4RPBA

Crystal structure of p domain of snow mountain norovirus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
308
structure length
300
Chain Sequence
KPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLTLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFGVITQRDKQNAAGQSQPANRGHDAVVPTYTAQYTPKLGQVQIGTDLKVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYLPLKGGYGNPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norovirus hu/gii.2/kl109/1978/mys
molecule tags Viral protein
molecule keywords Capsid protein VP1
total genus 71
structure length 300
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rpbA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rpbA01
3PVDA 5KW9A 1IHMA 4OP7A 5F4OA 5F4MA 4Z4YA 3SLNA 3SJPA 4X7DA 4OOSA 4QVJA 4WZTA 4Z4WA 4OPVA 3PUMA 4RLZA 5J3OA 4P2NA 3SLDA 4X7FA 5IYRA 3PUNA 4Z4ZA 3ASSA 3SKBA 3BY2A 2OBRA 4WZEA 3Q39A 4OPOA 4WZKA 3ASTA 4ROXA 4X05A 4RDLA 4X7CA 3LQEA 4Z4UA 3D26A 2OBSA 2OBTA 4RDKA 4P1VA 4OPSA 5F4JA 4Z4RA 3PA2A 3LQ6A 4OOVA 3V7AA 4Z4TA 3BY1A 3Q3AA 2ZL5A 3Q6QA 5BSYA 4QVAA 3R6KA 4QUZA 5BSXA 4P26A 4OOXA 4Z4SA 3BQJA 3PA1A 4X0CA 4Z4VA 4X7EA 3RY8A 3SEJA 4RPDA 3Q38A 4RM0A 5IYPA 2ZL7A 4X07A 5IYWA 4P12A 3ASRA 5IYQA 5HZBA 4P25A 4RDJA 3R6JA 3ONUA 5E6TA 4P3IA 5IYNA 4RPBA 2ZL6A 5HZAA 4QV2A 4X06A 3Q6RA 3ASQA 5J35A 4WZLA 3ASPA 3ONYA
chains in the Genus database with same CATH superfamily
2C78A 1FNMA 4XLHA 1NBMA 3W5VA 1KMHA 2V31A 4B3XA 1EFUA 1KK3A 3JU4A 3P27A 3MMPA 1ZUNB 4KKUA 3CCUB 1T5EA 1W9XA 1QVFB 1ZM2A 3AVTA 1PJ6A 4X7DA 1PJ5A 1K73D 1KC8D 2PLFA 2D9RA 1AMOA 3ZZ0A 1QFJA 1HA3A 3SJZA 1QX4A 1SM4A 1JNYA 3WQZA 4XLCA 1JA1A 1VQ5B 1BX0A 1F20A 1F60A 3A8JA 4X7FA 3U6BA 3CB4A 1YIJB 5EMNA 1R5OA 1EP2B 2C5BA 3B8HA 2ZXHA 4U9UA 3BY2A 5FL7A 1I18A 4G6IA 2ZTGA 1YITB 3VNVA 3QFCA 5DSZA 2E1BA 4RD1A 3GVLA 1YJWB 3CD6B 1EXMA 2PE3A 3A35A 1UD3A 1VQ6B 2R9VA 2F43A 1IB0A 2Q6KA 4P9SA 2F1MA 3OP1A 4M53A 4P1VA 1NB9A 1JB9A 4ZGNB 5F4JA 3ZZTA 2V7UA 4QHYA 3PA2A 4G1BA 2BPOA 4H9GA 2Q6IA 1YJNB 3I56B 1WP6A 1K28D 1CNFA 2XNCA 1GAQA 2C4TA 1W87A 2JIZA 2ZL5A 4YAWA 5FO0A 3KL9A 3Q6QA 1JA0A 1ZM9A 3GQBA 2XGJA 1WDTA 1ZM4A 1VLYA 4QVAA 4XL9A 4LBZA 2CC2A 1YHQB 1H85A 5BSXA 2HCJB 2JJ1A 3DDYA 1I7PA 4XR6A 3OE7A 4OOXA 2HMAA 2OYNA 1OB2A 1DDIA 3BQJA 4M2LA 2GQFA 2GJRA 1VQLB 2ZZGA 3CCMB 4CQJA 2QDXA 2GK7A 3CP8A 1D2EA 4UZUA 1N07A 1GAWA 2BSAA 1N08A 1OB5A 2HDNB 3CP2A 4HIZA 4E0FA 2WYRA 1PKVA 4X07A 2FVGA 4YXWA 1E64A 1QUEA 2XNDA 5IYQA 2VZLA 1BMFA 2F1LA 4ASUA 5E6TA 1QGZA 1BLIA 2OK8A 1PJ7A 2VBTA 4RPBA 3GIRA 1JJ2B 2ZL6A 5HZAA 1Q9SA 3OPOA 4UZFA 3JQQA 1UD2A 4XOTA 3OZUA 4EH1A 1V0EA 1FRNA 3WYAA 2GJKA 2X0KA 1B2RA 4AF6A 5J35A 1FNCA 5HKKA 3G05A 4XLFA 1VQOB 1W34A 1N06A 1WOPA 4II3A 1WOOA 1W0JA 3ONYA 5H5JA 2OK7A 3A8KA 5B6IA 5KW9A 4KKSA 4OP7A 2CNDA 4XMYA 1VQKB 2QEXB 5F4OA 1XQBA 2V7WA 2ZXIA 4Z1MA 3ZC3A 4FN5A 1E1RA 1W35A 1NJID 3SLNA 3A3GA 1V5VA 3AVUA 4OOSA 2YWGA 3W2EA 2VBVA 4XQFA 2ZITA 4OPVA 1E3ZA 2X85A 3PUMA 3CCQB 3OAAA 4B44A 5TV2A 3H94A 3GVKA 4JMQA 3OEHA 1TLLA 1WPCA 2B7BA 2V7VA 4P2NA 3E1YE 3SLDA 5IYRA 1ELOA 1T6ZA 4G5GA 4RD3A 5CDFA 5TY0A 2X8KA 1HZEA 3G71B 1XFOA 4N3NA 2DERA 3LO8A 1HVXA 4B47A 2W6IA 4OPOA 2DOGA 3ASTA 4ROXA 3QFSA 1YX2A 1VQNB 4LBVA 3CCLB 5GV7A 1DDGA 1E62A 1WOSA 4NBSA 3CC4B 3LQEA 1G7TA 2VNKA 3OFNA 1CQXA 1S4MA 4G7XA 3CCRB 1T6XA 3BCDA 5GV8A 3VR6A 4RDKA 2DIEA 4OPSA 2QE7A 3CRZA 2WJVA 1Q86D 3QFRA 1VQMB 4PGOA 2HLDA 5IK2A 4OOVA 3ZIAA 3V7AA 1U2RA 1EP1B 1KD1D 4XN3A 4YAFA 1XB2A 1WORA 1ZM3A 3GSIA 4XONA 4ZCIA 2F4NA 1E3XA 4Y7CA 1GO2A 1R5NA 2W6JA 4XLEA 4P26A 3GVJA 1EFRA 4RD6A 4Z4SA 4X0CA 1VQ4B 3G6EB 4TT3A 3VMFA 1GR1A 1H8EA 1FRQA 4XM3A 3JQPA 4Y9UA 1J9ZA 4IW3B 3WBKA 4YHBA 2BM0A 4YELA 5IYPA 3CMEB 4TSFA 3OW2B 2VNHA 2ZL7A 4UZEA 5IYWA 4P12A 3ASRA 2C5HA 5DN6A 4P6VF 3AVXA 1QGAA 2X3UA 2CK3A 4XKWA 5HZBA 4P25A 4RDJA 5HXBA 3ZZUA 4P22A 3OEEA 4P3IA 4ZCMA 2LZJA 3CCVB 4YEJA 2OTJB 3JQRA 4QV2A 1G7CA 4AF7A 4ZV4A 4M1KA 1Q82D 1K9MD 3VO2A 1UD6A 1N05A 1DARA 2VJJA 2WPDA 3Q6RA 1FNBA 3W2FA 2PIAA 3ASQA 3WY9A 2P3MA 1D1NA 4LC0A 4RCZA 2JN9A 2Q6OA 4XD7A 3OZWA 2V7TA 2YWFA 4MYTA 4FXUA 2BGJA 5KSWB 3CW2A 4G7WA 4TMVA 1H42A 3PVDA 4TMZA 1W0KA 2D3LA 1WTHD 2WR8A 4XKVA 1NRKA 4DQLA 2Q6LA 5F4MA 1GVHA 2VNIA 3A1PA 2X53S 4Z4YA 2E1RA 3VO1A 1MABA 2XNJA 2QA4B 4QVJA 4BPRA 5LMZA 2DYIA 3AGQA 1UD5A 2VBSA 2M5SA 4HE5A 4B4DA 1B23P 2QTLA 5L46A 3WBJA 3PENA 2DEUA 3VNUA 5J3OA 3AVYA 4XORA 1KZLA 4XOPA 3BCFA 1UD8A 4L8JA 3P26A 3WXMA 3PUNA 1EP3B 2RC5A 5TR9A 3WNCA 3CCSB 2OBRA 4M0LA 1V0FA 1Y0RA 4KKTA 2BN4A 3T51B 3Q39A 4J0QA 3MCAA 1VQ8B 2ZZFA 4B48A 4WZKA 3AGPA 5DS0A 4B3GA 4X05A 3FPKA 4PC7A 4RDLA 2GPJA 3B82A 4XN0A 4DNTB 1P4MA 3CC2B 1S72B 4X7CA 2AHOA 3AVWA 4Z4UA 3I1FA 2BGIA 4PC6A 2OBSA 5H59A 3BH4A 2GREA 4RJLA 3OOCA 1BPLA 3OKXA 1N8RD 3LQ6A 3U2QA 3H9NA 4B3FX 5FA6A 2D3NA 1Q81D 1GJRA 2EIXA 3R6KA 4P6YA 4WWVA 4C0SA 2VNJA 4GQNA 2NPFA 2BVNA 5AN9A 1TTTA 1QFZA 1UMKA 3E20A 1VHEA 1BX1A 2QTZA 2D74A 1SKQA 2X6WA 4B43A 2BMWA 4QFMA 2ZZQA 2BV3A 1FDRA 4PAAA 3W5HA 3OW7A 2ZBVA 4X7EA 1QH0A 4TMXA 3RY8A 1YLOA 2PMDA 2YWEA 3SEJA 1NB0A 3QSYA 3ZBUA 4RPDA 3I55B 1MRZA 3CTAA 2V4DA 4X8IA 4LBYA 2ZZEA 3T56B 3CCEB 1RQPA 1N0VC 3KEWA 4Q7JB 1IJEA 4ZGQB 1W2BB 4FWTA 4PABA 3LVBA 2R6HA 3CXCB 1KJZA 1KK0A 2NV4A 5FIUA 2XZLA 1WSVA 5IYNA 4MYUA 3A8IA 4DK1A 5A88A 2VBUA 4ZCLA 2ZBUA 4P3YA 2QGGA 4II2A 2B7CA 1OHHA 2RC6A 1OGJA 4FK8A 4M4SA 1EFTA 2OTLB 3ASPA 4UAJA 1A8PA 3ISXA 3ZPNA 2C2WA 2X6YA 1IHMA 1QUFA 2CRVA 2ZTNA 1QFYA 3CC7B 1VLOA 2XEXA 1EFCA 5THXA 3WNDA 4PC1A 4TMWA 2BF4A 4G1VA 3SJPA 1E43A 3FPPA 3QE2A 2VYQA 2BM1A 2XZPA 4WZTA 4Z4WA 2DY1A 1UD4A 4XNFA 4PC2A 4TMTA 4Y9RA 4RLZA 4AVZA 4DNRB 4XLAA 1KRHA 4NCNA 2X6XA 2GJPA 2WZNA 4NNJA 3ES9A 4YAUA 2DETA 4N3GA 4TKOB 1IJFA 2KVOA 2YWHA 2QN6A 2Z6BD 1Y0YA 2C4UA 3BNWA 4Z4ZA 3ASSA 1QG0A 4HE6A 1RQRA 4TN1A 3OZVA 4LBWA 3SKBA 3W2IA 4WZEA 5KNLA 1VJSA 1KK2A 1G7RA 1QVGB 5FO1A 2V7XA 1M90D 3HAGA 4YALA 3OJWA 1Q7YD 3MHPA 1TUIA 5TRDA 3ZBTA 3CMAB 2JJ2A 2CBXA 1BQEA 3D26A 4RD4A 2OBTA 2JDIA 3CESA 4Z4RA 4DK0A 3CCJB 1YI2B 1VHOA 5A89A 1QGYA 1KK1A 3CPXA 4Z4TA 3AVVA 3QFTA 4F7DA 2FX3A 2CW5A 3BY1A 3W2HA 3Q3AA 4PC3A 1VQ9B 1TVCA 4AC9A 1FNDA 1E63A 5BSYA 1CNEA 3W2GA 2DCUA 4ACBA 1KQSB 4QUZA 2QMUA 2WJYA 4ACAA 1I8DA 1E1QA 1E79A 1D8TA 3PA1A 1T6YA 1OGIA 1EWYA 2I1LA 5JBQA 1DG1G 4Z4VA 4DQKA 1YJ9B 1M1KD 5A8AA 3B78A 3FJOA 3ZUGA 3CPWB 2B5OA 1G7SA 1AIPA 1N0UA 1VF7A 4YAOA 3W5UA 2CF4A 3Q38A 4RM0A 3G4SB 3T53B 4RD2A 2V7QA 1NDHA 1COWA 1BJKA 2WSSA 4RD0A 2EFGA 2XZOA 3WNBA 1SKYB 4K1XA 3NE5B 3R6JA 1VQ7B 3ONUA 2VJIA 2WZPP 3U6KA 2GK6A 3A3BA 3FKSA 1K8AD 3J81k 1S0UA 1KTVA 1WSRA 2J7KA 1FX0A 4RCYA 4X06A 3V76A 5FNZA 2XOKA 3BC9A 1R5BA 1OB0A 1WU8A 3CMMA 3LNNA 3OJXA 4C43A 4WZLA 1VQPB 2C77A 1XE1A 4R71A 1H8HA 4WQMA
chains in the Genus database with same CATH topology
3PVDA 5KW9A 1IHMA 4OP7A 5F4OA 5F4MA 4Z4YA 3SLNA 3SJPA 4X7DA 4OOSA 4QVJA 4WZTA 4Z4WA 4OPVA 3PUMA 4RLZA 5J3OA 4P2NA 3SLDA 4X7FA 5IYRA 3PUNA 4Z4ZA 3ASSA 3SKBA 3BY2A 2OBRA 4WZEA 3Q39A 4OPOA 4WZKA 3ASTA 4ROXA 4X05A 4RDLA 4X7CA 3LQEA 4Z4UA 3D26A 2OBSA 2OBTA 4RDKA 4P1VA 4OPSA 5F4JA 4Z4RA 3PA2A 3LQ6A 4OOVA 3V7AA 4Z4TA 3BY1A 3Q3AA 2ZL5A 3Q6QA 5BSYA 4QVAA 3R6KA 4QUZA 5BSXA 4P26A 4OOXA 4Z4SA 3BQJA 3PA1A 4X0CA 4Z4VA 4X7EA 3RY8A 3SEJA 4RPDA 3Q38A 4RM0A 5IYPA 2ZL7A 4X07A 5IYWA 4P12A 3ASRA 5IYQA 5HZBA 4P25A 4RDJA 3R6JA 3ONUA 5E6TA 4P3IA 5IYNA 4RPBA 2ZL6A 5HZAA 4QV2A 4X06A 3Q6RA 3ASQA 5J35A 4WZLA 3ASPA 3ONYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVD A;  5KW9 A;  1IHM A;  4OP7 A;  5F4O A;  5F4M A;  4Z4Y A;  3SLN A;  3SJP A;  4X7D A;  4OOS A;  4QVJ A;  4WZT A;  4Z4W A;  4OPV A;  3PUM A;  4RLZ A;  5J3O A;  4P2N A;  3SLD A;  4X7F A;  5IYR A;  3PUN A;  4Z4Z A;  3ASS A;  3SKB A;  3BY2 A;  2OBR A;  4WZE A;  3Q39 A;  4OPO A;  4WZK A;  3AST A;  4ROX A;  4X05 A;  4RDL A;  4X7C A;  3LQE A;  4Z4U A;  3D26 A;  2OBS A;  2OBT A;  4RDK A;  4P1V A;  4OPS A;  5F4J A;  4Z4R A;  3PA2 A;  3LQ6 A;  4OOV A;  3V7A A;  4Z4T A;  3BY1 A;  3Q3A A;  2ZL5 A;  3Q6Q A;  5BSY A;  4QVA A;  3R6K A;  4QUZ A;  5BSX A;  4P26 A;  4OOX A;  4Z4S A;  3BQJ A;  3PA1 A;  4X0C A;  4Z4V A;  4X7E A;  3RY8 A;  3SEJ A;  4RPD A;  3Q38 A;  4RM0 A;  5IYP A;  2ZL7 A;  4X07 A;  5IYW A;  4P12 A;  3ASR A;  5IYQ A;  5HZB A;  4P25 A;  4RDJ A;  3R6J A;  3ONU A;  5E6T A;  4P3I A;  5IYN A;  4RPB A;  2ZL6 A;  5HZA A;  4QV2 A;  4X06 A;  3Q6R A;  3ASQ A;  5J35 A;  4WZL A;  3ASP A;  3ONY A; 
#chains in the Genus database with same CATH topology
 2C78 A;  1FNM A;  4XLH A;  1NBM A;  3W5V A;  1KMH A;  2V31 A;  4B3X A;  1EFU A;  1KK3 A;  3JU4 A;  3P27 A;  3MMP A;  1ZUN B;  4KKU A;  3CCU B;  1T5E A;  1W9X A;  1QVF B;  1ZM2 A;  3AVT A;  1PJ6 A;  4X7D A;  1PJ5 A;  1K73 D;  1KC8 D;  2PLF A;  2D9R A;  1AMO A;  3ZZ0 A;  1QFJ A;  1HA3 A;  3SJZ A;  1QX4 A;  1SM4 A;  1JNY A;  3WQZ A;  4XLC A;  1JA1 A;  1VQ5 B;  1BX0 A;  1F20 A;  1F60 A;  3A8J A;  4X7F A;  3U6B A;  3CB4 A;  1YIJ B;  5EMN A;  1R5O A;  1EP2 B;  2C5B A;  3B8H A;  2ZXH A;  4U9U A;  3BY2 A;  5FL7 A;  1I18 A;  4G6I A;  2ZTG A;  1YIT B;  3VNV A;  3QFC A;  5DSZ A;  2E1B A;  4RD1 A;  3GVL A;  1YJW B;  3CD6 B;  1EXM A;  2PE3 A;  3A35 A;  1UD3 A;  1VQ6 B;  2R9V A;  2F43 A;  1IB0 A;  2Q6K A;  4P9S A;  2F1M A;  3OP1 A;  4M53 A;  4P1V A;  1NB9 A;  1JB9 A;  4ZGN B;  5F4J A;  3ZZT A;  2V7U A;  4QHY A;  3PA2 A;  4G1B A;  2BPO A;  4H9G A;  2Q6I A;  1YJN B;  3I56 B;  1WP6 A;  1K28 D;  1CNF A;  2XNC A;  1GAQ A;  2C4T A;  1W87 A;  2JIZ A;  2ZL5 A;  4YAW A;  5FO0 A;  3KL9 A;  3Q6Q A;  1JA0 A;  1ZM9 A;  3GQB A;  2XGJ A;  1WDT A;  1ZM4 A;  1VLY A;  4QVA A;  4XL9 A;  4LBZ A;  2CC2 A;  1YHQ B;  1H85 A;  5BSX A;  2HCJ B;  2JJ1 A;  3DDY A;  1I7P A;  4XR6 A;  3OE7 A;  4OOX A;  2HMA A;  2OYN A;  1OB2 A;  1DDI A;  3BQJ A;  4M2L A;  2GQF A;  2GJR A;  1VQL B;  2ZZG A;  3CCM B;  4CQJ A;  2QDX A;  2GK7 A;  3CP8 A;  1D2E A;  4UZU A;  1N07 A;  1GAW A;  2BSA A;  1N08 A;  1OB5 A;  2HDN B;  3CP2 A;  4HIZ A;  4E0F A;  2WYR A;  1PKV A;  4X07 A;  2FVG A;  4YXW A;  1E64 A;  1QUE A;  2XND A;  5IYQ A;  2VZL A;  1BMF A;  2F1L A;  4ASU A;  5E6T A;  1QGZ A;  1BLI A;  2OK8 A;  1PJ7 A;  2VBT A;  4RPB A;  3GIR A;  1JJ2 B;  2ZL6 A;  5HZA A;  1Q9S A;  3OPO A;  4UZF A;  3JQQ A;  1UD2 A;  4XOT A;  3OZU A;  4EH1 A;  1V0E A;  1FRN A;  3WYA A;  2GJK A;  2X0K A;  1B2R A;  4AF6 A;  5J35 A;  1FNC A;  5HKK A;  3G05 A;  4XLF A;  1VQO B;  1W34 A;  1N06 A;  1WOP A;  4II3 A;  1WOO A;  1W0J A;  3ONY A;  5H5J A;  2OK7 A;  3A8K A;  5B6I A;  5KW9 A;  4KKS A;  4OP7 A;  2CND A;  4XMY A;  1VQK B;  2QEX B;  5F4O A;  1XQB A;  2V7W A;  2ZXI A;  4Z1M A;  3ZC3 A;  4FN5 A;  1E1R A;  1W35 A;  1NJI D;  3SLN A;  3A3G A;  1V5V A;  3AVU A;  4OOS A;  2YWG A;  3W2E A;  2VBV A;  4XQF A;  2ZIT A;  4OPV A;  1E3Z A;  2X85 A;  3PUM A;  3CCQ B;  3OAA A;  4B44 A;  5TV2 A;  3H94 A;  3GVK A;  4JMQ A;  3OEH A;  1TLL A;  1WPC A;  2B7B A;  2V7V A;  4P2N A;  3E1Y E;  3SLD A;  5IYR A;  1ELO A;  1T6Z A;  4G5G A;  4RD3 A;  5CDF A;  5TY0 A;  2X8K A;  1HZE A;  3G71 B;  1XFO A;  4N3N A;  2DER A;  3LO8 A;  1HVX A;  4B47 A;  2W6I A;  4OPO A;  2DOG A;  3AST A;  4ROX A;  3QFS A;  1YX2 A;  1VQN B;  4LBV A;  3CCL B;  5GV7 A;  1DDG A;  1E62 A;  1WOS A;  4NBS A;  3CC4 B;  3LQE A;  1G7T A;  2VNK A;  3OFN A;  1CQX A;  1S4M A;  4G7X A;  3CCR B;  1T6X A;  3BCD A;  5GV8 A;  3VR6 A;  4RDK A;  2DIE A;  4OPS A;  2QE7 A;  3CRZ A;  2WJV A;  1Q86 D;  3QFR A;  1VQM B;  4PGO A;  2HLD A;  5IK2 A;  4OOV A;  3ZIA A;  3V7A A;  1U2R A;  1EP1 B;  1KD1 D;  4XN3 A;  4YAF A;  1XB2 A;  1WOR A;  1ZM3 A;  3GSI A;  4XON A;  4ZCI A;  2F4N A;  1E3X A;  4Y7C A;  1GO2 A;  1R5N A;  2W6J A;  4XLE A;  4P26 A;  3GVJ A;  1EFR A;  4RD6 A;  4Z4S A;  4X0C A;  1VQ4 B;  3G6E B;  4TT3 A;  3VMF A;  1GR1 A;  1H8E A;  1FRQ A;  4XM3 A;  3JQP A;  4Y9U A;  1J9Z A;  4IW3 B;  3WBK A;  4YHB A;  2BM0 A;  4YEL A;  5IYP A;  3CME B;  4TSF A;  3OW2 B;  2VNH A;  2ZL7 A;  4UZE A;  5IYW A;  4P12 A;  3ASR A;  2C5H A;  5DN6 A;  4P6V F;  3AVX A;  1QGA A;  2X3U A;  2CK3 A;  4XKW A;  5HZB A;  4P25 A;  4RDJ A;  5HXB A;  3ZZU A;  4P22 A;  3OEE A;  4P3I A;  4ZCM A;  2LZJ A;  3CCV B;  4YEJ A;  2OTJ B;  3JQR A;  4QV2 A;  1G7C A;  4AF7 A;  4ZV4 A;  4M1K A;  1Q82 D;  1K9M D;  3VO2 A;  1UD6 A;  1N05 A;  1DAR A;  2VJJ A;  2WPD A;  3Q6R A;  1FNB A;  3W2F A;  2PIA A;  3ASQ A;  3WY9 A;  2P3M A;  1D1N A;  4LC0 A;  4RCZ A;  2JN9 A;  2Q6O A;  4XD7 A;  3OZW A;  2V7T A;  2YWF A;  4MYT A;  4FXU A;  2BGJ A;  5KSW B;  3CW2 A;  4G7W A;  4TMV A;  1H42 A;  3PVD A;  4TMZ A;  1W0K A;  2D3L A;  1WTH D;  2WR8 A;  4XKV A;  1NRK A;  4DQL A;  2Q6L A;  5F4M A;  1GVH A;  2VNI A;  3A1P A;  2X53 S;  4Z4Y A;  2E1R A;  3VO1 A;  1MAB A;  2XNJ A;  2QA4 B;  4QVJ A;  4BPR A;  5LMZ A;  2DYI A;  3AGQ A;  1UD5 A;  2VBS A;  2M5S A;  4HE5 A;  4B4D A;  1B23 P;  2QTL A;  5L46 A;  3WBJ A;  3PEN A;  2DEU A;  3VNU A;  5J3O A;  3AVY A;  4XOR A;  1KZL A;  4XOP A;  3BCF A;  1UD8 A;  4L8J A;  3P26 A;  3WXM A;  3PUN A;  1EP3 B;  2RC5 A;  5TR9 A;  3WNC A;  3CCS B;  2OBR A;  4M0L A;  1V0F A;  1Y0R A;  4KKT A;  2BN4 A;  3T51 B;  3Q39 A;  4J0Q A;  3MCA A;  1VQ8 B;  2ZZF A;  4B48 A;  4WZK A;  3AGP A;  5DS0 A;  4B3G A;  4X05 A;  3FPK A;  4PC7 A;  4RDL A;  2GPJ A;  3B82 A;  4XN0 A;  4DNT B;  1P4M A;  3CC2 B;  1S72 B;  4X7C A;  2AHO A;  3AVW A;  4Z4U A;  3I1F A;  2BGI A;  4PC6 A;  2OBS A;  5H59 A;  3BH4 A;  2GRE A;  4RJL A;  3OOC A;  1BPL A;  3OKX A;  1N8R D;  3LQ6 A;  3U2Q A;  3H9N A;  4B3F X;  5FA6 A;  2D3N A;  1Q81 D;  1GJR A;  2EIX A;  3R6K A;  4P6Y A;  4WWV A;  4C0S A;  2VNJ A;  4GQN A;  2NPF A;  2BVN A;  5AN9 A;  1TTT A;  1QFZ A;  1UMK A;  3E20 A;  1VHE A;  1BX1 A;  2QTZ A;  2D74 A;  1SKQ A;  2X6W A;  4B43 A;  2BMW A;  4QFM A;  2ZZQ A;  2BV3 A;  1FDR A;  4PAA A;  3W5H A;  3OW7 A;  2ZBV A;  4X7E A;  1QH0 A;  4TMX A;  3RY8 A;  1YLO A;  2PMD A;  2YWE A;  3SEJ A;  1NB0 A;  3QSY A;  3ZBU A;  4RPD A;  3I55 B;  1MRZ A;  3CTA A;  2V4D A;  4X8I A;  4LBY A;  2ZZE A;  3T56 B;  3CCE B;  1RQP A;  1N0V C;  3KEW A;  4Q7J B;  1IJE A;  4ZGQ B;  1W2B B;  4FWT A;  4PAB A;  3LVB A;  2R6H A;  3CXC B;  1KJZ A;  1KK0 A;  2NV4 A;  5FIU A;  2XZL A;  1WSV A;  5IYN A;  4MYU A;  3A8I A;  4DK1 A;  5A88 A;  2VBU A;  4ZCL A;  2ZBU A;  4P3Y A;  2QGG A;  4II2 A;  2B7C A;  1OHH A;  2RC6 A;  1OGJ A;  4FK8 A;  4M4S A;  1EFT A;  2OTL B;  3ASP A;  4UAJ A;  1A8P A;  3ISX A;  3ZPN A;  2C2W A;  2X6Y A;  1IHM A;  1QUF A;  2CRV A;  2ZTN A;  1QFY A;  3CC7 B;  1VLO A;  2XEX A;  1EFC A;  5THX A;  3WND A;  4PC1 A;  4TMW A;  2BF4 A;  4G1V A;  3SJP A;  1E43 A;  3FPP A;  3QE2 A;  2VYQ A;  2BM1 A;  2XZP A;  4WZT A;  4Z4W A;  2DY1 A;  1UD4 A;  4XNF A;  4PC2 A;  4TMT A;  4Y9R A;  4RLZ A;  4AVZ A;  4DNR B;  4XLA A;  1KRH A;  4NCN A;  2X6X A;  2GJP A;  2WZN A;  4NNJ A;  3ES9 A;  4YAU A;  2DET A;  4N3G A;  4TKO B;  1IJF A;  2KVO A;  2YWH A;  2QN6 A;  2Z6B D;  1Y0Y A;  2C4U A;  3BNW A;  4Z4Z A;  3ASS A;  1QG0 A;  4HE6 A;  1RQR A;  4TN1 A;  3OZV A;  4LBW A;  3SKB A;  3W2I A;  4WZE A;  5KNL A;  1VJS A;  1KK2 A;  1G7R A;  1QVG B;  5FO1 A;  2V7X A;  1M90 D;  3HAG A;  4YAL A;  3OJW A;  1Q7Y D;  3MHP A;  1TUI A;  5TRD A;  3ZBT A;  3CMA B;  2JJ2 A;  2CBX A;  1BQE A;  3D26 A;  4RD4 A;  2OBT A;  2JDI A;  3CES A;  4Z4R A;  4DK0 A;  3CCJ B;  1YI2 B;  1VHO A;  5A89 A;  1QGY A;  1KK1 A;  3CPX A;  4Z4T A;  3AVV A;  3QFT A;  4F7D A;  2FX3 A;  2CW5 A;  3BY1 A;  3W2H A;  3Q3A A;  4PC3 A;  1VQ9 B;  1TVC A;  4AC9 A;  1FND A;  1E63 A;  5BSY A;  1CNE A;  3W2G A;  2DCU A;  4ACB A;  1KQS B;  4QUZ A;  2QMU A;  2WJY A;  4ACA A;  1I8D A;  1E1Q A;  1E79 A;  1D8T A;  3PA1 A;  1T6Y A;  1OGI A;  1EWY A;  2I1L A;  5JBQ A;  1DG1 G;  4Z4V A;  4DQK A;  1YJ9 B;  1M1K D;  5A8A A;  3B78 A;  3FJO A;  3ZUG A;  3CPW B;  2B5O A;  1G7S A;  1AIP A;  1N0U A;  1VF7 A;  4YAO A;  3W5U A;  2CF4 A;  3Q38 A;  4RM0 A;  3G4S B;  3T53 B;  4RD2 A;  2V7Q A;  1NDH A;  1COW A;  1BJK A;  2WSS A;  4RD0 A;  2EFG A;  2XZO A;  3WNB A;  1SKY B;  4K1X A;  3NE5 B;  3R6J A;  1VQ7 B;  3ONU A;  2VJI A;  2WZP P;  3U6K A;  2GK6 A;  3A3B A;  3FKS A;  1K8A D;  3J81 k;  1S0U A;  1KTV A;  1WSR A;  2J7K A;  1FX0 A;  4RCY A;  4X06 A;  3V76 A;  5FNZ A;  2XOK A;  3BC9 A;  1R5B A;  1OB0 A;  1WU8 A;  3CMM A;  3LNN A;  3OJX A;  4C43 A;  4WZL A;  1VQP B;  2C77 A;  1XE1 A;  4R71 A;  1H8H A;  4WQM A; 
#chains in the Genus database with same CATH homology
 3PVD A;  5KW9 A;  1IHM A;  4OP7 A;  5F4O A;  5F4M A;  4Z4Y A;  3SLN A;  3SJP A;  4X7D A;  4OOS A;  4QVJ A;  4WZT A;  4Z4W A;  4OPV A;  3PUM A;  4RLZ A;  5J3O A;  4P2N A;  3SLD A;  4X7F A;  5IYR A;  3PUN A;  4Z4Z A;  3ASS A;  3SKB A;  3BY2 A;  2OBR A;  4WZE A;  3Q39 A;  4OPO A;  4WZK A;  3AST A;  4ROX A;  4X05 A;  4RDL A;  4X7C A;  3LQE A;  4Z4U A;  3D26 A;  2OBS A;  2OBT A;  4RDK A;  4P1V A;  4OPS A;  5F4J A;  4Z4R A;  3PA2 A;  3LQ6 A;  4OOV A;  3V7A A;  4Z4T A;  3BY1 A;  3Q3A A;  2ZL5 A;  3Q6Q A;  5BSY A;  4QVA A;  3R6K A;  4QUZ A;  5BSX A;  4P26 A;  4OOX A;  4Z4S A;  3BQJ A;  3PA1 A;  4X0C A;  4Z4V A;  4X7E A;  3RY8 A;  3SEJ A;  4RPD A;  3Q38 A;  4RM0 A;  5IYP A;  2ZL7 A;  4X07 A;  5IYW A;  4P12 A;  3ASR A;  5IYQ A;  5HZB A;  4P25 A;  4RDJ A;  3R6J A;  3ONU A;  5E6T A;  4P3I A;  5IYN A;  4RPB A;  2ZL6 A;  5HZA A;  4QV2 A;  4X06 A;  3Q6R A;  3ASQ A;  5J35 A;  4WZL A;  3ASP A;  3ONY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...