;  1W87 A;  3HAG A;  1PJ5 A;  1KK0 A;  4ACA A;  3OW2 B;  2V7T A;  3Q39 A;  3JQP A;  4FN5 A;  3U6K A;  4XKW A;  1T6Z A;  1Q82 D;  4WZE A;  4YHB A;  4YEJ A;  2VJJ A;  3BY1 A;  4AF6 A;  3A3G A;  3BH4 A;  3B78 A;  3JU4 A;  4ZCM A;  5IYN A;  2WZN A;  1JNY A;  2DIE A;  1A8P A;  2WYR A;  1BLI A;  2CRV A;  1CNE A;  1HA3 A;  4B4D A;  2Q6K A;  1D1N A;  1VQL B;  2X3U A;  1N05 A;  1Y0Y A;  2WR8 A;  1WTH D;  4RPB A;  3W2F A;  2BGI A;  3OZW A;  5J3O A;  3P26 A;  3OZV A;  5IYQ A;  2V7W A;  1GR1 A;  3OKX A;  4UZF A;  4TMV A;  3I55 B;  3GSI A;  1G7C A;  2C4U A;  3QFC A;  2D3N A;  2I1L A;  3BQJ A;  2CBX A;  2V7V A;  3ONU A;  2J7K A;  4OPV A;  5F4J A;  2QEX B;  3CCR B;  2XGJ A;  1WP6 A;  4RM0 A;  2ZL5 A;  3SLN A;  3ZC3 A;  3G4S B;  2HDN B;  3CTA A;  5HKK A;  3Q38 A;  1JA0 A;  4ZCI A;  1UD4 A;  2CC2 A;  4DK1 A;  1WOS A;  4XLA A;  3VO2 A;  5GV7 A;  1ZM4 A;  1YJ9 B;  3V76 A;  4UZE A;  1N06 A;  1ZM2 A;  5HZA A;  1I8D A;  4WWV A;  1OB5 A;  4XKV A;  2VNH A;  1K73 D;  1TUI A;  1VHO A;  1G7R A;  4B48 A;  1N07 A;  5B6I A;  4TKO B;  1E43 A;  1OGI A;  1R5O A;  5AN9 A;  2XEX A;  4PAB A;  4ZCL A;  3WBJ A;  1QFY A;  5F4M A;  1N0U A;  1DDI A;  1XE1 A;  4OPS A;  2ZTN A;  4XON A;  1YHQ B;  3GVJ A;  2GK6 A;  2WSS A;  2Q6O A;  4XOR A;  4LBV A;  5TR9 A;  2EIX A;  1MRZ A;  1V0E A;  2F43 A;  4P1V A;  2RC6 A;  1BJK A;  1Q9S A;  4X7D A;  1WSV A;  1EFR A;  4C0S A;  1F20 A;  2XND A;  1KZL A;  3JQQ A;  3PUN A;  4KKS A;  1M1K D;  4RD1 A;  1G7S A;  1S0U A;  3Q6Q A;  5A89 A;  5DSZ A;  5GV8 A;  1UD6 A;  3ISX A;  3FKS A;  4RCZ A;  2VNJ A;  4Z4S A;  4X0C A;  3W5U A;  3LNN A;  2VJI A;  1T6X A;  3CCS B;  4X7E A;  2BF4 A;  4XLH A;  3QSY A;  1H8H A;  2VZL A;  1YJN B;  1Y0R A;  3G05 A;  5H59 A;  1W34 A;  1NRK A;  3SLD A;  2F4N A;  4XOP A;  4FWT A;  4ACB A;  5TV2 A;  3SJP A;  2CW5 A;  1YIJ B;  2YWE A;  4B44 A;  4U9U A;  1ZM3 A;  4F7D A;  4ZV4 A;  2DET A;  3CC4 B;  1E3X A;  4G7X A;  2VNI A;  2B7C A;  1FDR A;  1KC8 D;  3QE2 A;  3AGQ A;  3AVX A;  1W35 A;  4X7F A;  5HXB A;  2C78 A;  3BCD A;  3LO8 A;  3LQ6 A;  1OGJ A;  3W5H A;  3A8J A;  1QX4 A;  2VBV A;  4GQN A;  3VMF A;  3ASP A;  1FNB A;  1IHM A;  3CCE B;  2YWG A;  3CP8 A;  4ROX A;  3CPX A;  2X6Y A;  5KNL A;  2PIA A;  5E6T A;  2M5S A;  1EWY A;  2GRE A;  3P27 A;  2GJK A;  1QH0 A;  2X0K A;  4X7C A;  1CQX A;  5A88 A;  1VHE A;  4XD7 A;  3PUM A;  1ZM9 A;  2YWH A;  4Z4W A;  1E63 A;  3MCA A;  1NB9 A;  4L8J A;  5FIU A;  2F1M A;  2C5H A;  1VLY A;  4M2L A;  1R5B A;  2C5B A;  4X8I A;  1ELO A;  1IB0 A;  4ASU A;  2FX3 A;  2NV4 A;  2CND A;  3G6E B;  2HLD A;  4K1X A;  3CC2 B;  2Q6L A;  3I56 B;  1H42 A;  1GAQ A;  5IYR A;  3W5V A;  5CDF A;  4XLC A;  3CCL B;  2DYI A;  2X8K A;  2X85 A;  3W2I A;  1YIT B;  1QG0 A;  2DY1 A;  1WOO A;  3AVU A;  1YJW B;  2PE3 A;  3B82 A;  2C77 A;  2RC5 A;  1WU8 A;  3CCQ B;  5BSY A;  2EFG A;  1VQN B;  2B7B A;  4PAA A;  4Z4V A;  2D9R A;  2ZBU A;  5DN6 A;  4M0L A;  4LBZ A;  1QVF B;  4RJL A;  1VQ7 B;  2QMU A;  3T51 B;  4RD2 A;  2OTJ B;  4AVZ A;  2JIZ A;  1S4M A;  1WOR A;  2Z6B D;  5KSW B;  1D2E A;  5KW9 A;  1KJZ A;  3A8I A;  1NB0 A;  1IJE A;  3J81 k;  2ZBV A;  3I1F A;  2BM1 A;  2ZIT A;  3CCV B;  4TSF A;  4DK0 A;  3ZBT A;  2BMW A;  3MMP A;  2HCJ B;  4P12 A;  3ZUG A;  3A35 A;  4P3I A;  4B3F X;  1QGZ A;  1VQK B;  2DEU A;  2GQF A;  1H8E A;  2Q6I A;  2PMD A;  4LBW A;  1QVG B;  1FNC A;  1TVC A;  3CC7 B;  3VNU A;  1YLO A;  4QVJ A;  2BVN A;  2D74 A;  1JB9 A;  1VQ5 B;  1BMF A;  4P22 A;  4BPR A;  2VBT A;  3QFR A;  3BY2 A;  1UMK A;  4KKT A;  1GAW A;  2B5O A;  5L46 A;  3OJW A;  3CMM A;  1T5E A;  1YI2 B;  1TLL A;  4CQJ A;  4G5G A;  4XLF A;  1V5V A;  3W2E A;  4G1B A;  1M90 D;  3OOC A;  4E0F A;  3A8K A;  2VNK A;  3A1P A;  3GQB A;  3WY9 A;  3WQZ A;  1RQR A;  3CES A;  2ZZE A;  4RD0 A;  1UD2 A;  2OBR A;  1VQP B;  1E62 A;  4II2 A;  4ZGN B;  2ZZQ A;  3ASR A;  5IYW A;  4RLZ A;  1F60 A;  3GVL A;  4QV2 A;  1VF7 A;  4TMT A;  5FO0 A;  4Q7J B;  4HE6 A;  4XM3 A;  2R9V A;  3CCU B;  4YAU A;  2XNC A;  2BN4 A;  3OFN A;  1VQ9 B;  2GJR A;  4TMZ A;  3WBK A;  4YXW A;  4OPO A;  4Z4Z A;  4P26 A;  1J9Z A;  3OJX A;  1OB0 A;  1DDG A;  2AHO A;  1QGY A;  1N08 A;  1PJ6 A;  1XFO A;  1PJ7 A;  4XL9 A;  4XQF A;  3AVY A;  2P3M A;  3OE7 A;  4B3X A;  4LC0 A;  3SEJ A;  4OOS A;  1N8R D;  3RY8 A;  1R5N A;  1YX2 A;  4TMW A;  1VLO A;  4AC9 A;  4XLE A;  2DCU A;  3LVB A;  3U2Q A;  4DQK A;  3ASS A;  4FK8 A;  1K28 D;  3ZIA A;  1EFT A;  2BM0 A;  1Q86 D;  1K9M D;  1QFJ A;  2JN9 A;  4QVA A;  4WQM A;  1EFC A;  1KRH A;  4H9G A;  4Y9R A;  2WPD A;  1Q81 D;  4Z4T A;  2X6W A;  4OP7 A;  3SJZ A;  2V7U A;  3KL9 A;  2CK3 A;  1W0K A;  1VQ6 B;  3VNV A;  2WJY A;  4TN1 A;  2JJ2 A;  2OK8 A;  3DDY A;  4DNT B;  4UAJ A;  2ZZF A;  3H9N A;  4N3G A;  3SKB A;  4KKU A;  2V4D A;  2ZZG A;  2JJ1 A;  4YAW A;  3WND A;  2ZL7 A;  1KK1 A;  3ZBU A;  2HMA A;  1UD8 A;  5J35 A;  2QTL A;  3QFS A;  4X05 A;  4P6V F;  4RD4 A;  1VQO B;  4B3G A;  1EP1 B;  1DAR A;  2QDX A;  4P6Y A;  2X6X A;  5THX A;  1OHH A;  4HIZ A;  2QN6 A;  2VBU A;  5FL7 A;  2BSA A;  1EFU A;  3FJO A;  1D8T A;  4Z4R A;  4II3 A;  3AVT A;  1T6Y A;  1GJR A;  2XZL A;  4X06 A;  4WZK A;  4IW3 B;  4PC7 A;  5TRD A;  4C43 A;  1JA1 A;  4PC2 A;  4YEL A;  4DNR B;  2GK7 A;  1W0J A;  3CD6 B;  4M1K A;  3ES9 A;  3CMA B;  3Q3A A;  4XMY A;  1VQM B;  1H85 A;  1KTV A;  4RDJ A;  4RDK A;  4Y7C A;  1QGA A;  5FA6 A;  1BX0 A;  4EH1 A;  2JDI A;  3OW7 A;  2DOG A;  4Y9U A;  2YWF A;  2ZTG A;  3OEE A;  2DER A;  1B2R A;  3T56 B;  4X07 A;  4WZL A;  1AMO A;  2OBT A;  3ZZT A;  4P25 A;  3CCM B;  1FNM A;  3H94 A;  1NDH A;  1B23 P;  4G6I A;  4UZU A;  4J0Q A;  3AST A;  1NBM A;  4M53 A;  2QA4 B;  3OZU A;  2C2W A;  4TT3 A;  1KK2 A;  4AF7 A;  2XOK A;  4P2N A;  2QE7 A;  1E3Z A;  1GO2 A;  3NE5 B;  1DG1 G;  1V0F A;  1OB2 A;  3BNW A;  1KD1 D;  1EP2 B;  3AVW A;  3E1Y E;  3CW2 A;  3CCJ B;  4N3N A;  1GVH A;  3AVV A;  3PEN A;  2FVG A;  1CNF A;  1BQE A;  1E79 A;  3LQE A;  1PKV A;  2CF4 A;  3WYA A;  5FO1 A;  1EXM A;  2V7X A;  4Z4U A;  2E1R A;  4NCN A;  1TTT A;  4XN0 A;  4FXU A;  4YAL A;  4OOX A;  2OBS A;  2LZJ A;  3D26 A;  1UD3 A;  1KK3 A;  1WOP A;  3BCF A;  3OEH A;  4YAF A;  3R6J A;  2BV3 A;  3WXM A;  2ZL6 A;  4XNF A;  5F4O A;  2BGJ A;  2QTZ A;  4OOV A;  4QUZ A;  1I7P A;  1FRQ A;  4RDL A;  4B47 A;  5A8A A;  4G7W A;  1FND A;  3GIR A;  4PC6 A;  2KVO A;  2XZP A;  1SM4 A;  1WDT A;  2XZO A;  1BPL A;  3ZPN A;  1MAB A;  1VJS A;  3CB4 A;  1N0V C;  3G71 B;  5IK2 A;  2ZXH A; 
#chains in the Genus database with same CATH homology
 3PUM A;  4Z4W A;  3R6K A;  4RPB A;  3ASS A;  5J3O A;  5IYQ A;  4QVA A;  3BQJ A;  4Z4T A;  5F4J A;  4OPV A;  3ONU A;  5IYR A;  4RM0 A;  4OP7 A;  2ZL5 A;  3SLN A;  3PA1 A;  3Q38 A;  3SKB A;  5BSY A;  4Z4V A;  2ZL7 A;  5J35 A;  4X05 A;  5HZA A;  5KW9 A;  3Q6R A;  4Z4R A;  5F4M A;  3ONY A;  4X06 A;  4OPS A;  4P12 A;  4WZK A;  3ASQ A;  3PVD A;  4P3I A;  4RPD A;  3Q3A A;  5IYP A;  4RDJ A;  4RDK A;  4QVJ A;  4P1V A;  5BSX A;  4X7D A;  4X07 A;  4WZL A;  3BY2 A;  3PUN A;  5HZB A;  2OBT A;  4P25 A;  3Q6Q A;  3V7A A;  4WZT A;  3AST A;  4Z4S A;  4X0C A;  4Z4Y A;  4P2N A;  4X7E A;  3PA2 A;  3SLD A;  2OBR A;  3SJP A;  3ASR A;  5IYW A;  4RLZ A;  3Q39 A;  4QV2 A;  4WZE A;  3LQE A;  4Z4U A;  3BY1 A;  4OOX A;  2OBS A;  4X7F A;  3D26 A;  5IYN A;  3R6J A;  3LQ6 A;  4OPO A;  4Z4Z A;  2ZL6 A;  5F4O A;  4P26 A;  4OOV A;  4QUZ A;  4RDL A;  3ASP A;  1IHM A;  4ROX A;  5E6T A;  3SEJ A;  4OOS A;  4X7C A;  3RY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...