4RPAA

Crystal structure of inorganic pyrophosphatase from staphylococcus aureus in complex with mn2+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
308
structure length
306
Chain Sequence
b'AKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable manganese-dependent inorganic pyrophosphatase
publication title Structure of inorganic pyrophosphatase from Staphylococcus aureus reveals conformational flexibility of the active site.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 98
structure length 306
sequence length 308
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4rpaA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 4rpaA01
2HAWA 1K23A 2IW4A 3DEVA 2QB8A 4PY9A 1WPPA 1K20A 2QB7A 4RPAA 1WPNA 3W5WA 2QB6A 2ENXA 2EB0A 1WPMA 1I74A 4LS9A
chains in the Genus database with same CATH superfamily
2KPTA 4K7XA 1SDJA 1XUBA 3PW9A 1GQZA 1S7JA 5M47A 4LS9A 4JUUA 2H9FA 5GL2A 3EDNA 1WPNA 1BWZA 1U1WA 1WPMA 2YMAA 3WQZA 2LT2A 1QY9A 2ZXRA 1W62A 1T6KA 4LG3A 1U0KA 1K23A 4J9XA 2AZPA 3G98A 1YM5A 2GKEA 5H2GA 4IJZA 4Q2HA 4LB0A 4PY9A 3IGHX 1WPPA 5GL3A 3FVEA 2Q9HA 4GL6A 5ANPA 2QB6A 2ENXA 3EJXA 2IW4A 2ZVFA 4OA3A 5GL4A 5IWEA 3W5WA 4DUNA 2EB0A 3ICJA 5H2YA 2PW0A 1K20A 1TM0A 2PVZA 2HAWA 3DEVA 5GKXA 2QB8A 4J9WA 4IK0A 4K8LA 4DWZA 4K7GB 4JD7A 2GKJA 4FC5A 4RPAA 1XUAA 1W61A 4JBDA 5HA4A 2MPBA 2KW7A 2ZXOA 1U1XA 3PVHA 1I74A 4Q60A 2QB7A 2ZXPA 4JCIA 2Q9JA 1U1VA 3EKMA 3G7KA 2OTNA 1IR6A 3PTJA 1QYAA
chains in the Genus database with same CATH topology
2KPTA 4K7XA 1SDJA 1XUBA 3PW9A 1GQZA 1S7JA 5M47A 4LS9A 4JUUA 2H9FA 5GL2A 3EDNA 1WPNA 1BWZA 1U1WA 1WPMA 2YMAA 3WQZA 2LT2A 1QY9A 2ZXRA 1W62A 1T6KA 4LG3A 1U0KA 1K23A 4J9XA 2AZPA 3G98A 1YM5A 2GKEA 5H2GA 4IJZA 4Q2HA 4LB0A 4PY9A 3IGHX 1WPPA 5GL3A 3FVEA 2Q9HA 4GL6A 5ANPA 2QB6A 2ENXA 3EJXA 2IW4A 2ZVFA 4OA3A 5GL4A 5IWEA 3W5WA 4DUNA 2EB0A 3ICJA 5H2YA 2PW0A 1K20A 1TM0A 2PVZA 2HAWA 3DEVA 5GKXA 2QB8A 4J9WA 4IK0A 4K8LA 4DWZA 4K7GB 4JD7A 2GKJA 4FC5A 4RPAA 1XUAA 1W61A 4JBDA 5HA4A 2MPBA 2KW7A 2ZXOA 1U1XA 3PVHA 1I74A 4Q60A 2QB7A 2ZXPA 4JCIA 2Q9JA 1U1VA 3EKMA 3G7KA 2OTNA 1IR6A 3PTJA 1QYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAW A;  1K23 A;  2IW4 A;  3DEV A;  2QB8 A;  4PY9 A;  1WPP A;  1K20 A;  2QB7 A;  4RPA A;  1WPN A;  3W5W A;  2QB6 A;  2ENX A;  2EB0 A;  1WPM A;  1I74 A;  4LS9 A; 
#chains in the Genus database with same CATH topology
 2KPT A;  4K7X A;  1SDJ A;  1XUB A;  3PW9 A;  1GQZ A;  1S7J A;  5M47 A;  4LS9 A;  4JUU A;  2H9F A;  5GL2 A;  3EDN A;  1WPN A;  1BWZ A;  1U1W A;  1WPM A;  2YMA A;  3WQZ A;  2LT2 A;  1QY9 A;  2ZXR A;  1W62 A;  1T6K A;  4LG3 A;  1U0K A;  1K23 A;  4J9X A;  2AZP A;  3G98 A;  1YM5 A;  2GKE A;  5H2G A;  4IJZ A;  4Q2H A;  4LB0 A;  4PY9 A;  3IGH X;  1WPP A;  5GL3 A;  3FVE A;  2Q9H A;  4GL6 A;  5ANP A;  2QB6 A;  2ENX A;  3EJX A;  2IW4 A;  2ZVF A;  4OA3 A;  5GL4 A;  5IWE A;  3W5W A;  4DUN A;  2EB0 A;  3ICJ A;  5H2Y A;  2PW0 A;  1K20 A;  1TM0 A;  2PVZ A;  2HAW A;  3DEV A;  5GKX A;  2QB8 A;  4J9W A;  4IK0 A;  4K8L A;  4DWZ A;  4K7G B;  4JD7 A;  2GKJ A;  4FC5 A;  4RPA A;  1XUA A;  1W61 A;  4JBD A;  5HA4 A;  2MPB A;  2KW7 A;  2ZXO A;  1U1X A;  3PVH A;  1I74 A;  4Q60 A;  2QB7 A;  2ZXP A;  4JCI A;  2Q9J A;  1U1V A;  3EKM A;  3G7K A;  2OTN A;  1IR6 A;  3PTJ A;  1QYA A; 
#chains in the Genus database with same CATH homology
 2KPT A;  4K7X A;  1SDJ A;  1XUB A;  3PW9 A;  1GQZ A;  1S7J A;  5M47 A;  4LS9 A;  4JUU A;  2H9F A;  5GL2 A;  3EDN A;  1WPN A;  1BWZ A;  1U1W A;  1WPM A;  2YMA A;  3WQZ A;  2LT2 A;  1QY9 A;  2ZXR A;  1W62 A;  1T6K A;  4LG3 A;  1U0K A;  1K23 A;  4J9X A;  2AZP A;  3G98 A;  1YM5 A;  2GKE A;  5H2G A;  4IJZ A;  4Q2H A;  4LB0 A;  4PY9 A;  3IGH X;  1WPP A;  5GL3 A;  3FVE A;  2Q9H A;  4GL6 A;  5ANP A;  2QB6 A;  2ENX A;  3EJX A;  2IW4 A;  2ZVF A;  4OA3 A;  5GL4 A;  5IWE A;  3W5W A;  4DUN A;  2EB0 A;  3ICJ A;  5H2Y A;  2PW0 A;  1K20 A;  1TM0 A;  2PVZ A;  2HAW A;  3DEV A;  5GKX A;  2QB8 A;  4J9W A;  4IK0 A;  4K8L A;  4DWZ A;  4K7G B;  4JD7 A;  2GKJ A;  4FC5 A;  4RPA A;  1XUA A;  1W61 A;  4JBD A;  5HA4 A;  2MPB A;  2KW7 A;  2ZXO A;  1U1X A;  3PVH A;  1I74 A;  4Q60 A;  2QB7 A;  2ZXP A;  4JCI A;  2Q9J A;  1U1V A;  3EKM A;  3G7K A;  2OTN A;  1IR6 A;  3PTJ A;  1QYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...