4ROXA

Crystal structure of p domain of hawaii norovirus (gii.1)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
305
structure length
299
Chain Sequence
GPGSKPFTLPILTIGELSNSRFPVPIDELYTSPNEGVIVQPQNGRSTLDGELLGTTQLVPSNICALRGRINAQVDHHQWNLQVTNTNGTPFDPTEDVPAPLGTPDFLANIYGVTSQRNPNNTCRAHDGVLATWSPKFTPKLGSVILGTWLDLNQPTRFTPVGLFNTDHFDQWALPSYSGRLTLNMNLAPSVSPLFPGEQLLFFRSHIPLKGGTSDGAIDCLLPQEWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norovirus hu/gii.1/7ek/hawaii/1971/usa
molecule tags Viral protein
molecule keywords Capsid protein VP1
total genus 72
structure length 299
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4roxA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4roxA01
3SJPA 3ONYA 5IYWA 5KW9A 5BSXA 5IYQA 5IYPA 2OBRA 3ASSA 5J35A 4WZKA 3Q6RA 3PUNA 4Z4UA 3ONUA 4Z4SA 3Q39A 4X06A 4OOVA 3ASTA 2ZL5A 3ASPA 5F4JA 4OP7A 3PUMA 3RY8A 4RM0A 4P25A 5IYRA 4OPOA 4Z4ZA 3PA1A 4RLZA 3SKBA 5F4OA 3R6JA 4WZLA 4WZEA 3PVDA 3SEJA 3V7AA 3Q3AA 5E6TA 1IHMA 3D26A 4QVAA 4RPBA 4QVJA 3BY2A 3BQJA 3LQ6A 4Z4TA 5F4MA 3R6KA 4ROXA 3PA2A 3SLDA 4QUZA 4P26A 4QV2A 4P12A 5IYNA 4Z4WA 4X0CA 3LQEA 4P1VA 4X7FA 4OPVA 4RDJA 3Q38A 2OBSA 4X05A 3ASQA 4Z4YA 2ZL7A 4RDLA 4WZTA 4OOSA 4X7DA 5BSYA 4P3IA 4X7CA 3SLNA 4RPDA 5HZBA 3ASRA 4RDKA 3Q6QA 4OOXA 4X7EA 5J3OA 5HZAA 2ZL6A 4Z4RA 4Z4VA 4X07A 4OPSA 4P2NA 2OBTA 3BY1A
chains in the Genus database with same CATH superfamily
4N3NA 3ZPNA 3T51B 4DK1A 3CMMA 2Q6LA 5IYWA 5KW9A 4XR6A 1FRQA 4YALA 2QTLA 1FDRA 2C5BA 5IYPA 4M53A 4P3YA 2OBRA 3MMPA 1OGIA 1VQ9B 3OJWA 1QVGB 1I18A 1EP2B 1W87A 3BCDA 2WYRA 4IW3B 5H5JA 2B7BA 3CCQB 2V7XA 1VJSA 4KKUA 3A3GA 2QE7A 4ACAA 3QFCA 1VQPB 3CC7B 3CD6B 3QSYA 1OGJA 3Q39A 5TRDA 1NB0A 4HIZA 1ELOA 4MYTA 1E43A 4OOVA 3GSIA 1YIJB 2PMDA 1FNBA 4DQLA 2DY1A 1WSRA 2V7QA 4B43A 2BGJA 3ASPA 4EH1A 5F4JA 2WR8A 1HVXA 4DK0A 4B47A 1W2BB 1TTTA 2F1LA 1VQ4B 4ZCLA 3B78A 2M5SA 2QTZA 3ES9A 1G7CA 5TY0A 3CC4B 3PENA 4RD4A 2V4DA 3J81k 1QFZA 2V7WA 1D8TA 5A88A 4P6YA 2C4TA 1S0UA 1WOOA 3BCFA 1KJZA 4RLZA 4YAOA 3R6JA 1YJNB 4K1XA 2GQFA 4J0QA 1DARA 1E3ZA 3SEJA 2VBTA 3LO8A 3OJXA 3W5VA 2YWEA 5E6TA 1BLIA 3LVBA 4P22A 1IHMA 3QE2A 4PC7A 2CF4A 1GJRA 1UMKA 4Z4TA 3PA2A 4FN5A 2PLFA 1GVHA 3W2GA 2D3LA 4QV2A 1BMFA 1QGZA 2BM1A 3VR6A 2OYNA 5HXBA 1JNYA 1QX4A 3W2IA 4II2A 3W5HA 2F1MA 1D1NA 4RCZA 3WXMA 3CESA 1SKYB 3CCJB 3WYAA 2WPDA 3Q38A 1W34A 1NDHA 4PAAA 1QFYA 3FJOA 4AVZA 2BF4A 4OOSA 1N08A 4XKVA 3VNUA 1F20A 3A8JA 3ZUGA 1VQ8B 1H85A 1YLOA 1ZM4A 4X7CA 1B23P 3GQBA 5DSZA 4L8JA 1YJ9B 1VQKB 2RC6A 2VYQA 4G7WA 3CXCB 1UD3A 4B48A 3CCRB 1W0KA 3U2QA 3B82A 1VHOA 1AIPA 3H9NA 4Z1MA 4Z4RA 3SJZA 4C43A 1B2RA 1E64A 2X85A 4HE5A 4LBWA 4ZGNB 1Y0YA 4P2NA 3CRZA 2D9RA 2OBTA 1FX0A 2C77A 3ZBTA 3BY1A 4YHBA 4TT3A 4LC0A 2BPOA 4PABA 1SM4A 3ISXA 1EFRA 4Y9RA 4X8IA 1E3XA 1W9XA 1QUEA 3JQRA 1CNFA 3JU4A 5IYQA 4XLCA 2PE3A 2HDNB 2JN9A 1JA1A 2V7VA 2GJKA 3ASSA 1VQNB 4ZCMA 1BX0A 3W2EA 1CQXA 1PJ6A 2CW5A 3WBJA 1R5BA 4YAUA 2CC2A 1N0VC 1H42A 3CTAA 4P9SA 4XN3A 4ACBA 3OEHA 3AGQA 1KD1D 1MABA 1UD2A 1YI2B 1VLYA 1XQBA 2VBSA 4X06A 2OK8A 3OW2B 1VHEA 2ZL5A 1M1KD 4XOPA 4P6VF 3VO1A 3JQQA 1VQ7B 1T5EA 4B3XA 5THXA 2DERA 3T53B 1OHHA 4YXWA 1KK2A 5FO1A 4OP7A 2D3NA 3G4SB 2V7TA 3BC9A 4TKOB 2CRVA 3PUMA 1YHQB 1QFJA 1UD6A 2BMWA 3AVUA 3G6EB 1I7PA 3GVKA 2QA4B 3W2HA 5IYRA 2F4NA 2BN4A 3ZZ0A 4Z4ZA 2EIXA 1BQEA 1T6XA 5KSWB 3CP2A 1OB5A 3P26A 3CCEB 2ZTGA 2GK6A 3PVDA 1GO2A 3V7AA 4JMQA 4FWTA 5GV8A 3QFTA 4M2LA 5A89A 1M90D 2QMUA 3CP8A 4G1BA 4QVAA 1OB2A 3BY2A 2X3UA 4RD3A 2VNIA 2R9VA 2V31A 4ROXA 1JA0A 4II3A 3SLDA 1Q82D 4P26A 2VBUA 2XGJA 2ZZGA 4UZFA 4Z4WA 1S72B 2W6JA 3OKXA 2OK7A 2ZBVA 2Q6IA 2VNHA 1VQLB 1YX2A 4X7FA 1KC8D 2YWHA 2YWFA 1E63A 3GVJA 1A8PA 4XM3A 1E79A 5TV2A 5FO0A 2DEUA 4BPRA 4X7DA 1OB0A 4TMXA 1FNCA 4XLHA 1BX1A 2Q6KA 1U2RA 1WSVA 1CNEA 3CW2A 4RPDA 2XEXA 5L46A 2JDIA 1VQOB 2C5HA 1N8RD 1K9MD 1WORA 1WPCA 4C0SA 4NBSA 1E1RA 3G05A 2ZZQA 5HZAA 5J3OA 4PC2A 2VNKA 2ZL6A 3AVXA 4KKTA 3B8HA 4OPSA 2XZLA 4N3GA 1ZM9A 5A8AA 4YAFA 3OZWA 3I55B 4TMWA 2XZOA 4XD7A 2GJPA 4PC6A 1V5VA 1HA3A 3SJPA 3HAGA 2WJVA 3U6KA 1PKVA 2ZITA 3DDYA 4U9UA 1FRNA 4WWVA 4XNFA 5DN6A 1PJ5A 4XN0A 4XLEA 4FXUA 2JJ1A 5BSXA 3V76A 3I56B 1N07A 1XB2A 4XLAA 2VJIA 3T56B 1UD8A 1EWYA 1R5NA 2E1BA 4WZKA 4B3GA 2XOKA 3ONUA 4XORA 3ZZTA 1DDIA 4MYUA 3A8KA 2ZZEA 3MHPA 5AN9A 3KL9A 2CK3A 5EMNA 3G71B 5FIUA 4GQNA 5FL7A 3ASTA 3CPWB 1ZM2A 2P3MA 1HZEA 4XMYA 2GJRA 3A3BA 4PC3A 3A1PA 3AVYA 3OZVA 4M1KA 2DYIA 1WTHD 2YWGA 3FPKA 4HE6A 1Q86D 2HLDA 2DETA 2CNDA 3AVWA 3ZIAA 3VMFA 2GK7A 1EP3B 2BGIA 1IJEA 1E62A 4RM0A 3E20A 3AVVA 2DOGA 1K73D 5IK2A 3AVTA 2XNJA 3KEWA 4OPOA 1GR1A 3QFSA 3U6BA 2BV3A 3WNDA 2PIAA 2QN6A 3OEEA 3PA1A 2OTLB 2B7CA 3CC2B 4B3FX 4G6IA 5H59A 1KZLA 1MRZA 4WZLA 4LBYA 5B6IA 1TLLA 2J7KA 4WZEA 2V7UA 2Z6BD 5FNZA 4DNRB 4H9GA 1VQ5B 1BPLA 4G1VA 3Q3AA 4TN1A 4ZCIA 3OFNA 2BVNA 3W5UA 3D26A 2B5OA 1NRKA 2WSSA 1FNMA 2FVGA 4RPBA 3W2FA 1BJKA 1UD4A 4QHYA 3BQJA 2DCUA 1COWA 3OOCA 4XLFA 2JIZA 4QUZA 4E0FA 4TSFA 4XOTA 1S4MA 1GAWA 1EXMA 1TVCA 5IYNA 1KK3A 1KK1A 4X0CA 2VZLA 2OTJB 3WQZA 4P1VA 1VQMB 4DQKA 4G5GA 4AC9A 3OPOA 4OPVA 1W35A 2QGGA 1YJWB 1UD5A 4X05A 2WJYA 4Z4YA 3A35A 1N0UA 3H94A 2ZXIA 1RQRA 2ZL7A 4M4SA 1WOPA 4WZTA 4LBVA 5BSYA 4AF6A 1NJID 3CB4A 4P3IA 1QG0A 3VO2A 1JB9A 1V0EA 3SLNA 2CBXA 5HZBA 3ASRA 3Q6QA 3AGPA 4RD1A 1QH0A 3LNNA 4RD2A 1EFCA 3OZUA 4OOXA 1T6ZA 2ZZFA 5FA6A 3QFRA 4UAJA 3CCUB 1T6YA 4XL9A 5LMZA 1VLOA 4ZV4A 1Q7YD 2RC5A 3OAAA 1QUFA 4RD0A 1I8DA 4R71A 1W0JA 3WY9A 1AMOA 3CMAB 2DIEA 1EFTA 3ONYA 2W6IA 3CCLB 1TUIA 2F43A 3P27A 1Y0RA 1H8HA 1F60A 1K28D 1Q9SA 2QDXA 3WNBA 4TMVA 1DDGA 4NCNA 4UZUA 1G7TA 2I1LA 5J35A 4Q7JB 3Q6RA 3PUNA 1ZM3A 2X6WA 4AF7A 4Z4UA 4Z4SA 3NE5B 2BM0A 3ZBUA 3JQPA 1SKQA 3WBKA 5KNLA 1FNDA 1E1QA 2EFGA 2C2WA 2BSAA 1NBMA 4Y7CA 3CCSB 2X0KA 2VNJA 2LZJA 2VJJA 1WOSA 4Y9UA 4F7DA 4CQJA 3FPPA 1KMHA 2X6XA 3OW7A 4QFMA 2QEXB 4M0LA 5CDFA 3CCVB 1V0FA 2JJ2A 4TMTA 5GV7A 1Q81D 2X6YA 3GIRA 1KQSB 1EFUA 1VQ6B 2Q6OA 2HMAA 3RY8A 4RD6A 1QGAA 2ZTNA 2FX3A 5DS0A 4P25A 1IJFA 1WP6A 2AHOA 3MCAA 4XQFA 4YELA 1XFOA 3A8IA 2ZBUA 3FKSA 5JBQA 3SKBA 4YEJA 3OE7A 5F4OA 1EP1B 1VF7A 1N05A 3CMEB 2R6HA 4RCYA 1KTVA 2D74A 3E1YE 1IB0A 4PGOA 3VNVA 2NPFA 2HCJB 3BNWA 3ZZUA 1N06A 4QVJA 2E1RA 1NB9A 1KK0A 4UZEA 4XKWA 2WZPP 3LQ6A 5TR9A 5HKKA 5F4MA 4NNJA 2C78A 3R6KA 4G7XA 4LBZA 1G7SA 2WZNA 4WQMA 2X53S 1GAQA 1KRHA 1RQPA 2GPJA 4P12A 4YAWA 1PJ7A 1K8AD 1ZUNB 3LQEA 2XZPA 2X8KA 2XNCA 4KKSA 1J9ZA 1D2EA 2KVOA 4RDJA 3GVLA 2OBSA 4RJLA 3ASQA 2XNDA 1XE1A 4RDLA 2NV4A 1QGYA 4XONA 2ZXHA 1R5OA 4B4DA 1YITB 2GREA 1QVFB 3I1FA 4RDKA 4ASUA 3ZC3A 1P4MA 1H8EA 4ZGQB 1JJ2B 2VBVA 4X7EA 4DNTB 1WU8A 4B44A 4FK8A 4PC1A 3BH4A 3WNCA 4Z4VA 4TMZA 4X07A 2C4UA 1DG1G 3CPXA 1WDTA 1G7RA 3CCMB 3OP1A
chains in the Genus database with same CATH topology
3SJPA 3ONYA 5IYWA 5KW9A 5BSXA 5IYQA 5IYPA 2OBRA 3ASSA 5J35A 4WZKA 3Q6RA 3PUNA 4Z4UA 3ONUA 4Z4SA 3Q39A 4X06A 4OOVA 3ASTA 2ZL5A 3ASPA 5F4JA 4OP7A 3PUMA 3RY8A 4RM0A 4P25A 5IYRA 4OPOA 4Z4ZA 3PA1A 4RLZA 3SKBA 5F4OA 3R6JA 4WZLA 4WZEA 3PVDA 3SEJA 3V7AA 3Q3AA 5E6TA 1IHMA 3D26A 4QVAA 4RPBA 4QVJA 3BY2A 3BQJA 3LQ6A 4Z4TA 5F4MA 3R6KA 4ROXA 3PA2A 3SLDA 4QUZA 4P26A 4QV2A 4P12A 5IYNA 4Z4WA 4X0CA 3LQEA 4P1VA 4X7FA 4OPVA 4RDJA 3Q38A 2OBSA 4X05A 3ASQA 4Z4YA 2ZL7A 4RDLA 4WZTA 4OOSA 4X7DA 5BSYA 4P3IA 4X7CA 3SLNA 4RPDA 5HZBA 3ASRA 4RDKA 3Q6QA 4OOXA 4X7EA 5J3OA 5HZAA 2ZL6A 4Z4RA 4Z4VA 4X07A 4OPSA 4P2NA 2OBTA 3BY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJP A;  3ONY A;  5IYW A;  5KW9 A;  5BSX A;  5IYQ A;  5IYP A;  2OBR A;  3ASS A;  5J35 A;  4WZK A;  3Q6R A;  3PUN A;  4Z4U A;  3ONU A;  4Z4S A;  3Q39 A;  4X06 A;  4OOV A;  3AST A;  2ZL5 A;  3ASP A;  5F4J A;  4OP7 A;  3PUM A;  3RY8 A;  4RM0 A;  4P25 A;  5IYR A;  4OPO A;  4Z4Z A;  3PA1 A;  4RLZ A;  3SKB A;  5F4O A;  3R6J A;  4WZL A;  4WZE A;  3PVD A;  3SEJ A;  3V7A A;  3Q3A A;  5E6T A;  1IHM A;  3D26 A;  4QVA A;  4RPB A;  4QVJ A;  3BY2 A;  3BQJ A;  3LQ6 A;  4Z4T A;  5F4M A;  3R6K A;  4ROX A;  3PA2 A;  3SLD A;  4QUZ A;  4P26 A;  4QV2 A;  4P12 A;  5IYN A;  4Z4W A;  4X0C A;  3LQE A;  4P1V A;  4X7F A;  4OPV A;  4RDJ A;  3Q38 A;  2OBS A;  4X05 A;  3ASQ A;  4Z4Y A;  2ZL7 A;  4RDL A;  4WZT A;  4OOS A;  4X7D A;  5BSY A;  4P3I A;  4X7C A;  3SLN A;  4RPD A;  5HZB A;  3ASR A;  4RDK A;  3Q6Q A;  4OOX A;  4X7E A;  5J3O A;  5HZA A;  2ZL6 A;  4Z4R A;  4Z4V A;  4X07 A;  4OPS A;  4P2N A;  2OBT A;  3BY1 A; 
#chains in the Genus database with same CATH topology
 4N3N A;  3ZPN A;  3T51 B;  4DK1 A;  3CMM A;  2Q6L A;  5IYW A;  5KW9 A;  4XR6 A;  1FRQ A;  4YAL A;  2QTL A;  1FDR A;  2C5B A;  5IYP A;  4M53 A;  4P3Y A;  2OBR A;  3MMP A;  1OGI A;  1VQ9 B;  3OJW A;  1QVG B;  1I18 A;  1EP2 B;  1W87 A;  3BCD A;  2WYR A;  4IW3 B;  5H5J A;  2B7B A;  3CCQ B;  2V7X A;  1VJS A;  4KKU A;  3A3G A;  2QE7 A;  4ACA A;  3QFC A;  1VQP B;  3CC7 B;  3CD6 B;  3QSY A;  1OGJ A;  3Q39 A;  5TRD A;  1NB0 A;  4HIZ A;  1ELO A;  4MYT A;  1E43 A;  4OOV A;  3GSI A;  1YIJ B;  2PMD A;  1FNB A;  4DQL A;  2DY1 A;  1WSR A;  2V7Q A;  4B43 A;  2BGJ A;  3ASP A;  4EH1 A;  5F4J A;  2WR8 A;  1HVX A;  4DK0 A;  4B47 A;  1W2B B;  1TTT A;  2F1L A;  1VQ4 B;  4ZCL A;  3B78 A;  2M5S A;  2QTZ A;  3ES9 A;  1G7C A;  5TY0 A;  3CC4 B;  3PEN A;  4RD4 A;  2V4D A;  3J81 k;  1QFZ A;  2V7W A;  1D8T A;  5A88 A;  4P6Y A;  2C4T A;  1S0U A;  1WOO A;  3BCF A;  1KJZ A;  4RLZ A;  4YAO A;  3R6J A;  1YJN B;  4K1X A;  2GQF A;  4J0Q A;  1DAR A;  1E3Z A;  3SEJ A;  2VBT A;  3LO8 A;  3OJX A;  3W5V A;  2YWE A;  5E6T A;  1BLI A;  3LVB A;  4P22 A;  1IHM A;  3QE2 A;  4PC7 A;  2CF4 A;  1GJR A;  1UMK A;  4Z4T A;  3PA2 A;  4FN5 A;  2PLF A;  1GVH A;  3W2G A;  2D3L A;  4QV2 A;  1BMF A;  1QGZ A;  2BM1 A;  3VR6 A;  2OYN A;  5HXB A;  1JNY A;  1QX4 A;  3W2I A;  4II2 A;  3W5H A;  2F1M A;  1D1N A;  4RCZ A;  3WXM A;  3CES A;  1SKY B;  3CCJ B;  3WYA A;  2WPD A;  3Q38 A;  1W34 A;  1NDH A;  4PAA A;  1QFY A;  3FJO A;  4AVZ A;  2BF4 A;  4OOS A;  1N08 A;  4XKV A;  3VNU A;  1F20 A;  3A8J A;  3ZUG A;  1VQ8 B;  1H85 A;  1YLO A;  1ZM4 A;  4X7C A;  1B23 P;  3GQB A;  5DSZ A;  4L8J A;  1YJ9 B;  1VQK B;  2RC6 A;  2VYQ A;  4G7W A;  3CXC B;  1UD3 A;  4B48 A;  3CCR B;  1W0K A;  3U2Q A;  3B82 A;  1VHO A;  1AIP A;  3H9N A;  4Z1M A;  4Z4R A;  3SJZ A;  4C43 A;  1B2R A;  1E64 A;  2X85 A;  4HE5 A;  4LBW A;  4ZGN B;  1Y0Y A;  4P2N A;  3CRZ A;  2D9R A;  2OBT A;  1FX0 A;  2C77 A;  3ZBT A;  3BY1 A;  4YHB A;  4TT3 A;  4LC0 A;  2BPO A;  4PAB A;  1SM4 A;  3ISX A;  1EFR A;  4Y9R A;  4X8I A;  1E3X A;  1W9X A;  1QUE A;  3JQR A;  1CNF A;  3JU4 A;  5IYQ A;  4XLC A;  2PE3 A;  2HDN B;  2JN9 A;  1JA1 A;  2V7V A;  2GJK A;  3ASS A;  1VQN B;  4ZCM A;  1BX0 A;  3W2E A;  1CQX A;  1PJ6 A;  2CW5 A;  3WBJ A;  1R5B A;  4YAU A;  2CC2 A;  1N0V C;  1H42 A;  3CTA A;  4P9S A;  4XN3 A;  4ACB A;  3OEH A;  3AGQ A;  1KD1 D;  1MAB A;  1UD2 A;  1YI2 B;  1VLY A;  1XQB A;  2VBS A;  4X06 A;  2OK8 A;  3OW2 B;  1VHE A;  2ZL5 A;  1M1K D;  4XOP A;  4P6V F;  3VO1 A;  3JQQ A;  1VQ7 B;  1T5E A;  4B3X A;  5THX A;  2DER A;  3T53 B;  1OHH A;  4YXW A;  1KK2 A;  5FO1 A;  4OP7 A;  2D3N A;  3G4S B;  2V7T A;  3BC9 A;  4TKO B;  2CRV A;  3PUM A;  1YHQ B;  1QFJ A;  1UD6 A;  2BMW A;  3AVU A;  3G6E B;  1I7P A;  3GVK A;  2QA4 B;  3W2H A;  5IYR A;  2F4N A;  2BN4 A;  3ZZ0 A;  4Z4Z A;  2EIX A;  1BQE A;  1T6X A;  5KSW B;  3CP2 A;  1OB5 A;  3P26 A;  3CCE B;  2ZTG A;  2GK6 A;  3PVD A;  1GO2 A;  3V7A A;  4JMQ A;  4FWT A;  5GV8 A;  3QFT A;  4M2L A;  5A89 A;  1M90 D;  2QMU A;  3CP8 A;  4G1B A;  4QVA A;  1OB2 A;  3BY2 A;  2X3U A;  4RD3 A;  2VNI A;  2R9V A;  2V31 A;  4ROX A;  1JA0 A;  4II3 A;  3SLD A;  1Q82 D;  4P26 A;  2VBU A;  2XGJ A;  2ZZG A;  4UZF A;  4Z4W A;  1S72 B;  2W6J A;  3OKX A;  2OK7 A;  2ZBV A;  2Q6I A;  2VNH A;  1VQL B;  1YX2 A;  4X7F A;  1KC8 D;  2YWH A;  2YWF A;  1E63 A;  3GVJ A;  1A8P A;  4XM3 A;  1E79 A;  5TV2 A;  5FO0 A;  2DEU A;  4BPR A;  4X7D A;  1OB0 A;  4TMX A;  1FNC A;  4XLH A;  1BX1 A;  2Q6K A;  1U2R A;  1WSV A;  1CNE A;  3CW2 A;  4RPD A;  2XEX A;  5L46 A;  2JDI A;  1VQO B;  2C5H A;  1N8R D;  1K9M D;  1WOR A;  1WPC A;  4C0S A;  4NBS A;  1E1R A;  3G05 A;  2ZZQ A;  5HZA A;  5J3O A;  4PC2 A;  2VNK A;  2ZL6 A;  3AVX A;  4KKT A;  3B8H A;  4OPS A;  2XZL A;  4N3G A;  1ZM9 A;  5A8A A;  4YAF A;  3OZW A;  3I55 B;  4TMW A;  2XZO A;  4XD7 A;  2GJP A;  4PC6 A;  1V5V A;  1HA3 A;  3SJP A;  3HAG A;  2WJV A;  3U6K A;  1PKV A;  2ZIT A;  3DDY A;  4U9U A;  1FRN A;  4WWV A;  4XNF A;  5DN6 A;  1PJ5 A;  4XN0 A;  4XLE A;  4FXU A;  2JJ1 A;  5BSX A;  3V76 A;  3I56 B;  1N07 A;  1XB2 A;  4XLA A;  2VJI A;  3T56 B;  1UD8 A;  1EWY A;  1R5N A;  2E1B A;  4WZK A;  4B3G A;  2XOK A;  3ONU A;  4XOR A;  3ZZT A;  1DDI A;  4MYU A;  3A8K A;  2ZZE A;  3MHP A;  5AN9 A;  3KL9 A;  2CK3 A;  5EMN A;  3G71 B;  5FIU A;  4GQN A;  5FL7 A;  3AST A;  3CPW B;  1ZM2 A;  2P3M A;  1HZE A;  4XMY A;  2GJR A;  3A3B A;  4PC3 A;  3A1P A;  3AVY A;  3OZV A;  4M1K A;  2DYI A;  1WTH D;  2YWG A;  3FPK A;  4HE6 A;  1Q86 D;  2HLD A;  2DET A;  2CND A;  3AVW A;  3ZIA A;  3VMF A;  2GK7 A;  1EP3 B;  2BGI A;  1IJE A;  1E62 A;  4RM0 A;  3E20 A;  3AVV A;  2DOG A;  1K73 D;  5IK2 A;  3AVT A;  2XNJ A;  3KEW A;  4OPO A;  1GR1 A;  3QFS A;  3U6B A;  2BV3 A;  3WND A;  2PIA A;  2QN6 A;  3OEE A;  3PA1 A;  2OTL B;  2B7C A;  3CC2 B;  4B3F X;  4G6I A;  5H59 A;  1KZL A;  1MRZ A;  4WZL A;  4LBY A;  5B6I A;  1TLL A;  2J7K A;  4WZE A;  2V7U A;  2Z6B D;  5FNZ A;  4DNR B;  4H9G A;  1VQ5 B;  1BPL A;  4G1V A;  3Q3A A;  4TN1 A;  4ZCI A;  3OFN A;  2BVN A;  3W5U A;  3D26 A;  2B5O A;  1NRK A;  2WSS A;  1FNM A;  2FVG A;  4RPB A;  3W2F A;  1BJK A;  1UD4 A;  4QHY A;  3BQJ A;  2DCU A;  1COW A;  3OOC A;  4XLF A;  2JIZ A;  4QUZ A;  4E0F A;  4TSF A;  4XOT A;  1S4M A;  1GAW A;  1EXM A;  1TVC A;  5IYN A;  1KK3 A;  1KK1 A;  4X0C A;  2VZL A;  2OTJ B;  3WQZ A;  4P1V A;  1VQM B;  4DQK A;  4G5G A;  4AC9 A;  3OPO A;  4OPV A;  1W35 A;  2QGG A;  1YJW B;  1UD5 A;  4X05 A;  2WJY A;  4Z4Y A;  3A35 A;  1N0U A;  3H94 A;  2ZXI A;  1RQR A;  2ZL7 A;  4M4S A;  1WOP A;  4WZT A;  4LBV A;  5BSY A;  4AF6 A;  1NJI D;  3CB4 A;  4P3I A;  1QG0 A;  3VO2 A;  1JB9 A;  1V0E A;  3SLN A;  2CBX A;  5HZB A;  3ASR A;  3Q6Q A;  3AGP A;  4RD1 A;  1QH0 A;  3LNN A;  4RD2 A;  1EFC A;  3OZU A;  4OOX A;  1T6Z A;  2ZZF A;  5FA6 A;  3QFR A;  4UAJ A;  3CCU B;  1T6Y A;  4XL9 A;  5LMZ A;  1VLO A;  4ZV4 A;  1Q7Y D;  2RC5 A;  3OAA A;  1QUF A;  4RD0 A;  1I8D A;  4R71 A;  1W0J A;  3WY9 A;  1AMO A;  3CMA B;  2DIE A;  1EFT A;  3ONY A;  2W6I A;  3CCL B;  1TUI A;  2F43 A;  3P27 A;  1Y0R A;  1H8H A;  1F60 A;  1K28 D;  1Q9S A;  2QDX A;  3WNB A;  4TMV A;  1DDG A;  4NCN A;  4UZU A;  1G7T A;  2I1L A;  5J35 A;  4Q7J B;  3Q6R A;  3PUN A;  1ZM3 A;  2X6W A;  4AF7 A;  4Z4U A;  4Z4S A;  3NE5 B;  2BM0 A;  3ZBU A;  3JQP A;  1SKQ A;  3WBK A;  5KNL A;  1FND A;  1E1Q A;  2EFG A;  2C2W A;  2BSA A;  1NBM A;  4Y7C A;  3CCS B;  2X0K A;  2VNJ A;  2LZJ A;  2VJJ A;  1WOS A;  4Y9U A;  4F7D A;  4CQJ A;  3FPP A;  1KMH A;  2X6X A;  3OW7 A;  4QFM A;  2QEX B;  4M0L A;  5CDF A;  3CCV B;  1V0F A;  2JJ2 A;  4TMT A;  5GV7 A;  1Q81 D;  2X6Y A;  3GIR A;  1KQS B;  1EFU A;  1VQ6 B;  2Q6O A;  2HMA A;  3RY8 A;  4RD6 A;  1QGA A;  2ZTN A;  2FX3 A;  5DS0 A;  4P25 A;  1IJF A;  1WP6 A;  2AHO A;  3MCA A;  4XQF A;  4YEL A;  1XFO A;  3A8I A;  2ZBU A;  3FKS A;  5JBQ A;  3SKB A;  4YEJ A;  3OE7 A;  5F4O A;  1EP1 B;  1VF7 A;  1N05 A;  3CME B;  2R6H A;  4RCY A;  1KTV A;  2D74 A;  3E1Y E;  1IB0 A;  4PGO A;  3VNV A;  2NPF A;  2HCJ B;  3BNW A;  3ZZU A;  1N06 A;  4QVJ A;  2E1R A;  1NB9 A;  1KK0 A;  4UZE A;  4XKW A;  2WZP P;  3LQ6 A;  5TR9 A;  5HKK A;  5F4M A;  4NNJ A;  2C78 A;  3R6K A;  4G7X A;  4LBZ A;  1G7S A;  2WZN A;  4WQM A;  2X53 S;  1GAQ A;  1KRH A;  1RQP A;  2GPJ A;  4P12 A;  4YAW A;  1PJ7 A;  1K8A D;  1ZUN B;  3LQE A;  2XZP A;  2X8K A;  2XNC A;  4KKS A;  1J9Z A;  1D2E A;  2KVO A;  4RDJ A;  3GVL A;  2OBS A;  4RJL A;  3ASQ A;  2XND A;  1XE1 A;  4RDL A;  2NV4 A;  1QGY A;  4XON A;  2ZXH A;  1R5O A;  4B4D A;  1YIT B;  2GRE A;  1QVF B;  3I1F A;  4RDK A;  4ASU A;  3ZC3 A;  1P4M A;  1H8E A;  4ZGQ B;  1JJ2 B;  2VBV A;  4X7E A;  4DNT B;  1WU8 A;  4B44 A;  4FK8 A;  4PC1 A;  3BH4 A;  3WNC A;  4Z4V A;  4TMZ A;  4X07 A;  2C4U A;  1DG1 G;  3CPX A;  1WDT A;  1G7R A;  3CCM B;  3OP1 A; 
#chains in the Genus database with same CATH homology
 3SJP A;  3ONY A;  5IYW A;  5KW9 A;  5BSX A;  5IYQ A;  5IYP A;  2OBR A;  3ASS A;  5J35 A;  4WZK A;  3Q6R A;  3PUN A;  4Z4U A;  3ONU A;  4Z4S A;  3Q39 A;  4X06 A;  4OOV A;  3AST A;  2ZL5 A;  3ASP A;  5F4J A;  4OP7 A;  3PUM A;  3RY8 A;  4RM0 A;  4P25 A;  5IYR A;  4OPO A;  4Z4Z A;  3PA1 A;  4RLZ A;  3SKB A;  5F4O A;  3R6J A;  4WZL A;  4WZE A;  3PVD A;  3SEJ A;  3V7A A;  3Q3A A;  5E6T A;  1IHM A;  3D26 A;  4QVA A;  4RPB A;  4QVJ A;  3BY2 A;  3BQJ A;  3LQ6 A;  4Z4T A;  5F4M A;  3R6K A;  4ROX A;  3PA2 A;  3SLD A;  4QUZ A;  4P26 A;  4QV2 A;  4P12 A;  5IYN A;  4Z4W A;  4X0C A;  3LQE A;  4P1V A;  4X7F A;  4OPV A;  4RDJ A;  3Q38 A;  2OBS A;  4X05 A;  3ASQ A;  4Z4Y A;  2ZL7 A;  4RDL A;  4WZT A;  4OOS A;  4X7D A;  5BSY A;  4P3I A;  4X7C A;  3SLN A;  4RPD A;  5HZB A;  3ASR A;  4RDK A;  3Q6Q A;  4OOX A;  4X7E A;  5J3O A;  5HZA A;  2ZL6 A;  4Z4R A;  4Z4V A;  4X07 A;  4OPS A;  4P2N A;  2OBT A;  3BY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...