4RQFA

Human seryl-trna synthetase dimer complexed with one molecule of trnasec
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
475
structure length
451
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTMMDKVEFVHMLNATMCATTRTICAILENYQTKKGITVPEKLKEFMPPGLQELIPFVKPAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
molecule keywords selenocysteine tRNA
total genus 130
structure length 451
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqfA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqfA02
4YRFA 3R07A 3IALA 2CJAA 2FYKA 3QO5A 4J15A 1B8AA 1BIAA 3IG2A 1ASYA 4WJ4A 2ZT8A 3IKMB 2ZNJA 1NJ1A 4WJ3M 4XU3A 4XTVA 3REXA 1FYFA 1WPYA 1SERA 4WI1A 1PYSB 4O2DA 1YB3A 1QE0A 3HRIA 4XEOA 4YRGA 1Z7MA 3L1AA 3HFZB 2EWNA 5E3IA 2ZNIA 3LSQA 4H2VA 5C53B 2IY5B 5KNNA 1X2GA 1EIYB 4H2WA 4H2XB 2ZR3A 4P3PA 3VQXA 2AMCB 2ZR2A 4P73C 3UGTA 4YDQA 4YRSA 3NENA 3G1ZA 4YRTA 4HVCA 3HFZA 5ELOA 1G5HA 1VQZA 4CH3A 3MEYA 3RF1A 3ICAA 3W3SA 2ALYB 3V7SA 4P74C 1USYA 4NCXA 3UFGA 3VBBA 4P75A 2AMCA 3E9HA 1WQWA 2C8MA 5ELNA 4HWOA 4YP0A 1HXDA 2ZZEA 2ARSA 3A7RA 3RACA 4CS2A 3I7FA 3QO8A 4LNSA 3HFVA 4RQFA 3TEGA 4KR3A 3L4GA 4YRMA 1YGBA 3BJUA 3DSQA 1X56A 4P72A 2G4CA 3P8YA 2I4NA 5HGQA 3HXZA 3RIRA 2QHVA 4YRCA 2RHQB 2ZINA 4PG3A 4P73A 3V7RA 3RGLA 4UPAA 4H2XA 3LSSA 4K86A 3HXXA 1NJ6A 4RQEA 4KQEA 2P5IA 3BFMA 3HXWA 4P75C 1KOGA 3FJPA 2DTHA 4E51A 4AH6A 3RKYA 2DQ3A 1PYSA 4PHCA 2E1HA 4TVAA 4TQFA 1L0WA 1WYDA 2ARTA 5C52B 4UP9A 4EO4A 3A7UA 1ATIA 1NYRA 4XU2A 4L87A 1X55A 4WF2A 4XTYA 2DTIA 1B76A 5F5WA 4TVAB 2DXTA 1BBWA 4X5OA 3E9IA 4HWSA 3TUPA 3HRKA 4XTXA 2CGHA 2DKGA 3A5ZA 3A74A 1QF6A 2RHQA 1RIQA 4TVYA 1HC7A 2DEQA 4RMFA 4Q15A 2Q7EA 1X54A 1J5WA 1SRYA 3V7CA 4H2SA 2E41A 3PCOA 2ZCEA 1EQRA 1EIYA 2E3CA 2Q7GA 4CS3A 1USYC 3CMQA 3M4QA 1WQ7A 3HY0A 1NYQA 2ARUA 1NNHA 5C51B 1G51A 1Z7NA 2HNIA 1E24A 4ZTUB 2CJ9A 2AKWB 2P0LA 2ODRD 4DQ2A 1BBUA 1NJ5A 1EFWA 2I4LA 4P72C 1C0AA 1B70B 2DJZA 4UP8A 2I4OA 3RL6A 3HXVA 1B7YA 1NJ8A 2ZTGA 2ZT6A 4OLFA 2DZCA 3VQVA 2DVEA 4G84A 2DDZA 4HWPA 1E1OA 4XTWA 2ZIOA 2EJ9A 3A7AA 3VQWA 4CH6A 1ASZA 1B7YB 1YFRA 4G85A 4ZTZB 4TVWA 3A5YA 4EX5A 2DZ9A 4UP7A 2DQ0A 3L2ZA 3REUA 4P71C 2E10A 2I4MA 3QNEA 4KR2A 4YRKA 1W66A 2Q5IA 3MF2A 2E65A 4P71A 2ZT5A 4BW9A 2J3MA 3MF1A 4YRQA 1WLEA 4CH4A 1KMNA 1WU7A 4P3NA 3A32A 2EJFA 1IL2A 2DXUA 2EAYA 3HTZA 1B70A 2Q7HA 4ZIBA 4BWAA 4YPFA 4YRJA 1X01A 3ERRA 4CH5A 4K87A 4HWTA 1BIBA 1HTTA 2CJBA 4H2UA 2RHSA 3V8KA 2DU5A 3LC0A 4DPGA 5K1XA 4YRPA 4HA8A 1N9WA 1H4VB 3V8LA 4TWAA 2Q5HA 1H4QA 1EOVA 3EFRA 1H4SA 2ZGWA 2QHSA 3NETA 4CS4A 4YRRA 2EL9A 2E64A 3RUXA 3TEHB 3WQZA 4XU0A 1LYLA 1JJCB 2QHTA 2ZXFA 3PCOB 2E5AA 4YCWA 3UGQA 3NEMA 2DTOA 2J3LA 3QTCA 2IY5A 3NELA 4YREA 1X2HA 2EJGA 4K88A 11ASA 1E1TA 3A31A 4HWRA 4YRNA 1G5IA 3TEHA 3QO7A 4Q6GA 1JJCA 4YCVA 3EFSA 3RKWA 1ADYA 2AKWA 1SETA 4H02A 3V8JA 1YFTA 4OP0A 4XU1A 4P3OA 2ALYA 2RHSB 1GGMA 4YCUA 3HXUA 4YRLA 4P74A 5K1PA 2CIMA 4XTZA 3IKLA 2QHUA 4YROA 2C7IA 3UH0A 3M4PA 2DU7A 4H2YA 3RKXA 2ZZFA 3L4GB 3HY1A 4TQDA 3P8VA 2XTIA 4RDXA 4XTUA 3OD1A 1YFSA 2XGTA 2PMEA 3PZCA 4XEMA 1KMMA 3VQYA 2ZIMA 2PMFA 1NJ2A 4H2TA 3HXYA 1E22A 1SESA 3KFUA 1WNLA 4YYEA 12ASA 4YRIA 1EVLA 1ADJA 2ODRC 3P8TA 4TTVA 1H4TA 1EVKA 2ZT7A 2ZZGA
chains in the Genus database with same CATH superfamily
4R6ZA 1FD9A 1XL4A 3SPGA 2FYKA 4J15A 3SJCC 3AEIA 3CCRV 3OTOB 1ASYA 2ZT8A 4OX9B 4O4IB 4D7SA 1OCOC 4FFBB 3IKMB 2CK3G 3DC5A 4FLUA 3D36A 1N33B 5KHHA 4XTVA 5J2UA 4DV7B 1OCOB 5KX5B 2E75B 4JI5O 3E35A 1S5HC 2Q0AA 3CCLV 3EVKA 4YRGA 5IWAO 1Q5OA 1FXKA 1Z7MA 3L1AA 2GV9A 1K4CC 3LSQA 4H2VA 2IY5B 4UV8A 4GCZA 2IBZH 1DGSA 4H2XB 3K59A 5KAFZ 4DV4O 1VQPV 3VQXA 4EKWA 4P73C 2LO1A 3UGTA 2NNUA 3NENA 3APQA 3L71H 1WB8A 1J5EB 2BSKB 2Y4TA 1NR1A 1OHHG 1G5HA 4DW1A 2HVKC 3CC7V 1GN4A 3RF1A 3UT5A 3OD4A 2P90A 3SJQC 2ALYB 3E8HA 2ADPA 3VBBA 3CE2A 4LF9B 3CMAV 3CJHA 3RYIA 5ELNA 2ZZEA 1WA8A 4HNAA 2M6YA 1XNQO 4PA3A 1TVKA 2ZKOA 2JK5C 1ROPA 1GM7A 2Q73A 2FL4A 1NI8A 2VWJA 2AHZA 5DM6V 3P8YA 1RP3B 5HGQA 4MTOA 2QTSA 1R73A 3DGEA 5LGTA 3GB7C 4PG3A 4FK5C 4X64O 2LW1A 1K33A 3TXSA 2N74A 1R6NA 4K86A 3T1HO 4PHZA 3HXXA 1RPRA 4DV4B 2BOCC 4KQEA 4HAMA 4WFFA 1G8MA 2XOKG 3IC9A 3K3WA 1MOFA 4QE7A 3FJPA 2E74B 2R72A 2CGOA 4J7KA 4MT8A 4E51A 5KX5A 4LF6B 1PYSA 4ZOLA 4WBNB 4TVAA 4JI5B 3ZRWB 3BRCA 3K04A 5GONB 1NYRA 3FAVA 1GTOA 5B1BB 3B2EE 4PA6A 4XU2A 2AZ2A 3U0ZA 1Z5WA 2YC0A 2OWOA 3ZHVA 4IIJB 1XMOB 4FM0A 3ZMZA 2CTQA 3SJBC 1B76A 3W7TA 3E8GA 1YI2V 3OTOO 4DV1B 2UUBB 1FXHA 3E9IA 1XBLA 1XHZA 4NTXA 1PD3A 3TUPA 2YEVB 5J2TA 2HHHO 3A74A 2JGDB 4TV9A 2Z5UA 4TVYA 1HC7A 1WJZA 2WLIB 1SS3A 3IGAC 1QLNA 2B9ZA 2QSAA 1NTKH 3ASNB 4I55B 5BR8B 1J5WA 1H38A 1NZ6A 2P22C 1JPXA 4PDRA 2H94A 3OMIB 4BR6A 2Q9LA 1YDXA 4GX0A 4O2BA 2E41A 1K3EA 3PCOA 2R9AA 4KHPB 2RNBA 3ZMSA 4I0XA 3I55V 1EIYA 2WLIA 5KHJA 3CCEV 3M4QA 2UXDO 1JA8A 1XMQB 4BW5A 4UVCA 4J80A 2ZQMA 1JR9A 4JGSA 2ZXWB 2WLKA 1MA1A 2Z0AA 4PV1B 4ZTUB 1ENVA 3WG7C 5KMGA 2CJ9A 4OGQB 1KD1W 3OM3B 1MABG 3IC7A 1GM8A 2YI8A 3MD0A 1YXBA 1XDCA 3OW2U 3ABLB 4G28B 1D2DA 1XHXA 4X89A 3RL6A 3HKEA 2P5OA 4DV2O 3E22A 1CEZA 2ZTGA 4JPRA 1KBHA 2KQXA 1NJIW 2YIBA 4H13B 3IAYA 4MVRA 1VQNV 3VOUA 4HWPA 2XAQA 1K4DC 3DXRA 4XTWA 4B3RB 1VIBA 5LOVB 5B1AC 4AHCA 1ASZA 4UXNA 1B7YB 2ODMA 1Y76A 4G85A 2KB1A 3CHXA 3TXQA 2QWOB 4ZTZB 3JCUZ 2ZDIA 3SYPA 1JJOA 3A5YA 1AI4A 1EFRG 2JIZG 4B7EA 4UP7A 3L2ZA 1SKVA 3JD2A 1NVPD 4P71C 4MW8A 4DV1O 2UUBO 3HPLC 4YRKA 2F95B 1T5EA 4DR7B 1WN7A 3QG5A 4JI8B 1YEWA 1XMOO 4P71A 4GKJO 2J3MA 5H2FZ 4P3NA 4DRXB 2JEUA 1G1XB 3J81N 1TUEB 4BWAA 4YRJA 1X01A 3UKMA 4DYLA 4JI1B 4AI8A 5JQGB 4HWTA 1P49A 1COWG 4I0XB 4DR3B 4JI1O 1M56B 5JH7B 2V1DA 2DU5A 3SYAA 3LC0A 2QGNA 1BS3A 2Y69C 4X66O 1PNLA 5IYBO 2PGGA 3IJ4A 5LP6A 4DR2O 3KCYA 4MVZA 1H4VB 1H4QA 3EFRA 1H4SA 2ZGWA 1H8EG 4F6RA 1HW7A 2E64A 2OIEA 1DF4A 4PI2A 4XU0A 1M93A 1ZTEA 3LNNA 4UB8Z 2E5AA 4YCWA 1UPGA 3UGQA 5LP6B 4MSWC 4E2LA 3NELA 1M5IA 4TT3G 1OCRC 2LQTA 4K88A 2YUAA 4UCVA 1E1TA 3CCMV 4YJ2B 2B1IA 1THZA 3RGBA 3QO7A 3WFVA 4Q6GA 4F4LA 4FZ0A 2QKAA 4FLVA 2Q67A 5GTHZ 1PL0A 1F4MA 4NXMB 3EFSA 3RKWA 3FD9A 2AKWA 2Q4PA 1SETA 3V8JA 4WF9V 2ALYA 5HFMA 2RHSB 1NS1A 2XHBA 4YRLA 2EJ7A 1J5EO 5K1PA 4LVKA 5D5PA 2JJ1G 4XTZA 1BHAA 5JJJB 4B3MB 1R6KA 4YROA 5H6QA 5FLXN 4JI2O 3ASOC 4H37A 3UH0A 2AXTZ 2DU7A 3RKXA 3WB0A 4FFKA 3P3PA 4TQDA 1EN5A 1I0HA 4ICGA 2QA4V 3DTUB 1HNXO 3CCVV 3L9DA 4QJFB 1GH6A 5CBFA 3OD1A 4YJ3A 1URFA 4J9YB 2EIJB 5LGNA 2R9RB 1XNRO 3K58A 2YXLA 5F2VO 1AP5A 4YIPA 3ASNC 3ABKB 1IBLO 4XEMA 5H6RA 2CH7B 1W0JG 4D7TA 5FNVA 4RAIA 4H2TA 1K97A 1HR0B 3K0GA 1TA8A 2EZPA 4PDMA 1WNLA 3KFUA 4N23A 4MW3A 4K0KB 4YRIA 1WB7A 3H1JH 1ADJA 3F7VC 2ODRC 5IE9A 2CH7A 3K5MA 5CA0B 4TUYB 3FAVB 1N34O 4DUYB 3JASA 2ZM6B 2PI5A 4YRFA 3R07A 2A9HA 2DYRB 2IJHA 1N36O 3IG2A 1MZFA 2P7TC 1Q6IA 1Q82W 5EK0A 4HNAB 2ZNJA 5EBWC 4WJ3M 2OTLV 4XU3A 1SZTA 2A7WA 2FB5A 3AG7A 3B8NA 1EZVH 3A0HZ 3BEHA 3ASOB 2L35A 3SPIA 1H2MA 2QM4A 4O2DA 1YB3A 1U96A 3ABTA 2Q68A 3HFZB 1HNZO 4JI6B 1B06A 2EWNA 2ZNIA 3CP1A 1EIYB 1AROP 2DE0X 3J80N 1PKXA 4P3PA 1S5JA 2D3OW 3H01A 4YDQA 2JGUA 2F4VB 3G6BA 2HVJC 4O4LB 4YRTA 5BZBA 3CEIA 3OE7G 5LHHA 1XREA 2VQEO 4U3FH 3MEYA 3H9VA 3V7SA 1XOUA 4WBNA 5LYJB 3B8MA 2WA3A 2AMCA 3E9HA 5ITZB 3CCJV 1WQWA 2F93B 1YJNV 2C8MA 3JALB 4X20A 1Y66A 2DYSC 4CS2A 1JFFA 4R50A 3ETDA 4NTYA 4LCUC 3QO8A 1N0NA 2UXBB 3OUFA 4LNSA 1B04A 4WCEV 3HFVA 4WFHA 4LF4O 4LF7B 2X7RB 3CXCU 3RVZA 5BXZA 3BJUA 3DSQA 2FYUH 4X1KB 1JX9A 1R3LC 4K8ZA 1K5QA 4GX2A 3HXZA 3CXHF 1FXKB 5CBHA 1Y76B 1KQSU 2QHVA 1R3JC 3TETA 3D3IA 4QPKA 5IY5B 4LNUB 3V7RA 3FYIB 1SZXA 1SA0A 2ZE7A 1V55B 2A06H 1IVSA 4LFCB 4H2XA 4MVMA 4FLXA 2EJRA 1NJ6A 4RQEA 2X6BA 1S77D 1VMGA 2JS5A 2EZOA 1YZBA 3M8AA 1KOGA 4JV5B 1N33O 4WFAV 2HFEC 3UT5B 2DTHA 3SPHA 1IBMB 4AH6A 1V9PA 2DQ3A 3RKYA 4PHCA 1AR1B 4LF4B 1H2LA 4JZGA 4KUMA 1L0WA 2VQEB 2ARTA 3H1LH 1HP8A 2F4VO 5JH7A 2NLJC 1MMMA 3UO2A 1MG1A 5CMUA 2WLNA 4I5SA 3A8TA 4GLXA 3ABMB 1VP7A 5DEDA 3ZHSA 4HWSA 2WLJA 3HRKA 2GTAA 1QF6A 5LMNB 4DV3B 1L0LH 2RHQA 2O57A 2QJ1A 1GO3F 4UVBA 2DEQA 1AJPA 2HR3A 3ETQA 2PI4A 2AGAA 3EHBB 3BAAA 3RYFA 4I4TA 3V7CA 4H2SA 4JI6O 2RMKB 2ZCEA 2IU0A 4I9WA 4X1YB 4QE9A 2K1EA 5IJ0B 2G38A 1M9NA 3ZIAG 1K9MW 4CS3A 3PJSK 2XAFA 1KKDA 4J41A 1KUQA 1AJQA 4U3JA 2DOSA 1M56C 4YXWG 3H1IH 4YIOA 1AI5A 2HNIA 2XTAA 2P0LA 3R66A 1YIJV 2ODRD 1OCZC 3JAWA 3JYCA 4LVMA 5TISZ 4P72C 3SR2C 3HKDB 3ZHQA 1IBKO 2DJZA 1AI7A 1NTMH 1N34B 4LC1A 4KXRA 4O4HA 4OLFA 1N8RW 2DZCA 4JYAB 3VQVA 4JZ2A 3G4SV 2YSUB 3FB5C 1IBMO 1VF6C 1L0NH 4MTFA 1Y74A 1XNRB 3HKDA 3VQWA 4CH6A 1S0VA 1VQ7V 2RJZA 1FFXA 2F23A 3TJTA 4I50B 2DQ0A 3JCZA 3QF7A 3REUA 3ABKC 2I4MA 4KR2A 1NBMG 4FLYA 4IYIA 2Q5IA 2EIKC 4DR6B 1DTOA 4BW9A 4YRQA 3W7UA 2CTWA 4LFCO 2HP8A 1KMNA 3JATA 1WU7A 2B5UA 2EJFA 3LDEA 5H5NA 3KKYA 4LH6A 3X2QB 4EEQA 1SQFA 2Q5ZA 3CRAA 4R8CA 3HTZA 1B70A 1P4RA 1LNQA 1SQVH 3JD3A 5EYPB 4I4TB 3ZRWA 1K34A 4CH5A 5A2QN 2OT5A 3E22B 4ABMA 1JQ0A 2XNDG 3KG2A 5B1BC 3B77A 1RM1C 4H2UA 3U11A 1VQMV 3V8KA 4W4LA 1BGYH 3WG7B 3A0BZ 2JRIA 3CS5A 2UXBO 2QKCA 4U3JB 1O9GA 4NXMO 3U10A 4GKKO 4GX1A 2F43G 2LGWA 4ZHQB 2ITCC 3RBZA 4LWSA 1P7BA 4X9QA 1FFTB 4UV9A 4MVUA 4XDLA 1EOVA 3C3SA 1AI6A 2Q0OC 2X0LA 4CS4A 4KFMA 3NETA 3BHPA 2VS0A 2PTMA 3L74H 3W7WA 4OPAA 3TEHB 1I94O 1LYLA 4JASA 3ZHTA 1D5AA 3CYOA 4JI0O 2QHTA 2ZXFA 5KUKA 2AHYA 3NEMA 1N4CA 1S5LZ 2J3LA 3CC2V 4YY3O 2E5LB 2CUGA 4BAYA 4P9OA 3RN4A 4X62O 5B3SC 4I9QA 11ASA 1BQZA 4JI4B 4YRNA 2KSDA 3HB3B 5LXTB 3E83A 1HNZB 3ZBHA 1JJCA 2QKSA 3HKBB 1YFTA 4PDLA 4U7OA 5IYCO 4P3OA 1YHQV 2Y48A 1GGMA 2D2CB 3RYHB 5LHIA 4AILC 1FS0G 3P3NA 5L3CA 1NH2D 3AK2A 5LYJA 1W59A 4DR3O 3ZMTA 3IKLA 1VQ8V 1M4UA 2EINC 3JASB 2F1MA 2YIBD 1H8HG 3SYOA 3FKSG 2XT9A 3ZRSA 4LFBB 4K0KO 4DW0A 3P8VA 3EFFK 2RN9A 5CBGA 3N2GB 4D6TH 5KA6A 3K5LA 1HR0O 1QBZA 4XTUA 3L72H 1U97A 4GX5A 2FKXA 1NQTA 3A2FA 4DR7O 4NXNB 1YFSA 4HYOA 3RW0A 1S72V 1IBLB 4B3RO 2XGTA 4LVJA 4B3TB 4J7JA 4JI7O 2LP7A 3JD4A 4G27B 1H2SB 3T4ZA 2PMEA 2HG5C 1FXVA 3BA9A 1Q90D 5AG2A 2ETNA 3VQYA 1MZEA 3CSXA 2ZE5A 5C8YB 3O9OA 5EIBD 3RFRA 1BMFG 1CXZB 4JI3O 3HXYA 2BE3A 1QQCA 1KECA 5JJNB 1LR1A 2R70A 4YYEA 12ASA 4X1IB 2ARHA 1Q7YW 3ML0A 3TK1A 4UVAA 4OXSA 2Y4UA 2YDEA 3P8TA 2XUMA 2JS3A 2ZXWC 3SYCA 4DR5O 4DV2B 3BABA 2UU9B 1HNXB 3FB6C 2W6IG 1B8AA 4ZKIA 1BIAA 2LFSA 1B6QA 3LDCA 4WJ4A 2N04A 4KL1A 1ZWIC 5KUMA 4O4JA 4BIUA 5B1AB 3N2KB 1VF5B 1XI1A 4J10A 3REXA 3GWOA 1FYFA 1WPYA 4DK1A 1QU7A 1WP7A 2UXDB 1SERA 4WI1A 1PYSB 2KG7A 1R3KC 2WLLA 1QE0A 3HRIA 2A79B 2W0XA 3RYFB 5FNVB 4O4JB 4JI7B 4B3TO 2Q8VA 5E3IA 4HT4A 2QDOA 4B08A 3FFQA 5BR8O 5KNNA 3JD0A 5A9GA 4H2WA 1OCRB 4FIPC 3UQ8A 4RUFA 2DWEC 4B3SO 2ZR2A 4DR2B 4DO2A 4JAUA 1O9HA 5LA6A 1RSOB 4JAAA 3G1ZA 5CA0A 1R6TA 4B7KA 4HVCA 4G2KA 5ELOA 4LFBO 2VWKA 2AW9A 3CRQA 1VQZA 1GAXA 5IDJA 3ICAA 1R3IC 1YJWV 4ZI7B 3STLC 4P74C 1USYA 4NCXA 3H1KH 4P75A 2HEPA 4TV8A 1PV0A 4LFAB 4RUEA 4O2BB 4YP0A 3A7RA 3RACA 1OCCB 1TUBB 1DLBA 3KCXA 2DWDC 4KR3A 4X1IA 3WU2Z 1GKFA 4YRMA 3FB7C 5CA1A 1YGBA 5JCOC 3LNMB 3MQZA 2G4CA 2I4NA 4GKJB 4UCOA 4U7NA 1NT2B 4X62B 2BCCH 4LR3A 1E1QG 5EBMC 4YRCA 2RHQB 3OGCC 4W4KA 2LFRA 3AK3A 4QIWF 2BTQB 3RGLA 3RT3C 4TWKA 1RFYA 5CA1B 3L75H 4B3SB 1QVFU 3SDLA 4CC5A 3CX5F 4DV0B 2WPDG 3K0DA 4JI8O 1S3JA 4Z2WA 1VQ9V 2P5IA 1P84F 4X1YA 3KZIZ 3BFMA 3HXWA 5LP6C 4NVPA 1MSWD 4P75C 2IW5A 4NKGB 2OTJV 2C2AA 5JVDB 1VF7A 3S3XA 3MAQA 5DECA 2B1GA 4IHJB 3B40A 4LBEC 3ZN0A 1FYJA 1WYDA 4EO4A 5ITZA 1XNQB 5J2TB 1ATIA 3T2MA 3OAAG 5JCOA 3S3WA 2DW4A 3JAWB 1M1KW 1JVMA 4LF9O 4WF2A 4X88A 4XTYA 4I55A 3BVOA 1VQKV 1NVPB 3SYQA 3RYCB 2DTIA 2BOBC 4J42A 5F5WA 4BIZA 4IHJA 2XASA 4PD4F 4JF3A 5L3FA 4TVAB 1F4NA 5LA6B 3JSNA 1VQ5V 3K06A 1UJWB 2QEXV 2IJIA 4O4HB 2CGHA 5GONA 5IWAB 2UU9O 1YITV 1MNGA 4MVSA 2EILC 3ZN1A 1QCEA 4IIJA 1DF5A 1Y74B 3K08A 4PI0A 1YVWA 5LL6Y 3B4SA 1IX9A 1SRYA 5EZYA 1TGOA 4NB5A 5EBLC 2LW7A 5E79Z 4UCUA 1XMQO 4JI3B 2OCCC 2V4DA 1EQRA 3MHSC 4I50A 2UUAO 1FXKC 2Q7GA 1WQ7A 2GHYA 1WAZA 2GUZA 2YI9A 3OTFA 2HHHB 4KHPO 3CWBH 3OR7C 5C51B 4ZBMA 2R9IA 2Y69B 1D5NA 1JOYA 1E24A 1XEQA 2FTKA 2KKWA 4K35A 4OX9O 1FJGB 2MK3A 1FJGO 3T1YO 3H1HH 4DQ2A 2N05A 2EIMB 2DYRC 1EFWA 4DXWA 3OEEG 2AZ0A 1K5SA 1C0AA 1B70B 2I4OA 1Y67A 5LMUO 1B7YA 1NJ8A 2NR5A 4LP8A 2OYQA 1OCCC 1CP9A 2ZT6A 2IU3A 2RQ6A 1Q6UA 4G84A 2LGQA 4DUZB 2NS6A 1AVMA 3K9AA 4BIOA 1E1OA 2ZIOA 2EJ9A 1AR5A 3P32A 3ETGA 4YJ2A 3A7AA 1M57B 1RPOA 4UCSA 4PA7A 1YFRA 4MS2A 1BZKA 4FZ1A 5CB4B 4LF5B 3T1HB 4LF6O 2V7QG 2HKOA 2EBOA 4EX5A 4FM2A 2FMLA 2YICA 1IXMA 3STZC 2ILMA 1PNMA 1G4YB 2E10A 2DJVA 4KP4A 1Q3EA 4RO2A 1I7FA 1ZAUA 1US6A 1Q86W 1G6UA 3E8BA 5BY1A 3JD1A 2YXHA 2ZT5A 5C93A 1B3QA 3ZJZA 3MF1A 5GTIZ 5CB4A 1WLEA 4CH4A 3A32A 3CRCA 3JAKA 1IL2A 4JI0B 1WNSA 3UO3A 2UXCO 5E1AC 3AG1B 1RM1B 2P06A 4YPFA 4JYCA 2QE7G 4YJ3B 3ERRA 4XBFA 2F66C 5IYDO 1BIBA 4JTDB 2QWPB 2UUCO 4DPGA 4GKKB 3OUSA 3ICXA 2CDYA 4YRPA 4UB6Z 4DV0O 2GUZB 2YXYA 1BE3H 3ABMC 3T1CA 1ZUQA 4EFEA 5IJ9A 1Q81W 3ABLC 2XAGA 1QLEB 5GW7A 1BT8A 3FB8C 4PA9A 4IYHA 1P7GA 2PYJA 3F5WC 2QHSA 2WWWA 2QWRB 3CCQV 2IJJA 3N2GA 4CBCA 2YIDA 2EL9A 2WLHA 3OR6C 3C90A 1E1RG 4LH7A 2ZD9A 5B3SB 3JSLA 1ZX3A 2DTOA 2CTRA 4PDVA 3BFRA 2IY5A 1M57C 3ZX6A 2PF4E 3I5DA 1V55C 2Y0PA 4X65O 2EJGA 1J95A 4XDKA 1GM9A 3A31A 3DXRB 5L3BA 4LFAO 4HWRA 4P2ZA 3I56V 1AJNA 5LOVA 2QWQB 5EYPA 4FMTA 4DUZO 3W7SA 4YCVA 1YTFB 4XU1A 4L8JA 3CB2A 4YCUA 4AQYO 3BPZA 1SQQH 4P74A 5LMUB 3M7MX 1XL6A 2CIMA 4E4EA 2CTPA 1SQXH 3CRRA 1QR8A 2C7IA 3T1YB 2A8EA 1BQ0A 2QTOA 4JYAO 3M4PA 1TVKB 1TUBA 5KLVH 2RCVA 3HY1A 3BA8A 3O65A 4EB6B 4PA4A 4DV5O 1YJ9V 4DR1O 3P30A 3N2KA 3CMEV 4O2AA 4MVQA 2UUAB 4LVIA 2UXXA 1PL4A 3ZCCA 4FLZA 4C7UA 1AB3A 1I5YA 4HBNA 4CZZA 3WB1A 4EB6A 3LSUA 1IZ3A 2ZIMA 1VQ4V 4JYYA 1KP2A 4NTWA 4XDJA 2PMFA 1H2NA 4X20B 3ZMVA 2EIKB 4O2AB 3G6EV 3AG4C 5L3GA 1SESA 2ZT9B 4DV6B 4LF8B 5JVDA 3A0RA 3ZRXA 2WLMA 3F7YC 3G80A 3PN1A 2DYSB 3RYHA 3K5NA 1R1BA 3AG4B 3Q4HA 1QVGU 5B66Z 2M7WA 2ZE8A 5LHGA 4YHHB 1EVKA 5JJEB 1SC5B 2NN4A 4IT5A 4UCTA 3ZMUA 3SPJA 2ZDIC 1V54B 4IL6Z 3IALA 2CJAA 3QO5A 4ZI7A 3OGIB 1N32B 2OIGA 5KHKA 1V54C 4ASUG 5IYZB 1L1FA 1NJ1A 5FPRA 1WPXA 2JVDA 4UCRA 4TUYA 2JGDA 1Y6XA 4DR4B 1BCCH 4NXNO 1VEWA 3BCCH 1SF9A 1EN4A 4FM1A 1NH2B 3K57A 1GMGA 4XEOA 4FVMA 3K03A 5EZYB 3AG2C 2GTSA 4FLWA 1K7DA 5KAIZ 4LVLA 4JV5O 1IURA 1EZJA 1PP9H 4WFBV 1NTZH 5C53B 1L8DA 2BTQA 1X2GA 3ABUA 2X6CA 2H3OA 3AG2B 1FKAO 1S76D 3AG3C 2ZR3A 3DC6A 2AMCB 3AG1C 2EIJC 1X59A 1VARA 4YRSA 5LXTA 3CCUV 1VQOV 1JFFB 1BL8A 3HFZA 4CH3A 2K9PA 4P30A 1UFIA 1OCZB 3W3SA 4JI2B 1JJ2U 2QM7A 3D36C 3UFGA 1LUVA 4B3MO 5B1OA 5EC2C 4JI4O 4HWOA 1HXDA 2ARSA 4JTAB 4HZ3A 5IJ0A 3HKCA 3I7FA 4P9PA 4GYCB 2W6JG 2A3QA 4LNUA 1F7YA 1PPJH 4RQFA 1QLEC 4GZRB 1SA0B 3TEGA 3L4GA 2VQFO 1X56A 4P72A 1HDJA 3ZRVA 5JWPA 2WLLB 3Q4HB 3LDDA 2PUSA 4WFEA 1HWYA 4FLTA 3RIRA 1Q8IA 2YEVA 2BTOA 3TCUA 4TV9B 3UCSC 1YF2A 2WA4A 2ZINA 4P73A 2PZSA 1GN2A 2YS8A 2Z3YA 3OMAB 2E76B 3BY6A 4RWUA 4R7CA 3CPWU 3D3QA 2JDIG 4UPAA 3CRMA 2HJFC 2XAHA 3LSSA 4JYBA 3SJAC 2Q69A 3OT7A 4H33A 2ADQB 5IYZA 1QR9A 4J7ZA 3ZEDA 4MTGA 1KP3A 1MSDA 3G71V 4DRXA 2H8PC 2OCHA 3X2QC 2E1HA 4H44B 2DN9A 4TQFA 1BSMA 5LBQA 5C52B 4UP9A 4X66B 3A7UA 3K9SA 5KMGB 1HNWB 2EINB 3CCSV 1Q43A 4PELA 4L87A 1X55A 4DR5B 4DR6O 5KHGA 4H0LB 2LJ2A 2IH3C 2P67A 2WSSG 2DXTA 1BBWA 4X5OA 3HKEB 2EILB 1I5XA 4XTXA 2DKGA 3A5ZA 3RWRD 4IGGA 1NU1H 1RIQA 2ZM6O 1OV9A 4DUYO 2DMXA 3C3TA 4GT1A 1LUWA 5DN6G 2P4VA 2Y0IA 3R65A 4RMFA 4Q15A 2Q7EA 2KG7B 1X54A 2OCCB 1OZ0A 2GDSA 2IM9A 4TOIA 5D5QA 3ZS8C 2MW2B 2E3CA 1USYC 3CMQA 5EIBC 1ZL8B 1PNKA 1WP8A 3ETEA 4MTXA 1KC8W 4DR4O 3HY0A 1NYQA 4GUNA 2ARUA 1NNHA 1RSOA 1G51A 1Z7NA 2BSKA 4QGPA 3CC4V 1QHTA 3E89A 2AKWB 5B1NA 2P6JA 4UUJC 1BBUA 3GVMA 1NJ5A 2I4LA 2PY5A 1Y4MA 3HR0A 5L3EA 3OMNB 1A32A 1ZL8A 3RYCA 4UP8A 1TAEA 3CJHB 3RYIB 1GK9A 1HNWO 4DV6O 3HXVA 3THOA 5KHIA 3AK1A 3TGUH 4UFZA 1ORQC 4Z1VA 1X4TA 2DVEA 1N0JA 2JJ2G 4WFGA 1DK1A 2DDZA 3J7AU 1JMKC 1GRJA 1VQ6V 2EX3A 4F6EA 3GWKC 1H2KA 5IJ9B 3FYEB 4YY3B 2E5LO 1GN6A 3K5OA 3JATB 4TVWA 4F6RB 2DZ9A 2QR4A 1I08A 4NR1A 1I94B 3QNEA 3SPCA 1F51A 2IH1C 1IXBA 1ZLZA 2QWNB 4QPJA 4A5UB 1W66A 3MF2A 2HLDG 2E65A 3EXAA 4TSFG 4J9ZB 2X6AA 3ZHUA 4CC6A 3CD6V 1FFXB 2GBOA 4DV5B 3FX7A 1W2BU 2DXUA 3F5TA 3AG3B 5H9CA 4AQYB 1KMIZ 3QVNA 1EM1A 5J9PC 2EAYA 4ZOLB 2A0LA 3APOA 2Q7HA 4ZIBA 1PM9A 3W7XA 3OEHG 2CE4A 4LWSB 4J11A 4K87A 3OFNG 1HTTA 5BMVA 2YIAA 2VQFB 2CJBA 4Q20A 4I7ZB 2RHSA 2ZE6A 1KB9F 1E79G 5K1XA 4X65B 2GSMB 1WPBA 1BHBA 4FJCC 2XAJA 3N27A 4HA8A 1N9WA 1JCHA 1XQ8A 4JAVA 4OPHA 2EIMC 5IT9N 1SQPH 1SQBH 3V8LA 1EBOA 3E86A 2Q5HA 2L6LA 4TWAA 2P4KA 5BMVB 1NR7A 3E2EA 1H2GA 1VF6A 2W0FC 5KA5A 3L70H 1AP6A 4YRRA 1CPYA 3RUXA 3WQZA 3MDSA 4MVOA 1JJCB 3MHHC 3B09A 3E8FA 3PCOB 4K8XA 4LF7O 2PYLA 4X64B 1XUQA 3QTCA 1KKCA 4NYKA 4K3AA 4X8AA 5IY5C 3UM7A 4YREA 3L73H 4JTCB 1X2HA 1K8AW 1AR4A 5CA3A 1YCIA 1K73W 1XILA 5LGUA 5FL7G 1FPOA 5HFLA 2RDCA 4O4IA 1FAFA 1G5IA 4FFBA 1KU9A 3NR7A 3TEHA 1Z2GA 4N21A 1Z5VA 3K79A 5JQGA 1ADYA 2VRZA 1N32O 4H02A 4EFBA 4OP0A 1IDSA 5EC1C 5CN0A 3HXUA 2UXNA 4FPPA 2UUCB 5B5EZ 1IBKB 2QHUA 2Q6AA 3JALA 3SGIA 3LUTB 1M90W 4YHHO 1GN3A 1Q6HA 4DK0A 3HKCB 4H2YA 1QNMA 2CGNA 1YSCA 2ZZFA 3HKBA 5FPOA 3L4GB 3RVYA 2QM8A 2UXCB 2EULA 2ATKC 4X1KA 4LF8O 1ZSPA 3T4DA 1F23A 1K92A 3IFXA 2XTIA 3JARA 3D8CA 4RDXA 3WB2A 1YTFD 5L3DA 3G67A 4QNHB 2ITDC 3ZHRA 1AILA 1OJHA 3PZCA 2CAZC 1KMMA 4TV8B 1W0KG 2IJKA 4LF5O 3JARB 1NJ2A 1EN6A 1WA8B 3NXSA 2WAMA 1N36B 4Z1MG 4ZHQA 4DV7O 1E22A 4DR1B 2HJDA 4DV3O 5LMNO 1SQGA 3JAKB 1KYOF 3M99B 3JAMN 1EVLA 4TTVA 1VQLV 2JEXA 1H4TA 4O4LA 5C8YA 4PJ0Z 2ZT7A 2ZZGA 1NKDA 5J2UB
chains in the Genus database with same CATH topology
4YRFA 4R6ZA 2ZDIC 1V54B 3R07A 1XL4A 3SPGA 2CJAA 2FYKA 3IALA 3QO5A 2A9HA 2DYRB 2W6IG 4J15A 1B8AA 4ZKIA 2IJHA 1BIAA 2LFSA 3IG2A 1B6QA 3AEIA 3CCRV 1ASYA 2P7TC 3LDCA 4WJ4A 1Q82W 2ZT8A 5EK0A 1ZWIC 1V54C 4ASUG 5KUMA 1OCOC 4BIUA 3IKMB 2CK3G 5B1AB 5EBWC 1L1FA 2ZNJA 1NJ1A 4WJ3M 3D36A 1WPXA 2OTLV 4XU3A 1SZTA 4XTVA 3REXA 3GWOA 1FYFA 3B8NA 1WPYA 1OCOB 3BEHA 1SERA 4WI1A 3ASOB 3SPIA 1PYSB 3E35A 1S5HC 4O2DA 3CCLV 1NH2B 1R3KC 1YB3A 1GMGA 2WLLA 1QE0A 3HRIA 3ABTA 4XEOA 4YRGA 2A79B 1Z7MA 1FXKA 2Q68A 3L1AA 3K03A 3AG2C 3HFZB 1K7DA 2EWNA 1K4CC 4LVLA 5E3IA 1EZJA 3CP1A 2ZNIA 4WFBV 3LSQA 4HT4A 4H2VA 5C53B 2IY5B 4UV8A 1X2GA 5KNNA 1EIYB 3JD0A 4H2WA 3ABUA 4GCZA 2X6CA 1AROP 3AG2B 1OCRB 4H2XB 4FIPC 1PKXA 4RUFA 1VQPV 3AG3C 1S76D 2ZR3A 4P3PA 3VQXA 2AMCB 2DWEC 3AG1C 2D3OW 2ZR2A 2EIJC 3H01A 4EKWA 4P73C 2NNUA 4TVAB 3UGTA 3NENA 4YRSA 4DO2A 3CCUV 4JAUA 2HVJC 1VQOV 3G1ZA 4YRTA 1NR1A 1BL8A 1OHHG 4G2KA 5BZBA 3HFZA 1G5HA 5ELOA 4HVCA 2HVKC 3OE7G 5LHHA 3CC7V 1VQZA 4CH3A 3MEYA 4P30A 3RF1A 1OCZB 2P90A 5IDJA 3ICAA 3SJQC 2ALYB 1R3IC 3W3SA 3V7SA 1JJ2U 1YJWV 3STLC 2QM7A 1USYA 4NCXA 3E8HA 4P74C 3UFGA 3VBBA 4P75A 3B8MA 3CMAV 5B1OA 5EC2C 2AMCA 3E9HA 3CCJV 1WQWA 2C8MA 1YJNV 4RUEA 4HWOA 5ELNA 4YP0A 1HXDA 2ZZEA 2ARSA 4JTAB 3A7RA 3RACA 1Y66A 2DYSC 1OCCB 4R50A 4HZ3A 3ETDA 4PA3A 4LCUC 3QO8A 3I7FA 4CS2A 4P9PA 3OUFA 4LNSA 2JK5C 4WCEV 2W6JG 1ROPA 3HFVA 1GM7A 1DLBA 4WFHA 4RQFA 1QLEC 3TEGA 2DWDC 4KR3A 3L4GA 2X7RB 3CXCU 1GKFA 2ODRD 3RVZA 4YRMA 3FB7C 2AHZA 1YGBA 3BJUA 3DSQA 3LNMB 1X56A 4P72A 5DM6V 3MQZA 2G4CA 1JX9A 1R3LC 2I4NA 3ZRVA 3P8YA 1K5QA 5HGQA 2WLLB 3LDDA 4GX2A 4MTOA 4WFEA 3HXZA 1FXKB 1HWYA 4U7NA 5CBHA 2YEVA 3RIRA 1R73A 1KQSU 1E1QG 2QHVA 3TCUA 1R3JC 3DGEA 5EBMC 3TETA 5LGTA 4YRCA 2RHQB 3OGCC 2LFRA 3GB7C 2ZINA 4PG3A 3D3IA 4QPKA 4P73A 4FK5C 5IY5B 2Z3YA 3OMAB 4QIWF 3V7RA 3BY6A 3FYIB 3RGLA 4R7CA 3CPWU 1K33A 1V55B 2JDIG 4UPAA 4H2XA 4MVMA 2HJFC 2XAHA 4TWKA 1R6NA 2EJRA 3LSSA 4JYBA 1QVFU 4K86A 2Q69A 3HXXA 1RPRA 4YDQA 1NJ6A 4RQEA 2WPDG 2BOCC 2X6BA 3K0DA 1S3JA 4H33A 4HAMA 1VQ9V 1S77D 4WFFA 2P5IA 1G8MA 2EZOA 2XOKG 3BFMA 3HXWA 3K3WA 1QR9A 1MSWD 4P75C 1MOFA 2IW5A 4QE7A 4MTGA 2C2AA 2OTJV 1KP3A 3FJPA 1KOGA 4WFAV 3G71V 2HFEC 2DTHA 2H8PC 3SPHA 4MT8A 4E51A 4AH6A 2B1GA 3RKYA 2DQ3A 3X2QC 4LBEC 1AR1B 3ZN0A 1PYSA 2E1HA 4PHCA 4TVAA 4TQFA 4KUMA 1L0WA 1WYDA 2ARTA 4TWAA 5LBQA 3ZRWB 4UP9A 4EO4A 5C52B 3K04A 3A7UA 1ATIA 1NYRA 3T2MA 3OAAG 2EINB 3CCSV 1GTOA 5B1BB 4PA6A 4XU2A 4PELA 2DW4A 4L87A 1M1KW 1JVMA 1X55A 2NLJC 4WF2A 4X88A 4XTYA 1VQKV 1MG1A 3ZMZA 1NVPB 3SYQA 2DTIA 2BOBC 1B76A 5CMUA 4BIZA 3E8GA 2WLNA 2IH3C 4I5SA 3W7TA 2XASA 1YI2V 5F5WA 2P67A 2WSSG 4JF3A 5L3FA 3ABMB 1BBWA 1F4NA 1FXHA 2DXTA 3E9IA 4X5OA 2EILB 1PD3A 1VQ5V 3K06A 2WLJA 1I5XA 4HWSA 1UJWB 2YEVB 2QEXV 2IJIA 3HRKA 3TUPA 4XTXA 2CGHA 2DKGA 3A5ZA 3A74A 1QF6A 2RHQA 2Z5UA 1RIQA 4TVYA 1YITV 1HC7A 2WLIB 4GT1A 5DN6G 1GO3F 4MVSA 4UVBA 2EILC 3IGAC 3ZN1A 1QLNA 2DEQA 1AJPA 1QCEA 2HR3A 3R65A 2PI4A 1DF5A 3ASNB 3K08A 4RMFA 4Q15A 2Q7EA 1X54A 3EHBB 1J5WA 2OCCB 1H38A 4PDRA 1JPXA 1OZ0A 2H94A 3OMIB 1SRYA 3V7CA 4H2SA 2E41A 4GX0A 3PCOA 1K3EA 2ZCEA 4I9WA 2IU0A 4QE9A 5EBLC 2K1EA 3ZMSA 3I55V 2OCCC 1M9NA 3MHSC 1EQRA 3ZIAG 1K9MW 1EIYA 1FXKC 2E3CA 2WLIA 2Q7GA 4CS3A 1USYC 3PJSK 3CCEV 3CMQA 2XAFA 1KKDA 3M4QA 1PNKA 1WQ7A 2GHYA 3ETEA 4MTXA 1AJQA 1KC8W 3HY0A 4BW5A 1NYQA 4UVCA 2ARUA 1M56C 4YXWG 2ZQMA 3OR7C 1NNHA 5C51B 1G51A 4JGSA 1AI5A 1Z7NA 2ZXWB 4ZBMA 2R9IA 2WLKA 2Y69B 2HNIA 1JOYA 1E24A 4ZTUB 1ENVA 3WG7C 3CC4V 2CJ9A 3E89A 2FTKA 2AKWB 2P0LA 2MK3A 1YIJV 5B1NA 1KD1W 2P6JA 3OM3B 4UUJC 1MABG 1OCZC 1GM8A 3IC7A 1BBUA 3JYCA 3MD0A 4DQ2A 2EIMB 1NJ5A 2DYRC 4LVMA 4DXWA 2I4LA 3OEEG 1EFWA 1Y4MA 4P72C 5L3EA 1K5SA 1C0AA 3OW2U 3ABLB 3OMNB 1B70B 2DJZA 1AI7A 4UP8A 4G28B 2I4OA 1GK9A 4X89A 3RL6A 3HXVA 1B7YA 1NJ8A 4LP8A 1CEZA 2ZTGA 4LC1A 4JPRA 1OCCC 1ORQC 1CP9A 2ZT6A 4OLFA 1N8RW 2DZCA 2PI5A 2IU3A 1NJIW 2DVEA 4G84A 3VQVA 2JJ2G 3G4SV 2YSUB 3FB5C 4MVRA 2NS6A 4WFGA 1VQNV 3VOUA 3K9AA 2XAQA 2DDZA 1K4DC 4MTFA 1E1OA 4HWPA 4XTWA 2ZIOA 2EJ9A 1VQ6V 3P32A 3ETGA 3A7AA 3VQWA 1M57B 1S0VA 1RPOA 4CH6A 5B1AC 1ASZA 4UXNA 1B7YB 4PA7A 3FYEB 1YFRA 4MS2A 1VQ7V 4G85A 2KB1A 4ZTZB 2ZDIA 3SYPA 4TVWA 3A5YA 1AI4A 1EFRG 2V7QG 2HKOA 2JIZG 2EBOA 2DZ9A 4EX5A 4UP7A 2DQ0A 3JCZA 3L2ZA 1IXMA 3STZC 3REUA 1PNMA 3ABKC 1G4YB 3JD2A 1NVPD 2E10A 4KP4A 2I4MA 4P71C 3QNEA 4KR2A 4MW8A 1NBMG 4RO2A 3HPLC 3SPCA 4YRKA 1F51A 2IH1C 4QPJA 1W66A 1Q86W 2Q5IA 2HLDG 3E8BA 3MF2A 2E65A 4TSFG 3JD1A 2EIKC 4P71A 2ZT5A 1DTOA 4J9ZB 2X6AA 5C93A 4BW9A 2J3MA 3ZJZA 3MF1A 4YRQA 1WLEA 3W7UA 3CD6V 4CH4A 1KMNA 1WU7A 4P3NA 2B5UA 3A32A 1W2BU 2EJFA 2DXUA 1IL2A 3LDEA 3AG3B 5H9CA 2JEUA 2EAYA 3X2QB 5E1AC 5J9PC 3AG1B 4R8CA 3HTZA 2A0LA 1B70A 1RM1B 1P4RA 2Q7HA 1TUEB 4ZIBA 1LNQA 4BWAA 4YPFA 3ZRWA 3JD3A 3W7XA 4YRJA 4JYCA 1X01A 2QE7G 3OEHG 1K34A 3ERRA 3UKMA 4CH5A 2OT5A 3OFNG 4XBFA 4K87A 1JQ0A 2XNDG 3KG2A 4HWTA 5B1BC 1COWG 5IYDO 1BIBA 3B77A 1HTTA 4JTDB 1RM1C 2CJBA 4Q20A 4H2UA 1M56B 1VQMV 2RHSA 3V8KA 2V1DA 2DU5A 3SYAA 3LC0A 4DPGA 1E79G 3OUSA 2Y69C 5K1XA 2GSMB 4YRPA 1BHBA 3WG7B 4FJCC 1PNLA 2XAJA 5IYBO 3ABMC 1N9WA 1JCHA 4HA8A 4JAVA 3T1CA 4GX1A 2EIMC 2F43G 2ITCC 1Q81W 3RBZA 3ABLC 4MVZA 1P7BA 1H4VB 3V8LA 3E86A 1EBOA 1FFTB 2XAGA 4MVUA 4UV9A 1QLEB 4XDLA 1EOVA 2Q5HA 5GW7A 3EFRA 1H4QA 2ZGWA 1H4SA 1H8EG 3FB8C 4PA9A 1NR7A 3E2EA 1AI6A 1H2GA 2W0FC 5KA5A 3F5WC 2X0LA 2QHSA 2WWWA 3CCQV 3NETA 4KFMA 4CS4A 2IJJA 4CBCA 4YRRA 2EL9A 2E64A 1CPYA 3W7WA 1DF4A 3RUXA 3TEHB 3WQZA 2WLHA 3OR6C 1LYLA 4XU0A 1E1RG 4JASA 4MVOA 3CYOA 3MHHC 1JJCB 2QHTA 2ZXFA 3E8FA 5KUKA 3PCOB 2ZD9A 5B3SB 2AHYA 2E5AA 4YCWA 3UGQA 3NEMA 2DTOA 4PDVA 4X8AA 3CC2V 2J3LA 5IY5C 3QTCA 2IY5A 1M57C 4MSWC 4E2LA 3UM7A 3NELA 4BAYA 1X2HA 4JTCB 4P9OA 1K8AW 4YREA 4TT3G 1V55C 2EJGA 1OCRC 4K88A 1J95A 4XDKA 5B3SC 5CA3A 11ASA 1GM9A 1E1TA 3CCMV 3A31A 5L3BA 1K73W 5LGUA 5FL7G 4P2ZA 4HWRA 5HFLA 3I56V 4YRNA 1AJNA 3HB3B 2B1IA 1THZA 3E83A 1G5IA 3TEHA 3QO7A 4N21A 3WFVA 4Q6GA 4FMTA 4F4LA 1JJCA 2QKSA 2Q67A 3W7SA 3K79A 1PL0A 4YCVA 1F4MA 3EFSA 3RKWA 1ADYA 2AKWA 1SETA 4H02A 3V8JA 1YTFB 1YFTA 4OP0A 4XU1A 4PDLA 4U7OA 5IYCO 4WF9V 1YHQV 4P3OA 2ALYA 2Y48A 5HFMA 1GGMA 2RHSB 5EC1C 4YCUA 5CN0A 3HXUA 4YRLA 5LHIA 4P74A 2UXNA 1FS0G 4FPPA 1XL6A 5L3CA 1NH2D 4LVKA 5K1PA 2JJ1G 2CIMA 4XTZA 3ZMTA 1BHAA 3IKLA 1VQ8V 2QHUA 2Q6AA 3LUTB 1R6KA 1M90W 4YROA 1QR8A 5H6QA 2C7IA 3ASOC 2EINC 4H37A 2A8EA 2QTOA 3M4PA 3UH0A 4KQEA 1H8HG 2DU7A 4H2YA 3RKXA 1YSCA 3SYOA 2ZZFA 3FKSG 3L4GB 3HY1A 3RVYA 3ZRSA 2QM8A 4TQDA 3P8VA 4PA4A 3EFFK 2ATKC 5CBGA 2QA4V 1YJ9V 3T4DA 3DTUB 3CCVV 1F23A 1K92A 3IFXA 4QJFB 5KA6A 2XTIA 3P30A 4RDXA 1QBZA 4XTUA 3CMEV 5CBFA 3OD1A 4GX5A 4MVQA 1NQTA 4LVIA 1YTFD 2UXXA 5L3DA 4J9YB 4QNHB 2ITDC 2EIJB 3ZCCA 1YFSA 5LGNA 4HYOA 3RW0A 2R9RB 1S72V 1I5YA 2XGTA 4LVJA 4CZZA 2LP7A 3JD4A 4G27B 3ASNC 3T4ZA 3ABKB 2PMEA 3PZCA 2HG5C 1FXVA 4XEMA 5H6RA 1KMMA 1W0KG 3VQYA 2IJKA 1VQ4V 2ZIMA 1W0JG 1KP2A 4XDJA 2PMFA 1NJ2A 4RAIA 4H2TA 3NXSA 2WAMA 1BMFG 4Z1MG 1K97A 3ZMVA 2EIKB 3K0GA 3HXYA 3G6EV 1E22A 3AG4C 5L3GA 1SESA 1KECA 2EZPA 4PDMA 3A0RA 1WNLA 3KFUA 3ZRXA 2WLMA 4YYEA 4N23A 12ASA 1Q7YW 4MW3A 3F7YC 3ML0A 4YRIA 3M99B 3TK1A 4UVAA 1EVLA 2DYSB 4OXSA 1ADJA 3F7VC 2ODRC 3AG4B 3P8TA 1QVGU 2M7WA 4TTVA 1VQLV 2JEXA 5LHGA 1H4TA 2ZXWC 1EVKA 2ZT7A 3SYCA 2ZZGA 1NKDA 3ZMUA 3SPJA 3FB6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRF A;  3R07 A;  3IAL A;  2CJA A;  2FYK A;  3QO5 A;  4J15 A;  1B8A A;  1BIA A;  3IG2 A;  1ASY A;  4WJ4 A;  2ZT8 A;  3IKM B;  2ZNJ A;  1NJ1 A;  4WJ3 M;  4XU3 A;  4XTV A;  3REX A;  1FYF A;  1WPY A;  1SER A;  4WI1 A;  1PYS B;  4O2D A;  1YB3 A;  1QE0 A;  3HRI A;  4XEO A;  4YRG A;  1Z7M A;  3L1A A;  3HFZ B;  2EWN A;  5E3I A;  2ZNI A;  3LSQ A;  4H2V A;  5C53 B;  2IY5 B;  5KNN A;  1X2G A;  1EIY B;  4H2W A;  4H2X B;  2ZR3 A;  4P3P A;  3VQX A;  2AMC B;  2ZR2 A;  4P73 C;  3UGT A;  4YDQ A;  4YRS A;  3NEN A;  3G1Z A;  4YRT A;  4HVC A;  3HFZ A;  5ELO A;  1G5H A;  1VQZ A;  4CH3 A;  3MEY A;  3RF1 A;  3ICA A;  3W3S A;  2ALY B;  3V7S A;  4P74 C;  1USY A;  4NCX A;  3UFG A;  3VBB A;  4P75 A;  2AMC A;  3E9H A;  1WQW A;  2C8M A;  5ELN A;  4HWO A;  4YP0 A;  1HXD A;  2ZZE A;  2ARS A;  3A7R A;  3RAC A;  4CS2 A;  3I7F A;  3QO8 A;  4LNS A;  3HFV A;  4RQF A;  3TEG A;  4KR3 A;  3L4G A;  4YRM A;  1YGB A;  3BJU A;  3DSQ A;  1X56 A;  4P72 A;  2G4C A;  3P8Y A;  2I4N A;  5HGQ A;  3HXZ A;  3RIR A;  2QHV A;  4YRC A;  2RHQ B;  2ZIN A;  4PG3 A;  4P73 A;  3V7R A;  3RGL A;  4UPA A;  4H2X A;  3LSS A;  4K86 A;  3HXX A;  1NJ6 A;  4RQE A;  4KQE A;  2P5I A;  3BFM A;  3HXW A;  4P75 C;  1KOG A;  3FJP A;  2DTH A;  4E51 A;  4AH6 A;  3RKY A;  2DQ3 A;  1PYS A;  4PHC A;  2E1H A;  4TVA A;  4TQF A;  1L0W A;  1WYD A;  2ART A;  5C52 B;  4UP9 A;  4EO4 A;  3A7U A;  1ATI A;  1NYR A;  4XU2 A;  4L87 A;  1X55 A;  4WF2 A;  4XTY A;  2DTI A;  1B76 A;  5F5W A;  4TVA B;  2DXT A;  1BBW A;  4X5O A;  3E9I A;  4HWS A;  3TUP A;  3HRK A;  4XTX A;  2CGH A;  2DKG A;  3A5Z A;  3A74 A;  1QF6 A;  2RHQ A;  1RIQ A;  4TVY A;  1HC7 A;  2DEQ A;  4RMF A;  4Q15 A;  2Q7E A;  1X54 A;  1J5W A;  1SRY A;  3V7C A;  4H2S A;  2E41 A;  3PCO A;  2ZCE A;  1EQR A;  1EIY A;  2E3C A;  2Q7G A;  4CS3 A;  1USY C;  3CMQ A;  3M4Q A;  1WQ7 A;  3HY0 A;  1NYQ A;  2ARU A;  1NNH A;  5C51 B;  1G51 A;  1Z7N A;  2HNI A;  1E24 A;  4ZTU B;  2CJ9 A;  2AKW B;  2P0L A;  2ODR D;  4DQ2 A;  1BBU A;  1NJ5 A;  1EFW A;  2I4L A;  4P72 C;  1C0A A;  1B70 B;  2DJZ A;  4UP8 A;  2I4O A;  3RL6 A;  3HXV A;  1B7Y A;  1NJ8 A;  2ZTG A;  2ZT6 A;  4OLF A;  2DZC A;  3VQV A;  2DVE A;  4G84 A;  2DDZ A;  4HWP A;  1E1O A;  4XTW A;  2ZIO A;  2EJ9 A;  3A7A A;  3VQW A;  4CH6 A;  1ASZ A;  1B7Y B;  1YFR A;  4G85 A;  4ZTZ B;  4TVW A;  3A5Y A;  4EX5 A;  2DZ9 A;  4UP7 A;  2DQ0 A;  3L2Z A;  3REU A;  4P71 C;  2E10 A;  2I4M A;  3QNE A;  4KR2 A;  4YRK A;  1W66 A;  2Q5I A;  3MF2 A;  2E65 A;  4P71 A;  2ZT5 A;  4BW9 A;  2J3M A;  3MF1 A;  4YRQ A;  1WLE A;  4CH4 A;  1KMN A;  1WU7 A;  4P3N A;  3A32 A;  2EJF A;  1IL2 A;  2DXU A;  2EAY A;  3HTZ A;  1B70 A;  2Q7H A;  4ZIB A;  4BWA A;  4YPF A;  4YRJ A;  1X01 A;  3ERR A;  4CH5 A;  4K87 A;  4HWT A;  1BIB A;  1HTT A;  2CJB A;  4H2U A;  2RHS A;  3V8K A;  2DU5 A;  3LC0 A;  4DPG A;  5K1X A;  4YRP A;  4HA8 A;  1N9W A;  1H4V B;  3V8L A;  4TWA A;  2Q5H A;  1H4Q A;  1EOV A;  3EFR A;  1H4S A;  2ZGW A;  2QHS A;  3NET A;  4CS4 A;  4YRR A;  2EL9 A;  2E64 A;  3RUX A;  3TEH B;  3WQZ A;  4XU0 A;  1LYL A;  1JJC B;  2QHT A;  2ZXF A;  3PCO B;  2E5A A;  4YCW A;  3UGQ A;  3NEM A;  2DTO A;  2J3L A;  3QTC A;  2IY5 A;  3NEL A;  4YRE A;  1X2H A;  2EJG A;  4K88 A;  11AS A;  1E1T A;  3A31 A;  4HWR A;  4YRN A;  1G5I A;  3TEH A;  3QO7 A;  4Q6G A;  1JJC A;  4YCV A;  3EFS A;  3RKW A;  1ADY A;  2AKW A;  1SET A;  4H02 A;  3V8J A;  1YFT A;  4OP0 A;  4XU1 A;  4P3O A;  2ALY A;  2RHS B;  1GGM A;  4YCU A;  3HXU A;  4YRL A;  4P74 A;  5K1P A;  2CIM A;  4XTZ A;  3IKL A;  2QHU A;  4YRO A;  2C7I A;  3UH0 A;  3M4P A;  2DU7 A;  4H2Y A;  3RKX A;  2ZZF A;  3L4G B;  3HY1 A;  4TQD A;  3P8V A;  2XTI A;  4RDX A;  4XTU A;  3OD1 A;  1YFS A;  2XGT A;  2PME A;  3PZC A;  4XEM A;  1KMM A;  3VQY A;  2ZIM A;  2PMF A;  1NJ2 A;  4H2T A;  3HXY A;  1E22 A;  1SES A;  3KFU A;  1WNL A;  4YYE A;  12AS A;  4YRI A;  1EVL A;  1ADJ A;  2ODR C;  3P8T A;  4TTV A;  1H4T A;  1EVK A;  2ZT7 A;  2ZZG A; 
#chains in the Genus database with same CATH topology
 4R6Z A;  1FD9 A;  1XL4 A;  3SPG A;  2FYK A;  4J15 A;  3SJC C;  3AEI A;  3CCR V;  3OTO B;  1ASY A;  2ZT8 A;  4OX9 B;  4O4I B;  4D7S A;  1OCO C;  4FFB B;  3IKM B;  2CK3 G;  3DC5 A;  4FLU A;  3D36 A;  1N33 B;  5KHH A;  4XTV A;  5J2U A;  4DV7 B;  1OCO B;  5KX5 B;  2E75 B;  4JI5 O;  3E35 A;  1S5H C;  2Q0A A;  3CCL V;  3EVK A;  4YRG A;  5IWA O;  1Q5O A;  1FXK A;  1Z7M A;  3L1A A;  2GV9 A;  1K4C C;  3LSQ A;  4H2V A;  2IY5 B;  4UV8 A;  4GCZ A;  2IBZ H;  1DGS A;  4H2X B;  3K59 A;  5KAF Z;  4DV4 O;  1VQP V;  3VQX A;  4EKW A;  4P73 C;  2LO1 A;  3UGT A;  2NNU A;  3NEN A;  3APQ A;  3L71 H;  1WB8 A;  1J5E B;  2BSK B;  2Y4T A;  1NR1 A;  1OHH G;  1G5H A;  4DW1 A;  2HVK C;  3CC7 V;  1GN4 A;  3RF1 A;  3UT5 A;  3OD4 A;  2P90 A;  3SJQ C;  2ALY B;  3E8H A;  2ADP A;  3VBB A;  3CE2 A;  4LF9 B;  3CMA V;  3CJH A;  3RYI A;  5ELN A;  2ZZE A;  1WA8 A;  4HNA A;  2M6Y A;  1XNQ O;  4PA3 A;  1TVK A;  2ZKO A;  2JK5 C;  1ROP A;  1GM7 A;  2Q73 A;  2FL4 A;  1NI8 A;  2VWJ A;  2AHZ A;  5DM6 V;  3P8Y A;  1RP3 B;  5HGQ A;  4MTO A;  2QTS A;  1R73 A;  3DGE A;  5LGT A;  3GB7 C;  4PG3 A;  4FK5 C;  4X64 O;  2LW1 A;  1K33 A;  3TXS A;  2N74 A;  1R6N A;  4K86 A;  3T1H O;  4PHZ A;  3HXX A;  1RPR A;  4DV4 B;  2BOC C;  4KQE A;  4HAM A;  4WFF A;  1G8M A;  2XOK G;  3IC9 A;  3K3W A;  1MOF A;  4QE7 A;  3FJP A;  2E74 B;  2R72 A;  2CGO A;  4J7K A;  4MT8 A;  4E51 A;  5KX5 A;  4LF6 B;  1PYS A;  4ZOL A;  4WBN B;  4TVA A;  4JI5 B;  3ZRW B;  3BRC A;  3K04 A;  5GON B;  1NYR A;  3FAV A;  1GTO A;  5B1B B;  3B2E E;  4PA6 A;  4XU2 A;  2AZ2 A;  3U0Z A;  1Z5W A;  2YC0 A;  2OWO A;  3ZHV A;  4IIJ B;  1XMO B;  4FM0 A;  3ZMZ A;  2CTQ A;  3SJB C;  1B76 A;  3W7T A;  3E8G A;  1YI2 V;  3OTO O;  4DV1 B;  2UUB B;  1FXH A;  3E9I A;  1XBL A;  1XHZ A;  4NTX A;  1PD3 A;  3TUP A;  2YEV B;  5J2T A;  2HHH O;  3A74 A;  2JGD B;  4TV9 A;  2Z5U A;  4TVY A;  1HC7 A;  1WJZ A;  2WLI B;  1SS3 A;  3IGA C;  1QLN A;  2B9Z A;  2QSA A;  1NTK H;  3ASN B;  4I55 B;  5BR8 B;  1J5W A;  1H38 A;  1NZ6 A;  2P22 C;  1JPX A;  4PDR A;  2H94 A;  3OMI B;  4BR6 A;  2Q9L A;  1YDX A;  4GX0 A;  4O2B A;  2E41 A;  1K3E A;  3PCO A;  2R9A A;  4KHP B;  2RNB A;  3ZMS A;  4I0X A;  3I55 V;  1EIY A;  2WLI A;  5KHJ A;  3CCE V;  3M4Q A;  2UXD O;  1JA8 A;  1XMQ B;  4BW5 A;  4UVC A;  4J80 A;  2ZQM A;  1JR9 A;  4JGS A;  2ZXW B;  2WLK A;  1MA1 A;  2Z0A A;  4PV1 B;  4ZTU B;  1ENV A;  3WG7 C;  5KMG A;  2CJ9 A;  4OGQ B;  1KD1 W;  3OM3 B;  1MAB G;  3IC7 A;  1GM8 A;  2YI8 A;  3MD0 A;  1YXB A;  1XDC A;  3OW2 U;  3ABL B;  4G28 B;  1D2D A;  1XHX A;  4X89 A;  3RL6 A;  3HKE A;  2P5O A;  4DV2 O;  3E22 A;  1CEZ A;  2ZTG A;  4JPR A;  1KBH A;  2KQX A;  1NJI W;  2YIB A;  4H13 B;  3IAY A;  4MVR A;  1VQN V;  3VOU A;  4HWP A;  2XAQ A;  1K4D C;  3DXR A;  4XTW A;  4B3R B;  1VIB A;  5LOV B;  5B1A C;  4AHC A;  1ASZ A;  4UXN A;  1B7Y B;  2ODM A;  1Y76 A;  4G85 A;  2KB1 A;  3CHX A;  3TXQ A;  2QWO B;  4ZTZ B;  3JCU Z;  2ZDI A;  3SYP A;  1JJO A;  3A5Y A;  1AI4 A;  1EFR G;  2JIZ G;  4B7E A;  4UP7 A;  3L2Z A;  1SKV A;  3JD2 A;  1NVP D;  4P71 C;  4MW8 A;  4DV1 O;  2UUB O;  3HPL C;  4YRK A;  2F95 B;  1T5E A;  4DR7 B;  1WN7 A;  3QG5 A;  4JI8 B;  1YEW A;  1XMO O;  4P71 A;  4GKJ O;  2J3M A;  5H2F Z;  4P3N A;  4DRX B;  2JEU A;  1G1X B;  3J81 N;  1TUE B;  4BWA A;  4YRJ A;  1X01 A;  3UKM A;  4DYL A;  4JI1 B;  4AI8 A;  5JQG B;  4HWT A;  1P49 A;  1COW G;  4I0X B;  4DR3 B;  4JI1 O;  1M56 B;  5JH7 B;  2V1D A;  2DU5 A;  3SYA A;  3LC0 A;  2QGN A;  1BS3 A;  2Y69 C;  4X66 O;  1PNL A;  5IYB O;  2PGG A;  3IJ4 A;  5LP6 A;  4DR2 O;  3KCY A;  4MVZ A;  1H4V B;  1H4Q A;  3EFR A;  1H4S A;  2ZGW A;  1H8E G;  4F6R A;  1HW7 A;  2E64 A;  2OIE A;  1DF4 A;  4PI2 A;  4XU0 A;  1M93 A;  1ZTE A;  3LNN A;  4UB8 Z;  2E5A A;  4YCW A;  1UPG A;  3UGQ A;  5LP6 B;  4MSW C;  4E2L A;  3NEL A;  1M5I A;  4TT3 G;  1OCR C;  2LQT A;  4K88 A;  2YUA A;  4UCV A;  1E1T A;  3CCM V;  4YJ2 B;  2B1I A;  1THZ A;  3RGB A;  3QO7 A;  3WFV A;  4Q6G A;  4F4L A;  4FZ0 A;  2QKA A;  4FLV A;  2Q67 A;  5GTH Z;  1PL0 A;  1F4M A;  4NXM B;  3EFS A;  3RKW A;  3FD9 A;  2AKW A;  2Q4P A;  1SET A;  3V8J A;  4WF9 V;  2ALY A;  5HFM A;  2RHS B;  1NS1 A;  2XHB A;  4YRL A;  2EJ7 A;  1J5E O;  5K1P A;  4LVK A;  5D5P A;  2JJ1 G;  4XTZ A;  1BHA A;  5JJJ B;  4B3M B;  1R6K A;  4YRO A;  5H6Q A;  5FLX N;  4JI2 O;  3ASO C;  4H37 A;  3UH0 A;  2AXT Z;  2DU7 A;  3RKX A;  3WB0 A;  4FFK A;  3P3P A;  4TQD A;  1EN5 A;  1I0H A;  4ICG A;  2QA4 V;  3DTU B;  1HNX O;  3CCV V;  3L9D A;  4QJF B;  1GH6 A;  5CBF A;  3OD1 A;  4YJ3 A;  1URF A;  4J9Y B;  2EIJ B;  5LGN A;  2R9R B;  1XNR O;  3K58 A;  2YXL A;  5F2V O;  1AP5 A;  4YIP A;  3ASN C;  3ABK B;  1IBL O;  4XEM A;  5H6R A;  2CH7 B;  1W0J G;  4D7T A;  5FNV A;  4RAI A;  4H2T A;  1K97 A;  1HR0 B;  3K0G A;  1TA8 A;  2EZP A;  4PDM A;  1WNL A;  3KFU A;  4N23 A;  4MW3 A;  4K0K B;  4YRI A;  1WB7 A;  3H1J H;  1ADJ A;  3F7V C;  2ODR C;  5IE9 A;  2CH7 A;  3K5M A;  5CA0 B;  4TUY B;  3FAV B;  1N34 O;  4DUY B;  3JAS A;  2ZM6 B;  2PI5 A;  4YRF A;  3R07 A;  2A9H A;  2DYR B;  2IJH A;  1N36 O;  3IG2 A;  1MZF A;  2P7T C;  1Q6I A;  1Q82 W;  5EK0 A;  4HNA B;  2ZNJ A;  5EBW C;  4WJ3 M;  2OTL V;  4XU3 A;  1SZT A;  2A7W A;  2FB5 A;  3AG7 A;  3B8N A;  1EZV H;  3A0H Z;  3BEH A;  3ASO B;  2L35 A;  3SPI A;  1H2M A;  2QM4 A;  4O2D A;  1YB3 A;  1U96 A;  3ABT A;  2Q68 A;  3HFZ B;  1HNZ O;  4JI6 B;  1B06 A;  2EWN A;  2ZNI A;  3CP1 A;  1EIY B;  1ARO P;  2DE0 X;  3J80 N;  1PKX A;  4P3P A;  1S5J A;  2D3O W;  3H01 A;  4YDQ A;  2JGU A;  2F4V B;  3G6B A;  2HVJ C;  4O4L B;  4YRT A;  5BZB A;  3CEI A;  3OE7 G;  5LHH A;  1XRE A;  2VQE O;  4U3F H;  3MEY A;  3H9V A;  3V7S A;  1XOU A;  4WBN A;  5LYJ B;  3B8M A;  2WA3 A;  2AMC A;  3E9H A;  5ITZ B;  3CCJ V;  1WQW A;  2F93 B;  1YJN V;  2C8M A;  3JAL B;  4X20 A;  1Y66 A;  2DYS C;  4CS2 A;  1JFF A;  4R50 A;  3ETD A;  4NTY A;  4LCU C;  3QO8 A;  1N0N A;  2UXB B;  3OUF A;  4LNS A;  1B04 A;  4WCE V;  3HFV A;  4WFH A;  4LF4 O;  4LF7 B;  2X7R B;  3CXC U;  3RVZ A;  5BXZ A;  3BJU A;  3DSQ A;  2FYU H;  4X1K B;  1JX9 A;  1R3L C;  4K8Z A;  1K5Q A;  4GX2 A;  3HXZ A;  3CXH F;  1FXK B;  5CBH A;  1Y76 B;  1KQS U;  2QHV A;  1R3J C;  3TET A;  3D3I A;  4QPK A;  5IY5 B;  4LNU B;  3V7R A;  3FYI B;  1SZX A;  1SA0 A;  2ZE7 A;  1V55 B;  2A06 H;  1IVS A;  4LFC B;  4H2X A;  4MVM A;  4FLX A;  2EJR A;  1NJ6 A;  4RQE A;  2X6B A;  1S77 D;  1VMG A;  2JS5 A;  2EZO A;  1YZB A;  3M8A A;  1KOG A;  4JV5 B;  1N33 O;  4WFA V;  2HFE C;  3UT5 B;  2DTH A;  3SPH A;  1IBM B;  4AH6 A;  1V9P A;  2DQ3 A;  3RKY A;  4PHC A;  1AR1 B;  4LF4 B;  1H2L A;  4JZG A;  4KUM A;  1L0W A;  2VQE B;  2ART A;  3H1L H;  1HP8 A;  2F4V O;  5JH7 A;  2NLJ C;  1MMM A;  3UO2 A;  1MG1 A;  5CMU A;  2WLN A;  4I5S A;  3A8T A;  4GLX A;  3ABM B;  1VP7 A;  5DED A;  3ZHS A;  4HWS A;  2WLJ A;  3HRK A;  2GTA A;  1QF6 A;  5LMN B;  4DV3 B;  1L0L H;  2RHQ A;  2O57 A;  2QJ1 A;  1GO3 F;  4UVB A;  2DEQ A;  1AJP A;  2HR3 A;  3ETQ A;  2PI4 A;  2AGA A;  3EHB B;  3BAA A;  3RYF A;  4I4T A;  3V7C A;  4H2S A;  4JI6 O;  2RMK B;  2ZCE A;  2IU0 A;  4I9W A;  4X1Y B;  4QE9 A;  2K1E A;  5IJ0 B;  2G38 A;  1M9N A;  3ZIA G;  1K9M W;  4CS3 A;  3PJS K;  2XAF A;  1KKD A;  4J41 A;  1KUQ A;  1AJQ A;  4U3J A;  2DOS A;  1M56 C;  4YXW G;  3H1I H;  4YIO A;  1AI5 A;  2HNI A;  2XTA A;  2P0L A;  3R66 A;  1YIJ V;  2ODR D;  1OCZ C;  3JAW A;  3JYC A;  4LVM A;  5TIS Z;  4P72 C;  3SR2 C;  3HKD B;  3ZHQ A;  1IBK O;  2DJZ A;  1AI7 A;  1NTM H;  1N34 B;  4LC1 A;  4KXR A;  4O4H A;  4OLF A;  1N8R W;  2DZC A;  4JYA B;  3VQV A;  4JZ2 A;  3G4S V;  2YSU B;  3FB5 C;  1IBM O;  1VF6 C;  1L0N H;  4MTF A;  1Y74 A;  1XNR B;  3HKD A;  3VQW A;  4CH6 A;  1S0V A;  1VQ7 V;  2RJZ A;  1FFX A;  2F23 A;  3TJT A;  4I50 B;  2DQ0 A;  3JCZ A;  3QF7 A;  3REU A;  3ABK C;  2I4M A;  4KR2 A;  1NBM G;  4FLY A;  4IYI A;  2Q5I A;  2EIK C;  4DR6 B;  1DTO A;  4BW9 A;  4YRQ A;  3W7U A;  2CTW A;  4LFC O;  2HP8 A;  1KMN A;  3JAT A;  1WU7 A;  2B5U A;  2EJF A;  3LDE A;  5H5N A;  3KKY A;  4LH6 A;  3X2Q B;  4EEQ A;  1SQF A;  2Q5Z A;  3CRA A;  4R8C A;  3HTZ A;  1B70 A;  1P4R A;  1LNQ A;  1SQV H;  3JD3 A;  5EYP B;  4I4T B;  3ZRW A;  1K34 A;  4CH5 A;  5A2Q N;  2OT5 A;  3E22 B;  4ABM A;  1JQ0 A;  2XND G;  3KG2 A;  5B1B C;  3B77 A;  1RM1 C;  4H2U A;  3U11 A;  1VQM V;  3V8K A;  4W4L A;  1BGY H;  3WG7 B;  3A0B Z;  2JRI A;  3CS5 A;  2UXB O;  2QKC A;  4U3J B;  1O9G A;  4NXM O;  3U10 A;  4GKK O;  4GX1 A;  2F43 G;  2LGW A;  4ZHQ B;  2ITC C;  3RBZ A;  4LWS A;  1P7B A;  4X9Q A;  1FFT B;  4UV9 A;  4MVU A;  4XDL A;  1EOV A;  3C3S A;  1AI6 A;  2Q0O C;  2X0L A;  4CS4 A;  4KFM A;  3NET A;  3BHP A;  2VS0 A;  2PTM A;  3L74 H;  3W7W A;  4OPA A;  3TEH B;  1I94 O;  1LYL A;  4JAS A;  3ZHT A;  1D5A A;  3CYO A;  4JI0 O;  2QHT A;  2ZXF A;  5KUK A;  2AHY A;  3NEM A;  1N4C A;  1S5L Z;  2J3L A;  3CC2 V;  4YY3 O;  2E5L B;  2CUG A;  4BAY A;  4P9O A;  3RN4 A;  4X62 O;  5B3S C;  4I9Q A;  11AS A;  1BQZ A;  4JI4 B;  4YRN A;  2KSD A;  3HB3 B;  5LXT B;  3E83 A;  1HNZ B;  3ZBH A;  1JJC A;  2QKS A;  3HKB B;  1YFT A;  4PDL A;  4U7O A;  5IYC O;  4P3O A;  1YHQ V;  2Y48 A;  1GGM A;  2D2C B;  3RYH B;  5LHI A;  4AIL C;  1FS0 G;  3P3N A;  5L3C A;  1NH2 D;  3AK2 A;  5LYJ A;  1W59 A;  4DR3 O;  3ZMT A;  3IKL A;  1VQ8 V;  1M4U A;  2EIN C;  3JAS B;  2F1M A;  2YIB D;  1H8H G;  3SYO A;  3FKS G;  2XT9 A;  3ZRS A;  4LFB B;  4K0K O;  4DW0 A;  3P8V A;  3EFF K;  2RN9 A;  5CBG A;  3N2G B;  4D6T H;  5KA6 A;  3K5L A;  1HR0 O;  1QBZ A;  4XTU A;  3L72 H;  1U97 A;  4GX5 A;  2FKX A;  1NQT A;  3A2F A;  4DR7 O;  4NXN B;  1YFS A;  4HYO A;  3RW0 A;  1S72 V;  1IBL B;  4B3R O;  2XGT A;  4LVJ A;  4B3T B;  4J7J A;  4JI7 O;  2LP7 A;  3JD4 A;  4G27 B;  1H2S B;  3T4Z A;  2PME A;  2HG5 C;  1FXV A;  3BA9 A;  1Q90 D;  5AG2 A;  2ETN A;  3VQY A;  1MZE A;  3CSX A;  2ZE5 A;  5C8Y B;  3O9O A;  5EIB D;  3RFR A;  1BMF G;  1CXZ B;  4JI3 O;  3HXY A;  2BE3 A;  1QQC A;  1KEC A;  5JJN B;  1LR1 A;  2R70 A;  4YYE A;  12AS A;  4X1I B;  2ARH A;  1Q7Y W;  3ML0 A;  3TK1 A;  4UVA A;  4OXS A;  2Y4U A;  2YDE A;  3P8T A;  2XUM A;  2JS3 A;  2ZXW C;  3SYC A;  4DR5 O;  4DV2 B;  3BAB A;  2UU9 B;  1HNX B;  3FB6 C;  2W6I G;  1B8A A;  4ZKI A;  1BIA A;  2LFS A;  1B6Q A;  3LDC A;  4WJ4 A;  2N04 A;  4KL1 A;  1ZWI C;  5KUM A;  4O4J A;  4BIU A;  5B1A B;  3N2K B;  1VF5 B;  1XI1 A;  4J10 A;  3REX A;  3GWO A;  1FYF A;  1WPY A;  4DK1 A;  1QU7 A;  1WP7 A;  2UXD B;  1SER A;  4WI1 A;  1PYS B;  2KG7 A;  1R3K C;  2WLL A;  1QE0 A;  3HRI A;  2A79 B;  2W0X A;  3RYF B;  5FNV B;  4O4J B;  4JI7 B;  4B3T O;  2Q8V A;  5E3I A;  4HT4 A;  2QDO A;  4B08 A;  3FFQ A;  5BR8 O;  5KNN A;  3JD0 A;  5A9G A;  4H2W A;  1OCR B;  4FIP C;  3UQ8 A;  4RUF A;  2DWE C;  4B3S O;  2ZR2 A;  4DR2 B;  4DO2 A;  4JAU A;  1O9H A;  5LA6 A;  1RSO B;  4JAA A;  3G1Z A;  5CA0 A;  1R6T A;  4B7K A;  4HVC A;  4G2K A;  5ELO A;  4LFB O;  2VWK A;  2AW9 A;  3CRQ A;  1VQZ A;  1GAX A;  5IDJ A;  3ICA A;  1R3I C;  1YJW V;  4ZI7 B;  3STL C;  4P74 C;  1USY A;  4NCX A;  3H1K H;  4P75 A;  2HEP A;  4TV8 A;  1PV0 A;  4LFA B;  4RUE A;  4O2B B;  4YP0 A;  3A7R A;  3RAC A;  1OCC B;  1TUB B;  1DLB A;  3KCX A;  2DWD C;  4KR3 A;  4X1I A;  3WU2 Z;  1GKF A;  4YRM A;  3FB7 C;  5CA1 A;  1YGB A;  5JCO C;  3LNM B;  3MQZ A;  2G4C A;  2I4N A;  4GKJ B;  4UCO A;  4U7N A;  1NT2 B;  4X62 B;  2BCC H;  4LR3 A;  1E1Q G;  5EBM C;  4YRC A;  2RHQ B;  3OGC C;  4W4K A;  2LFR A;  3AK3 A;  4QIW F;  2BTQ B;  3RGL A;  3RT3 C;  4TWK A;  1RFY A;  5CA1 B;  3L75 H;  4B3S B;  1QVF U;  3SDL A;  4CC5 A;  3CX5 F;  4DV0 B;  2WPD G;  3K0D A;  4JI8 O;  1S3J A;  4Z2W A;  1VQ9 V;  2P5I A;  1P84 F;  4X1Y A;  3KZI Z;  3BFM A;  3HXW A;  5LP6 C;  4NVP A;  1MSW D;  4P75 C;  2IW5 A;  4NKG B;  2OTJ V;  2C2A A;  5JVD B;  1VF7 A;  3S3X A;  3MAQ A;  5DEC A;  2B1G A;  4IHJ B;  3B40 A;  4LBE C;  3ZN0 A;  1FYJ A;  1WYD A;  4EO4 A;  5ITZ A;  1XNQ B;  5J2T B;  1ATI A;  3T2M A;  3OAA G;  5JCO A;  3S3W A;  2DW4 A;  3JAW B;  1M1K W;  1JVM A;  4LF9 O;  4WF2 A;  4X88 A;  4XTY A;  4I55 A;  3BVO A;  1VQK V;  1NVP B;  3SYQ A;  3RYC B;  2DTI A;  2BOB C;  4J42 A;  5F5W A;  4BIZ A;  4IHJ A;  2XAS A;  4PD4 F;  4JF3 A;  5L3F A;  4TVA B;  1F4N A;  5LA6 B;  3JSN A;  1VQ5 V;  3K06 A;  1UJW B;  2QEX V;  2IJI A;  4O4H B;  2CGH A;  5GON A;  5IWA B;  2UU9 O;  1YIT V;  1MNG A;  4MVS A;  2EIL C;  3ZN1 A;  1QCE A;  4IIJ A;  1DF5 A;  1Y74 B;  3K08 A;  4PI0 A;  1YVW A;  5LL6 Y;  3B4S A;  1IX9 A;  1SRY A;  5EZY A;  1TGO A;  4NB5 A;  5EBL C;  2LW7 A;  5E79 Z;  4UCU A;  1XMQ O;  4JI3 B;  2OCC C;  2V4D A;  1EQR A;  3MHS C;  4I50 A;  2UUA O;  1FXK C;  2Q7G A;  1WQ7 A;  2GHY A;  1WAZ A;  2GUZ A;  2YI9 A;  3OTF A;  2HHH B;  4KHP O;  3CWB H;  3OR7 C;  5C51 B;  4ZBM A;  2R9I A;  2Y69 B;  1D5N A;  1JOY A;  1E24 A;  1XEQ A;  2FTK A;  2KKW A;  4K35 A;  4OX9 O;  1FJG B;  2MK3 A;  1FJG O;  3T1Y O;  3H1H H;  4DQ2 A;  2N05 A;  2EIM B;  2DYR C;  1EFW A;  4DXW A;  3OEE G;  2AZ0 A;  1K5S A;  1C0A A;  1B70 B;  2I4O A;  1Y67 A;  5LMU O;  1B7Y A;  1NJ8 A;  2NR5 A;  4LP8 A;  2OYQ A;  1OCC C;  1CP9 A;  2ZT6 A;  2IU3 A;  2RQ6 A;  1Q6U A;  4G84 A;  2LGQ A;  4DUZ B;  2NS6 A;  1AVM A;  3K9A A;  4BIO A;  1E1O A;  2ZIO A;  2EJ9 A;  1AR5 A;  3P32 A;  3ETG A;  4YJ2 A;  3A7A A;  1M57 B;  1RPO A;  4UCS A;  4PA7 A;  1YFR A;  4MS2 A;  1BZK A;  4FZ1 A;  5CB4 B;  4LF5 B;  3T1H B;  4LF6 O;  2V7Q G;  2HKO A;  2EBO A;  4EX5 A;  4FM2 A;  2FML A;  2YIC A;  1IXM A;  3STZ C;  2ILM A;  1PNM A;  1G4Y B;  2E10 A;  2DJV A;  4KP4 A;  1Q3E A;  4RO2 A;  1I7F A;  1ZAU A;  1US6 A;  1Q86 W;  1G6U A;  3E8B A;  5BY1 A;  3JD1 A;  2YXH A;  2ZT5 A;  5C93 A;  1B3Q A;  3ZJZ A;  3MF1 A;  5GTI Z;  5CB4 A;  1WLE A;  4CH4 A;  3A32 A;  3CRC A;  3JAK A;  1IL2 A;  4JI0 B;  1WNS A;  3UO3 A;  2UXC O;  5E1A C;  3AG1 B;  1RM1 B;  2P06 A;  4YPF A;  4JYC A;  2QE7 G;  4YJ3 B;  3ERR A;  4XBF A;  2F66 C;  5IYD O;  1BIB A;  4JTD B;  2QWP B;  2UUC O;  4DPG A;  4GKK B;  3OUS A;  3ICX A;  2CDY A;  4YRP A;  4UB6 Z;  4DV0 O;  2GUZ B;  2YXY A;  1BE3 H;  3ABM C;  3T1C A;  1ZUQ A;  4EFE A;  5IJ9 A;  1Q81 W;  3ABL C;  2XAG A;  1QLE B;  5GW7 A;  1BT8 A;  3FB8 C;  4PA9 A;  4IYH A;  1P7G A;  2PYJ A;  3F5W C;  2QHS A;  2WWW A;  2QWR B;  3CCQ V;  2IJJ A;  3N2G A;  4CBC A;  2YID A;  2EL9 A;  2WLH A;  3OR6 C;  3C90 A;  1E1R G;  4LH7 A;  2ZD9 A;  5B3S B;  3JSL A;  1ZX3 A;  2DTO A;  2CTR A;  4PDV A;  3BFR A;  2IY5 A;  1M57 C;  3ZX6 A;  2PF4 E;  3I5D A;  1V55 C;  2Y0P A;  4X65 O;  2EJG A;  1J95 A;  4XDK A;  1GM9 A;  3A31 A;  3DXR B;  5L3B A;  4LFA O;  4HWR A;  4P2Z A;  3I56 V;  1AJN A;  5LOV A;  2QWQ B;  5EYP A;  4FMT A;  4DUZ O;  3W7S A;  4YCV A;  1YTF B;  4XU1 A;  4L8J A;  3CB2 A;  4YCU A;  4AQY O;  3BPZ A;  1SQQ H;  4P74 A;  5LMU B;  3M7M X;  1XL6 A;  2CIM A;  4E4E A;  2CTP A;  1SQX H;  3CRR A;  1QR8 A;  2C7I A;  3T1Y B;  2A8E A;  1BQ0 A;  2QTO A;  4JYA O;  3M4P A;  1TVK B;  1TUB A;  5KLV H;  2RCV A;  3HY1 A;  3BA8 A;  3O65 A;  4EB6 B;  4PA4 A;  4DV5 O;  1YJ9 V;  4DR1 O;  3P30 A;  3N2K A;  3CME V;  4O2A A;  4MVQ A;  2UUA B;  4LVI A;  2UXX A;  1PL4 A;  3ZCC A;  4FLZ A;  4C7U A;  1AB3 A;  1I5Y A;  4HBN A;  4CZZ A;  3WB1 A;  4EB6 A;  3LSU A;  1IZ3 A;  2ZIM A;  1VQ4 V;  4JYY A;  1KP2 A;  4NTW A;  4XDJ A;  2PMF A;  1H2N A;  4X20 B;  3ZMV A;  2EIK B;  4O2A B;  3G6E V;  3AG4 C;  5L3G A;  1SES A;  2ZT9 B;  4DV6 B;  4LF8 B;  5JVD A;  3A0R A;  3ZRX A;  2WLM A;  3F7Y C;  3G80 A;  3PN1 A;  2DYS B;  3RYH A;  3K5N A;  1R1B A;  3AG4 B;  3Q4H A;  1QVG U;  5B66 Z;  2M7W A;  2ZE8 A;  5LHG A;  4YHH B;  1EVK A;  5JJE B;  1SC5 B;  2NN4 A;  4IT5 A;  4UCT A;  3ZMU A;  3SPJ A;  2ZDI C;  1V54 B;  4IL6 Z;  3IAL A;  2CJA A;  3QO5 A;  4ZI7 A;  3OGI B;  1N32 B;  2OIG A;  5KHK A;  1V54 C;  4ASU G;  5IYZ B;  1L1F A;  1NJ1 A;  5FPR A;  1WPX A;  2JVD A;  4UCR A;  4TUY A;  2JGD A;  1Y6X A;  4DR4 B;  1BCC H;  4NXN O;  1VEW A;  3BCC H;  1SF9 A;  1EN4 A;  4FM1 A;  1NH2 B;  3K57 A;  1GMG A;  4XEO A;  4FVM A;  3K03 A;  5EZY B;  3AG2 C;  2GTS A;  4FLW A;  1K7D A;  5KAI Z;  4LVL A;  4JV5 O;  1IUR A;  1EZJ A;  1PP9 H;  4WFB V;  1NTZ H;  5C53 B;  1L8D A;  2BTQ A;  1X2G A;  3ABU A;  2X6C A;  2H3O A;  3AG2 B;  1FKA O;  1S76 D;  3AG3 C;  2ZR3 A;  3DC6 A;  2AMC B;  3AG1 C;  2EIJ C;  1X59 A;  1VAR A;  4YRS A;  5LXT A;  3CCU V;  1VQO V;  1JFF B;  1BL8 A;  3HFZ A;  4CH3 A;  2K9P A;  4P30 A;  1UFI A;  1OCZ B;  3W3S A;  4JI2 B;  1JJ2 U;  2QM7 A;  3D36 C;  3UFG A;  1LUV A;  4B3M O;  5B1O A;  5EC2 C;  4JI4 O;  4HWO A;  1HXD A;  2ARS A;  4JTA B;  4HZ3 A;  5IJ0 A;  3HKC A;  3I7F A;  4P9P A;  4GYC B;  2W6J G;  2A3Q A;  4LNU A;  1F7Y A;  1PPJ H;  4RQF A;  1QLE C;  4GZR B;  1SA0 B;  3TEG A;  3L4G A;  2VQF O;  1X56 A;  4P72 A;  1HDJ A;  3ZRV A;  5JWP A;  2WLL B;  3Q4H B;  3LDD A;  2PUS A;  4WFE A;  1HWY A;  4FLT A;  3RIR A;  1Q8I A;  2YEV A;  2BTO A;  3TCU A;  4TV9 B;  3UCS C;  1YF2 A;  2WA4 A;  2ZIN A;  4P73 A;  2PZS A;  1GN2 A;  2YS8 A;  2Z3Y A;  3OMA B;  2E76 B;  3BY6 A;  4RWU A;  4R7C A;  3CPW U;  3D3Q A;  2JDI G;  4UPA A;  3CRM A;  2HJF C;  2XAH A;  3LSS A;  4JYB A;  3SJA C;  2Q69 A;  3OT7 A;  4H33 A;  2ADQ B;  5IYZ A;  1QR9 A;  4J7Z A;  3ZED A;  4MTG A;  1KP3 A;  1MSD A;  3G71 V;  4DRX A;  2H8P C;  2OCH A;  3X2Q C;  2E1H A;  4H44 B;  2DN9 A;  4TQF A;  1BSM A;  5LBQ A;  5C52 B;  4UP9 A;  4X66 B;  3A7U A;  3K9S A;  5KMG B;  1HNW B;  2EIN B;  3CCS V;  1Q43 A;  4PEL A;  4L87 A;  1X55 A;  4DR5 B;  4DR6 O;  5KHG A;  4H0L B;  2LJ2 A;  2IH3 C;  2P67 A;  2WSS G;  2DXT A;  1BBW A;  4X5O A;  3HKE B;  2EIL B;  1I5X A;  4XTX A;  2DKG A;  3A5Z A;  3RWR D;  4IGG A;  1NU1 H;  1RIQ A;  2ZM6 O;  1OV9 A;  4DUY O;  2DMX A;  3C3T A;  4GT1 A;  1LUW A;  5DN6 G;  2P4V A;  2Y0I A;  3R65 A;  4RMF A;  4Q15 A;  2Q7E A;  2KG7 B;  1X54 A;  2OCC B;  1OZ0 A;  2GDS A;  2IM9 A;  4TOI A;  5D5Q A;  3ZS8 C;  2MW2 B;  2E3C A;  1USY C;  3CMQ A;  5EIB C;  1ZL8 B;  1PNK A;  1WP8 A;  3ETE A;  4MTX A;  1KC8 W;  4DR4 O;  3HY0 A;  1NYQ A;  4GUN A;  2ARU A;  1NNH A;  1RSO A;  1G51 A;  1Z7N A;  2BSK A;  4QGP A;  3CC4 V;  1QHT A;  3E89 A;  2AKW B;  5B1N A;  2P6J A;  4UUJ C;  1BBU A;  3GVM A;  1NJ5 A;  2I4L A;  2PY5 A;  1Y4M A;  3HR0 A;  5L3E A;  3OMN B;  1A32 A;  1ZL8 A;  3RYC A;  4UP8 A;  1TAE A;  3CJH B;  3RYI B;  1GK9 A;  1HNW O;  4DV6 O;  3HXV A;  3THO A;  5KHI A;  3AK1 A;  3TGU H;  4UFZ A;  1ORQ C;  4Z1V A;  1X4T A;  2DVE A;  1N0J A;  2JJ2 G;  4WFG A;  1DK1 A;  2DDZ A;  3J7A U;  1JMK C;  1GRJ A;  1VQ6 V;  2EX3 A;  4F6E A;  3GWK C;  1H2K A;  5IJ9 B;  3FYE B;  4YY3 B;  2E5L O;  1GN6 A;  3K5O A;  3JAT B;  4TVW A;  4F6R B;  2DZ9 A;  2QR4 A;  1I08 A;  4NR1 A;  1I94 B;  3QNE A;  3SPC A;  1F51 A;  2IH1 C;  1IXB A;  1ZLZ A;  2QWN B;  4QPJ A;  4A5U B;  1W66 A;  3MF2 A;  2HLD G;  2E65 A;  3EXA A;  4TSF G;  4J9Z B;  2X6A A;  3ZHU A;  4CC6 A;  3CD6 V;  1FFX B;  2GBO A;  4DV5 B;  3FX7 A;  1W2B U;  2DXU A;  3F5T A;  3AG3 B;  5H9C A;  4AQY B;  1KMI Z;  3QVN A;  1EM1 A;  5J9P C;  2EAY A;  4ZOL B;  2A0L A;  3APO A;  2Q7H A;  4ZIB A;  1PM9 A;  3W7X A;  3OEH G;  2CE4 A;  4LWS B;  4J11 A;  4K87 A;  3OFN G;  1HTT A;  5BMV A;  2YIA A;  2VQF B;  2CJB A;  4Q20 A;  4I7Z B;  2RHS A;  2ZE6 A;  1KB9 F;  1E79 G;  5K1X A;  4X65 B;  2GSM B;  1WPB A;  1BHB A;  4FJC C;  2XAJ A;  3N27 A;  4HA8 A;  1N9W A;  1JCH A;  1XQ8 A;  4JAV A;  4OPH A;  2EIM C;  5IT9 N;  1SQP H;  1SQB H;  3V8L A;  1EBO A;  3E86 A;  2Q5H A;  2L6L A;  4TWA A;  2P4K A;  5BMV B;  1NR7 A;  3E2E A;  1H2G A;  1VF6 A;  2W0F C;  5KA5 A;  3L70 H;  1AP6 A;  4YRR A;  1CPY A;  3RUX A;  3WQZ A;  3MDS A;  4MVO A;  1JJC B;  3MHH C;  3B09 A;  3E8F A;  3PCO B;  4K8X A;  4LF7 O;  2PYL A;  4X64 B;  1XUQ A;  3QTC A;  1KKC A;  4NYK A;  4K3A A;  4X8A A;  5IY5 C;  3UM7 A;  4YRE A;  3L73 H;  4JTC B;  1X2H A;  1K8A W;  1AR4 A;  5CA3 A;  1YCI A;  1K73 W;  1XIL A;  5LGU A;  5FL7 G;  1FPO A;  5HFL A;  2RDC A;  4O4I A;  1FAF A;  1G5I A;  4FFB A;  1KU9 A;  3NR7 A;  3TEH A;  1Z2G A;  4N21 A;  1Z5V A;  3K79 A;  5JQG A;  1ADY A;  2VRZ A;  1N32 O;  4H02 A;  4EFB A;  4OP0 A;  1IDS A;  5EC1 C;  5CN0 A;  3HXU A;  2UXN A;  4FPP A;  2UUC B;  5B5E Z;  1IBK B;  2QHU A;  2Q6A A;  3JAL A;  3SGI A;  3LUT B;  1M90 W;  4YHH O;  1GN3 A;  1Q6H A;  4DK0 A;  3HKC B;  4H2Y A;  1QNM A;  2CGN A;  1YSC A;  2ZZF A;  3HKB A;  5FPO A;  3L4G B;  3RVY A;  2QM8 A;  2UXC B;  2EUL A;  2ATK C;  4X1K A;  4LF8 O;  1ZSP A;  3T4D A;  1F23 A;  1K92 A;  3IFX A;  2XTI A;  3JAR A;  3D8C A;  4RDX A;  3WB2 A;  1YTF D;  5L3D A;  3G67 A;  4QNH B;  2ITD C;  3ZHR A;  1AIL A;  1OJH A;  3PZC A;  2CAZ C;  1KMM A;  4TV8 B;  1W0K G;  2IJK A;  4LF5 O;  3JAR B;  1NJ2 A;  1EN6 A;  1WA8 B;  3NXS A;  2WAM A;  1N36 B;  4Z1M G;  4ZHQ A;  4DV7 O;  1E22 A;  4DR1 B;  2HJD A;  4DV3 O;  5LMN O;  1SQG A;  3JAK B;  1KYO F;  3M99 B;  3JAM N;  1EVL A;  4TTV A;  1VQL V;  2JEX A;  1H4T A;  4O4L A;  5C8Y A;  4PJ0 Z;  2ZT7 A;  2ZZG A;  1NKD A;  5J2U B; 
#chains in the Genus database with same CATH homology
 4YRF A;  4R6Z A;  2ZDI C;  1V54 B;  3R07 A;  1XL4 A;  3SPG A;  2CJA A;  2FYK A;  3IAL A;  3QO5 A;  2A9H A;  2DYR B;  2W6I G;  4J15 A;  1B8A A;  4ZKI A;  2IJH A;  1BIA A;  2LFS A;  3IG2 A;  1B6Q A;  3AEI A;  3CCR V;  1ASY A;  2P7T C;  3LDC A;  4WJ4 A;  1Q82 W;  2ZT8 A;  5EK0 A;  1ZWI C;  1V54 C;  4ASU G;  5KUM A;  1OCO C;  4BIU A;  3IKM B;  2CK3 G;  5B1A B;  5EBW C;  1L1F A;  2ZNJ A;  1NJ1 A;  4WJ3 M;  3D36 A;  1WPX A;  2OTL V;  4XU3 A;  1SZT A;  4XTV A;  3REX A;  3GWO A;  1FYF A;  3B8N A;  1WPY A;  1OCO B;  3BEH A;  1SER A;  4WI1 A;  3ASO B;  3SPI A;  1PYS B;  3E35 A;  1S5H C;  4O2D A;  3CCL V;  1NH2 B;  1R3K C;  1YB3 A;  1GMG A;  2WLL A;  1QE0 A;  3HRI A;  3ABT A;  4XEO A;  4YRG A;  2A79 B;  1Z7M A;  1FXK A;  2Q68 A;  3L1A A;  3K03 A;  3AG2 C;  3HFZ B;  1K7D A;  2EWN A;  1K4C C;  4LVL A;  5E3I A;  1EZJ A;  3CP1 A;  2ZNI A;  4WFB V;  3LSQ A;  4HT4 A;  4H2V A;  5C53 B;  2IY5 B;  4UV8 A;  1X2G A;  5KNN A;  1EIY B;  3JD0 A;  4H2W A;  3ABU A;  4GCZ A;  2X6C A;  1ARO P;  3AG2 B;  1OCR B;  4H2X B;  4FIP C;  1PKX A;  4RUF A;  1VQP V;  3AG3 C;  1S76 D;  2ZR3 A;  4P3P A;  3VQX A;  2AMC B;  2DWE C;  3AG1 C;  2D3O W;  2ZR2 A;  2EIJ C;  3H01 A;  4EKW A;  4P73 C;  2NNU A;  4TVA B;  3UGT A;  3NEN A;  4YRS A;  4DO2 A;  3CCU V;  4JAU A;  2HVJ C;  1VQO V;  3G1Z A;  4YRT A;  1NR1 A;  1BL8 A;  1OHH G;  4G2K A;  5BZB A;  3HFZ A;  1G5H A;  5ELO A;  4HVC A;  2HVK C;  3OE7 G;  5LHH A;  3CC7 V;  1VQZ A;  4CH3 A;  3MEY A;  4P30 A;  3RF1 A;  1OCZ B;  2P90 A;  5IDJ A;  3ICA A;  3SJQ C;  2ALY B;  1R3I C;  3W3S A;  3V7S A;  1JJ2 U;  1YJW V;  3STL C;  2QM7 A;  1USY A;  4NCX A;  3E8H A;  4P74 C;  3UFG A;  3VBB A;  4P75 A;  3B8M A;  3CMA V;  5B1O A;  5EC2 C;  2AMC A;  3E9H A;  3CCJ V;  1WQW A;  2C8M A;  1YJN V;  4RUE A;  4HWO A;  5ELN A;  4YP0 A;  1HXD A;  2ZZE A;  2ARS A;  4JTA B;  3A7R A;  3RAC A;  1Y66 A;  2DYS C;  1OCC B;  4R50 A;  4HZ3 A;  3ETD A;  4PA3 A;  4LCU C;  3QO8 A;  3I7F A;  4CS2 A;  4P9P A;  3OUF A;  4LNS A;  2JK5 C;  4WCE V;  2W6J G;  1ROP A;  3HFV A;  1GM7 A;  1DLB A;  4WFH A;  4RQF A;  1QLE C;  3TEG A;  2DWD C;  4KR3 A;  3L4G A;  2X7R B;  3CXC U;  1GKF A;  2ODR D;  3RVZ A;  4YRM A;  3FB7 C;  2AHZ A;  1YGB A;  3BJU A;  3DSQ A;  3LNM B;  1X56 A;  4P72 A;  5DM6 V;  3MQZ A;  2G4C A;  1JX9 A;  1R3L C;  2I4N A;  3ZRV A;  3P8Y A;  1K5Q A;  5HGQ A;  2WLL B;  3LDD A;  4GX2 A;  4MTO A;  4WFE A;  3HXZ A;  1FXK B;  1HWY A;  4U7N A;  5CBH A;  2YEV A;  3RIR A;  1R73 A;  1KQS U;  1E1Q G;  2QHV A;  3TCU A;  1R3J C;  3DGE A;  5EBM C;  3TET A;  5LGT A;  4YRC A;  2RHQ B;  3OGC C;  2LFR A;  3GB7 C;  2ZIN A;  4PG3 A;  3D3I A;  4QPK A;  4P73 A;  4FK5 C;  5IY5 B;  2Z3Y A;  3OMA B;  4QIW F;  3V7R A;  3BY6 A;  3FYI B;  3RGL A;  4R7C A;  3CPW U;  1K33 A;  1V55 B;  2JDI G;  4UPA A;  4H2X A;  4MVM A;  2HJF C;  2XAH A;  4TWK A;  1R6N A;  2EJR A;  3LSS A;  4JYB A;  1QVF U;  4K86 A;  2Q69 A;  3HXX A;  1RPR A;  4YDQ A;  1NJ6 A;  4RQE A;  2WPD G;  2BOC C;  2X6B A;  3K0D A;  1S3J A;  4H33 A;  4HAM A;  1VQ9 V;  1S77 D;  4WFF A;  2P5I A;  1G8M A;  2EZO A;  2XOK G;  3BFM A;  3HXW A;  3K3W A;  1QR9 A;  1MSW D;  4P75 C;  1MOF A;  2IW5 A;  4QE7 A;  4MTG A;  2C2A A;  2OTJ V;  1KP3 A;  3FJP A;  1KOG A;  4WFA V;  3G71 V;  2HFE C;  2DTH A;  2H8P C;  3SPH A;  4MT8 A;  4E51 A;  4AH6 A;  2B1G A;  3RKY A;  2DQ3 A;  3X2Q C;  4LBE C;  1AR1 B;  3ZN0 A;  1PYS A;  2E1H A;  4PHC A;  4TVA A;  4TQF A;  4KUM A;  1L0W A;  1WYD A;  2ART A;  4TWA A;  5LBQ A;  3ZRW B;  4UP9 A;  4EO4 A;  5C52 B;  3K04 A;  3A7U A;  1ATI A;  1NYR A;  3T2M A;  3OAA G;  2EIN B;  3CCS V;  1GTO A;  5B1B B;  4PA6 A;  4XU2 A;  4PEL A;  2DW4 A;  4L87 A;  1M1K W;  1JVM A;  1X55 A;  2NLJ C;  4WF2 A;  4X88 A;  4XTY A;  1VQK V;  1MG1 A;  3ZMZ A;  1NVP B;  3SYQ A;  2DTI A;  2BOB C;  1B76 A;  5CMU A;  4BIZ A;  3E8G A;  2WLN A;  2IH3 C;  4I5S A;  3W7T A;  2XAS A;  1YI2 V;  5F5W A;  2P67 A;  2WSS G;  4JF3 A;  5L3F A;  3ABM B;  1BBW A;  1F4N A;  1FXH A;  2DXT A;  3E9I A;  4X5O A;  2EIL B;  1PD3 A;  1VQ5 V;  3K06 A;  2WLJ A;  1I5X A;  4HWS A;  1UJW B;  2YEV B;  2QEX V;  2IJI A;  3HRK A;  3TUP A;  4XTX A;  2CGH A;  2DKG A;  3A5Z A;  3A74 A;  1QF6 A;  2RHQ A;  2Z5U A;  1RIQ A;  4TVY A;  1YIT V;  1HC7 A;  2WLI B;  4GT1 A;  5DN6 G;  1GO3 F;  4MVS A;  4UVB A;  2EIL C;  3IGA C;  3ZN1 A;  1QLN A;  2DEQ A;  1AJP A;  1QCE A;  2HR3 A;  3R65 A;  2PI4 A;  1DF5 A;  3ASN B;  3K08 A;  4RMF A;  4Q15 A;  2Q7E A;  1X54 A;  3EHB B;  1J5W A;  2OCC B;  1H38 A;  4PDR A;  1JPX A;  1OZ0 A;  2H94 A;  3OMI B;  1SRY A;  3V7C A;  4H2S A;  2E41 A;  4GX0 A;  3PCO A;  1K3E A;  2ZCE A;  4I9W A;  2IU0 A;  4QE9 A;  5EBL C;  2K1E A;  3ZMS A;  3I55 V;  2OCC C;  1M9N A;  3MHS C;  1EQR A;  3ZIA G;  1K9M W;  1EIY A;  1FXK C;  2E3C A;  2WLI A;  2Q7G A;  4CS3 A;  1USY C;  3PJS K;  3CCE V;  3CMQ A;  2XAF A;  1KKD A;  3M4Q A;  1PNK A;  1WQ7 A;  2GHY A;  3ETE A;  4MTX A;  1AJQ A;  1KC8 W;  3HY0 A;  4BW5 A;  1NYQ A;  4UVC A;  2ARU A;  1M56 C;  4YXW G;  2ZQM A;  3OR7 C;  1NNH A;  5C51 B;  1G51 A;  4JGS A;  1AI5 A;  1Z7N A;  2ZXW B;  4ZBM A;  2R9I A;  2WLK A;  2Y69 B;  2HNI A;  1JOY A;  1E24 A;  4ZTU B;  1ENV A;  3WG7 C;  3CC4 V;  2CJ9 A;  3E89 A;  2FTK A;  2AKW B;  2P0L A;  2MK3 A;  1YIJ V;  5B1N A;  1KD1 W;  2P6J A;  3OM3 B;  4UUJ C;  1MAB G;  1OCZ C;  1GM8 A;  3IC7 A;  1BBU A;  3JYC A;  3MD0 A;  4DQ2 A;  2EIM B;  1NJ5 A;  2DYR C;  4LVM A;  4DXW A;  2I4L A;  3OEE G;  1EFW A;  1Y4M A;  4P72 C;  5L3E A;  1K5S A;  1C0A A;  3OW2 U;  3ABL B;  3OMN B;  1B70 B;  2DJZ A;  1AI7 A;  4UP8 A;  4G28 B;  2I4O A;  1GK9 A;  4X89 A;  3RL6 A;  3HXV A;  1B7Y A;  1NJ8 A;  4LP8 A;  1CEZ A;  2ZTG A;  4LC1 A;  4JPR A;  1OCC C;  1ORQ C;  1CP9 A;  2ZT6 A;  4OLF A;  1N8R W;  2DZC A;  2PI5 A;  2IU3 A;  1NJI W;  2DVE A;  4G84 A;  3VQV A;  2JJ2 G;  3G4S V;  2YSU B;  3FB5 C;  4MVR A;  2NS6 A;  4WFG A;  1VQN V;  3VOU A;  3K9A A;  2XAQ A;  2DDZ A;  1K4D C;  4MTF A;  1E1O A;  4HWP A;  4XTW A;  2ZIO A;  2EJ9 A;  1VQ6 V;  3P32 A;  3ETG A;  3A7A A;  3VQW A;  1M57 B;  1S0V A;  1RPO A;  4CH6 A;  5B1A C;  1ASZ A;  4UXN A;  1B7Y B;  4PA7 A;  3FYE B;  1YFR A;  4MS2 A;  1VQ7 V;  4G85 A;  2KB1 A;  4ZTZ B;  2ZDI A;  3SYP A;  4TVW A;  3A5Y A;  1AI4 A;  1EFR G;  2V7Q G;  2HKO A;  2JIZ G;  2EBO A;  2DZ9 A;  4EX5 A;  4UP7 A;  2DQ0 A;  3JCZ A;  3L2Z A;  1IXM A;  3STZ C;  3REU A;  1PNM A;  3ABK C;  1G4Y B;  3JD2 A;  1NVP D;  2E10 A;  4KP4 A;  2I4M A;  4P71 C;  3QNE A;  4KR2 A;  4MW8 A;  1NBM G;  4RO2 A;  3HPL C;  3SPC A;  4YRK A;  1F51 A;  2IH1 C;  4QPJ A;  1W66 A;  1Q86 W;  2Q5I A;  2HLD G;  3E8B A;  3MF2 A;  2E65 A;  4TSF G;  3JD1 A;  2EIK C;  4P71 A;  2ZT5 A;  1DTO A;  4J9Z B;  2X6A A;  5C93 A;  4BW9 A;  2J3M A;  3ZJZ A;  3MF1 A;  4YRQ A;  1WLE A;  3W7U A;  3CD6 V;  4CH4 A;  1KMN A;  1WU7 A;  4P3N A;  2B5U A;  3A32 A;  1W2B U;  2EJF A;  2DXU A;  1IL2 A;  3LDE A;  3AG3 B;  5H9C A;  2JEU A;  2EAY A;  3X2Q B;  5E1A C;  5J9P C;  3AG1 B;  4R8C A;  3HTZ A;  2A0L A;  1B70 A;  1RM1 B;  1P4R A;  2Q7H A;  1TUE B;  4ZIB A;  1LNQ A;  4BWA A;  4YPF A;  3ZRW A;  3JD3 A;  3W7X A;  4YRJ A;  4JYC A;  1X01 A;  2QE7 G;  3OEH G;  1K34 A;  3ERR A;  3UKM A;  4CH5 A;  2OT5 A;  3OFN G;  4XBF A;  4K87 A;  1JQ0 A;  2XND G;  3KG2 A;  4HWT A;  5B1B C;  1COW G;  5IYD O;  1BIB A;  3B77 A;  1HTT A;  4JTD B;  1RM1 C;  2CJB A;  4Q20 A;  4H2U A;  1M56 B;  1VQM V;  2RHS A;  3V8K A;  2V1D A;  2DU5 A;  3SYA A;  3LC0 A;  4DPG A;  1E79 G;  3OUS A;  2Y69 C;  5K1X A;  2GSM B;  4YRP A;  1BHB A;  3WG7 B;  4FJC C;  1PNL A;  2XAJ A;  5IYB O;  3ABM C;  1N9W A;  1JCH A;  4HA8 A;  4JAV A;  3T1C A;  4GX1 A;  2EIM C;  2F43 G;  2ITC C;  1Q81 W;  3RBZ A;  3ABL C;  4MVZ A;  1P7B A;  1H4V B;  3V8L A;  3E86 A;  1EBO A;  1FFT B;  2XAG A;  4MVU A;  4UV9 A;  1QLE B;  4XDL A;  1EOV A;  2Q5H A;  5GW7 A;  3EFR A;  1H4Q A;  2ZGW A;  1H4S A;  1H8E G;  3FB8 C;  4PA9 A;  1NR7 A;  3E2E A;  1AI6 A;  1H2G A;  2W0F C;  5KA5 A;  3F5W C;  2X0L A;  2QHS A;  2WWW A;  3CCQ V;  3NET A;  4KFM A;  4CS4 A;  2IJJ A;  4CBC A;  4YRR A;  2EL9 A;  2E64 A;  1CPY A;  3W7W A;  1DF4 A;  3RUX A;  3TEH B;  3WQZ A;  2WLH A;  3OR6 C;  1LYL A;  4XU0 A;  1E1R G;  4JAS A;  4MVO A;  3CYO A;  3MHH C;  1JJC B;  2QHT A;  2ZXF A;  3E8F A;  5KUK A;  3PCO B;  2ZD9 A;  5B3S B;  2AHY A;  2E5A A;  4YCW A;  3UGQ A;  3NEM A;  2DTO A;  4PDV A;  4X8A A;  3CC2 V;  2J3L A;  5IY5 C;  3QTC A;  2IY5 A;  1M57 C;  4MSW C;  4E2L A;  3UM7 A;  3NEL A;  4BAY A;  1X2H A;  4JTC B;  4P9O A;  1K8A W;  4YRE A;  4TT3 G;  1V55 C;  2EJG A;  1OCR C;  4K88 A;  1J95 A;  4XDK A;  5B3S C;  5CA3 A;  11AS A;  1GM9 A;  1E1T A;  3CCM V;  3A31 A;  5L3B A;  1K73 W;  5LGU A;  5FL7 G;  4P2Z A;  4HWR A;  5HFL A;  3I56 V;  4YRN A;  1AJN A;  3HB3 B;  2B1I A;  1THZ A;  3E83 A;  1G5I A;  3TEH A;  3QO7 A;  4N21 A;  3WFV A;  4Q6G A;  4FMT A;  4F4L A;  1JJC A;  2QKS A;  2Q67 A;  3W7S A;  3K79 A;  1PL0 A;  4YCV A;  1F4M A;  3EFS A;  3RKW A;  1ADY A;  2AKW A;  1SET A;  4H02 A;  3V8J A;  1YTF B;  1YFT A;  4OP0 A;  4XU1 A;  4PDL A;  4U7O A;  5IYC O;  4WF9 V;  1YHQ V;  4P3O A;  2ALY A;  2Y48 A;  5HFM A;  1GGM A;  2RHS B;  5EC1 C;  4YCU A;  5CN0 A;  3HXU A;  4YRL A;  5LHI A;  4P74 A;  2UXN A;  1FS0 G;  4FPP A;  1XL6 A;  5L3C A;  1NH2 D;  4LVK A;  5K1P A;  2JJ1 G;  2CIM A;  4XTZ A;  3ZMT A;  1BHA A;  3IKL A;  1VQ8 V;  2QHU A;  2Q6A A;  3LUT B;  1R6K A;  1M90 W;  4YRO A;  1QR8 A;  5H6Q A;  2C7I A;  3ASO C;  2EIN C;  4H37 A;  2A8E A;  2QTO A;  3M4P A;  3UH0 A;  4KQE A;  1H8H G;  2DU7 A;  4H2Y A;  3RKX A;  1YSC A;  3SYO A;  2ZZF A;  3FKS G;  3L4G B;  3HY1 A;  3RVY A;  3ZRS A;  2QM8 A;  4TQD A;  3P8V A;  4PA4 A;  3EFF K;  2ATK C;  5CBG A;  2QA4 V;  1YJ9 V;  3T4D A;  3DTU B;  3CCV V;  1F23 A;  1K92 A;  3IFX A;  4QJF B;  5KA6 A;  2XTI A;  3P30 A;  4RDX A;  1QBZ A;  4XTU A;  3CME V;  5CBF A;  3OD1 A;  4GX5 A;  4MVQ A;  1NQT A;  4LVI A;  1YTF D;  2UXX A;  5L3D A;  4J9Y B;  4QNH B;  2ITD C;  2EIJ B;  3ZCC A;  1YFS A;  5LGN A;  4HYO A;  3RW0 A;  2R9R B;  1S72 V;  1I5Y A;  2XGT A;  4LVJ A;  4CZZ A;  2LP7 A;  3JD4 A;  4G27 B;  3ASN C;  3T4Z A;  3ABK B;  2PME A;  3PZC A;  2HG5 C;  1FXV A;  4XEM A;  5H6R A;  1KMM A;  1W0K G;  3VQY A;  2IJK A;  1VQ4 V;  2ZIM A;  1W0J G;  1KP2 A;  4XDJ A;  2PMF A;  1NJ2 A;  4RAI A;  4H2T A;  3NXS A;  2WAM A;  1BMF G;  4Z1M G;  1K97 A;  3ZMV A;  2EIK B;  3K0G A;  3HXY A;  3G6E V;  1E22 A;  3AG4 C;  5L3G A;  1SES A;  1KEC A;  2EZP A;  4PDM A;  3A0R A;  1WNL A;  3KFU A;  3ZRX A;  2WLM A;  4YYE A;  4N23 A;  12AS A;  1Q7Y W;  4MW3 A;  3F7Y C;  3ML0 A;  4YRI A;  3M99 B;  3TK1 A;  4UVA A;  1EVL A;  2DYS B;  4OXS A;  1ADJ A;  3F7V C;  2ODR C;  3AG4 B;  3P8T A;  1QVG U;  2M7W A;  4TTV A;  1VQL V;  2JEX A;  5LHG A;  1H4T A;  2ZXW C;  1EVK A;  2ZT7 A;  3SYC A;  2ZZG A;  1NKD A;  3ZMU A;  3SPJ A;  3FB6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...