4RPAA

Crystal structure of inorganic pyrophosphatase from staphylococcus aureus in complex with mn2+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
308
structure length
306
Chain Sequence
AKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of inorganic pyrophosphatase from Staphylococcus aureus reveals conformational flexibility of the active site.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Probable manganese-dependent inorganic pyrophosphatase
total genus 98
structure length 306
sequence length 308
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4rpaA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 4rpaA01
1WPMA 1WPPA 1I74A 1K20A 2QB6A 2QB8A 2HAWA 2EB0A 2IW4A 4PY9A 2ENXA 3DEVA 4LS9A 3W5WA 1K23A 4RPAA 1WPNA 2QB7A
chains in the Genus database with same CATH superfamily
4K8LA 1U1VA 3G98A 1U1XA 1U0KA 1U1WA 2ZVFA 2OTNA 2ZXRA 1IR6A 1S7JA 2ZXPA 1K20A 4GL6A 2QB8A 2HAWA 2EB0A 5GL2A 4PY9A 1WPNA 5GL4A 5HA4A 3EKMA 1WPMA 2IW4A 3W5WA 4JCIA 2ENXA 2LT2A 4JD7A 4LS9A 2ZXOA 1T6KA 4JUUA 4Q2HA 2PVZA 5GKXA 4J9WA 2YMAA 3ICJA 4FC5A 1WPPA 1YM5A 5ANPA 4J9XA 2QB6A 1W62A 2GKJA 3IGHX 5GL3A 2Q9JA 2KPTA 2GKEA 5H2GA 3PW9A 2Q9HA 4Q60A 1TM0A 4IJZA 3DEVA 4DUNA 4IK0A 1W61A 4K7GB 1I74A 4DWZA 5IWEA 4LG3A 2H9FA 3PTJA 3EJXA 2PW0A 1GQZA 3PVHA 3EDNA 2KW7A 2QB7A 5M47A 1BWZA 1XUAA 1SDJA 1QYAA 4LB0A 2MPBA 3G7KA 2AZPA 1QY9A 4K7XA 3WQZA 1XUBA 4OA3A 4JBDA 3FVEA 1K23A 4RPAA 5H2YA
chains in the Genus database with same CATH topology
4K8LA 1U1VA 3G98A 1U1XA 1U0KA 1U1WA 2ZVFA 2OTNA 2ZXRA 1IR6A 1S7JA 2ZXPA 1K20A 4GL6A 2QB8A 2HAWA 2EB0A 5GL2A 4PY9A 1WPNA 5GL4A 5HA4A 3EKMA 1WPMA 2IW4A 3W5WA 4JCIA 2ENXA 2LT2A 4JD7A 4LS9A 2ZXOA 1T6KA 4JUUA 4Q2HA 2PVZA 5GKXA 4J9WA 2YMAA 3ICJA 4FC5A 1WPPA 1YM5A 5ANPA 4J9XA 2QB6A 1W62A 2GKJA 3IGHX 5GL3A 2Q9JA 2KPTA 2GKEA 5H2GA 3PW9A 2Q9HA 4Q60A 1TM0A 4IJZA 3DEVA 4DUNA 4IK0A 1W61A 4K7GB 1I74A 4DWZA 5IWEA 4LG3A 2H9FA 3PTJA 3EJXA 2PW0A 1GQZA 3PVHA 3EDNA 2KW7A 2QB7A 5M47A 1BWZA 1XUAA 1SDJA 1QYAA 4LB0A 2MPBA 3G7KA 2AZPA 1QY9A 4K7XA 3WQZA 1XUBA 4OA3A 4JBDA 3FVEA 1K23A 4RPAA 5H2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPM A;  1WPP A;  1I74 A;  1K20 A;  2QB6 A;  2QB8 A;  2HAW A;  2EB0 A;  2IW4 A;  4PY9 A;  2ENX A;  3DEV A;  4LS9 A;  3W5W A;  1K23 A;  4RPA A;  1WPN A;  2QB7 A; 
#chains in the Genus database with same CATH topology
 4K8L A;  1U1V A;  3G98 A;  1U1X A;  1U0K A;  1U1W A;  2ZVF A;  2OTN A;  2ZXR A;  1IR6 A;  1S7J A;  2ZXP A;  1K20 A;  4GL6 A;  2QB8 A;  2HAW A;  2EB0 A;  5GL2 A;  4PY9 A;  1WPN A;  5GL4 A;  5HA4 A;  3EKM A;  1WPM A;  2IW4 A;  3W5W A;  4JCI A;  2ENX A;  2LT2 A;  4JD7 A;  4LS9 A;  2ZXO A;  1T6K A;  4JUU A;  4Q2H A;  2PVZ A;  5GKX A;  4J9W A;  2YMA A;  3ICJ A;  4FC5 A;  1WPP A;  1YM5 A;  5ANP A;  4J9X A;  2QB6 A;  1W62 A;  2GKJ A;  3IGH X;  5GL3 A;  2Q9J A;  2KPT A;  2GKE A;  5H2G A;  3PW9 A;  2Q9H A;  4Q60 A;  1TM0 A;  4IJZ A;  3DEV A;  4DUN A;  4IK0 A;  1W61 A;  4K7G B;  1I74 A;  4DWZ A;  5IWE A;  4LG3 A;  2H9F A;  3PTJ A;  3EJX A;  2PW0 A;  1GQZ A;  3PVH A;  3EDN A;  2KW7 A;  2QB7 A;  5M47 A;  1BWZ A;  1XUA A;  1SDJ A;  1QYA A;  4LB0 A;  2MPB A;  3G7K A;  2AZP A;  1QY9 A;  4K7X A;  3WQZ A;  1XUB A;  4OA3 A;  4JBD A;  3FVE A;  1K23 A;  4RPA A;  5H2Y A; 
#chains in the Genus database with same CATH homology
 4K8L A;  1U1V A;  3G98 A;  1U1X A;  1U0K A;  1U1W A;  2ZVF A;  2OTN A;  2ZXR A;  1IR6 A;  1S7J A;  2ZXP A;  1K20 A;  4GL6 A;  2QB8 A;  2HAW A;  2EB0 A;  5GL2 A;  4PY9 A;  1WPN A;  5GL4 A;  5HA4 A;  3EKM A;  1WPM A;  2IW4 A;  3W5W A;  4JCI A;  2ENX A;  2LT2 A;  4JD7 A;  4LS9 A;  2ZXO A;  1T6K A;  4JUU A;  4Q2H A;  2PVZ A;  5GKX A;  4J9W A;  2YMA A;  3ICJ A;  4FC5 A;  1WPP A;  1YM5 A;  5ANP A;  4J9X A;  2QB6 A;  1W62 A;  2GKJ A;  3IGH X;  5GL3 A;  2Q9J A;  2KPT A;  2GKE A;  5H2G A;  3PW9 A;  2Q9H A;  4Q60 A;  1TM0 A;  4IJZ A;  3DEV A;  4DUN A;  4IK0 A;  1W61 A;  4K7G B;  1I74 A;  4DWZ A;  5IWE A;  4LG3 A;  2H9F A;  3PTJ A;  3EJX A;  2PW0 A;  1GQZ A;  3PVH A;  3EDN A;  2KW7 A;  2QB7 A;  5M47 A;  1BWZ A;  1XUA A;  1SDJ A;  1QYA A;  4LB0 A;  2MPB A;  3G7K A;  2AZP A;  1QY9 A;  4K7X A;  3WQZ A;  1XUB A;  4OA3 A;  4JBD A;  3FVE A;  1K23 A;  4RPA A;  5H2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...