4RPBA

Crystal structure of p domain of snow mountain norovirus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
308
structure length
300
Chain Sequence
b'KPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLTLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFGVITQRDKQNAAGQSQPANRGHDAVVPTYTAQYTPKLGQVQIGTDLKVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYLPLKGGYGNPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
molecule tags Viral protein
source organism Norovirus hu/gii.2/kl109/1978/mys
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
total genus 71
structure length 300
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rpbA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rpbA01
4X7FA 3BQJA 4QUZA 4Z4UA 4Z4VA 3ASRA 4X0CA 4WZKA 4QVJA 3LQ6A 3Q6RA 4X06A 2OBRA 4OPSA 4RM0A 3R6KA 3Q39A 4P25A 4OOSA 5E6TA 3SKBA 4WZLA 4Z4SA 5F4MA 5J35A 3SEJA 3ASSA 5IYPA 4P12A 3Q38A 5BSYA 3LQEA 3SJPA 3SLDA 5BSXA 4RDKA 4X7DA 1IHMA 2OBTA 5HZAA 4QV2A 4RPBA 4X7CA 4X05A 5J3OA 4Z4TA 5KW9A 4Z4RA 4RPDA 3Q6QA 2ZL7A 4ROXA 3PA1A 5F4OA 4RDJA 3R6JA 3PVDA 4RDLA 3BY1A 4X07A 4X7EA 4WZEA 2ZL5A 4Z4ZA 2OBSA 4QVAA 4OPOA 4WZTA 5F4JA 5IYWA 5IYNA 4Z4YA 4OP7A 4P26A 3ASQA 4OOVA 4P2NA 5IYRA 3ONUA 4RLZA 4P1VA 2ZL6A 3PUMA 3RY8A 4OOXA 5HZBA 4OPVA 4Z4WA 3BY2A 3PUNA 3SLNA 3ONYA 3ASTA 3Q3AA 3V7AA 3ASPA 3PA2A 3D26A 4P3IA 5IYQA
chains in the Genus database with same CATH superfamily
3CP8A 1E1QA 3QSYA 3CPXA 4XKVA 1COWA 1GAWA 1N8RD 2BGJA 4ZGQB 4P6VF 3A3BA 4Z4UA 1PJ7A 4PC7A 3A1PA 2DERA 1YI2B 5DN6A 4P3YA 1SM4A 1QVFB 1EWYA 3ASRA 1Q82D 3CB4A 3I56B 4U9UA 4XLEA 1W0JA 4ZGNB 1WSRA 2XNJA 2ZBVA 4IW3B 4AVZA 1YJNB 4NCNA 5H59A 2OBRA 1BLIA 1KK0A 2GK6A 3CMEB 1VHOA 4FWTA 1W34A 1JA0A 3Q39A 1E1RA 4II2A 1YHQB 2ZITA 1VQ8B 3GVLA 2F4NA 1QX4A 1QGAA 1J9ZA 4UZEA 4ZCLA 3ZBTA 5JBQA 3W2FA 4NBSA 1M1KD 1OHHA 5F4MA 3OE7A 1PKVA 4RD0A 1BQEA 3G05A 2E1BA 3ASSA 1OB0A 2JJ1A 3OAAA 4Y7CA 3CESA 2R6HA 1IJFA 4XR6A 3A8KA 4HIZA 2ZZEA 3MMPA 1MRZA 2CF4A 3LQEA 4P22A 3SJPA 1YLOA 1D8TA 2I1LA 2Q6KA 4ACAA 2OYNA 2VBSA 3T51B 2Q6LA 4RDKA 1VQMB 1TUIA 4RCZA 5J3OA 1WSVA 4UZUA 2ZXHA 4HE5A 4Z4RA 2C4UA 1DG1G 1DDGA 1I8DA 1VJSA 2C77A 2GJPA 3OEHA 4LBYA 1VQNB 1W9XA 2ZBUA 3PA1A 4B44A 1QFYA 5TRDA 3R6JA 3CCEB 4RDLA 3OZWA 3OKXA 4WZEA 1OGIA 2OBSA 4TMVA 4DK1A 3ZZTA 2VJJA 4RD4A 2QEXB 2OTJB 2FX3A 4G7XA 4PC2A 4WZTA 5FNZA 5F4JA 5LMZA 1B23P 2VNHA 4B3GA 2ZZFA 3ASQA 3T53B 1T5EA 2X85A 4YAOA 4YEJA 4B3FX 4E0FA 4Y9UA 4XN0A 2XOKA 2B7BA 4DQLA 1WU8A 3VNUA 2CBXA 1QUFA 2C78A 3OP1A 4P2NA 3ONUA 2PE3A 3WNBA 2XEXA 1OGJA 1GAQA 5L46A 4MYTA 2GREA 3PUMA 4M0LA 1NB9A 3RY8A 3ES9A 3OW7A 4OPVA 4Z4WA 3CMMA 3FKSA 3ZUGA 1VQPB 5KSWB 2KVOA 1EFCA 3W2GA 4PC1A 1Q81D 3LO8A 4K1XA 2CNDA 3V7AA 4FN5A 4YHBA 1K28D 4YAUA 2BM1A 3A8IA 1E79A 4PC3A 4Q7JB 1VQ6B 2VNJA 3AVXA 3MCAA 4EH1A 1E43A 4PABA 4TKOB 1TVCA 4FK8A 5FO0A 3BCFA 4II3A 3VO1A 3CC4B 1H8EA 1W35A 1WOOA 4QUZA 3ZC3A 1XFOA 4N3GA 1E64A 4B48A 1QFZA 5IK2A 2RC6A 1AIPA 4WZKA 4G1BA 1E3XA 1JA1A 3AVUA 2AHOA 2DIEA 4KKTA 4GQNA 4XNFA 5TY0A 2OTLB 1ZM2A 2BN4A 4RM0A 3R6KA 1ZM3A 4P25A 4OOSA 4J0QA 2JN9A 1QGYA 3AVYA 3SKBA 3H94A 4WZLA 1R5BA 4L8JA 1XB2A 2JDIA 2VYQA 2V31A 3CCQB 1UD2A 1I18A 1KK3A 1KK1A 2W6JA 2D3LA 3NE5B 4NNJA 2BVNA 3CP2A 1N05A 1VQ9B 2WJYA 3CW2A 3SEJA 4RD2A 4AF7A 2Q6OA 1N0UA 2J7KA 1JJ2B 5H5JA 2VBUA 5FL7A 1N08A 5HKKA 3VR6A 4XONA 5CDFA 4DNTB 4RJLA 3SLDA 1SKYB 4Y9RA 2PLFA 2E1RA 4YELA 2GQFA 1WTHD 4YALA 3OOCA 5FA6A 2W6IA 2D3NA 4ZCIA 1IHMA 3AVWA 5DSZA 2F1MA 3ZZ0A 2C4TA 2VBTA 2BM0A 1YJWB 4QV2A 4X7CA 3OJWA 4XOPA 5KW9A 1QFJA 4N3NA 3Q6QA 3B8HA 2BGIA 2ZL7A 1KK2A 3BC9A 4TMXA 3KL9A 4QFMA 4FXUA 4RDJA 2XZPA 1V0FA 4BPRA 2VBVA 4P6YA 2DCUA 1EP1B 4Z4ZA 4XORA 4ASUA 4F7DA 2CK3A 1FDRA 3LVBA 3HAGA 1CNEA 1KJZA 1DDIA 5IYWA 4Z4YA 1XE1A 4OP7A 4P26A 3CCMB 3OPOA 1NJID 3ZIAA 2QTZA 1T6XA 1ZM9A 1BX0A 1TLLA 3GVJA 1OB5A 3BNWA 3W2IA 4P1VA 3CMAB 2ZL6A 4XN3A 2DEUA 1VLOA 2X6WA 4LBWA 4OOXA 1HVXA 5HZBA 2NPFA 3FPPA 2PIAA 3BCDA 3GIRA 2WR8A 2V7VA 3CPWB 1VF7A 1EP3B 3FPKA 4ACBA 1E3ZA 1UD8A 2X53S 2XZOA 3ONYA 4M53A 2QMUA 1N0VC 1KMHA 3ZZUA 3QFCA 2C2WA 1U2RA 5TV2A 1GVHA 3D26A 4P3IA 4B3XA 4ZV4A 2ZXIA 1D2EA 4ZCMA 2QA4B 1KD1D 2D74A 1W0KA 3CRZA 3VNVA 2ZZQA 3OW2B 3PENA 5TR9A 4XLCA 1NB0A 2Z6BD 1YITB 2EFGA 4M1KA 3GQBA 4AF6A 3CD6B 4XMYA 3W5UA 1YJ9B 4TN1A 2WSSA 2HDNB 1ZM4A 3LQ6A 1KC8D 4TSFA 1G7TA 3OFNA 2X3UA 1UD5A 2F1LA 2DOGA 1I7PA 3WQZA 1Q7YD 3CCSB 3CC2B 3AGQA 2XGJA 1CNFA 2YWGA 1PJ6A 4OPSA 4YAFA 1FNMA 4P9SA 4B4DA 4TT3A 3FJOA 1K9MD 1KTVA 2B5OA 5E6TA 1WOSA 5GV8A 2HLDA 1FNCA 2CW5A 4XD7A 1QG0A 4AC9A 1VQ7B 1FNBA 3WNDA 3G4SB 3ZBUA 4RD3A 4XKWA 1KZLA 4XOTA 5IYPA 4XLHA 3CC7B 1VQOB 1VQ4B 1FNDA 2X8KA 1M90D 5BSYA 3A3GA 4LC0A 4XLAA 2RC5A 2Q6IA 4UZFA 3WNCA 1R5NA 1N07A 1WORA 1ELOA 4UAJA 1H85A 1Y0YA 2OBTA 5HZAA 1GO2A 4RPBA 4MYUA 2DETA 4DNRB 3U6BA 4B43A 3AGPA 5FIUA 4LBVA 2GK7A 4ROXA 2X6XA 2XNDA 2DYIA 4RCYA 4YAWA 1T6ZA 1MABA 2JIZA 3CCUB 3OJXA 4WQMA 2HCJB 1B2RA 4X07A 1V0EA 1ZUNB 2CC2A 4X7EA 1D1NA 1BX1A 4QVAA 4YXWA 3P26A 4PC6A 1WDTA 3WY9A 1NDHA 2F43A 4PAAA 2OK7A 5B6IA 1EP2B 4Z1MA 5THXA 1Q9SA 1N06A 2C5HA 1H8HA 2X6YA 1E62A 2VJIA 1YX2A 4OOVA 5IYRA 4RLZA 3CCVB 1TTTA 3OZUA 2HMAA 3JQQA 2QTLA 2V7UA 4KKUA 2GJRA 1K8AD 2NV4A 2V7TA 4XM3A 1GJRA 2VZLA 1S72B 1VQKB 4XL9A 1WP6A 3G71B 1RQRA 3PUNA 2V7QA 4WWVA 2WZPP 4KKSA 3ISXA 1CQXA 4G6IA 5FO1A 3SLNA 5KNLA 4M2LA 1F60A 2DY1A 4C43A 3ASTA 1IB0A 2PMDA 3SJZA 1EXMA 2GJKA 3CTAA 5IYQA 2V7WA 1DARA 4G1VA 2YWEA 3QFTA 1EFRA 1F20A 2VNIA 4X7FA 1NRKA 1H42A 1WPCA 2XZLA 3BQJA 2ZZGA 1YIJB 3JQPA 4DQKA 1BMFA 1AMOA 2JJ2A 3B82A 1OB2A 3P27A 4Z4VA 4X0CA 1QGZA 1R5OA 5A88A 5A8AA 3MHPA 3CCRB 3U6KA 1VHEA 4PGOA 1V5VA 3E20A 4QVJA 4TMTA 3Q6RA 3WXMA 1BPLA 4X06A 1UMKA 4C0SA 2EIXA 3A35A 2BMWA 2QGGA 2M5SA 2OK8A 3V76A 3I55B 2ZTNA 2LZJA 3JU4A 3CXCB 1QH0A 1VLYA 2CRVA 1PJ5A 1KQSB 2V4DA 4M4SA 3QFRA 4HE6A 4Z4SA 2C5BA 2ZTGA 3W2EA 2D9RA 3I1FA 4G5GA 1JNYA 5J35A 1HZEA 3W5HA 1T6YA 1NBMA 2QDXA 1FRNA 2R9VA 1KRHA 1E63A 4TMWA 4B47A 3E1YE 1FX0A 4LBZA 4P12A 3WBJA 3AVVA 1EFTA 1EFUA 3Q38A 3A8JA 3BH4A 2QE7A 2XNCA 3W2HA 1W2BB 4H9GA 4QHYA 1JB9A 4RD1A 5BSXA 1UD3A 1Y0RA 1G7RA 3B78A 1XQBA 4X7DA 1QUEA 3J81k 1S4MA 4XLFA 4JMQA 3U2QA 3GSIA 3VO2A 3OZVA 3LNNA 4X05A 4Z4TA 2BSAA 1FRQA 1G7CA 4RPDA 3GVKA 2BPOA 3WYAA 3VMFA 1W87A 5F4OA 3PVDA 3BY1A 3ZPNA 2VNKA 1QVGB 1A8PA 2ZL5A 4CQJA 5GV7A 1VQ5B 3T56B 2YWHA 1RQPA 1WOPA 3QFSA 4OPOA 3G6EB 4R71A 5DS0A 3AVTA 4XQFA 5IYNA 4RD6A 1GR1A 5EMNA 3WBKA 1K73D 5AN9A 2WYRA 1IJEA 2BV3A 2WJVA 4TMZA 1G7SA 2BF4A 5A89A 1BJKA 2WZNA 3KEWA 1VQLB 1S0UA 1UD6A 2FVGA 3W5VA 2WPDA 1HA3A 3CCJB 2B7CA 3BY2A 3QE2A 1P4MA 3H9NA 4G7WA 2GPJA 2X0KA 2V7XA 1UD4A 4X8IA 2YWFA 1Q86D 1SKQA 3DDYA 3JQRA 3Q3AA 4DK0A 3CCLB 5HXBA 3ASPA 3PA2A 2QN6A 2P3MA 3OEEA
chains in the Genus database with same CATH topology
4X7FA 3BQJA 4QUZA 4Z4UA 4Z4VA 3ASRA 4X0CA 4WZKA 4QVJA 3LQ6A 3Q6RA 4X06A 2OBRA 4OPSA 4RM0A 3R6KA 3Q39A 4P25A 4OOSA 5E6TA 3SKBA 4WZLA 4Z4SA 5F4MA 5J35A 3SEJA 3ASSA 5IYPA 4P12A 3Q38A 5BSYA 3LQEA 3SJPA 3SLDA 5BSXA 4RDKA 4X7DA 1IHMA 2OBTA 5HZAA 4QV2A 4RPBA 4X7CA 4X05A 5J3OA 4Z4TA 5KW9A 4Z4RA 4RPDA 3Q6QA 2ZL7A 4ROXA 3PA1A 5F4OA 4RDJA 3R6JA 3PVDA 4RDLA 3BY1A 4X07A 4X7EA 4WZEA 2ZL5A 4Z4ZA 2OBSA 4QVAA 4OPOA 4WZTA 5F4JA 5IYWA 5IYNA 4Z4YA 4OP7A 4P26A 3ASQA 4OOVA 4P2NA 5IYRA 3ONUA 4RLZA 4P1VA 2ZL6A 3PUMA 3RY8A 4OOXA 5HZBA 4OPVA 4Z4WA 3BY2A 3PUNA 3SLNA 3ONYA 3ASTA 3Q3AA 3V7AA 3ASPA 3PA2A 3D26A 4P3IA 5IYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X7F A;  3BQJ A;  4QUZ A;  4Z4U A;  4Z4V A;  3ASR A;  4X0C A;  4WZK A;  4QVJ A;  3LQ6 A;  3Q6R A;  4X06 A;  2OBR A;  4OPS A;  4RM0 A;  3R6K A;  3Q39 A;  4P25 A;  4OOS A;  5E6T A;  3SKB A;  4WZL A;  4Z4S A;  5F4M A;  5J35 A;  3SEJ A;  3ASS A;  5IYP A;  4P12 A;  3Q38 A;  5BSY A;  3LQE A;  3SJP A;  3SLD A;  5BSX A;  4RDK A;  4X7D A;  1IHM A;  2OBT A;  5HZA A;  4QV2 A;  4RPB A;  4X7C A;  4X05 A;  5J3O A;  4Z4T A;  5KW9 A;  4Z4R A;  4RPD A;  3Q6Q A;  2ZL7 A;  4ROX A;  3PA1 A;  5F4O A;  4RDJ A;  3R6J A;  3PVD A;  4RDL A;  3BY1 A;  4X07 A;  4X7E A;  4WZE A;  2ZL5 A;  4Z4Z A;  2OBS A;  4QVA A;  4OPO A;  4WZT A;  5F4J A;  5IYW A;  5IYN A;  4Z4Y A;  4OP7 A;  4P26 A;  3ASQ A;  4OOV A;  4P2N A;  5IYR A;  3ONU A;  4RLZ A;  4P1V A;  2ZL6 A;  3PUM A;  3RY8 A;  4OOX A;  5HZB A;  4OPV A;  4Z4W A;  3BY2 A;  3PUN A;  3SLN A;  3ONY A;  3AST A;  3Q3A A;  3V7A A;  3ASP A;  3PA2 A;  3D26 A;  4P3I A;  5IYQ A; 
#chains in the Genus database with same CATH topology
 3CP8 A;  1E1Q A;  3QSY A;  3CPX A;  4XKV A;  1COW A;  1GAW A;  1N8R D;  2BGJ A;  4ZGQ B;  4P6V F;  3A3B A;  4Z4U A;  1PJ7 A;  4PC7 A;  3A1P A;  2DER A;  1YI2 B;  5DN6 A;  4P3Y A;  1SM4 A;  1QVF B;  1EWY A;  3ASR A;  1Q82 D;  3CB4 A;  3I56 B;  4U9U A;  4XLE A;  1W0J A;  4ZGN B;  1WSR A;  2XNJ A;  2ZBV A;  4IW3 B;  4AVZ A;  1YJN B;  4NCN A;  5H59 A;  2OBR A;  1BLI A;  1KK0 A;  2GK6 A;  3CME B;  1VHO A;  4FWT A;  1W34 A;  1JA0 A;  3Q39 A;  1E1R A;  4II2 A;  1YHQ B;  2ZIT A;  1VQ8 B;  3GVL A;  2F4N A;  1QX4 A;  1QGA A;  1J9Z A;  4UZE A;  4ZCL A;  3ZBT A;  5JBQ A;  3W2F A;  4NBS A;  1M1K D;  1OHH A;  5F4M A;  3OE7 A;  1PKV A;  4RD0 A;  1BQE A;  3G05 A;  2E1B A;  3ASS A;  1OB0 A;  2JJ1 A;  3OAA A;  4Y7C A;  3CES A;  2R6H A;  1IJF A;  4XR6 A;  3A8K A;  4HIZ A;  2ZZE A;  3MMP A;  1MRZ A;  2CF4 A;  3LQE A;  4P22 A;  3SJP A;  1YLO A;  1D8T A;  2I1L A;  2Q6K A;  4ACA A;  2OYN A;  2VBS A;  3T51 B;  2Q6L A;  4RDK A;  1VQM B;  1TUI A;  4RCZ A;  5J3O A;  1WSV A;  4UZU A;  2ZXH A;  4HE5 A;  4Z4R A;  2C4U A;  1DG1 G;  1DDG A;  1I8D A;  1VJS A;  2C77 A;  2GJP A;  3OEH A;  4LBY A;  1VQN B;  1W9X A;  2ZBU A;  3PA1 A;  4B44 A;  1QFY A;  5TRD A;  3R6J A;  3CCE B;  4RDL A;  3OZW A;  3OKX A;  4WZE A;  1OGI A;  2OBS A;  4TMV A;  4DK1 A;  3ZZT A;  2VJJ A;  4RD4 A;  2QEX B;  2OTJ B;  2FX3 A;  4G7X A;  4PC2 A;  4WZT A;  5FNZ A;  5F4J A;  5LMZ A;  1B23 P;  2VNH A;  4B3G A;  2ZZF A;  3ASQ A;  3T53 B;  1T5E A;  2X85 A;  4YAO A;  4YEJ A;  4B3F X;  4E0F A;  4Y9U A;  4XN0 A;  2XOK A;  2B7B A;  4DQL A;  1WU8 A;  3VNU A;  2CBX A;  1QUF A;  2C78 A;  3OP1 A;  4P2N A;  3ONU A;  2PE3 A;  3WNB A;  2XEX A;  1OGJ A;  1GAQ A;  5L46 A;  4MYT A;  2GRE A;  3PUM A;  4M0L A;  1NB9 A;  3RY8 A;  3ES9 A;  3OW7 A;  4OPV A;  4Z4W A;  3CMM A;  3FKS A;  3ZUG A;  1VQP B;  5KSW B;  2KVO A;  1EFC A;  3W2G A;  4PC1 A;  1Q81 D;  3LO8 A;  4K1X A;  2CND A;  3V7A A;  4FN5 A;  4YHB A;  1K28 D;  4YAU A;  2BM1 A;  3A8I A;  1E79 A;  4PC3 A;  4Q7J B;  1VQ6 B;  2VNJ A;  3AVX A;  3MCA A;  4EH1 A;  1E43 A;  4PAB A;  4TKO B;  1TVC A;  4FK8 A;  5FO0 A;  3BCF A;  4II3 A;  3VO1 A;  3CC4 B;  1H8E A;  1W35 A;  1WOO A;  4QUZ A;  3ZC3 A;  1XFO A;  4N3G A;  1E64 A;  4B48 A;  1QFZ A;  5IK2 A;  2RC6 A;  1AIP A;  4WZK A;  4G1B A;  1E3X A;  1JA1 A;  3AVU A;  2AHO A;  2DIE A;  4KKT A;  4GQN A;  4XNF A;  5TY0 A;  2OTL B;  1ZM2 A;  2BN4 A;  4RM0 A;  3R6K A;  1ZM3 A;  4P25 A;  4OOS A;  4J0Q A;  2JN9 A;  1QGY A;  3AVY A;  3SKB A;  3H94 A;  4WZL A;  1R5B A;  4L8J A;  1XB2 A;  2JDI A;  2VYQ A;  2V31 A;  3CCQ B;  1UD2 A;  1I18 A;  1KK3 A;  1KK1 A;  2W6J A;  2D3L A;  3NE5 B;  4NNJ A;  2BVN A;  3CP2 A;  1N05 A;  1VQ9 B;  2WJY A;  3CW2 A;  3SEJ A;  4RD2 A;  4AF7 A;  2Q6O A;  1N0U A;  2J7K A;  1JJ2 B;  5H5J A;  2VBU A;  5FL7 A;  1N08 A;  5HKK A;  3VR6 A;  4XON A;  5CDF A;  4DNT B;  4RJL A;  3SLD A;  1SKY B;  4Y9R A;  2PLF A;  2E1R A;  4YEL A;  2GQF A;  1WTH D;  4YAL A;  3OOC A;  5FA6 A;  2W6I A;  2D3N A;  4ZCI A;  1IHM A;  3AVW A;  5DSZ A;  2F1M A;  3ZZ0 A;  2C4T A;  2VBT A;  2BM0 A;  1YJW B;  4QV2 A;  4X7C A;  3OJW A;  4XOP A;  5KW9 A;  1QFJ A;  4N3N A;  3Q6Q A;  3B8H A;  2BGI A;  2ZL7 A;  1KK2 A;  3BC9 A;  4TMX A;  3KL9 A;  4QFM A;  4FXU A;  4RDJ A;  2XZP A;  1V0F A;  4BPR A;  2VBV A;  4P6Y A;  2DCU A;  1EP1 B;  4Z4Z A;  4XOR A;  4ASU A;  4F7D A;  2CK3 A;  1FDR A;  3LVB A;  3HAG A;  1CNE A;  1KJZ A;  1DDI A;  5IYW A;  4Z4Y A;  1XE1 A;  4OP7 A;  4P26 A;  3CCM B;  3OPO A;  1NJI D;  3ZIA A;  2QTZ A;  1T6X A;  1ZM9 A;  1BX0 A;  1TLL A;  3GVJ A;  1OB5 A;  3BNW A;  3W2I A;  4P1V A;  3CMA B;  2ZL6 A;  4XN3 A;  2DEU A;  1VLO A;  2X6W A;  4LBW A;  4OOX A;  1HVX A;  5HZB A;  2NPF A;  3FPP A;  2PIA A;  3BCD A;  3GIR A;  2WR8 A;  2V7V A;  3CPW B;  1VF7 A;  1EP3 B;  3FPK A;  4ACB A;  1E3Z A;  1UD8 A;  2X53 S;  2XZO A;  3ONY A;  4M53 A;  2QMU A;  1N0V C;  1KMH A;  3ZZU A;  3QFC A;  2C2W A;  1U2R A;  5TV2 A;  1GVH A;  3D26 A;  4P3I A;  4B3X A;  4ZV4 A;  2ZXI A;  1D2E A;  4ZCM A;  2QA4 B;  1KD1 D;  2D74 A;  1W0K A;  3CRZ A;  3VNV A;  2ZZQ A;  3OW2 B;  3PEN A;  5TR9 A;  4XLC A;  1NB0 A;  2Z6B D;  1YIT B;  2EFG A;  4M1K A;  3GQB A;  4AF6 A;  3CD6 B;  4XMY A;  3W5U A;  1YJ9 B;  4TN1 A;  2WSS A;  2HDN B;  1ZM4 A;  3LQ6 A;  1KC8 D;  4TSF A;  1G7T A;  3OFN A;  2X3U A;  1UD5 A;  2F1L A;  2DOG A;  1I7P A;  3WQZ A;  1Q7Y D;  3CCS B;  3CC2 B;  3AGQ A;  2XGJ A;  1CNF A;  2YWG A;  1PJ6 A;  4OPS A;  4YAF A;  1FNM A;  4P9S A;  4B4D A;  4TT3 A;  3FJO A;  1K9M D;  1KTV A;  2B5O A;  5E6T A;  1WOS A;  5GV8 A;  2HLD A;  1FNC A;  2CW5 A;  4XD7 A;  1QG0 A;  4AC9 A;  1VQ7 B;  1FNB A;  3WND A;  3G4S B;  3ZBU A;  4RD3 A;  4XKW A;  1KZL A;  4XOT A;  5IYP A;  4XLH A;  3CC7 B;  1VQO B;  1VQ4 B;  1FND A;  2X8K A;  1M90 D;  5BSY A;  3A3G A;  4LC0 A;  4XLA A;  2RC5 A;  2Q6I A;  4UZF A;  3WNC A;  1R5N A;  1N07 A;  1WOR A;  1ELO A;  4UAJ A;  1H85 A;  1Y0Y A;  2OBT A;  5HZA A;  1GO2 A;  4RPB A;  4MYU A;  2DET A;  4DNR B;  3U6B A;  4B43 A;  3AGP A;  5FIU A;  4LBV A;  2GK7 A;  4ROX A;  2X6X A;  2XND A;  2DYI A;  4RCY A;  4YAW A;  1T6Z A;  1MAB A;  2JIZ A;  3CCU B;  3OJX A;  4WQM A;  2HCJ B;  1B2R A;  4X07 A;  1V0E A;  1ZUN B;  2CC2 A;  4X7E A;  1D1N A;  1BX1 A;  4QVA A;  4YXW A;  3P26 A;  4PC6 A;  1WDT A;  3WY9 A;  1NDH A;  2F43 A;  4PAA A;  2OK7 A;  5B6I A;  1EP2 B;  4Z1M A;  5THX A;  1Q9S A;  1N06 A;  2C5H A;  1H8H A;  2X6Y A;  1E62 A;  2VJI A;  1YX2 A;  4OOV A;  5IYR A;  4RLZ A;  3CCV B;  1TTT A;  3OZU A;  2HMA A;  3JQQ A;  2QTL A;  2V7U A;  4KKU A;  2GJR A;  1K8A D;  2NV4 A;  2V7T A;  4XM3 A;  1GJR A;  2VZL A;  1S72 B;  1VQK B;  4XL9 A;  1WP6 A;  3G71 B;  1RQR A;  3PUN A;  2V7Q A;  4WWV A;  2WZP P;  4KKS A;  3ISX A;  1CQX A;  4G6I A;  5FO1 A;  3SLN A;  5KNL A;  4M2L A;  1F60 A;  2DY1 A;  4C43 A;  3AST A;  1IB0 A;  2PMD A;  3SJZ A;  1EXM A;  2GJK A;  3CTA A;  5IYQ A;  2V7W A;  1DAR A;  4G1V A;  2YWE A;  3QFT A;  1EFR A;  1F20 A;  2VNI A;  4X7F A;  1NRK A;  1H42 A;  1WPC A;  2XZL A;  3BQJ A;  2ZZG A;  1YIJ B;  3JQP A;  4DQK A;  1BMF A;  1AMO A;  2JJ2 A;  3B82 A;  1OB2 A;  3P27 A;  4Z4V A;  4X0C A;  1QGZ A;  1R5O A;  5A88 A;  5A8A A;  3MHP A;  3CCR B;  3U6K A;  1VHE A;  4PGO A;  1V5V A;  3E20 A;  4QVJ A;  4TMT A;  3Q6R A;  3WXM A;  1BPL A;  4X06 A;  1UMK A;  4C0S A;  2EIX A;  3A35 A;  2BMW A;  2QGG A;  2M5S A;  2OK8 A;  3V76 A;  3I55 B;  2ZTN A;  2LZJ A;  3JU4 A;  3CXC B;  1QH0 A;  1VLY A;  2CRV A;  1PJ5 A;  1KQS B;  2V4D A;  4M4S A;  3QFR A;  4HE6 A;  4Z4S A;  2C5B A;  2ZTG A;  3W2E A;  2D9R A;  3I1F A;  4G5G A;  1JNY A;  5J35 A;  1HZE A;  3W5H A;  1T6Y A;  1NBM A;  2QDX A;  1FRN A;  2R9V A;  1KRH A;  1E63 A;  4TMW A;  4B47 A;  3E1Y E;  1FX0 A;  4LBZ A;  4P12 A;  3WBJ A;  3AVV A;  1EFT A;  1EFU A;  3Q38 A;  3A8J A;  3BH4 A;  2QE7 A;  2XNC A;  3W2H A;  1W2B B;  4H9G A;  4QHY A;  1JB9 A;  4RD1 A;  5BSX A;  1UD3 A;  1Y0R A;  1G7R A;  3B78 A;  1XQB A;  4X7D A;  1QUE A;  3J81 k;  1S4M A;  4XLF A;  4JMQ A;  3U2Q A;  3GSI A;  3VO2 A;  3OZV A;  3LNN A;  4X05 A;  4Z4T A;  2BSA A;  1FRQ A;  1G7C A;  4RPD A;  3GVK A;  2BPO A;  3WYA A;  3VMF A;  1W87 A;  5F4O A;  3PVD A;  3BY1 A;  3ZPN A;  2VNK A;  1QVG B;  1A8P A;  2ZL5 A;  4CQJ A;  5GV7 A;  1VQ5 B;  3T56 B;  2YWH A;  1RQP A;  1WOP A;  3QFS A;  4OPO A;  3G6E B;  4R71 A;  5DS0 A;  3AVT A;  4XQF A;  5IYN A;  4RD6 A;  1GR1 A;  5EMN A;  3WBK A;  1K73 D;  5AN9 A;  2WYR A;  1IJE A;  2BV3 A;  2WJV A;  4TMZ A;  1G7S A;  2BF4 A;  5A89 A;  1BJK A;  2WZN A;  3KEW A;  1VQL B;  1S0U A;  1UD6 A;  2FVG A;  3W5V A;  2WPD A;  1HA3 A;  3CCJ B;  2B7C A;  3BY2 A;  3QE2 A;  1P4M A;  3H9N A;  4G7W A;  2GPJ A;  2X0K A;  2V7X A;  1UD4 A;  4X8I A;  2YWF A;  1Q86 D;  1SKQ A;  3DDY A;  3JQR A;  3Q3A A;  4DK0 A;  3CCL B;  5HXB A;  3ASP A;  3PA2 A;  2QN6 A;  2P3M A;  3OEE A; 
#chains in the Genus database with same CATH homology
 4X7F A;  3BQJ A;  4QUZ A;  4Z4U A;  4Z4V A;  3ASR A;  4X0C A;  4WZK A;  4QVJ A;  3LQ6 A;  3Q6R A;  4X06 A;  2OBR A;  4OPS A;  4RM0 A;  3R6K A;  3Q39 A;  4P25 A;  4OOS A;  5E6T A;  3SKB A;  4WZL A;  4Z4S A;  5F4M A;  5J35 A;  3SEJ A;  3ASS A;  5IYP A;  4P12 A;  3Q38 A;  5BSY A;  3LQE A;  3SJP A;  3SLD A;  5BSX A;  4RDK A;  4X7D A;  1IHM A;  2OBT A;  5HZA A;  4QV2 A;  4RPB A;  4X7C A;  4X05 A;  5J3O A;  4Z4T A;  5KW9 A;  4Z4R A;  4RPD A;  3Q6Q A;  2ZL7 A;  4ROX A;  3PA1 A;  5F4O A;  4RDJ A;  3R6J A;  3PVD A;  4RDL A;  3BY1 A;  4X07 A;  4X7E A;  4WZE A;  2ZL5 A;  4Z4Z A;  2OBS A;  4QVA A;  4OPO A;  4WZT A;  5F4J A;  5IYW A;  5IYN A;  4Z4Y A;  4OP7 A;  4P26 A;  3ASQ A;  4OOV A;  4P2N A;  5IYR A;  3ONU A;  4RLZ A;  4P1V A;  2ZL6 A;  3PUM A;  3RY8 A;  4OOX A;  5HZB A;  4OPV A;  4Z4W A;  3BY2 A;  3PUN A;  3SLN A;  3ONY A;  3AST A;  3Q3A A;  3V7A A;  3ASP A;  3PA2 A;  3D26 A;  4P3I A;  5IYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...