4RPBA

Crystal structure of p domain of snow mountain norovirus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
308
structure length
300
Chain Sequence
KPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTAHLTLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFGVITQRDKQNAAGQSQPANRGHDAVVPTYTAQYTPKLGQVQIGTDLKVNQPVKFTPVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYLPLKGGYGNPAIDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAPVVVPANGYFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Structural Constraints on Human Norovirus Binding to Histo-Blood Group Antigens.
pubmed doi rcsb
source organism Norovirus hu/gii.2/kl109/1978/mys
molecule tags Viral protein
total genus 71
structure length 300
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rpbA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rpbA01
4WZLA 4X7CA 3ASRA 4X05A 3ONUA 4ROXA 4X7FA 3Q6RA 4QVJA 3ONYA 5IYNA 2ZL6A 4Z4WA 2ZL5A 4Z4UA 3Q6QA 5BSYA 5J35A 3LQEA 3BY1A 3ASSA 5E6TA 4Z4VA 5IYPA 4X06A 5F4OA 4WZEA 3Q38A 3SEJA 4OOVA 3Q39A 4QVAA 3Q3AA 4Z4YA 5IYRA 4RPBA 2OBSA 3PUMA 3SJPA 4P3IA 3D26A 3R6JA 4Z4RA 3SLDA 3PVDA 4OP7A 4WZKA 3PA2A 4QV2A 4OOXA 4P1VA 4RPDA 4P25A 2OBTA 3PA1A 3PUNA 5HZAA 4Z4TA 2ZL7A 3R6KA 4OPOA 3SLNA 4RLZA 4QUZA 5F4MA 3BQJA 4P26A 4Z4ZA 4OOSA 5KW9A 5IYQA 4X7DA 4X07A 3ASPA 4Z4SA 3SKBA 5HZBA 4RDJA 1IHMA 5F4JA 4X7EA 4P2NA 4P12A 3RY8A 4OPVA 5J3OA 3ASQA 4OPSA 4RDLA 4X0CA 3LQ6A 2OBRA 5IYWA 4RM0A 3V7AA 5BSXA 3BY2A 4RDKA 3ASTA 4WZTA
chains in the Genus database with same CATH superfamily
5JBQA 4XM3A 2Q6IA 1IB0A 2WR8A 1PJ6A 3A35A 4YAFA 4X7CA 1N0VC 3ASRA 1W35A 3ZZUA 3OJWA 3FPKA 2ZZGA 3MHPA 1CQXA 5HXBA 3GQBA 3Q6RA 2ZXIA 3PENA 2Q6LA 1VQPB 3ONYA 5IYNA 3OP1A 4UZEA 2WYRA 3JU4A 2RC5A 1KD1D 1T6YA 1SKYB 2YWHA 2CNDA 2XNJA 1OHHA 3V76A 1M90D 4HE6A 4MYUA 4YAWA 3CCUB 2X53S 4N3NA 2OTJB 1EFCA 4PC6A 4DNTB 1ZM4A 2YWGA 1T5EA 2WPDA 1TVCA 2C2WA 1VQ7B 3LQEA 3W2EA 3ZBUA 2ZZQA 4Z4VA 3G4SB 2M5SA 2PIAA 1WOSA 1I18A 3Q38A 3SEJA 1K28D 1VQKB 1TUIA 2GREA 2VNHA 3CP8A 1JA0A 2GK7A 3LO8A 3CPXA 4XN0A 2QTLA 4OOVA 1AIPA 2CBXA 3P26A 4C43A 3BC9A 3OEHA 1Q7YD 2FVGA 2OK7A 4RPBA 2XGJA 3SJPA 3NE5B 4P3IA 3CTAA 1WSVA 3CMEB 4Y9UA 1CNFA 3SLDA 3WQZA 3PVDA 4XLEA 3FPPA 3ZPNA 4HIZA 1ELOA 3J81k 1EFRA 4F7DA 4TMZA 2DERA 3MMPA 4TKOB 4TN1A 3BCFA 4YXWA 2Q6OA 3PUNA 3GVLA 2V7TA 2C5HA 4XLHA 1H42A 4P22A 4XLFA 4Z4TA 3SJZA 3B8HA 1JJ2B 2DYIA 1HZEA 4RCYA 3R6KA 2PE3A 2VBUA 3OPOA 3KL9A 3GIRA 4OPOA 2QE7A 3VNUA 1N08A 1WPCA 2VNIA 4P9SA 3BH4A 2W6JA 4RLZA 4QUZA 2VJJA 3QFRA 3B78A 1RQPA 1G7CA 2NV4A 4XMYA 4Z4ZA 5KW9A 1QUFA 4P6VF 1EP3B 1QFYA 1ZM9A 3QFCA 3H94A 3OW2B 2XZPA 4ZGQB 2GJRA 1KK3A 3ASPA 3CC2B 4ACBA 1QGYA 2X8KA 3AVXA 4ZCLA 1GAQA 3QSYA 1FNDA 2GJPA 3JQRA 4PAAA 1YITB 1IJFA 4RD4A 3CCEB 5F4JA 3WBKA 2VBTA 3KEWA 1FNMA 1DG1G 3W5VA 1QFJA 3E1YE 1BX0A 2VNKA 1W2BB 5DN6A 4RDLA 1P4MA 1WOPA 2WJVA 2CK3A 4B44A 1DDGA 2X85A 1W9XA 3CRZA 2V4DA 2JIZA 1KJZA 5B6IA 2X6YA 2PLFA 1NBMA 2C77A 4P6YA 4IW3B 1GVHA 1KK1A 2VYQA 3FKSA 1EWYA 3ZBTA 3AVWA 5FA6A 1RQRA 3OZWA 2X0KA 4X05A 3ONUA 4ROXA 1H85A 2F4NA 1FRNA 2W6IA 2P3MA 3WNDA 2C5BA 4E0FA 1Q82D 2GQFA 2ZL6A 2RC6A 1KRHA 1E1QA 4G1VA 1Y0YA 2ZL5A 3OEEA 4LBZA 4N3GA 1QUEA 4QFMA 1PKVA 2NPFA 5BSYA 1WTHD 1F60A 1JB9A 1I8DA 4G5GA 1UD3A 3MCAA 3OZUA 2OYNA 4ACAA 4XKVA 4TT3A 1VQ4B 1EFUA 1E62A 4EH1A 5F4OA 4WZEA 2V7QA 2BM0A 3WNCA 2XZLA 4DK0A 1H8HA 1K73D 5LMZA 1EP1B 3CPWB 2X6WA 3CCQB 2OBSA 3PUMA 1Q86D 2C78A 1EP2B 4XOPA 1Q81D 3VR6A 1WDTA 1U2RA 1D8TA 3PA2A 2ZZFA 4QV2A 4XKWA 3ZUGA 5A89A 3GSIA 3JQQA 4P1VA 4P25A 3WYAA 5KNLA 2GPJA 4B43A 5FL7A 3PA1A 5HZAA 1QGZA 3P27A 1E64A 2Z6BD 1B23P 3ISXA 3A8JA 2ZL7A 4WQMA 1NJID 2WJYA 1VJSA 1OB5A 1G7RA 4MYTA 4ASUA 4KKTA 4II2A 1SM4A 3WY9A 5TY0A 4J0QA 2OTLB 1COWA 1QX4A 4LBVA 5F4MA 3HAGA 1GAWA 2V7WA 4XLAA 4Z1MA 3T53B 4RJLA 3CMAB 3ES9A 1XE1A 2VZLA 1OB2A 2E1BA 4G7WA 5IYQA 1TTTA 1N0UA 1Y0RA 1Q9SA 2XEXA 4M53A 1UD8A 5H5JA 2V7XA 4TMVA 3AGPA 5HZBA 3W2FA 2ZITA 1ZM2A 5FO1A 2X6XA 3CP2A 2BSAA 1G7TA 2V7VA 1YI2B 4YHBA 3OE7A 4P12A 5J3OA 2B7BA 3ASQA 4NCNA 4LC0A 2QA4B 4X0CA 1YLOA 4CQJA 3OJXA 1HVXA 3LQ6A 1S4MA 1BX1A 1WORA 2OBRA 2PMDA 4YALA 5IYWA 4M4SA 3W2IA 1DARA 2KVOA 3U6KA 4Y7CA 2ZZEA 1V0FA 2HMAA 5TRDA 1D1NA 1GJRA 2XZOA 3OFNA 4XR6A 4ZGNB 4RD0A 1M1KD 4ZV4A 5FNZA 3QFTA 1BQEA 2X3UA 3W2HA 4RD3A 1N8RD 4XN3A 1QGAA 2AHOA 1FDRA 2BF4A 4M0LA 1KTVA 4QVJA 4RCZA 1S0UA 4RD2A 2HDNB 3AGQA 3WXMA 3VNVA 3CB4A 4B3FX 4DK1A 1BPLA 1UMKA 2BM1A 2BMWA 3Q6QA 1YHQB 1FNBA 2DETA 1JA1A 3BY1A 2GJKA 5E6TA 4PGOA 2OK8A 3G05A 1H8EA 4FK8A 4DQLA 1T6XA 4X06A 2HCJB 1WU8A 3E20A 2CF4A 2D3NA 2QGGA 1J9ZA 4II3A 3Q39A 5TV2A 5HKKA 4P3YA 2QN6A 2R9VA 3Q3AA 3DDYA 4Z4YA 1GR1A 4XOTA 2BV3A 1VHEA 3LNNA 1SKQA 1UD5A 1MRZA 1QG0A 4XONA 2HLDA 1YJNB 1KC8D 1KMHA 3WNBA 4Z4RA 4OP7A 5DS0A 5FIUA 4WZKA 5TR9A 3CCLB 1VQ5B 1NDHA 2F1LA 1B2RA 1E3ZA 2Q6KA 4OOXA 2B5OA 2EIXA 2V7UA 2WSSA 1BLIA 2D3LA 2YWFA 4RPDA 2EFGA 3G6EB 1VQ8B 5H59A 2OBTA 2WZNA 3A3BA 4FN5A 1I7PA 4C0SA 1K9MD 5A88A 4G7XA 1VQ6B 1OGIA 1E43A 4KKSA 3T56B 1N07A 3CCSB 5AN9A 5IK2A 4PC3A 3CD6B 1D2EA 1DDIA 3LVBA 3I1FA 3SLNA 1IJEA 2CRVA 1NB0A 3CW2A 4TMXA 4XQFA 1VHOA 2F43A 3ZIAA 4DQKA 1ZUNB 1W87A 1NB9A 3BNWA 4P26A 3OAAA 1HA3A 2VBVA 3OZVA 4OOSA 2BPOA 2DOGA 1VLYA 4Q7JB 4M1KA 4X07A 1KZLA 1TLLA 3W5UA 3I55B 5GV8A 4Z4SA 5DSZA 3AVUA 2ZTNA 3SKBA 1CNEA 1EFTA 1S72B 4PABA 2VBSA 1GO2A 2ZBVA 3QE2A 3OW7A 4P2NA 3AVVA 4B3GA 4K1XA 4OPVA 3ZZ0A 1FX0A 3CCVB 1T6ZA 2XOKA 2BN4A 4OPSA 4TMTA 3W5HA 4G6IA 1G7SA 3T51B 2BGJA 4RM0A 3V7AA 5BSXA 3JQPA 3BY2A 3VMFA 4RDKA 1VQOB 1JNYA 1WP6A 3ZC3A 2DY1A 1BJKA 4YEJA 3CCRB 2I1LA 1UD4A 3G71B 4M2LA 4XNFA 3VO2A 1KQSB 1E79A 4WZLA 2C4TA 3CCJB 1VQNB 2DIEA 1W0KA 3AVTA 2VJIA 4H9GA 1N05A 3H9NA 4X7FA 2ZBUA 1W34A 3CMMA 1PJ7A 2E1RA 2YWEA 2F1MA 1UD2A 3AVYA 4Z4WA 1XFOA 4R71A 2CW5A 2GK6A 2D74A 1KK2A 4Z4UA 1R5BA 1VLOA 1E1RA 2ZXHA 5J35A 1PJ5A 2J7KA 3WBJA 3ASSA 5GV7A 4DNRB 5IYPA 4RD6A 1FRQA 5CDFA 4ZCMA 4L8JA 3CCMB 1K8AD 3I56B 5A8AA 3CXCB 1OGJA 4PC2A 1WOOA 2JN9A 4XLCA 2QTZA 1N06A 4PC7A 3A8KA 3GVJA 4RD1A 1YJ9B 4ZCIA 4QVAA 3U2QA 1EXMA 2DCUA 5IYRA 4FXUA 1AMOA 1KK0A 2R6HA 1R5OA 2ZTGA 1QH0A 1V5VA 2JDIA 1YIJB 2JJ2A 2JJ1A 1R5NA 3D26A 4NNJA 4YAOA 5EMNA 3CC4B 3R6JA 4AVZA 1QFZA 3A8IA 4XD7A 1FNCA 1QVFB 4B48A 2BGIA 1BMFA 3OOCA 4YELA 4B3XA 1VF7A 4AF6A 1F20A 3QFSA 3ZZTA 3U6BA 4NBSA 4TMWA 1NRKA 4XORA 4UZFA 2D9RA 1E63A 2FX3A 4JMQA 3CESA 4LBWA 4AC9A 3CC7B 1VQMB 4BPRA 1ZM3A 4UAJA 4XL9A 5THXA 1VQ9B 4AF7A 2QEXB 5FO0A 3BQJA 4GQNA 3VO1A 1QVGB 2WZPP 4B47A 1A8PA 3A1PA 5KSWB 1YJWB 2BVNA 3FJOA 1E3XA 4X7DA 1UD6A 4YAUA 1OB0A 4FWTA 5L46A 2V31A 2DEUA 4B4DA 4KKUA 4X8IA 4LBYA 4WZTA 2LZJA 4RDJA 1IHMA 1VQLB 1YX2A 2CC2A 2VNJA 4X7EA 1W0JA 3BCDA 3GVKA 3RY8A 4UZUA 2XNDA 4PC1A 4U9UA 4Y9RA 1WSRA 4HE5A 2B7CA 2QDXA 4TSFA 3OKXA 3W2GA 2XNCA 3B82A 1XB2A 4G1BA 4QHYA 2C4UA 3ASTA 2QMUA 1XQBA 3A3GA 1V0EA 1MABA 4WWVA
chains in the Genus database with same CATH topology
4WZLA 4X7CA 3ASRA 4X05A 3ONUA 4ROXA 4X7FA 3Q6RA 4QVJA 3ONYA 5IYNA 2ZL6A 4Z4WA 2ZL5A 4Z4UA 3Q6QA 5BSYA 5J35A 3LQEA 3BY1A 3ASSA 5E6TA 4Z4VA 5IYPA 4X06A 5F4OA 4WZEA 3Q38A 3SEJA 4OOVA 3Q39A 4QVAA 3Q3AA 4Z4YA 5IYRA 4RPBA 2OBSA 3PUMA 3SJPA 4P3IA 3D26A 3R6JA 4Z4RA 3SLDA 3PVDA 4OP7A 4WZKA 3PA2A 4QV2A 4OOXA 4P1VA 4RPDA 4P25A 2OBTA 3PA1A 3PUNA 5HZAA 4Z4TA 2ZL7A 3R6KA 4OPOA 3SLNA 4RLZA 4QUZA 5F4MA 3BQJA 4P26A 4Z4ZA 4OOSA 5KW9A 5IYQA 4X7DA 4X07A 3ASPA 4Z4SA 3SKBA 5HZBA 4RDJA 1IHMA 5F4JA 4X7EA 4P2NA 4P12A 3RY8A 4OPVA 5J3OA 3ASQA 4OPSA 4RDLA 4X0CA 3LQ6A 2OBRA 5IYWA 4RM0A 3V7AA 5BSXA 3BY2A 4RDKA 3ASTA 4WZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZL A;  4X7C A;  3ASR A;  4X05 A;  3ONU A;  4ROX A;  4X7F A;  3Q6R A;  4QVJ A;  3ONY A;  5IYN A;  2ZL6 A;  4Z4W A;  2ZL5 A;  4Z4U A;  3Q6Q A;  5BSY A;  5J35 A;  3LQE A;  3BY1 A;  3ASS A;  5E6T A;  4Z4V A;  5IYP A;  4X06 A;  5F4O A;  4WZE A;  3Q38 A;  3SEJ A;  4OOV A;  3Q39 A;  4QVA A;  3Q3A A;  4Z4Y A;  5IYR A;  4RPB A;  2OBS A;  3PUM A;  3SJP A;  4P3I A;  3D26 A;  3R6J A;  4Z4R A;  3SLD A;  3PVD A;  4OP7 A;  4WZK A;  3PA2 A;  4QV2 A;  4OOX A;  4P1V A;  4RPD A;  4P25 A;  2OBT A;  3PA1 A;  3PUN A;  5HZA A;  4Z4T A;  2ZL7 A;  3R6K A;  4OPO A;  3SLN A;  4RLZ A;  4QUZ A;  5F4M A;  3BQJ A;  4P26 A;  4Z4Z A;  4OOS A;  5KW9 A;  5IYQ A;  4X7D A;  4X07 A;  3ASP A;  4Z4S A;  3SKB A;  5HZB A;  4RDJ A;  1IHM A;  5F4J A;  4X7E A;  4P2N A;  4P12 A;  3RY8 A;  4OPV A;  5J3O A;  3ASQ A;  4OPS A;  4RDL A;  4X0C A;  3LQ6 A;  2OBR A;  5IYW A;  4RM0 A;  3V7A A;  5BSX A;  3BY2 A;  4RDK A;  3AST A;  4WZT A; 
#chains in the Genus database with same CATH topology
 5JBQ A;  4XM3 A;  2Q6I A;  1IB0 A;  2WR8 A;  1PJ6 A;  3A35 A;  4YAF A;  4X7C A;  1N0V C;  3ASR A;  1W35 A;  3ZZU A;  3OJW A;  3FPK A;  2ZZG A;  3MHP A;  1CQX A;  5HXB A;  3GQB A;  3Q6R A;  2ZXI A;  3PEN A;  2Q6L A;  1VQP B;  3ONY A;  5IYN A;  3OP1 A;  4UZE A;  2WYR A;  3JU4 A;  2RC5 A;  1KD1 D;  1T6Y A;  1SKY B;  2YWH A;  2CND A;  2XNJ A;  1OHH A;  3V76 A;  1M90 D;  4HE6 A;  4MYU A;  4YAW A;  3CCU B;  2X53 S;  4N3N A;  2OTJ B;  1EFC A;  4PC6 A;  4DNT B;  1ZM4 A;  2YWG A;  1T5E A;  2WPD A;  1TVC A;  2C2W A;  1VQ7 B;  3LQE A;  3W2E A;  3ZBU A;  2ZZQ A;  4Z4V A;  3G4S B;  2M5S A;  2PIA A;  1WOS A;  1I18 A;  3Q38 A;  3SEJ A;  1K28 D;  1VQK B;  1TUI A;  2GRE A;  2VNH A;  3CP8 A;  1JA0 A;  2GK7 A;  3LO8 A;  3CPX A;  4XN0 A;  2QTL A;  4OOV A;  1AIP A;  2CBX A;  3P26 A;  4C43 A;  3BC9 A;  3OEH A;  1Q7Y D;  2FVG A;  2OK7 A;  4RPB A;  2XGJ A;  3SJP A;  3NE5 B;  4P3I A;  3CTA A;  1WSV A;  3CME B;  4Y9U A;  1CNF A;  3SLD A;  3WQZ A;  3PVD A;  4XLE A;  3FPP A;  3ZPN A;  4HIZ A;  1ELO A;  3J81 k;  1EFR A;  4F7D A;  4TMZ A;  2DER A;  3MMP A;  4TKO B;  4TN1 A;  3BCF A;  4YXW A;  2Q6O A;  3PUN A;  3GVL A;  2V7T A;  2C5H A;  4XLH A;  1H42 A;  4P22 A;  4XLF A;  4Z4T A;  3SJZ A;  3B8H A;  1JJ2 B;  2DYI A;  1HZE A;  4RCY A;  3R6K A;  2PE3 A;  2VBU A;  3OPO A;  3KL9 A;  3GIR A;  4OPO A;  2QE7 A;  3VNU A;  1N08 A;  1WPC A;  2VNI A;  4P9S A;  3BH4 A;  2W6J A;  4RLZ A;  4QUZ A;  2VJJ A;  3QFR A;  3B78 A;  1RQP A;  1G7C A;  2NV4 A;  4XMY A;  4Z4Z A;  5KW9 A;  1QUF A;  4P6V F;  1EP3 B;  1QFY A;  1ZM9 A;  3QFC A;  3H94 A;  3OW2 B;  2XZP A;  4ZGQ B;  2GJR A;  1KK3 A;  3ASP A;  3CC2 B;  4ACB A;  1QGY A;  2X8K A;  3AVX A;  4ZCL A;  1GAQ A;  3QSY A;  1FND A;  2GJP A;  3JQR A;  4PAA A;  1YIT B;  1IJF A;  4RD4 A;  3CCE B;  5F4J A;  3WBK A;  2VBT A;  3KEW A;  1FNM A;  1DG1 G;  3W5V A;  1QFJ A;  3E1Y E;  1BX0 A;  2VNK A;  1W2B B;  5DN6 A;  4RDL A;  1P4M A;  1WOP A;  2WJV A;  2CK3 A;  4B44 A;  1DDG A;  2X85 A;  1W9X A;  3CRZ A;  2V4D A;  2JIZ A;  1KJZ A;  5B6I A;  2X6Y A;  2PLF A;  1NBM A;  2C77 A;  4P6Y A;  4IW3 B;  1GVH A;  1KK1 A;  2VYQ A;  3FKS A;  1EWY A;  3ZBT A;  3AVW A;  5FA6 A;  1RQR A;  3OZW A;  2X0K A;  4X05 A;  3ONU A;  4ROX A;  1H85 A;  2F4N A;  1FRN A;  2W6I A;  2P3M A;  3WND A;  2C5B A;  4E0F A;  1Q82 D;  2GQF A;  2ZL6 A;  2RC6 A;  1KRH A;  1E1Q A;  4G1V A;  1Y0Y A;  2ZL5 A;  3OEE A;  4LBZ A;  4N3G A;  1QUE A;  4QFM A;  1PKV A;  2NPF A;  5BSY A;  1WTH D;  1F60 A;  1JB9 A;  1I8D A;  4G5G A;  1UD3 A;  3MCA A;  3OZU A;  2OYN A;  4ACA A;  4XKV A;  4TT3 A;  1VQ4 B;  1EFU A;  1E62 A;  4EH1 A;  5F4O A;  4WZE A;  2V7Q A;  2BM0 A;  3WNC A;  2XZL A;  4DK0 A;  1H8H A;  1K73 D;  5LMZ A;  1EP1 B;  3CPW B;  2X6W A;  3CCQ B;  2OBS A;  3PUM A;  1Q86 D;  2C78 A;  1EP2 B;  4XOP A;  1Q81 D;  3VR6 A;  1WDT A;  1U2R A;  1D8T A;  3PA2 A;  2ZZF A;  4QV2 A;  4XKW A;  3ZUG A;  5A89 A;  3GSI A;  3JQQ A;  4P1V A;  4P25 A;  3WYA A;  5KNL A;  2GPJ A;  4B43 A;  5FL7 A;  3PA1 A;  5HZA A;  1QGZ A;  3P27 A;  1E64 A;  2Z6B D;  1B23 P;  3ISX A;  3A8J A;  2ZL7 A;  4WQM A;  1NJI D;  2WJY A;  1VJS A;  1OB5 A;  1G7R A;  4MYT A;  4ASU A;  4KKT A;  4II2 A;  1SM4 A;  3WY9 A;  5TY0 A;  4J0Q A;  2OTL B;  1COW A;  1QX4 A;  4LBV A;  5F4M A;  3HAG A;  1GAW A;  2V7W A;  4XLA A;  4Z1M A;  3T53 B;  4RJL A;  3CMA B;  3ES9 A;  1XE1 A;  2VZL A;  1OB2 A;  2E1B A;  4G7W A;  5IYQ A;  1TTT A;  1N0U A;  1Y0R A;  1Q9S A;  2XEX A;  4M53 A;  1UD8 A;  5H5J A;  2V7X A;  4TMV A;  3AGP A;  5HZB A;  3W2F A;  2ZIT A;  1ZM2 A;  5FO1 A;  2X6X A;  3CP2 A;  2BSA A;  1G7T A;  2V7V A;  1YI2 B;  4YHB A;  3OE7 A;  4P12 A;  5J3O A;  2B7B A;  3ASQ A;  4NCN A;  4LC0 A;  2QA4 B;  4X0C A;  1YLO A;  4CQJ A;  3OJX A;  1HVX A;  3LQ6 A;  1S4M A;  1BX1 A;  1WOR A;  2OBR A;  2PMD A;  4YAL A;  5IYW A;  4M4S A;  3W2I A;  1DAR A;  2KVO A;  3U6K A;  4Y7C A;  2ZZE A;  1V0F A;  2HMA A;  5TRD A;  1D1N A;  1GJR A;  2XZO A;  3OFN A;  4XR6 A;  4ZGN B;  4RD0 A;  1M1K D;  4ZV4 A;  5FNZ A;  3QFT A;  1BQE A;  2X3U A;  3W2H A;  4RD3 A;  1N8R D;  4XN3 A;  1QGA A;  2AHO A;  1FDR A;  2BF4 A;  4M0L A;  1KTV A;  4QVJ A;  4RCZ A;  1S0U A;  4RD2 A;  2HDN B;  3AGQ A;  3WXM A;  3VNV A;  3CB4 A;  4B3F X;  4DK1 A;  1BPL A;  1UMK A;  2BM1 A;  2BMW A;  3Q6Q A;  1YHQ B;  1FNB A;  2DET A;  1JA1 A;  3BY1 A;  2GJK A;  5E6T A;  4PGO A;  2OK8 A;  3G05 A;  1H8E A;  4FK8 A;  4DQL A;  1T6X A;  4X06 A;  2HCJ B;  1WU8 A;  3E20 A;  2CF4 A;  2D3N A;  2QGG A;  1J9Z A;  4II3 A;  3Q39 A;  5TV2 A;  5HKK A;  4P3Y A;  2QN6 A;  2R9V A;  3Q3A A;  3DDY A;  4Z4Y A;  1GR1 A;  4XOT A;  2BV3 A;  1VHE A;  3LNN A;  1SKQ A;  1UD5 A;  1MRZ A;  1QG0 A;  4XON A;  2HLD A;  1YJN B;  1KC8 D;  1KMH A;  3WNB A;  4Z4R A;  4OP7 A;  5DS0 A;  5FIU A;  4WZK A;  5TR9 A;  3CCL B;  1VQ5 B;  1NDH A;  2F1L A;  1B2R A;  1E3Z A;  2Q6K A;  4OOX A;  2B5O A;  2EIX A;  2V7U A;  2WSS A;  1BLI A;  2D3L A;  2YWF A;  4RPD A;  2EFG A;  3G6E B;  1VQ8 B;  5H59 A;  2OBT A;  2WZN A;  3A3B A;  4FN5 A;  1I7P A;  4C0S A;  1K9M D;  5A88 A;  4G7X A;  1VQ6 B;  1OGI A;  1E43 A;  4KKS A;  3T56 B;  1N07 A;  3CCS B;  5AN9 A;  5IK2 A;  4PC3 A;  3CD6 B;  1D2E A;  1DDI A;  3LVB A;  3I1F A;  3SLN A;  1IJE A;  2CRV A;  1NB0 A;  3CW2 A;  4TMX A;  4XQF A;  1VHO A;  2F43 A;  3ZIA A;  4DQK A;  1ZUN B;  1W87 A;  1NB9 A;  3BNW A;  4P26 A;  3OAA A;  1HA3 A;  2VBV A;  3OZV A;  4OOS A;  2BPO A;  2DOG A;  1VLY A;  4Q7J B;  4M1K A;  4X07 A;  1KZL A;  1TLL A;  3W5U A;  3I55 B;  5GV8 A;  4Z4S A;  5DSZ A;  3AVU A;  2ZTN A;  3SKB A;  1CNE A;  1EFT A;  1S72 B;  4PAB A;  2VBS A;  1GO2 A;  2ZBV A;  3QE2 A;  3OW7 A;  4P2N A;  3AVV A;  4B3G A;  4K1X A;  4OPV A;  3ZZ0 A;  1FX0 A;  3CCV B;  1T6Z A;  2XOK A;  2BN4 A;  4OPS A;  4TMT A;  3W5H A;  4G6I A;  1G7S A;  3T51 B;  2BGJ A;  4RM0 A;  3V7A A;  5BSX A;  3JQP A;  3BY2 A;  3VMF A;  4RDK A;  1VQO B;  1JNY A;  1WP6 A;  3ZC3 A;  2DY1 A;  1BJK A;  4YEJ A;  3CCR B;  2I1L A;  1UD4 A;  3G71 B;  4M2L A;  4XNF A;  3VO2 A;  1KQS B;  1E79 A;  4WZL A;  2C4T A;  3CCJ B;  1VQN B;  2DIE A;  1W0K A;  3AVT A;  2VJI A;  4H9G A;  1N05 A;  3H9N A;  4X7F A;  2ZBU A;  1W34 A;  3CMM A;  1PJ7 A;  2E1R A;  2YWE A;  2F1M A;  1UD2 A;  3AVY A;  4Z4W A;  1XFO A;  4R71 A;  2CW5 A;  2GK6 A;  2D74 A;  1KK2 A;  4Z4U A;  1R5B A;  1VLO A;  1E1R A;  2ZXH A;  5J35 A;  1PJ5 A;  2J7K A;  3WBJ A;  3ASS A;  5GV7 A;  4DNR B;  5IYP A;  4RD6 A;  1FRQ A;  5CDF A;  4ZCM A;  4L8J A;  3CCM B;  1K8A D;  3I56 B;  5A8A A;  3CXC B;  1OGJ A;  4PC2 A;  1WOO A;  2JN9 A;  4XLC A;  2QTZ A;  1N06 A;  4PC7 A;  3A8K A;  3GVJ A;  4RD1 A;  1YJ9 B;  4ZCI A;  4QVA A;  3U2Q A;  1EXM A;  2DCU A;  5IYR A;  4FXU A;  1AMO A;  1KK0 A;  2R6H A;  1R5O A;  2ZTG A;  1QH0 A;  1V5V A;  2JDI A;  1YIJ B;  2JJ2 A;  2JJ1 A;  1R5N A;  3D26 A;  4NNJ A;  4YAO A;  5EMN A;  3CC4 B;  3R6J A;  4AVZ A;  1QFZ A;  3A8I A;  4XD7 A;  1FNC A;  1QVF B;  4B48 A;  2BGI A;  1BMF A;  3OOC A;  4YEL A;  4B3X A;  1VF7 A;  4AF6 A;  1F20 A;  3QFS A;  3ZZT A;  3U6B A;  4NBS A;  4TMW A;  1NRK A;  4XOR A;  4UZF A;  2D9R A;  1E63 A;  2FX3 A;  4JMQ A;  3CES A;  4LBW A;  4AC9 A;  3CC7 B;  1VQM B;  4BPR A;  1ZM3 A;  4UAJ A;  4XL9 A;  5THX A;  1VQ9 B;  4AF7 A;  2QEX B;  5FO0 A;  3BQJ A;  4GQN A;  3VO1 A;  1QVG B;  2WZP P;  4B47 A;  1A8P A;  3A1P A;  5KSW B;  1YJW B;  2BVN A;  3FJO A;  1E3X A;  4X7D A;  1UD6 A;  4YAU A;  1OB0 A;  4FWT A;  5L46 A;  2V31 A;  2DEU A;  4B4D A;  4KKU A;  4X8I A;  4LBY A;  4WZT A;  2LZJ A;  4RDJ A;  1IHM A;  1VQL B;  1YX2 A;  2CC2 A;  2VNJ A;  4X7E A;  1W0J A;  3BCD A;  3GVK A;  3RY8 A;  4UZU A;  2XND A;  4PC1 A;  4U9U A;  4Y9R A;  1WSR A;  4HE5 A;  2B7C A;  2QDX A;  4TSF A;  3OKX A;  3W2G A;  2XNC A;  3B82 A;  1XB2 A;  4G1B A;  4QHY A;  2C4U A;  3AST A;  2QMU A;  1XQB A;  3A3G A;  1V0E A;  1MAB A;  4WWV A; 
#chains in the Genus database with same CATH homology
 4WZL A;  4X7C A;  3ASR A;  4X05 A;  3ONU A;  4ROX A;  4X7F A;  3Q6R A;  4QVJ A;  3ONY A;  5IYN A;  2ZL6 A;  4Z4W A;  2ZL5 A;  4Z4U A;  3Q6Q A;  5BSY A;  5J35 A;  3LQE A;  3BY1 A;  3ASS A;  5E6T A;  4Z4V A;  5IYP A;  4X06 A;  5F4O A;  4WZE A;  3Q38 A;  3SEJ A;  4OOV A;  3Q39 A;  4QVA A;  3Q3A A;  4Z4Y A;  5IYR A;  4RPB A;  2OBS A;  3PUM A;  3SJP A;  4P3I A;  3D26 A;  3R6J A;  4Z4R A;  3SLD A;  3PVD A;  4OP7 A;  4WZK A;  3PA2 A;  4QV2 A;  4OOX A;  4P1V A;  4RPD A;  4P25 A;  2OBT A;  3PA1 A;  3PUN A;  5HZA A;  4Z4T A;  2ZL7 A;  3R6K A;  4OPO A;  3SLN A;  4RLZ A;  4QUZ A;  5F4M A;  3BQJ A;  4P26 A;  4Z4Z A;  4OOS A;  5KW9 A;  5IYQ A;  4X7D A;  4X07 A;  3ASP A;  4Z4S A;  3SKB A;  5HZB A;  4RDJ A;  1IHM A;  5F4J A;  4X7E A;  4P2N A;  4P12 A;  3RY8 A;  4OPV A;  5J3O A;  3ASQ A;  4OPS A;  4RDL A;  4X0C A;  3LQ6 A;  2OBR A;  5IYW A;  4RM0 A;  3V7A A;  5BSX A;  3BY2 A;  4RDK A;  3AST A;  4WZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...