4RQFA

Human seryl-trna synthetase dimer complexed with one molecule of trnasec
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
475
structure length
451
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTMMDKVEFVHMLNATMCATTRTICAILENYQTKKGITVPEKLKEFMPPGLQELIPFVKPAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
molecule keywords selenocysteine tRNA
total genus 130
structure length 451
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqfA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqfA02
4KR2A 1NJ8A 1WNLA 2ZR3A 4XEOA 4YRRA 1WU7A 3P8TA 4XU2A 3QO7A 4OLFA 1EIYA 5F5WA 2AKWB 1E1OA 3ERRA 2E10A 4YRLA 4YDQA 3L4GA 2QHSA 1WQ7A 3RL6A 4ZTUB 4H2UA 4UP7A 1E1TA 5ELOA 1NJ1A 4CH3A 4K87A 3IKMB 1WLEA 3RIRA 1YFSA 3HFZA 1PYSA 3G1ZA 3NELA 3IKLA 3V8JA 1B70B 2QHUA 1BIAA 3A7AA 12ASA 3KFUA 2RHQA 3EFSA 2P0LA 2P5IA 3FJPA 2PMFA 2DXUA 5ELNA 4HA8A 4YYEA 3RKXA 3A5ZA 4YRQA 2HNIA 3P8VA 3VQXA 3V7CA 2DXTA 2J3LA 2I4MA 2ZINA 4H2XA 4YRIA 3A7UA 1ASYA 3HXXA 2DU5A 4YRJA 2CJAA 3A74A 4P75A 2EJ9A 3HTZA 3A31A 1RIQA 2EWNA 1H4QA 1EIYB 2C8MA 3REUA 4Q15A 2AKWA 1W66A 3HXWA 4AH6A 4YREA 2FYKA 4XU0A 4XTYA 4EO4A 3RGLA 2ZGWA 3OD1A 4P72C 3NETA 1NYQA 2Q7GA 3HXVA 1X54A 4HWOA 1X55A 1L0WA 4XTUA 4P3NA 1FYFA 4L87A 4TWAA 2ZT8A 2DTOA 2ZIMA 4P73C 3TEHB 1B76A 1VQZA 4O2DA 1HC7A 4RMFA 1ATIA 2ZT5A 4KR3A 4TQDA 2EJGA 2EAYA 4YRSA 5C51B 2DQ3A 4YRNA 4ZIBA 1B8AA 4P72A 4WJ4A 4J15A 2ZR2A 1B7YA 3IG2A 4TVYA 2QHVA 4G84A 2DJZA 3RKYA 2CJBA 4Q6GA 2DZCA 2Q5HA 4K86A 3TEGA 1SETA 2CIMA 2RHSA 1YB3A 2RHQB 2CJ9A 1B7YB 4YCUA 4YCWA 4PHCA 3V8KA 4UP8A 1Z7MA 1J5WA 4DPGA 4YRGA 4HWSA 3HRKA 4P75C 3LSQA 4WF2A 3LSSA 3M4QA 1IL2A 4BW9A 4WI1A 1X56A 3VQWA 4LNSA 3IALA 4TQFA 1ASZA 1YFRA 3V7SA 2ARTA 1YFTA 3QO5A 2ARSA 1WQWA 4H2VA 2CGHA 1ADJA 2DTHA 3QNEA 4H2TA 3LC0A 4G85A 1Z7NA 3HXYA 3UH0A 1BBUA 4YRFA 1EVKA 3UGTA 3CMQA 3REXA 2Q7EA 3EFRA 1WPYA 2DQ0A 4XTZA 4RQFA 4EX5A 2ZNJA 1KOGA 1LYLA 1E22A 4P74C 1KMMA 2EL9A 1BBWA 1G51A 4UP9A 1H4VB 1X2HA 1QE0A 3P8YA 3HRIA 2ODRD 2DVEA 1E24A 4HWTA 2E41A 2AMCA 1EFWA 4DQ2A 2DDZA 4HVCA 1H4SA 3UGQA 2PMEA 3M4PA 4YRMA 2IY5A 3MEYA 1NJ5A 3UFGA 11ASA 3DSQA 2I4NA 1BIBA 4KQEA 2E3CA 3NEMA 2DTIA 4E51A 4PG3A 1HTTA 2Q5IA 3RACA 3BJUA 4CS4A 1ADYA 1C0AA 3TEHA 2ALYB 2DZ9A 4WJ3M 2ZNIA 4CS3A 2XTIA 4XEMA 4K88A 2ZZEA 4P3OA 3RF1A 1X01A 3I7FA 5K1XA 2DU7A 3HFZB 4OP0A 3E9HA 5K1PA 4YPFA 5C52B 3PZCA 2DEQA 3RUXA 4X5OA 3W3SA 2I4OA 2AMCB 4XU3A 4RQEA 2ZCEA 3HY1A 1NJ2A 4P71A 4P3PA 2ARUA 4H02A 4YRTA 1X2GA 2RHSB 1N9WA 1SRYA 3V8LA 1QF6A 2Q7HA 4TVAA 3QTCA 2I4LA 1G5HA 3L4GB 3HFVA 1NJ6A 4H2SA 3MF1A 4P73A 3PCOA 3HY0A 2ZIOA 3E9IA 1EOVA 4TVAB 1EVLA 4XTWA 3V7RA 3L2ZA 3A32A 4ZTZB 1HXDA 5KNNA 5C53B 1JJCA 4HWRA 3MF2A 3VQYA 4HWPA 2E65A 4XU1A 3HXUA 4CS2A 2ZZGA 3RKWA 2E1HA 4XTVA 2ZXFA 1USYC 1NNHA 2QHTA 1EQRA 2ZT6A 4H2YA 1JJCB 4RDXA 1SESA 2ALYA 4CH6A 4CH4A 2ODRC 2ZZFA 3QO8A 1YGBA 3L1AA 2ZTGA 2ZT7A 2J3MA 3WQZA 4YRKA 4P74A 1WYDA 4YRCA 3ICAA 1NYRA 1G5IA 3TUPA 1KMNA 1PYSB 4CH5A 3R07A 4YP0A 5E3IA 4P71C 1H4TA 2E5AA 1B70A 4UPAA 4TTVA 3A7RA 4YROA 1USYA 4NCXA 1SERA 3VQVA 2DKGA 4TVWA 2IY5B 3BFMA 4BWAA 2C7IA 5HGQA 2EJFA 1GGMA 3PCOB 4XTXA 3A5YA 2G4CA 3HXZA 2E64A 2XGTA 3VBBA 4YRPA 4H2WA 4H2XB 3NENA 4YCVA
chains in the Genus database with same CATH superfamily
3G6EV 2ITCC 5H6RA 1JOYA 1MZFA 4XEOA 4YRRA 1OCCB 2PF4E 4OGQB 2ARHA 3FFQA 3E35A 2CTWA 4JAVA 1E1OA 4U3JA 5KX5B 2X7RB 4IT5A 2QHSA 2QWQB 4PI0A 2GV9A 5GONB 3RL6A 4UCSA 3AG1C 2F66C 4UCVA 4DK1A 3U0ZA 3G6BA 1NR1A 2DMXA 4CC5A 5A2QN 2RNBA 3P3PA 2LQTA 3UKMA 2ETNA 1YFSA 3NELA 3UO3A 3N2KB 4EB6B 2E5LB 2CTQA 1I7FA 4I7ZB 1PNKA 1BIAA 2RHQA 3E83A 1KU9A 2P5IA 2F4VO 1Z5WA 2R9RB 4XDKA 2KB1A 3J7AU 1O9HA 3F7VC 4DV4O 2M7WA 2HNIA 3CRCA 2PY5A 4LF9B 2JGDB 2ZINA 4MVRA 1GN6A 3JAWA 3D8CA 4DR5B 1ZLZA 4UV8A 2RMKB 1L1FA 2XAQA 4LFCO 4PV1B 1B3QA 1RIQA 3CRRA 3BA9A 2WA3A 1BL8A 5CA0B 2AKWA 2RQ6A 3TXSA 4AH6A 1B06A 4YREA 1GM8A 1E1QG 4XU0A 4PHZA 3EXAA 5LA6B 2ZE7A 2ZGWA 5EYPA 3OD1A 5CA3A 4BIZA 4JI2O 3HXVA 2BTQA 3UO2A 4HWOA 2UUCB 2B9ZA 2YEVB 3ZMVA 4XTUA 4TT3G 2L6LA 4MVSA 4NVPA 4P3NA 4NKGB 3ABTA 3APOA 4L87A 1SS3A 3SYOA 3CD6V 3ABUA 2ZIMA 1TGOA 4P73C 3TEHB 1ZL8A 5KX5A 1B76A 2EX3A 3RYHB 4DV3B 3K03A 3QVNA 1Y67A 4RMFA 3JD3A 1Q86W 2ZT5A 4KR3A 1Y76B 4TQDA 3T2MA 1WNSA 2QWRB 2EAYA 4AI8A 2P06A 4B7EA 5C51B 4YIPA 4J80A 1YJ9V 5LP6A 2LGQA 2ZR2A 5LOVA 4FIPC 4F6RB 3IJ4A 1K33A 1KKDA 3K08A 1Z2GA 2ZE6A 3DXRA 2DJZA 4MTOA 4Q6GA 2CJBA 3RT3C 2DZCA 2PI4A 3N2GA 1QLEB 2X0LA 3APQA 2Q69A 2Q5HA 1WA8A 1WB7A 1S0VA 3HB3B 1SETA 3K06A 2UUAO 2UXDO 4R50A 3RN4A 1BT8A 4U3JB 1DF5A 3ZMZA 4ASUG 1LUWA 3QF7A 4FFBB 5LYJA 2CAZC 3K04A 2UXDB 4Z1VA 2ZE5A 1Z7MA 1J5WA 2RDCA 3T1YB 1SA0A 1Y6XA 2E74B 1WJZA 4EB6A 4RAIA 2XTAA 4FM2A 5JCOC 1H2KA 2JK5C 4O4IB 1OCCC 3HPLC 2CH7B 1IL2A 4X8AA 1X56A 4AILC 1MMMA 4LVLA 4JYAO 1ASZA 1YFRA 4PA6A 3JASA 3ZBHA 4LF4B 3V7SA 1KECA 1YDXA 1I94B 3B77A 5D5QA 4X65O 1YITV 2D3OW 3TGUH 3OE7G 4ZOLA 4FLYA 4MVMA 1XMOO 2EZPA 2UU9O 1EN4A 4N21A 2IH1C 1V54B 3K5LA 3ASNC 3ZEDA 3HKBB 4G85A 3STLC 4OPAA 1K8AW 3LNNA 2QJ1A 4J10A 4YRFA 5JCOA 4O4JB 4U7NA 4RWUA 3REXA 1JPXA 1GH6A 1K73W 1O9GA 4DO2A 3L75H 4DR5O 3RFRA 1KD1W 4XTZA 4EX5A 1U97A 4B3TO 1LYLA 2C2AA 5KHHA 1N36O 1KMMA 3AG4C 2Q67A 4X62O 3UCSC 2ADQB 1H4VB 4DR4B 1QE0A 2DJVA 2AHZA 1E24A 4X66O 3O65A 1P4RA 1TA8A 4IIJA 1EBOA 3JCZA 2AXTZ 4JZ2A 5LXTB 1GK9A 1R6KA 3M7MX 1TUBB 2BSKB 3JSNA 1W59A 2HG5C 4QE9A 2OTJV 3I55V 1SA0B 4UUJC 4W4KA 3OUFA 1QLEC 3NEMA 2P7TC 5LXTA 2DTIA 1HR0B 1ORQC 2AHYA 4O2BB 1HTTA 4LF7O 4UV9A 2Y0IA 3RACA 4JI0O 3L9DA 4CS4A 2R9AA 1S76D 2QTSA 3K9SA 4Q20A 1M56B 1IBLB 3OUSA 2ALYB 2DZ9A 5J9PC 4MVOA 3CWBH 3L74H 1IX9A 1S3JA 3TJTA 3RF1A 4BIOA 3CB2A 4UB6Z 4JV5B 2FKXA 4J7KA 3RWRD 4H0LB 3E9HA 4B3SO 3ASNB 2ZT9B 3EVKA 4DV1B 3OGIB 2DEQA 4X5OA 4DUZB 4B3RB 1QCEA 1XHXA 1IXBA 1XL4A 4P3PA 4P71A 5F2VO 3T4DA 4O2AA 3KCXA 4I50A 3RYFA 2Q4PA 1VQ9V 1KP3A 4LNUA 4MTFA 4TVAA 4D7TA 3OTOO 2IJHA 3J80N 1BE3H 3HFVA 4O4HB 4H2SA 2EIJC 3JASB 4DR3O 1R3IC 3W7SA 4HT4A 1RP3B 3IFXA 3MHSC 1GKFA 1IURA 3SYAA 5B1AB 1TUEB 1N32B 3JARA 2DW4A 1RPRA 1BQ0A 1AB3A 1Q6IA 4JAUA 2HVJC 4TVAB 2EIMB 1OJHA 1F23A 3JAMN 4FM0A 3DC5A 1MABG 2WWWA 3K0GA 3OEHG 4PA7A 2NN4A 1KKCA 1FXKA 3OFNG 1HXDA 3JD2A 3CJHB 1JJCA 1VQ8V 2Q0OC 2JGDA 4XDJA 4ZI7A 3OAAG 3HXUA 1OV9A 3E2EA 3CCLV 2QKCA 1JX9A 1UJWB 2V7QG 2E1HA 2BTOA 1GM7A 5IYZA 2ZXFA 1USYC 1EQRA 3CYOA 5A9GA 2ZT6A 4QGPA 3GVMA 4JI8O 2JJ2G 3ZRWA 4B3TB 4CH4A 3K58A 4N23A 2XAGA 3QO8A 3FAVB 1K3EA 3KZIZ 2OIGA 2ZKOA 3ZN1A 1YEWA 4F4LA 2Y4UA 1NYRA 5BMVA 3WB1A 3TUPA 1PYSB 4DRXA 2DN9A 4WFAV 3N2KA 4MSWC 2E5AA 1B70A 3ZRWB 5JJEB 1PPJH 4DR1O 2KQXA 5JH7A 4X65B 5FLXN 1VF5B 3SPCA 5IY5B 1DK1A 4NCXA 4O4HA 3CRQA 5IDJA 2IU3A 4BWAA 5EBWC 1JA8A 2Q6AA 2CE4A 4UCTA 2XGTA 5H2FZ 1YVWA 1BMFG 4DV5B 1QVGU 1LNQA 3CC2V 3IAYA 2X6CA 1QVFU 1WNLA 3L73H 5DEDA 5JH7B 2CH7A 1EZJA 1NVPB 3FB7C 5KA5A 2H3OA 1WU7A 2ILMA 1AI6A 4OLFA 3CE2A 3OM3B 4YJ3B 5F5WA 3U10A 2AKWB 2VQFO 1WP8A 5EBLC 3H1JH 4YDQA 1WQ7A 4XDLA 2K9PA 5KHKA 5KMGA 4UP7A 5AG2A 3CEIA 3E22B 5ELOA 4B08A 2BTQB 4UXNA 1KC8W 1UPGA 1NJ1A 4K87A 1G6UA 1WLEA 3RIRA 3ML0A 3IKLA 1NU1H 1N8RW 3V8JA 3L70H 2WLHA 1XMQO 2EIKB 3A7AA 3X2QC 3FJPA 5L3BA 4Z2WA 2DXUA 4HA8A 3A2FA 1QR8A 3ASOC 4YYEA 3T1YO 4JI6O 4YRQA 4LFBB 3OEEG 3P8VA 4I0XB 1SQXH 4TV9B 4CBCA 1YCIA 2KSDA 2J3LA 1AROP 2PGGA 4YY3B 2OCCC 3FYEB 4YRIA 2VQEB 2NS6A 3A7UA 4PA4A 4DUZO 4B3RO 1ASYA 2GUZB 4TOIA 3HXXA 5KAIZ 2DU5A 4I9WA 3JATA 2CTPA 4YRJA 4K8XA 1KUQA 1EIYB 4DV2O 3REUA 1D5NA 4Q15A 3STZC 4IL6Z 2EINC 4GCZA 2FYKA 4EO4A 3G4SV 1IBMO 1K92A 3W7WA 2OWOA 1G4YB 1L0LH 3RGBA 4BAYA 3JCUZ 1H2MA 1Q82W 5IJ0A 2Q7GA 2RJZA 2VQFB 1X55A 1I08A 2HVKC 1HWYA 3K5OA 3E8HA 3ZHQA 4J41A 4E2LA 3F5WC 1CEZA 2ZT8A 1Q6HA 4B3MO 4YIOA 2QA4V 3C3SA 4DW1A 4P30A 1VQZA 4O2DA 4JTDB 3CX5F 1YF2A 4GX5A 1FYJA 4X64B 4R7CA 1ATIA 3B8MA 3SDLA 3W7TA 2PYLA 3P30A 4FLTA 2VWJA 1YTFB 4QNHB 1RPOA 1FXHA 4YRNA 4ZIBA 3PJSK 1B8AA 2HJFC 1NT2B 2NLJC 4P72A 4JYCA 5GONA 2H94A 2Z3YA 2GDSA 2Y0PA 2MW2B 4TUYA 4GKKB 2DOSA 1WAZA 1R73A 4IHJA 3W7XA 3CRMA 1VQMV 4K86A 2HP8A 3TEGA 3RVZA 5BR8B 2RHSA 4J9ZB 2ZDIC 3RVYA 5CBHA 2UXBB 1XDCA 2M6YA 3BPZA 3R65A 4UVBA 1B7YB 3ABMC 3OR7C 4PHCA 2YIAA 4UP8A 3AG3B 2F43G 5BR8O 4R6ZA 3CCEV 2EIMC 4YRGA 1Z5VA 2GTSA 4UVCA 4I4TB 2AZ2A 4DV4B 1SZTA 2W0XA 1N4CA 1EN6A 3CP1A 5KMGB 1HNZO 2GSMB 4H44B 1ENVA 3BCCH 3M4QA 2QDOA 4RO2A 1Y74A 2Q68A 5BY1A 3VQWA 3IALA 1SQQH 4ABMA 3E89A 3FX7A 2WLIB 3ZX6A 5CBFA 3F5TA 2W6JG 1NTMH 4HYOA 4JI4B 3QO5A 2E76B 3JALB 2QM8A 4H2VA 5CN0A 1QNMA 4MW3A 3ETGA 3CMEV 3T1CA 4F6EA 2MK3A 1XHZA 3TETA 4LF5O 1R3KC 4YHHB 3FD9A 2F93B 5JJNB 4MS2A 5FNVB 1XMOB 1SF9A 4KL1A 1KBHA 4IGGA 5J2TA 3BEHA 4JYYA 1IBMB 4E4EA 1HNXO 4RQFA 2ZNJA 4K0KO 1KOGA 2HR3A 1R3LC 3ZRXA 2EL9A 3CC4V 1PNMA 5LMNO 2Y69C 1J5EB 5LA6A 2KG7B 2LFSA 1E79G 4CZZA 4TWKA 3J81N 1ZAUA 5B3SB 2E41A 4GX1A 4LVIA 3ABKB 2WLKA 2P5OA 2N05A 4HVCA 3WB0A 1PV0A 3UGQA 3SJCC 1P84F 1N34O 3FB5C 5LYJB 4OPHA 4X1YA 3I56V 4DUYO 1NJ5A 3UFGA 11ASA 1VQKV 1EM1A 3SPJA 3CCQV 2E3CA 2QKSA 1GO3F 1JVMA 2UUBO 3AG2C 4QPJA 4E51A 4PG3A 4IHJB 1VF6A 3D3IA 5L3CA 2Q5IA 5LMUO 4OX9B 3BJUA 2WLIA 2GTAA 4GX2A 1IVSA 1WPXA 2EULA 3DGEA 2ZNIA 4CS3A 1VQLV 1GN3A 4JI1O 4K88A 2ZZEA 4P3OA 4P2ZA 3RYFB 3I7FA 1BS3A 1MZEA 4WCEV 3ZRVA 2IJJA 2A79B 1V54C 3W3SA 1M4UA 4DR1B 2AMCB 4ZOLB 1Y66A 1KQSU 4DXWA 1W0KG 4X9QA 3IC7A 2ZCEA 3HY1A 1NJ2A 3ZMSA 3RBZA 3WG7B 3H1HH 3CPWU 4YRTA 4PDMA 2XT9A 2P6JA 1SRYA 4WFHA 2Q0AA 3K5NA 3MHHC 3V8LA 2GBOA 2I4LA 2JJ1G 3N27A 3HKDA 3L4GB 1Y4MA 1IZ3A 2H8PC 2FYUH 1AJNA 5B1OA 3MF1A 2A8EA 4I5SA 3ABLC 1X59A 1Q6UA 4FLXA 1NI8A 5B66Z 2WAMA 5CA0A 1AI5A 5C93A 5LP6B 2B5UA 3LUTB 1VF7A 5JQGB 4LWSB 4XTWA 3V7RA 1M5IA 4O4LB 5IYDO 1I94O 1G1XB 3L2ZA 1AI4A 2CK3G 4MTGA 4ZTZB 2QWPB 5EIBC 1FXVA 4DR7O 4O4JA 4X1IB 1N34B 4JYAB 5KUMA 4HWPA 2Z0AA 2DYRC 4P9PA 3RYIA 5LHGA 3JATB 4LF8B 2A0LA 3C90A 4PI2A 5LMUB 4LBEC 1CXZB 3GB7C 4KFMA 3QG5A 4H2YA 2X6AA 1D5AA 4O4IA 2E75B 4PD4F 2ALYA 5J2UB 2ODRC 4WFFA 3L1AA 4QE7A 3KCYA 2ZTGA 1OCOC 5HFMA 4X20B 2PZSA 3C3TA 1M1KW 1WYDA 4X89A 3ICAA 4KHPB 1SQGA 2OTLV 1G5IA 3OW2U 1KB9F 4UFZA 1RM1C 5H9CA 4TTVA 2A7WA 2YXLA 2ZXWC 4HAMA 4DV1O 4I9QA 4KXRA 4LFAO 4FM1A 3B4SA 1DLBA 4BW5A 2IY5B 4LFBO 2YIBA 2VS0A 3A5YA 2DE0X 2KKWA 2G4CA 4LF8O 3BY6A 4Z1MG 3BRCA 3BABA 1UFIA 1NJ8A 2Q8VA 1GMGA 1VQOV 3P8TA 4CC6A 1PP9H 3CC7V 1Y76A 4UB8Z 4ZKIA 1TAEA 1A32A 2DYSB 3D36C 4G27B 1KMIZ 2DWEC 4EEQA 4YRLA 2XOKG 3L4GA 4JAAA 4H2UA 3TXQA 1FXKB 3RYCB 1TUBA 3JYCA 3IKMB 1Q43A 1NJIW 3OR6C 1GTOA 2JGUA 1N33B 4TV9A 3G1ZA 3HFZA 2YC0A 2Q73A 5BXZA 1VQ7V 2ZE8A 1RSOB 4WBNB 2EIKC 12ASA 2WA4A 3CS5A 3EFSA 4ZHQA 4DV7B 2PMFA 1YZBA 5ELNA 3NENA 2LW1A 5LHHA 5EZYB 1OCZC 4FFBA 3E8FA 4NB5A 5KHIA 3RKXA 3FKSG 4FLVA 3A5ZA 3V7CA 4P9OA 2I4MA 2IBZH 3CCMV 5BZBA 4H2XA 1WPBA 1V55B 1CPYA 2YXYA 3B2EE 3RYIB 2E5LO 2XASA 3A74A 3CRAA 4G2KA 5B5EZ 2EJ9A 2P4KA 1GRJA 5B1BC 1H4QA 1BZKA 4X62B 1WN7A 1YIJV 2P22C 2C8MA 1AVMA 4GKKO 5TISZ 2HJDA 3RGLA 2IM9A 4JI3O 2Y48A 1QQCA 4NXNO 2ZQMA 3K0DA 4P72C 3NETA 2LO1A 5JJJB 2YI8A 1P7BA 1H2LA 1X54A 1L0WA 3CCSV 1FYFA 1R6TA 3HKBA 2UU9B 2EJRA 1J95A 2QE7G 1XNQO 1XQ8A 3UM7A 1RM1B 5ITZA 1HC7A 4RUEA 1IXMA 1FFXB 4MVUA 5LGNA 3K59A 3RYCA 3JARB 4JI6B 2DQ3A 3SJQC 3Q4HA 4FPPA 3CCUV 2WLJA 4WJ4A 4DR2O 1B7YA 4PA3A 3M99B 3TCUA 1XMQB 4MVQA 2QHVA 4G84A 2A9HA 3OMAB 1N32O 1SKVA 3O9OA 2IJKA 2UXNA 2XAJA 1Q7YW 2UUBB 1F7YA 4YXWG 2RHQB 4K0KB 4JTCB 2XAFA 1VP7A 4UCUA 2YSUB 1SQPH 5IYZB 4YY3O 1S5HC 1FPOA 3V8KA 2GUZA 4X1KB 3VOUA 1XNRB 1JFFB 3JAKB 1HP8A 3HRKA 1H2NA 3ZHUA 4H37A 4P75C 5IJ9B 2RCVA 2DYSC 4JGSA 3LSQA 4WF2A 3LSSA 4LWSA 1MG1A 4C7UA 4DV5O 1VQ4V 2A3QA 2QM4A 4LNSA 3F7YC 3NXSA 1XEQA 4JI7B 4WFGA 5CBGA 2YS8A 3NR7A 5CMUA 1B6QA 3SPHA 3OMIB 4ZHQB 2ARSA 1WQWA 4PDRA 4LVMA 3P3NA 1M90W 2R72A 2CGHA 1GAXA 1XNQB 2A06H 3QNEA 1XOUA 3DXRB 4GKJO 2KG7A 4ICGA 4LH7A 4LF7B 4YHHO 1Z7NA 3R66A 3ZHVA 1R1BA 4I50B 2UUCO 1BBUA 2Q9LA 3HXYA 3UGTA 4NYKA 3CMQA 3UH0A 4LNUB 3S3XA 3EFRA 2EILB 4DW0A 5JVDB 4FVMA 2UXCO 1IBKO 4JI3B 1WPYA 1MNGA 1FS0G 1OCOB 4AQYO 4DV0O 4UCRA 4JZGA 3THOA 3WU2Z 1E22A 4P74C 5D5PA 1BBWA 1FKAO 2JVDA 1Q90D 4DRXB 1YTFD 1Q8IA 4FZ0A 1X2HA 4AHCA 4LFCB 3P8YA 3HRIA 2DVEA 2CTRA 4BIUA 1NH2D 1YSCA 4X88A 3E8BA 4NTYA 1PL0A 2B1GA 1JQ0A 1EFWA 2OIEA 5IWAO 4JI5O 4DQ2A 2QR4A 5ITZB 4K8ZA 2N04A 3LDDA 4YRMA 3AG3C 2IY5A 1TVKA 3MEYA 3KKYA 2VWKA 4R8CA 3SYQA 2YDEA 1BSMA 5IJ9A 2WSSG 3SJBC 3HKDB 1LUVA 1S72V 4DV7O 4KQEA 2BOCC 3BHPA 4JI8B 1PL4A 1R3JC 2WPDG 1D2DA 1N33O 4YJ3A 5KA6A 2VRZA 2F1MA 1TVKB 3JAWB 4FLWA 1C0AA 3ABLB 1HW7A 3T1HB 4WJ3M 4WFBV 1NZ6A 2QEXV 4XEMA 2LW7A 5C8YB 3MQZA 4HNAA 1U96A 3HKEA 1QHTA 1RFYA 4JPRA 3ZMTA 5K1XA 1X01A 1E1RG 1IDSA 2OT5A 4J7ZA 3K79A 2DU7A 4UCOA 3HFZB 1FJGO 3D3QA 3JALA 5K1PA 1Q81W 4YPFA 5C52B 3WG7C 4LFAB 3PZCA 2NR5A 4D7SA 3MDSA 3ZS8C 2R70A 3L71H 1DF4A 4DK0A 5EYPB 2VQEO 1OHHG 4OXSA 4XU3A 5E1AC 5JVDA 3JAKA 4B3MB 1K7DA 1I5XA 2B1IA 3N2GB 3ZRSA 3HKEB 2QWOB 4PDVA 4JV5O 2ARUA 4H02A 1HNWO 2YEVA 5H6QA 1BGYH 1N0NA 5EBMC 5IT9N 3QTCA 1R6NA 1ZSPA 3FB6C 3AK2A 5LBQA 1QU7A 5DN6G 1AR4A 4QJFB 1SC5B 4PA9A 4A5UB 3GWOA 2L35A 3OMNB 4P73A 4X1IA 2HFEC 4U3FH 3PCOA 2UUAB 5CB4B 5EC1C 3B8NA 3HR0A 5EK0A 1GN2A 3E9IA 1RSOA 3AEIA 2CGNA 1EOVA 1EVLA 1QR9A 4IIJB 1NKDA 2PUSA 1H8HG 2PYJA 3A32A 5IE9A 3K5MA 3DTUB 1S5JA 1NS1A 3H1IH 1FJGB 5KNNA 4W4LA 1VMGA 1XREA 4HWRA 3VQYA 2OYQA 1JCHA 4X20A 2JRIA 2ZZGA 4FLZA 1K4DC 4XTVA 4JI0B 1NNHA 3CMAV 4LCUC 5JWPA 2QHTA 4EKWA 1XILA 1HR0O 1XL6A 1ZX3A 3S3WA 3AK3A 4MW8A 4RDXA 1I0HA 4LF6O 1SESA 4ZBMA 3BAAA 5LGTA 1YGBA 1SZXA 2YIDA 1MOFA 2J3MA 3WQZA 2UXBO 4YRKA 4P74A 4YRCA 2F23A 2EILC 1QBZA 5L3EA 4WFEA 5LHIA 4CH5A 4YP0A 2BOBC 4P71C 4B7KA 4FZ1A 3SYCA 1US6A 2W0FC 1G8MA 1H38A 4D6TH 4DR4O 1SERA 4TVWA 1YI2V 4LF4O 3BFMA 4TV8B 1JFFA 2C7IA 5HGQA 2EJFA 1N36B 1GGMA 4WF9V 4XTXA 3CXCU 4GZRB 4TSFG 4AQYB 3HXZA 4YRPA 3BVOA 5B1BB 3HKCB 4YCVA 2EINB 5KAFZ 4KR2A 1ZL8B 2ZR3A 3CXHF 1P7GA 5FPOA 4LP8A 1JR9A 4XU2A 3QO7A 5B1NA 1EIYA 3G71V 4NXMO 4TV8A 3PN1A 3ERRA 1FAFA 2E10A 2OCCB 1HDJA 1OCRC 4ZTUB 5KHGA 5KLVH 3ABMB 1E1TA 4UVAA 3TK1A 2IW5A 4X1YB 4CH3A 4TUYB 2QGNA 3ASOB 2BSKA 3ETEA 4JI7O 1M93A 3G80A 1PYSA 4MVZA 4J42A 4NTXA 2JEXA 5FNVA 2P90A 1B04A 1B70B 2QHUA 3BFRA 4GT1A 3KFUA 2P0LA 2DYRB 1FXKC 1ZUQA 2XAHA 3IGAC 1QLNA 2IH3C 3I5DA 5CB4A 1OCRB 2P67A 4KUMA 2WLLA 3D36A 3ICXA 2YUAA 3H01A 1NTKH 1K34A 2D2CB 3VQXA 1T5EA 3AG1B 2DXTA 4LVKA 4L8JA 3SR2C 1X4TA 3CHXA 3LSUA 5B1AC 2CJAA 4P75A 3JD1A 3JD4A 3HTZA 1AR1B 3A31A 4GUNA 2EWNA 2PI5A 3UT5B 2ZD9A 2EIJB 1W66A 3HXWA 4DR3B 1BHAA 4XTYA 5GW7A 3ETDA 3ZN0A 3ETQA 1CP9A 1NTZH 1SQBH 1NYQA 1BCCH 4O2AB 4QIWF 2OCHA 2W6IG 4HBNA 4IYIA 3E86A 2DWDC 1HNWB 1WB8A 5IY5C 4LF5B 1AP6A 3Q4HB 3UT5A 1H2GA 3MD0A 4TWAA 4FLUA 2AZ0A 1P49A 1AI7A 1AR5A 3OGCC 2DTOA 1YJNV 1K5QA 3ZCCA 2Q5ZA 1KP2A 1S5LZ 5FL7G 1M9NA 4H33A 1FFTB 1V55C 4FJCC 2EJGA 4GYCB 4YRSA 4DR7B 4LH6A 2UXXA 4JI2B 1L0NH 2HHHB 2FTKA 3T4ZA 2YICA 5KUKA 4J15A 2X6BA 5DM6V 3IG2A 4JASA 1OCZB 1DGSA 4TVYA 5H5NA 2EZOA 1HNZB 1IBLO 3RYHA 3X2QB 3RKYA 1NBMG 3CJHA 3MAQA 2HEPA 4XBFA 4RUFA 2YXHA 1YXBA 1VEWA 2G38A 2HKOA 3AG7A 2IU0A 2CIMA 1YB3A 2LFRA 5L3GA 1WP7A 4LC1A 4LVJA 3U11A 2LP7A 2CJ9A 2FL4A 4F6RA 4YCUA 3K57A 3KG2A 4YCWA 2HHHO 4LF9O 1H8EG 3M8AA 1L8DA 4DPGA 1AJQA 2JEUA 2QSAA 4HWSA 3FB8C 4O2BA 5LP6C 3ABKC 1ZTEA 5J2UA 4X64O 5B3SC 3FAVA 3CCRV 1N0JA 5JQGA 4JI5B 5IWAB 1NQTA 1VQPV 4O4LA 4BW9A 2F95B 4WI1A 4U7OA 4TQFA 1Q5OA 2ATKC 3G67A 4DV6B 1GM9A 4FFKA 4GX0A 2YIBD 4DV0B 2ARTA 4JI1B 5GTIZ 2BCCH 1YFTA 1IBKB 1K5SA 2LGWA 1THZA 5EZYA 5IYBO 2WLLB 1ADJA 2DTHA 4J7JA 2ZXWB 3A8TA 3ZHTA 4BR6A 3B09A 3CSXA 4H2TA 1H2SB 1M57C 3LC0A 1EVKA 1XNRO 3LNMB 2ZM6O 3K3WA 2Q7EA 4ZI7B 2CDYA 2AGAA 2CUGA 2DQ0A 3WFVA 1GN4A 4EFEA 3E8GA 4DV2B 1G51A 1PNLA 3ZIAG 4UP9A 2R9IA 3ZHRA 2PTMA 4J11A 3H1LH 1F4NA 1M56C 2ODRD 2QTOA 4GLXA 4KP4A 2Y4TA 1COWG 4HWTA 2AMCA 2YI9A 3H9VA 2FB5A 2RN9A 2DDZA 1H4SA 1SQVH 1F51A 2PMEA 3M4PA 4X1KA 1JJ2U 5LMNB 4KHPO 1PD3A 4PELA 3DSQA 3CCJV 2I4NA 1BIBA 5HFLA 1HNXB 3T1HO 3HKCA 4DV3O 4I55A 4JTAB 2ZM6B 1VQ5V 3ZHSA 5EIBD 2XHBA 1JMKC 1XI1A 4FMTA 2JDIG 5EC2C 4JF3A 1ADYA 1F4MA 3SPIA 5CA1A 1S77D 3TEHA 2O57A 4J9YB 1VF6C 1ZWIC 3GWKC 5J2TB 5FPRA 1Y74B 1XUQA 3H1KH 1XBLA 4DR2B 3SYPA 1VIBA 2XTIA 5DECA 4JI4O 5IYCO 3AG4B 1YJWV 5L3FA 1MSDA 4IYHA 4NXMB 4DV6O 3OT7A 2ITDC 4PDLA 3OTFA 4NR1A 5KHJA 1NR7A 4DR6B 4OP0A 3ZMUA 4EFBA 1VQNV 3RUXA 2IJIA 4WBNA 2I4OA 4X66B 1PKXA 2Z5UA 1I5YA 1FD9A 4RQEA 4YJ2B 1KYOF 5GTHZ 1M57B 3BA8A 1BHBA 3SPGA 4QPKA 3L72H 2P4VA 1X2GA 2RHSB 1OZ0A 3B40A 1N9WA 1QF6A 1W0JG 2Q7HA 3EFFK 3W7UA 1G5HA 2UXCB 2JS3A 1EZVH 4NXNB 1NJ6A 3A0HZ 3LDEA 2HLDG 2FMLA 4PJ0Z 1NVPD 3SGIA 4I4TA 2LJ2A 1MA1A 3HY0A 4GKJB 2XUMA 1BQZA 2ZIOA 2CGOA 2V4DA 2XNDG 5LGUA 1NH2B 3AG2B 3A0BZ 2ADPA 2K1EA 2WLNA 4I55B 4LF6B 4DR6O 5C53B 3RW0A 3DC6A 5LL6Y 1MSWD 3MF2A 4JYBA 2E65A 4XU1A 4CS2A 2NNUA 2F4VB 3E22A 3FYIB 3RKWA 3K9AA 4G28B 3P32A 3UQ8A 3ZJZA 4OX9O 1AILA 1FFXA 1EFRG 1PM9A 1JJCB 4K3AA 1SQFA 2AW9A 2Y69B 4I0XA 1LR1A 1URFA 2ODMA 4CH6A 1YHQV 2QM7A 2JIZG 2GHYA 2ZZFA 4FK5C 4LR3A 1JJOA 2ZT7A 3AK1A 4MT8A 4K35A 2V1DA 4HNAB 3OTOB 5L3DA 3CCVV 4YJ2A 2QWNB 4DUYB 1W2BU 1AJPA 3JD0A 3IC9A 3OD4A 1KMNA 1K9MW 3EHBB 3R07A 5E3IA 2EJ7A 1H4TA 2ZDIA 1AP5A 2QKAA 2N74A 1V9PA 5CA1B 4UPAA 2WLMA 3LDCA 3A7RA 4YROA 1VARA 1USYA 1K4CC 2BE3A 1VQ6V 4B3SB 2JS5A 1K97A 3VQVA 2DKGA 1ROPA 1J5EO 4H13B 4HZ3A 4DYLA 3JSLA 5BMVB 5E79Z 3A0RA 3PCOB 2EBOA 3SJAC 4MTXA 1WA8B 2E64A 3WB2A 3VBBA 4H2WA 4NTWA 5LOVB 4H2XB 1Q3EA 1EN5A 5IJ0B 1DTOA 5C8YA
chains in the Genus database with same CATH topology
2X6CA 3G6EV 2ITCC 5H6RA 1QVFU 1JOYA 2ZR3A 1NJ8A 1WNLA 4XEOA 4KR2A 4YRRA 1EZJA 1NVPB 1OCCB 3FB7C 5KA5A 1GMGA 1VQOV 4LP8A 1WU7A 3P8TA 4XU2A 1AI6A 3QO7A 4OLFA 3CC7V 5B1NA 4ZKIA 3G71V 3OM3B 1EIYA 5F5WA 2DYSB 4G27B 2AKWB 3E35A 4JAVA 1E1OA 3ERRA 5EBLC 2DWEC 2E10A 2X7RB 2XOKG 4YRLA 4YDQA 2OCCB 3L4GA 2QHSA 1WQ7A 1OCRC 4XDLA 3RL6A 4ZTUB 4H2UA 3AG1C 4UP7A 3ABMB 1E1TA 1FXKB 4UVAA 3TK1A 5ELOA 2IW5A 4UXNA 1KC8W 1NJ1A 1NR1A 4CH3A 4K87A 3JYCA 3ASOB 3IKMB 1WLEA 1NJIW 3ETEA 3OR6C 1GTOA 3UKMA 1YFSA 3ML0A 1PYSA 3G1ZA 3HFZA 4MVZA 3NELA 3RIRA 3IKLA 2JEXA 1N8RW 3V8JA 1VQ7V 2P90A 1B70B 2WLHA 1PNKA 2QHUA 2EIKB 2EIKC 4GT1A 12ASA 1BIAA 3A7AA 2RHQA 3KFUA 3EFSA 3E83A 3X2QC 2P0LA 2DYRB 1FXKC 5L3BA 2P5IA 2PMFA 2XAHA 2DXUA 3FJPA 5ELNA 2R9RB 3IGAC 4XDKA 5LHHA 1QLNA 2KB1A 4HA8A 2IH3C 1OCZC 3E8FA 1OCRB 1QR8A 2P67A 3F7VC 3ASOC 2WLLA 4KUMA 3D36A 4YYEA 3RKXA 3FKSG 3A5ZA 4YRQA 3H01A 2M7WA 2HNIA 1K34A 3OEEG 3P8VA 3VQXA 3V7CA 3AG1B 4P9OA 4CBCA 2DXTA 2J3LA 1AROP 4LVKA 2I4MA 2ZINA 4MVRA 3CCMV 2OCCC 3FYEB 5BZBA 4H2XA 4YRIA 1V55B 2NS6A 3A7UA 4PA4A 1CPYA 4UV8A 1ASYA 1L1FA 2XAQA 3HXXA 2DU5A 4I9WA 2XASA 5B1AC 2CJAA 3A74A 4YRJA 4P75A 3JD1A 3JD4A 4G2KA 2EJ9A 3HTZA 1AR1B 3A31A 5B1BC 1RIQA 2EWNA 1H4QA 2PI5A 2ZD9A 1EIYB 1YIJV 2C8MA 1BL8A 2EIJB 4Q15A 2AKWA 1W66A 3STZC 3HXWA 3REUA 4AH6A 2EINC 4GCZA 4YREA 1GM8A 2FYKA 1BHAA 1E1QG 4XU0A 4XTYA 4EO4A 3RGLA 3G4SV 2Y48A 5GW7A 1K92A 3ETDA 2ZGWA 3OD1A 3W7WA 5CA3A 2ZQMA 3K0DA 3ZN0A 4P72C 1G4YB 3NETA 4BAYA 1CP9A 1NYQA 1Q82W 1P7BA 4BIZA 2Q7GA 3HXVA 4QIWF 1X54A 4HWOA 1X55A 2W6IG 1L0WA 2YEVB 3ZMVA 2HVKC 2DWDC 3E86A 3CCSV 4XTUA 1HWYA 4TT3G 4MVSA 5IY5C 4P3NA 3E8HA 3ABTA 1FYFA 1H2GA 3MD0A 3F5WC 4L87A 4E2LA 1CEZA 2ZT8A 3SYOA 4TWAA 2EJRA 1J95A 1AI7A 2QE7G 3CD6V 3RF1A 3ABUA 3OGCC 2DTOA 2QA4V 2ZIMA 4P73C 1YJNV 3TEHB 1K5QA 3ZCCA 1B76A 1KP2A 4P30A 3UM7A 1RM1B 4JTDB 1VQZA 3K03A 5FL7G 1M9NA 4RUEA 1HC7A 4GX5A 1IXMA 4RMFA 3JD3A 4H33A 4R7CA 4MVUA 1FFTB 1V55C 1Q86W 1ATIA 2ZT5A 5LGNA 4FJCC 3T2MA 4TQDA 3B8MA 2EJGA 2EAYA 4YRSA 5C51B 3W7TA 3P30A 1YTFB 2UXXA 2DQ3A 1RPOA 1FXHA 3SJQC 4QNHB 1YJ9V 4YRNA 2FTKA 3PJSK 3T4ZA 1B8AA 2HJFC 2NLJC 4FPPA 5KUKA 3CCUV 2WLJA 4JYCA 4P72A 4J15A 4WJ4A 2ZR2A 2X6BA 4FIPC 2H94A 5DM6V 1B7YA 4JASA 1OCZB 3IG2A 1K33A 2Z3YA 1KKDA 3K08A 4PA3A 2EZOA 3M99B 3TCUA 4MVQA 3X2QB 2QHVA 2DJZA 4G84A 2A9HA 1NBMG 3OMAB 4MTOA 2CJBA 4Q6GA 3RKYA 4XBFA 2DZCA 2PI4A 1QLEB 1R73A 2X0LA 2Q69A 4RUFA 3W7XA 2Q5HA 2IJKA 1VQMV 4K86A 2UXNA 2XAJA 1SETA 3HB3B 3K06A 3RVZA 1S0VA 3TEGA 2CIMA 2HKOA 2IU0A 2RHSA 4J9ZB 4R50A 1Q7YW 2ZDIC 3RVYA 5CBHA 1YB3A 4YXWG 4TVYA 2LFRA 5L3GA 2RHQB 4LC1A 1DF5A 4JTCB 3ZMZA 2XAFA 4LVJA 4ASUG 2CJ9A 2LP7A 2YSUB 3R65A 4UVBA 1B7YB 4YCUA 3ABMC 1S5HC 3OR7C 3KG2A 4YCWA 4PHCA 3V8KA 4UP8A 1H8EG 3AG3B 3K04A 3VOUA 2F43G 4R6ZA 3CCEV 1Z7MA 2EIMC 1J5WA 4DPGA 1AJQA 2JEUA 4HWSA 4YRGA 3FB8C 3HRKA 4UVCA 4H37A 4P75C 1SZTA 3ABKC 2DYSC 4JGSA 5B3SC 3CCRV 3CP1A 4RAIA 3LSQA 2GSMB 2JK5C 4WF2A 3LSSA 1ENVA 1OCCC 1NQTA 3M4QA 3HPLC 1MG1A 1VQPV 1IL2A 4RO2A 4X8AA 4BW9A 2Q68A 1VQ4V 4WI1A 1X56A 3VQWA 4LNSA 3IALA 3F7YC 4O2DA 4LVLA 4U7OA 3NXSA 4TQFA 1ASZA 3E89A 1YFRA 4PA6A 4WFGA 2ATKC 2WLIB 5CBGA 5CBFA 1GM9A 5CMUA 3V7SA 1B6QA 4GX0A 3SPHA 2W6JG 3OMIB 2ARTA 4HYOA 1KECA 3QO5A 1YFTA 2ARSA 2QM8A 1WQWA 4H2VA 4KR3A 1K5SA 3B77A 1THZA 4PDRA 1YITV 2D3OW 4LVMA 5CN0A 1EFWA 5IYBO 4MW3A 1M90W 2WLLB 3ETGA 2CGHA 1ADJA 3OE7G 2DTHA 3CMEV 3QNEA 4MVMA 2ZXWB 3T1CA 2MK3A 2EZPA 4N21A 3TETA 2IH1C 4H2TA 4ZIBA 1R3KC 1V54B 1M57C 3LC0A 3ASNC 4G85A 3STLC 1Z7NA 4MS2A 1K8AW 3HXYA 1BBUA 1EVKA 4YRFA 3UGTA 3UH0A 4U7NA 3CMQA 3REXA 1JPXA 3LNMB 3K3WA 3EFRA 2Q7EA 2EILB 1K73W 3BEHA 4DO2A 1WPYA 2DQ0A 1KD1W 4XTZA 4RQFA 4EX5A 1FS0G 1OCOB 2ZNJA 1KOGA 3WFVA 1LYLA 2C2AA 2HR3A 1R3LC 1E22A 4P74C 1KMMA 3ZRXA 2EL9A 3AG4C 3CC4V 3E8GA 1BBWA 2Q67A 1G51A 1PNLA 1PNMA 2Y69C 3ZIAG 4UP9A 2R9IA 1YTFD 2LFSA 1E79G 1H4VB 4CZZA 4TWKA 1X2HA 1QE0A 3P8YA 1F4NA 1M56C 2ODRD 2AHZA 2DVEA 3HRIA 2QTOA 4BIUA 1NH2D 4KP4A 1YSCA 3E8BA 4X88A 5B3SB 1COWG 1P4RA 1PL0A 1JQ0A 2B1GA 1EBOA 3JCZA 4GX1A 2AMCA 3ABKB 2E41A 2WLKA 4DQ2A 4LVIA 2DDZA 4HVCA 1H4SA 3UGQA 1GK9A 3LDDA 1F51A 1R6KA 2PMEA 3M4PA 4YRMA 3AG3C 2IY5A 3FB5C 1JJ2U 3I56V 3MEYA 4R8CA 3SYQA 1NJ5A 3UFGA 2HG5C 1PD3A 11ASA 4PELA 4QE9A 2OTJV 1VQKV 3DSQA 3I55V 3SPJA 3CCJV 2WSSG 1BIBA 4UUJC 2I4NA 5HFLA 1S72V 4KQEA 3CCQV 4JTAB 2E3CA 2QKSA 1GO3F 2BOCC 1JVMA 3OUFA 1QLEC 3AG2C 1VQ5V 4QPJA 1R3JC 3NEMA 2P7TC 4FMTA 2DTIA 4PG3A 2JDIG 4E51A 1ORQC 2AHYA 2WPDG 1HTTA 5EC2C 3D3IA 4UV9A 5KA6A 5L3CA 2Q5IA 3RACA 4JF3A 3BJUA 2WLIA 1S76D 4GX2A 1ADYA 4CS4A 1C0AA 1F4MA 1WPXA 3SPIA 1S77D 4Q20A 3ABLB 1M56B 3TEHA 3OUSA 4J9YB 1ZWIC 2ALYB 2DZ9A 4WJ3M 3DGEA 5J9PC 4WFBV 2ZNIA 4CS3A 1VQLV 4MVOA 2QEXV 3SYPA 2XTIA 4XEMA 3MQZA 4K88A 5IYCO 3AG4B 1YJWV 2ZZEA 1S3JA 4JPRA 5L3FA 3ZMTA 4P2ZA 1X01A 3I7FA 1E1RG 4P3OA 2DU7A 2OT5A 4WCEV 3K79A 5K1XA 2ITDC 3HFZB 3ZRVA 4PDLA 1NR7A 4OP0A 3E9HA 3ZMUA 1Q81W 4YPFA 5K1PA 2IJJA 2A79B 3ASNB 5C52B 3WG7C 1V54C 1VQNV 3PZCA 2DEQA 2IJIA 4X5OA 3RUXA 3W3SA 2I4OA 1PKXA 2Z5UA 1I5YA 1QCEA 2AMCB 1Y66A 1DF4A 1KQSU 4DXWA 1W0KG 1OHHG 4OXSA 4XU3A 4RQEA 5E1AC 3IC7A 2ZCEA 1M57B 1K7DA 3HY1A 1I5XA 2B1IA 1NJ2A 3ZMSA 1XL4A 3ZRSA 3RBZA 1BHBA 4P3PA 3SPGA 3T4DA 4P71A 4QPKA 3WG7B 4HWTA 4PDVA 2ARUA 4H02A 3CPWU 4YRTA 1X2GA 2YEVA 4PDMA 1OZ0A 2P6JA 5H6QA 2RHSB 1N9WA 1VQ9V 1KP3A 1SRYA 4MTFA 4WFHA 1W0JG 3MHHC 5EBMC 2Q7HA 4TVAA 3V8LA 1QF6A 3QTCA 3EFFK 3W7UA 1R6NA 2JJ1G 2I4LA 1G5HA 3L4GB 2IJHA 1Y4MA 3FB6C 3HFVA 1NJ6A 2H8PC 5LBQA 1AJNA 3LDEA 4H2SA 5DN6G 2EIJC 2HLDG 5B1OA 4QJFB 3MF1A 4PA9A 1NVPD 2A8EA 3GWOA 3OMNB 1R3IC 3W7SA 4P73A 4I5SA 4HT4A 2HFEC 3ABLC 3IFXA 3PCOA 3MHSC 1GKFA 3SYAA 5EC1C 5B1AB 1TUEB 3HY0A 2WAMA 5C93A 1AI5A 3B8NA 5EK0A 2B5UA 1RPRA 2DW4A 2ZIOA 3E9IA 3AEIA 3LUTB 4JAUA 2HVJC 2XNDG 1EOVA 2EIMB 4TVAB 1EVLA 1QR9A 5LGUA 1NH2B 3AG2B 1F23A 4XTWA 1NKDA 3V7RA 2K1EA 5IYDO 1MABG 2WLNA 1H8HG 2WWWA 3K0GA 3OEHG 3L2ZA 3A32A 1AI4A 4PA7A 2CK3G 3DTUB 4MTGA 4ZTZB 1FXKA 3OFNG 1HXDA 1FXVA 5KNNA 5C53B 3JD2A 3RW0A 1JJCA 1MSWD 1VQ8V 3MF2A 5KUMA 4HWRA 4JYBA 3VQYA 4HWPA 2E65A 2DYRC 4XDJA 4XU1A 3OAAG 3HXUA 1JCHA 4CS2A 3E2EA 2NNUA 3CCLV 4P9PA 2ZZGA 1JX9A 3FYIB 1K4DC 3RKWA 5LHGA 1UJWB 3K9AA 2V7QG 2E1HA 4G28B 3P32A 4XTVA 2A0LA 3ZJZA 1GM7A 2ZXFA 1EFRG 1E24A 1NNHA 1USYC 3CMAV 4LBEC 4LCUC 2QHTA 4EKWA 1EQRA 1XL6A 3CYOA 3GB7C 2ZT6A 4KFMA 4H2YA 2JJ2G 1JJCB 4MW8A 3ZRWA 4RDXA 2X6AA 2Y69B 1SESA 4ZBMA 2ALYA 1YHQV 4CH6A 2QM7A 2ODRC 2JIZG 2GHYA 5LGTA 4CH4A 4N23A 2XAGA 3QO8A 4FK5C 1YGBA 4WFFA 2ZZFA 3L1AA 1K3EA 4QE7A 2ZTGA 2ZT7A 1OCOC 4MT8A 5HFMA 1MOFA 2V1DA 2J3MA 5L3DA 3WQZA 1M1KW 4YRKA 3ZN1A 1WYDA 4P74A 4YRCA 2EILC 4X89A 4F4LA 3CCVV 1QBZA 5L3EA 1NYRA 4WFEA 3ICAA 1W2BU 2OTLV 5LHIA 1G5IA 1AJPA 3JD0A 3TUPA 1KMNA 1PYSB 4CH5A 1K9MW 3OW2U 3EHBB 3R07A 4YP0A 4WFAV 2BOBC 1RM1C 5E3IA 4P71C 5H9CA 4MSWC 1H4TA 2ZDIA 1B70A 3ZRWB 3SYCA 2E5AA 4UPAA 4TTVA 2WLMA 2ZXWC 4HAMA 2W0FC 3LDCA 3A7RA 1G8MA 3SPCA 4YROA 1H38A 1K4CC 5IY5B 1VQ6V 1USYA 1K97A 1SERA 1DLBA 2DKGA 4NCXA 3VQVA 4TVWA 1ROPA 4BW5A 2IY5B 5IDJA 1YI2V 3BFMA 2IU3A 4BWAA 2C7IA 4HZ3A 5HGQA 2EJFA 5EBWC 3A0RA 2Q6AA 1GGMA 4WF9V 3PCOB 2EBOA 3A5YA 4XTXA 3CXCU 4MTXA 4TSFG 2E64A 2G4CA 2XGTA 3HXZA 3VBBA 4YRPA 4H2WA 5B1BB 1BMFG 3BY6A 1QVGU 4H2XB 1LNQA 4Z1MG 3NENA 4YCVA 1DTOA 3CC2V 2EINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KR2 A;  1NJ8 A;  1WNL A;  2ZR3 A;  4XEO A;  4YRR A;  1WU7 A;  3P8T A;  4XU2 A;  3QO7 A;  4OLF A;  1EIY A;  5F5W A;  2AKW B;  1E1O A;  3ERR A;  2E10 A;  4YRL A;  4YDQ A;  3L4G A;  2QHS A;  1WQ7 A;  3RL6 A;  4ZTU B;  4H2U A;  4UP7 A;  1E1T A;  5ELO A;  1NJ1 A;  4CH3 A;  4K87 A;  3IKM B;  1WLE A;  3RIR A;  1YFS A;  3HFZ A;  1PYS A;  3G1Z A;  3NEL A;  3IKL A;  3V8J A;  1B70 B;  2QHU A;  1BIA A;  3A7A A;  12AS A;  3KFU A;  2RHQ A;  3EFS A;  2P0L A;  2P5I A;  3FJP A;  2PMF A;  2DXU A;  5ELN A;  4HA8 A;  4YYE A;  3RKX A;  3A5Z A;  4YRQ A;  2HNI A;  3P8V A;  3VQX A;  3V7C A;  2DXT A;  2J3L A;  2I4M A;  2ZIN A;  4H2X A;  4YRI A;  3A7U A;  1ASY A;  3HXX A;  2DU5 A;  4YRJ A;  2CJA A;  3A74 A;  4P75 A;  2EJ9 A;  3HTZ A;  3A31 A;  1RIQ A;  2EWN A;  1H4Q A;  1EIY B;  2C8M A;  3REU A;  4Q15 A;  2AKW A;  1W66 A;  3HXW A;  4AH6 A;  4YRE A;  2FYK A;  4XU0 A;  4XTY A;  4EO4 A;  3RGL A;  2ZGW A;  3OD1 A;  4P72 C;  3NET A;  1NYQ A;  2Q7G A;  3HXV A;  1X54 A;  4HWO A;  1X55 A;  1L0W A;  4XTU A;  4P3N A;  1FYF A;  4L87 A;  4TWA A;  2ZT8 A;  2DTO A;  2ZIM A;  4P73 C;  3TEH B;  1B76 A;  1VQZ A;  4O2D A;  1HC7 A;  4RMF A;  1ATI A;  2ZT5 A;  4KR3 A;  4TQD A;  2EJG A;  2EAY A;  4YRS A;  5C51 B;  2DQ3 A;  4YRN A;  4ZIB A;  1B8A A;  4P72 A;  4WJ4 A;  4J15 A;  2ZR2 A;  1B7Y A;  3IG2 A;  4TVY A;  2QHV A;  4G84 A;  2DJZ A;  3RKY A;  2CJB A;  4Q6G A;  2DZC A;  2Q5H A;  4K86 A;  3TEG A;  1SET A;  2CIM A;  2RHS A;  1YB3 A;  2RHQ B;  2CJ9 A;  1B7Y B;  4YCU A;  4YCW A;  4PHC A;  3V8K A;  4UP8 A;  1Z7M A;  1J5W A;  4DPG A;  4YRG A;  4HWS A;  3HRK A;  4P75 C;  3LSQ A;  4WF2 A;  3LSS A;  3M4Q A;  1IL2 A;  4BW9 A;  4WI1 A;  1X56 A;  3VQW A;  4LNS A;  3IAL A;  4TQF A;  1ASZ A;  1YFR A;  3V7S A;  2ART A;  1YFT A;  3QO5 A;  2ARS A;  1WQW A;  4H2V A;  2CGH A;  1ADJ A;  2DTH A;  3QNE A;  4H2T A;  3LC0 A;  4G85 A;  1Z7N A;  3HXY A;  3UH0 A;  1BBU A;  4YRF A;  1EVK A;  3UGT A;  3CMQ A;  3REX A;  2Q7E A;  3EFR A;  1WPY A;  2DQ0 A;  4XTZ A;  4RQF A;  4EX5 A;  2ZNJ A;  1KOG A;  1LYL A;  1E22 A;  4P74 C;  1KMM A;  2EL9 A;  1BBW A;  1G51 A;  4UP9 A;  1H4V B;  1X2H A;  1QE0 A;  3P8Y A;  3HRI A;  2ODR D;  2DVE A;  1E24 A;  4HWT A;  2E41 A;  2AMC A;  1EFW A;  4DQ2 A;  2DDZ A;  4HVC A;  1H4S A;  3UGQ A;  2PME A;  3M4P A;  4YRM A;  2IY5 A;  3MEY A;  1NJ5 A;  3UFG A;  11AS A;  3DSQ A;  2I4N A;  1BIB A;  4KQE A;  2E3C A;  3NEM A;  2DTI A;  4E51 A;  4PG3 A;  1HTT A;  2Q5I A;  3RAC A;  3BJU A;  4CS4 A;  1ADY A;  1C0A A;  3TEH A;  2ALY B;  2DZ9 A;  4WJ3 M;  2ZNI A;  4CS3 A;  2XTI A;  4XEM A;  4K88 A;  2ZZE A;  4P3O A;  3RF1 A;  1X01 A;  3I7F A;  5K1X A;  2DU7 A;  3HFZ B;  4OP0 A;  3E9H A;  5K1P A;  4YPF A;  5C52 B;  3PZC A;  2DEQ A;  3RUX A;  4X5O A;  3W3S A;  2I4O A;  2AMC B;  4XU3 A;  4RQE A;  2ZCE A;  3HY1 A;  1NJ2 A;  4P71 A;  4P3P A;  2ARU A;  4H02 A;  4YRT A;  1X2G A;  2RHS B;  1N9W A;  1SRY A;  3V8L A;  1QF6 A;  2Q7H A;  4TVA A;  3QTC A;  2I4L A;  1G5H A;  3L4G B;  3HFV A;  1NJ6 A;  4H2S A;  3MF1 A;  4P73 A;  3PCO A;  3HY0 A;  2ZIO A;  3E9I A;  1EOV A;  4TVA B;  1EVL A;  4XTW A;  3V7R A;  3L2Z A;  3A32 A;  4ZTZ B;  1HXD A;  5KNN A;  5C53 B;  1JJC A;  4HWR A;  3MF2 A;  3VQY A;  4HWP A;  2E65 A;  4XU1 A;  3HXU A;  4CS2 A;  2ZZG A;  3RKW A;  2E1H A;  4XTV A;  2ZXF A;  1USY C;  1NNH A;  2QHT A;  1EQR A;  2ZT6 A;  4H2Y A;  1JJC B;  4RDX A;  1SES A;  2ALY A;  4CH6 A;  4CH4 A;  2ODR C;  2ZZF A;  3QO8 A;  1YGB A;  3L1A A;  2ZTG A;  2ZT7 A;  2J3M A;  3WQZ A;  4YRK A;  4P74 A;  1WYD A;  4YRC A;  3ICA A;  1NYR A;  1G5I A;  3TUP A;  1KMN A;  1PYS B;  4CH5 A;  3R07 A;  4YP0 A;  5E3I A;  4P71 C;  1H4T A;  2E5A A;  1B70 A;  4UPA A;  4TTV A;  3A7R A;  4YRO A;  1USY A;  4NCX A;  1SER A;  3VQV A;  2DKG A;  4TVW A;  2IY5 B;  3BFM A;  4BWA A;  2C7I A;  5HGQ A;  2EJF A;  1GGM A;  3PCO B;  4XTX A;  3A5Y A;  2G4C A;  3HXZ A;  2E64 A;  2XGT A;  3VBB A;  4YRP A;  4H2W A;  4H2X B;  3NEN A;  4YCV A; 
#chains in the Genus database with same CATH topology
 3G6E V;  2ITC C;  5H6R A;  1JOY A;  1MZF A;  4XEO A;  4YRR A;  1OCC B;  2PF4 E;  4OGQ B;  2ARH A;  3FFQ A;  3E35 A;  2CTW A;  4JAV A;  1E1O A;  4U3J A;  5KX5 B;  2X7R B;  4IT5 A;  2QHS A;  2QWQ B;  4PI0 A;  2GV9 A;  5GON B;  3RL6 A;  4UCS A;  3AG1 C;  2F66 C;  4UCV A;  4DK1 A;  3U0Z A;  3G6B A;  1NR1 A;  2DMX A;  4CC5 A;  5A2Q N;  2RNB A;  3P3P A;  2LQT A;  3UKM A;  2ETN A;  1YFS A;  3NEL A;  3UO3 A;  3N2K B;  4EB6 B;  2E5L B;  2CTQ A;  1I7F A;  4I7Z B;  1PNK A;  1BIA A;  2RHQ A;  3E83 A;  1KU9 A;  2P5I A;  2F4V O;  1Z5W A;  2R9R B;  4XDK A;  2KB1 A;  3J7A U;  1O9H A;  3F7V C;  4DV4 O;  2M7W A;  2HNI A;  3CRC A;  2PY5 A;  4LF9 B;  2JGD B;  2ZIN A;  4MVR A;  1GN6 A;  3JAW A;  3D8C A;  4DR5 B;  1ZLZ A;  4UV8 A;  2RMK B;  1L1F A;  2XAQ A;  4LFC O;  4PV1 B;  1B3Q A;  1RIQ A;  3CRR A;  3BA9 A;  2WA3 A;  1BL8 A;  5CA0 B;  2AKW A;  2RQ6 A;  3TXS A;  4AH6 A;  1B06 A;  4YRE A;  1GM8 A;  1E1Q G;  4XU0 A;  4PHZ A;  3EXA A;  5LA6 B;  2ZE7 A;  2ZGW A;  5EYP A;  3OD1 A;  5CA3 A;  4BIZ A;  4JI2 O;  3HXV A;  2BTQ A;  3UO2 A;  4HWO A;  2UUC B;  2B9Z A;  2YEV B;  3ZMV A;  4XTU A;  4TT3 G;  2L6L A;  4MVS A;  4NVP A;  4P3N A;  4NKG B;  3ABT A;  3APO A;  4L87 A;  1SS3 A;  3SYO A;  3CD6 V;  3ABU A;  2ZIM A;  1TGO A;  4P73 C;  3TEH B;  1ZL8 A;  5KX5 A;  1B76 A;  2EX3 A;  3RYH B;  4DV3 B;  3K03 A;  3QVN A;  1Y67 A;  4RMF A;  3JD3 A;  1Q86 W;  2ZT5 A;  4KR3 A;  1Y76 B;  4TQD A;  3T2M A;  1WNS A;  2QWR B;  2EAY A;  4AI8 A;  2P06 A;  4B7E A;  5C51 B;  4YIP A;  4J80 A;  1YJ9 V;  5LP6 A;  2LGQ A;  2ZR2 A;  5LOV A;  4FIP C;  4F6R B;  3IJ4 A;  1K33 A;  1KKD A;  3K08 A;  1Z2G A;  2ZE6 A;  3DXR A;  2DJZ A;  4MTO A;  4Q6G A;  2CJB A;  3RT3 C;  2DZC A;  2PI4 A;  3N2G A;  1QLE B;  2X0L A;  3APQ A;  2Q69 A;  2Q5H A;  1WA8 A;  1WB7 A;  1S0V A;  3HB3 B;  1SET A;  3K06 A;  2UUA O;  2UXD O;  4R50 A;  3RN4 A;  1BT8 A;  4U3J B;  1DF5 A;  3ZMZ A;  4ASU G;  1LUW A;  3QF7 A;  4FFB B;  5LYJ A;  2CAZ C;  3K04 A;  2UXD B;  4Z1V A;  2ZE5 A;  1Z7M A;  1J5W A;  2RDC A;  3T1Y B;  1SA0 A;  1Y6X A;  2E74 B;  1WJZ A;  4EB6 A;  4RAI A;  2XTA A;  4FM2 A;  5JCO C;  1H2K A;  2JK5 C;  4O4I B;  1OCC C;  3HPL C;  2CH7 B;  1IL2 A;  4X8A A;  1X56 A;  4AIL C;  1MMM A;  4LVL A;  4JYA O;  1ASZ A;  1YFR A;  4PA6 A;  3JAS A;  3ZBH A;  4LF4 B;  3V7S A;  1KEC A;  1YDX A;  1I94 B;  3B77 A;  5D5Q A;  4X65 O;  1YIT V;  2D3O W;  3TGU H;  3OE7 G;  4ZOL A;  4FLY A;  4MVM A;  1XMO O;  2EZP A;  2UU9 O;  1EN4 A;  4N21 A;  2IH1 C;  1V54 B;  3K5L A;  3ASN C;  3ZED A;  3HKB B;  4G85 A;  3STL C;  4OPA A;  1K8A W;  3LNN A;  2QJ1 A;  4J10 A;  4YRF A;  5JCO A;  4O4J B;  4U7N A;  4RWU A;  3REX A;  1JPX A;  1GH6 A;  1K73 W;  1O9G A;  4DO2 A;  3L75 H;  4DR5 O;  3RFR A;  1KD1 W;  4XTZ A;  4EX5 A;  1U97 A;  4B3T O;  1LYL A;  2C2A A;  5KHH A;  1N36 O;  1KMM A;  3AG4 C;  2Q67 A;  4X62 O;  3UCS C;  2ADQ B;  1H4V B;  4DR4 B;  1QE0 A;  2DJV A;  2AHZ A;  1E24 A;  4X66 O;  3O65 A;  1P4R A;  1TA8 A;  4IIJ A;  1EBO A;  3JCZ A;  2AXT Z;  4JZ2 A;  5LXT B;  1GK9 A;  1R6K A;  3M7M X;  1TUB B;  2BSK B;  3JSN A;  1W59 A;  2HG5 C;  4QE9 A;  2OTJ V;  3I55 V;  1SA0 B;  4UUJ C;  4W4K A;  3OUF A;  1QLE C;  3NEM A;  2P7T C;  5LXT A;  2DTI A;  1HR0 B;  1ORQ C;  2AHY A;  4O2B B;  1HTT A;  4LF7 O;  4UV9 A;  2Y0I A;  3RAC A;  4JI0 O;  3L9D A;  4CS4 A;  2R9A A;  1S76 D;  2QTS A;  3K9S A;  4Q20 A;  1M56 B;  1IBL B;  3OUS A;  2ALY B;  2DZ9 A;  5J9P C;  4MVO A;  3CWB H;  3L74 H;  1IX9 A;  1S3J A;  3TJT A;  3RF1 A;  4BIO A;  3CB2 A;  4UB6 Z;  4JV5 B;  2FKX A;  4J7K A;  3RWR D;  4H0L B;  3E9H A;  4B3S O;  3ASN B;  2ZT9 B;  3EVK A;  4DV1 B;  3OGI B;  2DEQ A;  4X5O A;  4DUZ B;  4B3R B;  1QCE A;  1XHX A;  1IXB A;  1XL4 A;  4P3P A;  4P71 A;  5F2V O;  3T4D A;  4O2A A;  3KCX A;  4I50 A;  3RYF A;  2Q4P A;  1VQ9 V;  1KP3 A;  4LNU A;  4MTF A;  4TVA A;  4D7T A;  3OTO O;  2IJH A;  3J80 N;  1BE3 H;  3HFV A;  4O4H B;  4H2S A;  2EIJ C;  3JAS B;  4DR3 O;  1R3I C;  3W7S A;  4HT4 A;  1RP3 B;  3IFX A;  3MHS C;  1GKF A;  1IUR A;  3SYA A;  5B1A B;  1TUE B;  1N32 B;  3JAR A;  2DW4 A;  1RPR A;  1BQ0 A;  1AB3 A;  1Q6I A;  4JAU A;  2HVJ C;  4TVA B;  2EIM B;  1OJH A;  1F23 A;  3JAM N;  4FM0 A;  3DC5 A;  1MAB G;  2WWW A;  3K0G A;  3OEH G;  4PA7 A;  2NN4 A;  1KKC A;  1FXK A;  3OFN G;  1HXD A;  3JD2 A;  3CJH B;  1JJC A;  1VQ8 V;  2Q0O C;  2JGD A;  4XDJ A;  4ZI7 A;  3OAA G;  3HXU A;  1OV9 A;  3E2E A;  3CCL V;  2QKC A;  1JX9 A;  1UJW B;  2V7Q G;  2E1H A;  2BTO A;  1GM7 A;  5IYZ A;  2ZXF A;  1USY C;  1EQR A;  3CYO A;  5A9G A;  2ZT6 A;  4QGP A;  3GVM A;  4JI8 O;  2JJ2 G;  3ZRW A;  4B3T B;  4CH4 A;  3K58 A;  4N23 A;  2XAG A;  3QO8 A;  3FAV B;  1K3E A;  3KZI Z;  2OIG A;  2ZKO A;  3ZN1 A;  1YEW A;  4F4L A;  2Y4U A;  1NYR A;  5BMV A;  3WB1 A;  3TUP A;  1PYS B;  4DRX A;  2DN9 A;  4WFA V;  3N2K A;  4MSW C;  2E5A A;  1B70 A;  3ZRW B;  5JJE B;  1PPJ H;  4DR1 O;  2KQX A;  5JH7 A;  4X65 B;  5FLX N;  1VF5 B;  3SPC A;  5IY5 B;  1DK1 A;  4NCX A;  4O4H A;  3CRQ A;  5IDJ A;  2IU3 A;  4BWA A;  5EBW C;  1JA8 A;  2Q6A A;  2CE4 A;  4UCT A;  2XGT A;  5H2F Z;  1YVW A;  1BMF G;  4DV5 B;  1QVG U;  1LNQ A;  3CC2 V;  3IAY A;  2X6C A;  1QVF U;  1WNL A;  3L73 H;  5DED A;  5JH7 B;  2CH7 A;  1EZJ A;  1NVP B;  3FB7 C;  5KA5 A;  2H3O A;  1WU7 A;  2ILM A;  1AI6 A;  4OLF A;  3CE2 A;  3OM3 B;  4YJ3 B;  5F5W A;  3U10 A;  2AKW B;  2VQF O;  1WP8 A;  5EBL C;  3H1J H;  4YDQ A;  1WQ7 A;  4XDL A;  2K9P A;  5KHK A;  5KMG A;  4UP7 A;  5AG2 A;  3CEI A;  3E22 B;  5ELO A;  4B08 A;  2BTQ B;  4UXN A;  1KC8 W;  1UPG A;  1NJ1 A;  4K87 A;  1G6U A;  1WLE A;  3RIR A;  3ML0 A;  3IKL A;  1NU1 H;  1N8R W;  3V8J A;  3L70 H;  2WLH A;  1XMQ O;  2EIK B;  3A7A A;  3X2Q C;  3FJP A;  5L3B A;  4Z2W A;  2DXU A;  4HA8 A;  3A2F A;  1QR8 A;  3ASO C;  4YYE A;  3T1Y O;  4JI6 O;  4YRQ A;  4LFB B;  3OEE G;  3P8V A;  4I0X B;  1SQX H;  4TV9 B;  4CBC A;  1YCI A;  2KSD A;  2J3L A;  1ARO P;  2PGG A;  4YY3 B;  2OCC C;  3FYE B;  4YRI A;  2VQE B;  2NS6 A;  3A7U A;  4PA4 A;  4DUZ O;  4B3R O;  1ASY A;  2GUZ B;  4TOI A;  3HXX A;  5KAI Z;  2DU5 A;  4I9W A;  3JAT A;  2CTP A;  4YRJ A;  4K8X A;  1KUQ A;  1EIY B;  4DV2 O;  3REU A;  1D5N A;  4Q15 A;  3STZ C;  4IL6 Z;  2EIN C;  4GCZ A;  2FYK A;  4EO4 A;  3G4S V;  1IBM O;  1K92 A;  3W7W A;  2OWO A;  1G4Y B;  1L0L H;  3RGB A;  4BAY A;  3JCU Z;  1H2M A;  1Q82 W;  5IJ0 A;  2Q7G A;  2RJZ A;  2VQF B;  1X55 A;  1I08 A;  2HVK C;  1HWY A;  3K5O A;  3E8H A;  3ZHQ A;  4J41 A;  4E2L A;  3F5W C;  1CEZ A;  2ZT8 A;  1Q6H A;  4B3M O;  4YIO A;  2QA4 V;  3C3S A;  4DW1 A;  4P30 A;  1VQZ A;  4O2D A;  4JTD B;  3CX5 F;  1YF2 A;  4GX5 A;  1FYJ A;  4X64 B;  4R7C A;  1ATI A;  3B8M A;  3SDL A;  3W7T A;  2PYL A;  3P30 A;  4FLT A;  2VWJ A;  1YTF B;  4QNH B;  1RPO A;  1FXH A;  4YRN A;  4ZIB A;  3PJS K;  1B8A A;  2HJF C;  1NT2 B;  2NLJ C;  4P72 A;  4JYC A;  5GON A;  2H94 A;  2Z3Y A;  2GDS A;  2Y0P A;  2MW2 B;  4TUY A;  4GKK B;  2DOS A;  1WAZ A;  1R73 A;  4IHJ A;  3W7X A;  3CRM A;  1VQM V;  4K86 A;  2HP8 A;  3TEG A;  3RVZ A;  5BR8 B;  2RHS A;  4J9Z B;  2ZDI C;  3RVY A;  5CBH A;  2UXB B;  1XDC A;  2M6Y A;  3BPZ A;  3R65 A;  4UVB A;  1B7Y B;  3ABM C;  3OR7 C;  4PHC A;  2YIA A;  4UP8 A;  3AG3 B;  2F43 G;  5BR8 O;  4R6Z A;  3CCE V;  2EIM C;  4YRG A;  1Z5V A;  2GTS A;  4UVC A;  4I4T B;  2AZ2 A;  4DV4 B;  1SZT A;  2W0X A;  1N4C A;  1EN6 A;  3CP1 A;  5KMG B;  1HNZ O;  2GSM B;  4H44 B;  1ENV A;  3BCC H;  3M4Q A;  2QDO A;  4RO2 A;  1Y74 A;  2Q68 A;  5BY1 A;  3VQW A;  3IAL A;  1SQQ H;  4ABM A;  3E89 A;  3FX7 A;  2WLI B;  3ZX6 A;  5CBF A;  3F5T A;  2W6J G;  1NTM H;  4HYO A;  4JI4 B;  3QO5 A;  2E76 B;  3JAL B;  2QM8 A;  4H2V A;  5CN0 A;  1QNM A;  4MW3 A;  3ETG A;  3CME V;  3T1C A;  4F6E A;  2MK3 A;  1XHZ A;  3TET A;  4LF5 O;  1R3K C;  4YHH B;  3FD9 A;  2F93 B;  5JJN B;  4MS2 A;  5FNV B;  1XMO B;  1SF9 A;  4KL1 A;  1KBH A;  4IGG A;  5J2T A;  3BEH A;  4JYY A;  1IBM B;  4E4E A;  1HNX O;  4RQF A;  2ZNJ A;  4K0K O;  1KOG A;  2HR3 A;  1R3L C;  3ZRX A;  2EL9 A;  3CC4 V;  1PNM A;  5LMN O;  2Y69 C;  1J5E B;  5LA6 A;  2KG7 B;  2LFS A;  1E79 G;  4CZZ A;  4TWK A;  3J81 N;  1ZAU A;  5B3S B;  2E41 A;  4GX1 A;  4LVI A;  3ABK B;  2WLK A;  2P5O A;  2N05 A;  4HVC A;  3WB0 A;  1PV0 A;  3UGQ A;  3SJC C;  1P84 F;  1N34 O;  3FB5 C;  5LYJ B;  4OPH A;  4X1Y A;  3I56 V;  4DUY O;  1NJ5 A;  3UFG A;  11AS A;  1VQK V;  1EM1 A;  3SPJ A;  3CCQ V;  2E3C A;  2QKS A;  1GO3 F;  1JVM A;  2UUB O;  3AG2 C;  4QPJ A;  4E51 A;  4PG3 A;  4IHJ B;  1VF6 A;  3D3I A;  5L3C A;  2Q5I A;  5LMU O;  4OX9 B;  3BJU A;  2WLI A;  2GTA A;  4GX2 A;  1IVS A;  1WPX A;  2EUL A;  3DGE A;  2ZNI A;  4CS3 A;  1VQL V;  1GN3 A;  4JI1 O;  4K88 A;  2ZZE A;  4P3O A;  4P2Z A;  3RYF B;  3I7F A;  1BS3 A;  1MZE A;  4WCE V;  3ZRV A;  2IJJ A;  2A79 B;  1V54 C;  3W3S A;  1M4U A;  4DR1 B;  2AMC B;  4ZOL B;  1Y66 A;  1KQS U;  4DXW A;  1W0K G;  4X9Q A;  3IC7 A;  2ZCE A;  3HY1 A;  1NJ2 A;  3ZMS A;  3RBZ A;  3WG7 B;  3H1H H;  3CPW U;  4YRT A;  4PDM A;  2XT9 A;  2P6J A;  1SRY A;  4WFH A;  2Q0A A;  3K5N A;  3MHH C;  3V8L A;  2GBO A;  2I4L A;  2JJ1 G;  3N27 A;  3HKD A;  3L4G B;  1Y4M A;  1IZ3 A;  2H8P C;  2FYU H;  1AJN A;  5B1O A;  3MF1 A;  2A8E A;  4I5S A;  3ABL C;  1X59 A;  1Q6U A;  4FLX A;  1NI8 A;  5B66 Z;  2WAM A;  5CA0 A;  1AI5 A;  5C93 A;  5LP6 B;  2B5U A;  3LUT B;  1VF7 A;  5JQG B;  4LWS B;  4XTW A;  3V7R A;  1M5I A;  4O4L B;  5IYD O;  1I94 O;  1G1X B;  3L2Z A;  1AI4 A;  2CK3 G;  4MTG A;  4ZTZ B;  2QWP B;  5EIB C;  1FXV A;  4DR7 O;  4O4J A;  4X1I B;  1N34 B;  4JYA B;  5KUM A;  4HWP A;  2Z0A A;  2DYR C;  4P9P A;  3RYI A;  5LHG A;  3JAT B;  4LF8 B;  2A0L A;  3C90 A;  4PI2 A;  5LMU B;  4LBE C;  1CXZ B;  3GB7 C;  4KFM A;  3QG5 A;  4H2Y A;  2X6A A;  1D5A A;  4O4I A;  2E75 B;  4PD4 F;  2ALY A;  5J2U B;  2ODR C;  4WFF A;  3L1A A;  4QE7 A;  3KCY A;  2ZTG A;  1OCO C;  5HFM A;  4X20 B;  2PZS A;  3C3T A;  1M1K W;  1WYD A;  4X89 A;  3ICA A;  4KHP B;  1SQG A;  2OTL V;  1G5I A;  3OW2 U;  1KB9 F;  4UFZ A;  1RM1 C;  5H9C A;  4TTV A;  2A7W A;  2YXL A;  2ZXW C;  4HAM A;  4DV1 O;  4I9Q A;  4KXR A;  4LFA O;  4FM1 A;  3B4S A;  1DLB A;  4BW5 A;  2IY5 B;  4LFB O;  2YIB A;  2VS0 A;  3A5Y A;  2DE0 X;  2KKW A;  2G4C A;  4LF8 O;  3BY6 A;  4Z1M G;  3BRC A;  3BAB A;  1UFI A;  1NJ8 A;  2Q8V A;  1GMG A;  1VQO V;  3P8T A;  4CC6 A;  1PP9 H;  3CC7 V;  1Y76 A;  4UB8 Z;  4ZKI A;  1TAE A;  1A32 A;  2DYS B;  3D36 C;  4G27 B;  1KMI Z;  2DWE C;  4EEQ A;  4YRL A;  2XOK G;  3L4G A;  4JAA A;  4H2U A;  3TXQ A;  1FXK B;  3RYC B;  1TUB A;  3JYC A;  3IKM B;  1Q43 A;  1NJI W;  3OR6 C;  1GTO A;  2JGU A;  1N33 B;  4TV9 A;  3G1Z A;  3HFZ A;  2YC0 A;  2Q73 A;  5BXZ A;  1VQ7 V;  2ZE8 A;  1RSO B;  4WBN B;  2EIK C;  12AS A;  2WA4 A;  3CS5 A;  3EFS A;  4ZHQ A;  4DV7 B;  2PMF A;  1YZB A;  5ELN A;  3NEN A;  2LW1 A;  5LHH A;  5EZY B;  1OCZ C;  4FFB A;  3E8F A;  4NB5 A;  5KHI A;  3RKX A;  3FKS G;  4FLV A;  3A5Z A;  3V7C A;  4P9O A;  2I4M A;  2IBZ H;  3CCM V;  5BZB A;  4H2X A;  1WPB A;  1V55 B;  1CPY A;  2YXY A;  3B2E E;  3RYI B;  2E5L O;  2XAS A;  3A74 A;  3CRA A;  4G2K A;  5B5E Z;  2EJ9 A;  2P4K A;  1GRJ A;  5B1B C;  1H4Q A;  1BZK A;  4X62 B;  1WN7 A;  1YIJ V;  2P22 C;  2C8M A;  1AVM A;  4GKK O;  5TIS Z;  2HJD A;  3RGL A;  2IM9 A;  4JI3 O;  2Y48 A;  1QQC A;  4NXN O;  2ZQM A;  3K0D A;  4P72 C;  3NET A;  2LO1 A;  5JJJ B;  2YI8 A;  1P7B A;  1H2L A;  1X54 A;  1L0W A;  3CCS V;  1FYF A;  1R6T A;  3HKB A;  2UU9 B;  2EJR A;  1J95 A;  2QE7 G;  1XNQ O;  1XQ8 A;  3UM7 A;  1RM1 B;  5ITZ A;  1HC7 A;  4RUE A;  1IXM A;  1FFX B;  4MVU A;  5LGN A;  3K59 A;  3RYC A;  3JAR B;  4JI6 B;  2DQ3 A;  3SJQ C;  3Q4H A;  4FPP A;  3CCU V;  2WLJ A;  4WJ4 A;  4DR2 O;  1B7Y A;  4PA3 A;  3M99 B;  3TCU A;  1XMQ B;  4MVQ A;  2QHV A;  4G84 A;  2A9H A;  3OMA B;  1N32 O;  1SKV A;  3O9O A;  2IJK A;  2UXN A;  2XAJ A;  1Q7Y W;  2UUB B;  1F7Y A;  4YXW G;  2RHQ B;  4K0K B;  4JTC B;  2XAF A;  1VP7 A;  4UCU A;  2YSU B;  1SQP H;  5IYZ B;  4YY3 O;  1S5H C;  1FPO A;  3V8K A;  2GUZ A;  4X1K B;  3VOU A;  1XNR B;  1JFF B;  3JAK B;  1HP8 A;  3HRK A;  1H2N A;  3ZHU A;  4H37 A;  4P75 C;  5IJ9 B;  2RCV A;  2DYS C;  4JGS A;  3LSQ A;  4WF2 A;  3LSS A;  4LWS A;  1MG1 A;  4C7U A;  4DV5 O;  1VQ4 V;  2A3Q A;  2QM4 A;  4LNS A;  3F7Y C;  3NXS A;  1XEQ A;  4JI7 B;  4WFG A;  5CBG A;  2YS8 A;  3NR7 A;  5CMU A;  1B6Q A;  3SPH A;  3OMI B;  4ZHQ B;  2ARS A;  1WQW A;  4PDR A;  4LVM A;  3P3N A;  1M90 W;  2R72 A;  2CGH A;  1GAX A;  1XNQ B;  2A06 H;  3QNE A;  1XOU A;  3DXR B;  4GKJ O;  2KG7 A;  4ICG A;  4LH7 A;  4LF7 B;  4YHH O;  1Z7N A;  3R66 A;  3ZHV A;  1R1B A;  4I50 B;  2UUC O;  1BBU A;  2Q9L A;  3HXY A;  3UGT A;  4NYK A;  3CMQ A;  3UH0 A;  4LNU B;  3S3X A;  3EFR A;  2EIL B;  4DW0 A;  5JVD B;  4FVM A;  2UXC O;  1IBK O;  4JI3 B;  1WPY A;  1MNG A;  1FS0 G;  1OCO B;  4AQY O;  4DV0 O;  4UCR A;  4JZG A;  3THO A;  3WU2 Z;  1E22 A;  4P74 C;  5D5P A;  1BBW A;  1FKA O;  2JVD A;  1Q90 D;  4DRX B;  1YTF D;  1Q8I A;  4FZ0 A;  1X2H A;  4AHC A;  4LFC B;  3P8Y A;  3HRI A;  2DVE A;  2CTR A;  4BIU A;  1NH2 D;  1YSC A;  4X88 A;  3E8B A;  4NTY A;  1PL0 A;  2B1G A;  1JQ0 A;  1EFW A;  2OIE A;  5IWA O;  4JI5 O;  4DQ2 A;  2QR4 A;  5ITZ B;  4K8Z A;  2N04 A;  3LDD A;  4YRM A;  3AG3 C;  2IY5 A;  1TVK A;  3MEY A;  3KKY A;  2VWK A;  4R8C A;  3SYQ A;  2YDE A;  1BSM A;  5IJ9 A;  2WSS G;  3SJB C;  3HKD B;  1LUV A;  1S72 V;  4DV7 O;  4KQE A;  2BOC C;  3BHP A;  4JI8 B;  1PL4 A;  1R3J C;  2WPD G;  1D2D A;  1N33 O;  4YJ3 A;  5KA6 A;  2VRZ A;  2F1M A;  1TVK B;  3JAW B;  4FLW A;  1C0A A;  3ABL B;  1HW7 A;  3T1H B;  4WJ3 M;  4WFB V;  1NZ6 A;  2QEX V;  4XEM A;  2LW7 A;  5C8Y B;  3MQZ A;  4HNA A;  1U96 A;  3HKE A;  1QHT A;  1RFY A;  4JPR A;  3ZMT A;  5K1X A;  1X01 A;  1E1R G;  1IDS A;  2OT5 A;  4J7Z A;  3K79 A;  2DU7 A;  4UCO A;  3HFZ B;  1FJG O;  3D3Q A;  3JAL A;  5K1P A;  1Q81 W;  4YPF A;  5C52 B;  3WG7 C;  4LFA B;  3PZC A;  2NR5 A;  4D7S A;  3MDS A;  3ZS8 C;  2R70 A;  3L71 H;  1DF4 A;  4DK0 A;  5EYP B;  2VQE O;  1OHH G;  4OXS A;  4XU3 A;  5E1A C;  5JVD A;  3JAK A;  4B3M B;  1K7D A;  1I5X A;  2B1I A;  3N2G B;  3ZRS A;  3HKE B;  2QWO B;  4PDV A;  4JV5 O;  2ARU A;  4H02 A;  1HNW O;  2YEV A;  5H6Q A;  1BGY H;  1N0N A;  5EBM C;  5IT9 N;  3QTC A;  1R6N A;  1ZSP A;  3FB6 C;  3AK2 A;  5LBQ A;  1QU7 A;  5DN6 G;  1AR4 A;  4QJF B;  1SC5 B;  4PA9 A;  4A5U B;  3GWO A;  2L35 A;  3OMN B;  4P73 A;  4X1I A;  2HFE C;  4U3F H;  3PCO A;  2UUA B;  5CB4 B;  5EC1 C;  3B8N A;  3HR0 A;  5EK0 A;  1GN2 A;  3E9I A;  1RSO A;  3AEI A;  2CGN A;  1EOV A;  1EVL A;  1QR9 A;  4IIJ B;  1NKD A;  2PUS A;  1H8H G;  2PYJ A;  3A32 A;  5IE9 A;  3K5M A;  3DTU B;  1S5J A;  1NS1 A;  3H1I H;  1FJG B;  5KNN A;  4W4L A;  1VMG A;  1XRE A;  4HWR A;  3VQY A;  2OYQ A;  1JCH A;  4X20 A;  2JRI A;  2ZZG A;  4FLZ A;  1K4D C;  4XTV A;  4JI0 B;  1NNH A;  3CMA V;  4LCU C;  5JWP A;  2QHT A;  4EKW A;  1XIL A;  1HR0 O;  1XL6 A;  1ZX3 A;  3S3W A;  3AK3 A;  4MW8 A;  4RDX A;  1I0H A;  4LF6 O;  1SES A;  4ZBM A;  3BAA A;  5LGT A;  1YGB A;  1SZX A;  2YID A;  1MOF A;  2J3M A;  3WQZ A;  2UXB O;  4YRK A;  4P74 A;  4YRC A;  2F23 A;  2EIL C;  1QBZ A;  5L3E A;  4WFE A;  5LHI A;  4CH5 A;  4YP0 A;  2BOB C;  4P71 C;  4B7K A;  4FZ1 A;  3SYC A;  1US6 A;  2W0F C;  1G8M A;  1H38 A;  4D6T H;  4DR4 O;  1SER A;  4TVW A;  1YI2 V;  4LF4 O;  3BFM A;  4TV8 B;  1JFF A;  2C7I A;  5HGQ A;  2EJF A;  1N36 B;  1GGM A;  4WF9 V;  4XTX A;  3CXC U;  4GZR B;  4TSF G;  4AQY B;  3HXZ A;  4YRP A;  3BVO A;  5B1B B;  3HKC B;  4YCV A;  2EIN B;  5KAF Z;  4KR2 A;  1ZL8 B;  2ZR3 A;  3CXH F;  1P7G A;  5FPO A;  4LP8 A;  1JR9 A;  4XU2 A;  3QO7 A;  5B1N A;  1EIY A;  3G71 V;  4NXM O;  4TV8 A;  3PN1 A;  3ERR A;  1FAF A;  2E10 A;  2OCC B;  1HDJ A;  1OCR C;  4ZTU B;  5KHG A;  5KLV H;  3ABM B;  1E1T A;  4UVA A;  3TK1 A;  2IW5 A;  4X1Y B;  4CH3 A;  4TUY B;  2QGN A;  3ASO B;  2BSK A;  3ETE A;  4JI7 O;  1M93 A;  3G80 A;  1PYS A;  4MVZ A;  4J42 A;  4NTX A;  2JEX A;  5FNV A;  2P90 A;  1B04 A;  1B70 B;  2QHU A;  3BFR A;  4GT1 A;  3KFU A;  2P0L A;  2DYR B;  1FXK C;  1ZUQ A;  2XAH A;  3IGA C;  1QLN A;  2IH3 C;  3I5D A;  5CB4 A;  1OCR B;  2P67 A;  4KUM A;  2WLL A;  3D36 A;  3ICX A;  2YUA A;  3H01 A;  1NTK H;  1K34 A;  2D2C B;  3VQX A;  1T5E A;  3AG1 B;  2DXT A;  4LVK A;  4L8J A;  3SR2 C;  1X4T A;  3CHX A;  3LSU A;  5B1A C;  2CJA A;  4P75 A;  3JD1 A;  3JD4 A;  3HTZ A;  1AR1 B;  3A31 A;  4GUN A;  2EWN A;  2PI5 A;  3UT5 B;  2ZD9 A;  2EIJ B;  1W66 A;  3HXW A;  4DR3 B;  1BHA A;  4XTY A;  5GW7 A;  3ETD A;  3ZN0 A;  3ETQ A;  1CP9 A;  1NTZ H;  1SQB H;  1NYQ A;  1BCC H;  4O2A B;  4QIW F;  2OCH A;  2W6I G;  4HBN A;  4IYI A;  3E86 A;  2DWD C;  1HNW B;  1WB8 A;  5IY5 C;  4LF5 B;  1AP6 A;  3Q4H B;  3UT5 A;  1H2G A;  3MD0 A;  4TWA A;  4FLU A;  2AZ0 A;  1P49 A;  1AI7 A;  1AR5 A;  3OGC C;  2DTO A;  1YJN V;  1K5Q A;  3ZCC A;  2Q5Z A;  1KP2 A;  1S5L Z;  5FL7 G;  1M9N A;  4H33 A;  1FFT B;  1V55 C;  4FJC C;  2EJG A;  4GYC B;  4YRS A;  4DR7 B;  4LH6 A;  2UXX A;  4JI2 B;  1L0N H;  2HHH B;  2FTK A;  3T4Z A;  2YIC A;  5KUK A;  4J15 A;  2X6B A;  5DM6 V;  3IG2 A;  4JAS A;  1OCZ B;  1DGS A;  4TVY A;  5H5N A;  2EZO A;  1HNZ B;  1IBL O;  3RYH A;  3X2Q B;  3RKY A;  1NBM G;  3CJH A;  3MAQ A;  2HEP A;  4XBF A;  4RUF A;  2YXH A;  1YXB A;  1VEW A;  2G38 A;  2HKO A;  3AG7 A;  2IU0 A;  2CIM A;  1YB3 A;  2LFR A;  5L3G A;  1WP7 A;  4LC1 A;  4LVJ A;  3U11 A;  2LP7 A;  2CJ9 A;  2FL4 A;  4F6R A;  4YCU A;  3K57 A;  3KG2 A;  4YCW A;  2HHH O;  4LF9 O;  1H8E G;  3M8A A;  1L8D A;  4DPG A;  1AJQ A;  2JEU A;  2QSA A;  4HWS A;  3FB8 C;  4O2B A;  5LP6 C;  3ABK C;  1ZTE A;  5J2U A;  4X64 O;  5B3S C;  3FAV A;  3CCR V;  1N0J A;  5JQG A;  4JI5 B;  5IWA B;  1NQT A;  1VQP V;  4O4L A;  4BW9 A;  2F95 B;  4WI1 A;  4U7O A;  4TQF A;  1Q5O A;  2ATK C;  3G67 A;  4DV6 B;  1GM9 A;  4FFK A;  4GX0 A;  2YIB D;  4DV0 B;  2ART A;  4JI1 B;  5GTI Z;  2BCC H;  1YFT A;  1IBK B;  1K5S A;  2LGW A;  1THZ A;  5EZY A;  5IYB O;  2WLL B;  1ADJ A;  2DTH A;  4J7J A;  2ZXW B;  3A8T A;  3ZHT A;  4BR6 A;  3B09 A;  3CSX A;  4H2T A;  1H2S B;  1M57 C;  3LC0 A;  1EVK A;  1XNR O;  3LNM B;  2ZM6 O;  3K3W A;  2Q7E A;  4ZI7 B;  2CDY A;  2AGA A;  2CUG A;  2DQ0 A;  3WFV A;  1GN4 A;  4EFE A;  3E8G A;  4DV2 B;  1G51 A;  1PNL A;  3ZIA G;  4UP9 A;  2R9I A;  3ZHR A;  2PTM A;  4J11 A;  3H1L H;  1F4N A;  1M56 C;  2ODR D;  2QTO A;  4GLX A;  4KP4 A;  2Y4T A;  1COW G;  4HWT A;  2AMC A;  2YI9 A;  3H9V A;  2FB5 A;  2RN9 A;  2DDZ A;  1H4S A;  1SQV H;  1F51 A;  2PME A;  3M4P A;  4X1K A;  1JJ2 U;  5LMN B;  4KHP O;  1PD3 A;  4PEL A;  3DSQ A;  3CCJ V;  2I4N A;  1BIB A;  5HFL A;  1HNX B;  3T1H O;  3HKC A;  4DV3 O;  4I55 A;  4JTA B;  2ZM6 B;  1VQ5 V;  3ZHS A;  5EIB D;  2XHB A;  1JMK C;  1XI1 A;  4FMT A;  2JDI G;  5EC2 C;  4JF3 A;  1ADY A;  1F4M A;  3SPI A;  5CA1 A;  1S77 D;  3TEH A;  2O57 A;  4J9Y B;  1VF6 C;  1ZWI C;  3GWK C;  5J2T B;  5FPR A;  1Y74 B;  1XUQ A;  3H1K H;  1XBL A;  4DR2 B;  3SYP A;  1VIB A;  2XTI A;  5DEC A;  4JI4 O;  5IYC O;  3AG4 B;  1YJW V;  5L3F A;  1MSD A;  4IYH A;  4NXM B;  4DV6 O;  3OT7 A;  2ITD C;  4PDL A;  3OTF A;  4NR1 A;  5KHJ A;  1NR7 A;  4DR6 B;  4OP0 A;  3ZMU A;  4EFB A;  1VQN V;  3RUX A;  2IJI A;  4WBN A;  2I4O A;  4X66 B;  1PKX A;  2Z5U A;  1I5Y A;  1FD9 A;  4RQE A;  4YJ2 B;  1KYO F;  5GTH Z;  1M57 B;  3BA8 A;  1BHB A;  3SPG A;  4QPK A;  3L72 H;  2P4V A;  1X2G A;  2RHS B;  1OZ0 A;  3B40 A;  1N9W A;  1QF6 A;  1W0J G;  2Q7H A;  3EFF K;  3W7U A;  1G5H A;  2UXC B;  2JS3 A;  1EZV H;  4NXN B;  1NJ6 A;  3A0H Z;  3LDE A;  2HLD G;  2FML A;  4PJ0 Z;  1NVP D;  3SGI A;  4I4T A;  2LJ2 A;  1MA1 A;  3HY0 A;  4GKJ B;  2XUM A;  1BQZ A;  2ZIO A;  2CGO A;  2V4D A;  2XND G;  5LGU A;  1NH2 B;  3AG2 B;  3A0B Z;  2ADP A;  2K1E A;  2WLN A;  4I55 B;  4LF6 B;  4DR6 O;  5C53 B;  3RW0 A;  3DC6 A;  5LL6 Y;  1MSW D;  3MF2 A;  4JYB A;  2E65 A;  4XU1 A;  4CS2 A;  2NNU A;  2F4V B;  3E22 A;  3FYI B;  3RKW A;  3K9A A;  4G28 B;  3P32 A;  3UQ8 A;  3ZJZ A;  4OX9 O;  1AIL A;  1FFX A;  1EFR G;  1PM9 A;  1JJC B;  4K3A A;  1SQF A;  2AW9 A;  2Y69 B;  4I0X A;  1LR1 A;  1URF A;  2ODM A;  4CH6 A;  1YHQ V;  2QM7 A;  2JIZ G;  2GHY A;  2ZZF A;  4FK5 C;  4LR3 A;  1JJO A;  2ZT7 A;  3AK1 A;  4MT8 A;  4K35 A;  2V1D A;  4HNA B;  3OTO B;  5L3D A;  3CCV V;  4YJ2 A;  2QWN B;  4DUY B;  1W2B U;  1AJP A;  3JD0 A;  3IC9 A;  3OD4 A;  1KMN A;  1K9M W;  3EHB B;  3R07 A;  5E3I A;  2EJ7 A;  1H4T A;  2ZDI A;  1AP5 A;  2QKA A;  2N74 A;  1V9P A;  5CA1 B;  4UPA A;  2WLM A;  3LDC A;  3A7R A;  4YRO A;  1VAR A;  1USY A;  1K4C C;  2BE3 A;  1VQ6 V;  4B3S B;  2JS5 A;  1K97 A;  3VQV A;  2DKG A;  1ROP A;  1J5E O;  4H13 B;  4HZ3 A;  4DYL A;  3JSL A;  5BMV B;  5E79 Z;  3A0R A;  3PCO B;  2EBO A;  3SJA C;  4MTX A;  1WA8 B;  2E64 A;  3WB2 A;  3VBB A;  4H2W A;  4NTW A;  5LOV B;  4H2X B;  1Q3E A;  1EN5 A;  5IJ0 B;  1DTO A;  5C8Y A; 
#chains in the Genus database with same CATH homology
 2X6C A;  3G6E V;  2ITC C;  5H6R A;  1QVF U;  1JOY A;  2ZR3 A;  1NJ8 A;  1WNL A;  4XEO A;  4KR2 A;  4YRR A;  1EZJ A;  1NVP B;  1OCC B;  3FB7 C;  5KA5 A;  1GMG A;  1VQO V;  4LP8 A;  1WU7 A;  3P8T A;  4XU2 A;  1AI6 A;  3QO7 A;  4OLF A;  3CC7 V;  5B1N A;  4ZKI A;  3G71 V;  3OM3 B;  1EIY A;  5F5W A;  2DYS B;  4G27 B;  2AKW B;  3E35 A;  4JAV A;  1E1O A;  3ERR A;  5EBL C;  2DWE C;  2E10 A;  2X7R B;  2XOK G;  4YRL A;  4YDQ A;  2OCC B;  3L4G A;  2QHS A;  1WQ7 A;  1OCR C;  4XDL A;  3RL6 A;  4ZTU B;  4H2U A;  3AG1 C;  4UP7 A;  3ABM B;  1E1T A;  1FXK B;  4UVA A;  3TK1 A;  5ELO A;  2IW5 A;  4UXN A;  1KC8 W;  1NJ1 A;  1NR1 A;  4CH3 A;  4K87 A;  3JYC A;  3ASO B;  3IKM B;  1WLE A;  1NJI W;  3ETE A;  3OR6 C;  1GTO A;  3UKM A;  1YFS A;  3ML0 A;  1PYS A;  3G1Z A;  3HFZ A;  4MVZ A;  3NEL A;  3RIR A;  3IKL A;  2JEX A;  1N8R W;  3V8J A;  1VQ7 V;  2P90 A;  1B70 B;  2WLH A;  1PNK A;  2QHU A;  2EIK B;  2EIK C;  4GT1 A;  12AS A;  1BIA A;  3A7A A;  2RHQ A;  3KFU A;  3EFS A;  3E83 A;  3X2Q C;  2P0L A;  2DYR B;  1FXK C;  5L3B A;  2P5I A;  2PMF A;  2XAH A;  2DXU A;  3FJP A;  5ELN A;  2R9R B;  3IGA C;  4XDK A;  5LHH A;  1QLN A;  2KB1 A;  4HA8 A;  2IH3 C;  1OCZ C;  3E8F A;  1OCR B;  1QR8 A;  2P67 A;  3F7V C;  3ASO C;  2WLL A;  4KUM A;  3D36 A;  4YYE A;  3RKX A;  3FKS G;  3A5Z A;  4YRQ A;  3H01 A;  2M7W A;  2HNI A;  1K34 A;  3OEE G;  3P8V A;  3VQX A;  3V7C A;  3AG1 B;  4P9O A;  4CBC A;  2DXT A;  2J3L A;  1ARO P;  4LVK A;  2I4M A;  2ZIN A;  4MVR A;  3CCM V;  2OCC C;  3FYE B;  5BZB A;  4H2X A;  4YRI A;  1V55 B;  2NS6 A;  3A7U A;  4PA4 A;  1CPY A;  4UV8 A;  1ASY A;  1L1F A;  2XAQ A;  3HXX A;  2DU5 A;  4I9W A;  2XAS A;  5B1A C;  2CJA A;  3A74 A;  4YRJ A;  4P75 A;  3JD1 A;  3JD4 A;  4G2K A;  2EJ9 A;  3HTZ A;  1AR1 B;  3A31 A;  5B1B C;  1RIQ A;  2EWN A;  1H4Q A;  2PI5 A;  2ZD9 A;  1EIY B;  1YIJ V;  2C8M A;  1BL8 A;  2EIJ B;  4Q15 A;  2AKW A;  1W66 A;  3STZ C;  3HXW A;  3REU A;  4AH6 A;  2EIN C;  4GCZ A;  4YRE A;  1GM8 A;  2FYK A;  1BHA A;  1E1Q G;  4XU0 A;  4XTY A;  4EO4 A;  3RGL A;  3G4S V;  2Y48 A;  5GW7 A;  1K92 A;  3ETD A;  2ZGW A;  3OD1 A;  3W7W A;  5CA3 A;  2ZQM A;  3K0D A;  3ZN0 A;  4P72 C;  1G4Y B;  3NET A;  4BAY A;  1CP9 A;  1NYQ A;  1Q82 W;  1P7B A;  4BIZ A;  2Q7G A;  3HXV A;  4QIW F;  1X54 A;  4HWO A;  1X55 A;  2W6I G;  1L0W A;  2YEV B;  3ZMV A;  2HVK C;  2DWD C;  3E86 A;  3CCS V;  4XTU A;  1HWY A;  4TT3 G;  4MVS A;  5IY5 C;  4P3N A;  3E8H A;  3ABT A;  1FYF A;  1H2G A;  3MD0 A;  3F5W C;  4L87 A;  4E2L A;  1CEZ A;  2ZT8 A;  3SYO A;  4TWA A;  2EJR A;  1J95 A;  1AI7 A;  2QE7 G;  3CD6 V;  3RF1 A;  3ABU A;  3OGC C;  2DTO A;  2QA4 V;  2ZIM A;  4P73 C;  1YJN V;  3TEH B;  1K5Q A;  3ZCC A;  1B76 A;  1KP2 A;  4P30 A;  3UM7 A;  1RM1 B;  4JTD B;  1VQZ A;  3K03 A;  5FL7 G;  1M9N A;  4RUE A;  1HC7 A;  4GX5 A;  1IXM A;  4RMF A;  3JD3 A;  4H33 A;  4R7C A;  4MVU A;  1FFT B;  1V55 C;  1Q86 W;  1ATI A;  2ZT5 A;  5LGN A;  4FJC C;  3T2M A;  4TQD A;  3B8M A;  2EJG A;  2EAY A;  4YRS A;  5C51 B;  3W7T A;  3P30 A;  1YTF B;  2UXX A;  2DQ3 A;  1RPO A;  1FXH A;  3SJQ C;  4QNH B;  1YJ9 V;  4YRN A;  2FTK A;  3PJS K;  3T4Z A;  1B8A A;  2HJF C;  2NLJ C;  4FPP A;  5KUK A;  3CCU V;  2WLJ A;  4JYC A;  4P72 A;  4J15 A;  4WJ4 A;  2ZR2 A;  2X6B A;  4FIP C;  2H94 A;  5DM6 V;  1B7Y A;  4JAS A;  1OCZ B;  3IG2 A;  1K33 A;  2Z3Y A;  1KKD A;  3K08 A;  4PA3 A;  2EZO A;  3M99 B;  3TCU A;  4MVQ A;  3X2Q B;  2QHV A;  2DJZ A;  4G84 A;  2A9H A;  1NBM G;  3OMA B;  4MTO A;  2CJB A;  4Q6G A;  3RKY A;  4XBF A;  2DZC A;  2PI4 A;  1QLE B;  1R73 A;  2X0L A;  2Q69 A;  4RUF A;  3W7X A;  2Q5H A;  2IJK A;  1VQM V;  4K86 A;  2UXN A;  2XAJ A;  1SET A;  3HB3 B;  3K06 A;  3RVZ A;  1S0V A;  3TEG A;  2CIM A;  2HKO A;  2IU0 A;  2RHS A;  4J9Z B;  4R50 A;  1Q7Y W;  2ZDI C;  3RVY A;  5CBH A;  1YB3 A;  4YXW G;  4TVY A;  2LFR A;  5L3G A;  2RHQ B;  4LC1 A;  1DF5 A;  4JTC B;  3ZMZ A;  2XAF A;  4LVJ A;  4ASU G;  2CJ9 A;  2LP7 A;  2YSU B;  3R65 A;  4UVB A;  1B7Y B;  4YCU A;  3ABM C;  1S5H C;  3OR7 C;  3KG2 A;  4YCW A;  4PHC A;  3V8K A;  4UP8 A;  1H8E G;  3AG3 B;  3K04 A;  3VOU A;  2F43 G;  4R6Z A;  3CCE V;  1Z7M A;  2EIM C;  1J5W A;  4DPG A;  1AJQ A;  2JEU A;  4HWS A;  4YRG A;  3FB8 C;  3HRK A;  4UVC A;  4H37 A;  4P75 C;  1SZT A;  3ABK C;  2DYS C;  4JGS A;  5B3S C;  3CCR V;  3CP1 A;  4RAI A;  3LSQ A;  2GSM B;  2JK5 C;  4WF2 A;  3LSS A;  1ENV A;  1OCC C;  1NQT A;  3M4Q A;  3HPL C;  1MG1 A;  1VQP V;  1IL2 A;  4RO2 A;  4X8A A;  4BW9 A;  2Q68 A;  1VQ4 V;  4WI1 A;  1X56 A;  3VQW A;  4LNS A;  3IAL A;  3F7Y C;  4O2D A;  4LVL A;  4U7O A;  3NXS A;  4TQF A;  1ASZ A;  3E89 A;  1YFR A;  4PA6 A;  4WFG A;  2ATK C;  2WLI B;  5CBG A;  5CBF A;  1GM9 A;  5CMU A;  3V7S A;  1B6Q A;  4GX0 A;  3SPH A;  2W6J G;  3OMI B;  2ART A;  4HYO A;  1KEC A;  3QO5 A;  1YFT A;  2ARS A;  2QM8 A;  1WQW A;  4H2V A;  4KR3 A;  1K5S A;  3B77 A;  1THZ A;  4PDR A;  1YIT V;  2D3O W;  4LVM A;  5CN0 A;  1EFW A;  5IYB O;  4MW3 A;  1M90 W;  2WLL B;  3ETG A;  2CGH A;  1ADJ A;  3OE7 G;  2DTH A;  3CME V;  3QNE A;  4MVM A;  2ZXW B;  3T1C A;  2MK3 A;  2EZP A;  4N21 A;  3TET A;  2IH1 C;  4H2T A;  4ZIB A;  1R3K C;  1V54 B;  1M57 C;  3LC0 A;  3ASN C;  4G85 A;  3STL C;  1Z7N A;  4MS2 A;  1K8A W;  3HXY A;  1BBU A;  1EVK A;  4YRF A;  3UGT A;  3UH0 A;  4U7N A;  3CMQ A;  3REX A;  1JPX A;  3LNM B;  3K3W A;  3EFR A;  2Q7E A;  2EIL B;  1K73 W;  3BEH A;  4DO2 A;  1WPY A;  2DQ0 A;  1KD1 W;  4XTZ A;  4RQF A;  4EX5 A;  1FS0 G;  1OCO B;  2ZNJ A;  1KOG A;  3WFV A;  1LYL A;  2C2A A;  2HR3 A;  1R3L C;  1E22 A;  4P74 C;  1KMM A;  3ZRX A;  2EL9 A;  3AG4 C;  3CC4 V;  3E8G A;  1BBW A;  2Q67 A;  1G51 A;  1PNL A;  1PNM A;  2Y69 C;  3ZIA G;  4UP9 A;  2R9I A;  1YTF D;  2LFS A;  1E79 G;  1H4V B;  4CZZ A;  4TWK A;  1X2H A;  1QE0 A;  3P8Y A;  1F4N A;  1M56 C;  2ODR D;  2AHZ A;  2DVE A;  3HRI A;  2QTO A;  4BIU A;  1NH2 D;  4KP4 A;  1YSC A;  3E8B A;  4X88 A;  5B3S B;  1COW G;  1P4R A;  1PL0 A;  1JQ0 A;  2B1G A;  1EBO A;  3JCZ A;  4GX1 A;  2AMC A;  3ABK B;  2E41 A;  2WLK A;  4DQ2 A;  4LVI A;  2DDZ A;  4HVC A;  1H4S A;  3UGQ A;  1GK9 A;  3LDD A;  1F51 A;  1R6K A;  2PME A;  3M4P A;  4YRM A;  3AG3 C;  2IY5 A;  3FB5 C;  1JJ2 U;  3I56 V;  3MEY A;  4R8C A;  3SYQ A;  1NJ5 A;  3UFG A;  2HG5 C;  1PD3 A;  11AS A;  4PEL A;  4QE9 A;  2OTJ V;  1VQK V;  3DSQ A;  3I55 V;  3SPJ A;  3CCJ V;  2WSS G;  1BIB A;  4UUJ C;  2I4N A;  5HFL A;  1S72 V;  4KQE A;  3CCQ V;  4JTA B;  2E3C A;  2QKS A;  1GO3 F;  2BOC C;  1JVM A;  3OUF A;  1QLE C;  3AG2 C;  1VQ5 V;  4QPJ A;  1R3J C;  3NEM A;  2P7T C;  4FMT A;  2DTI A;  4PG3 A;  2JDI G;  4E51 A;  1ORQ C;  2AHY A;  2WPD G;  1HTT A;  5EC2 C;  3D3I A;  4UV9 A;  5KA6 A;  5L3C A;  2Q5I A;  3RAC A;  4JF3 A;  3BJU A;  2WLI A;  1S76 D;  4GX2 A;  1ADY A;  4CS4 A;  1C0A A;  1F4M A;  1WPX A;  3SPI A;  1S77 D;  4Q20 A;  3ABL B;  1M56 B;  3TEH A;  3OUS A;  4J9Y B;  1ZWI C;  2ALY B;  2DZ9 A;  4WJ3 M;  3DGE A;  5J9P C;  4WFB V;  2ZNI A;  4CS3 A;  1VQL V;  4MVO A;  2QEX V;  3SYP A;  2XTI A;  4XEM A;  3MQZ A;  4K88 A;  5IYC O;  3AG4 B;  1YJW V;  2ZZE A;  1S3J A;  4JPR A;  5L3F A;  3ZMT A;  4P2Z A;  1X01 A;  3I7F A;  1E1R G;  4P3O A;  2DU7 A;  2OT5 A;  4WCE V;  3K79 A;  5K1X A;  2ITD C;  3HFZ B;  3ZRV A;  4PDL A;  1NR7 A;  4OP0 A;  3E9H A;  3ZMU A;  1Q81 W;  4YPF A;  5K1P A;  2IJJ A;  2A79 B;  3ASN B;  5C52 B;  3WG7 C;  1V54 C;  1VQN V;  3PZC A;  2DEQ A;  2IJI A;  4X5O A;  3RUX A;  3W3S A;  2I4O A;  1PKX A;  2Z5U A;  1I5Y A;  1QCE A;  2AMC B;  1Y66 A;  1DF4 A;  1KQS U;  4DXW A;  1W0K G;  1OHH G;  4OXS A;  4XU3 A;  4RQE A;  5E1A C;  3IC7 A;  2ZCE A;  1M57 B;  1K7D A;  3HY1 A;  1I5X A;  2B1I A;  1NJ2 A;  3ZMS A;  1XL4 A;  3ZRS A;  3RBZ A;  1BHB A;  4P3P A;  3SPG A;  3T4D A;  4P71 A;  4QPK A;  3WG7 B;  4HWT A;  4PDV A;  2ARU A;  4H02 A;  3CPW U;  4YRT A;  1X2G A;  2YEV A;  4PDM A;  1OZ0 A;  2P6J A;  5H6Q A;  2RHS B;  1N9W A;  1VQ9 V;  1KP3 A;  1SRY A;  4MTF A;  4WFH A;  1W0J G;  3MHH C;  5EBM C;  2Q7H A;  4TVA A;  3V8L A;  1QF6 A;  3QTC A;  3EFF K;  3W7U A;  1R6N A;  2JJ1 G;  2I4L A;  1G5H A;  3L4G B;  2IJH A;  1Y4M A;  3FB6 C;  3HFV A;  1NJ6 A;  2H8P C;  5LBQ A;  1AJN A;  3LDE A;  4H2S A;  5DN6 G;  2EIJ C;  2HLD G;  5B1O A;  4QJF B;  3MF1 A;  4PA9 A;  1NVP D;  2A8E A;  3GWO A;  3OMN B;  1R3I C;  3W7S A;  4P73 A;  4I5S A;  4HT4 A;  2HFE C;  3ABL C;  3IFX A;  3PCO A;  3MHS C;  1GKF A;  3SYA A;  5EC1 C;  5B1A B;  1TUE B;  3HY0 A;  2WAM A;  5C93 A;  1AI5 A;  3B8N A;  5EK0 A;  2B5U A;  1RPR A;  2DW4 A;  2ZIO A;  3E9I A;  3AEI A;  3LUT B;  4JAU A;  2HVJ C;  2XND G;  1EOV A;  2EIM B;  4TVA B;  1EVL A;  1QR9 A;  5LGU A;  1NH2 B;  3AG2 B;  1F23 A;  4XTW A;  1NKD A;  3V7R A;  2K1E A;  5IYD O;  1MAB G;  2WLN A;  1H8H G;  2WWW A;  3K0G A;  3OEH G;  3L2Z A;  3A32 A;  1AI4 A;  4PA7 A;  2CK3 G;  3DTU B;  4MTG A;  4ZTZ B;  1FXK A;  3OFN G;  1HXD A;  1FXV A;  5KNN A;  5C53 B;  3JD2 A;  3RW0 A;  1JJC A;  1MSW D;  1VQ8 V;  3MF2 A;  5KUM A;  4HWR A;  4JYB A;  3VQY A;  4HWP A;  2E65 A;  2DYR C;  4XDJ A;  4XU1 A;  3OAA G;  3HXU A;  1JCH A;  4CS2 A;  3E2E A;  2NNU A;  3CCL V;  4P9P A;  2ZZG A;  1JX9 A;  3FYI B;  1K4D C;  3RKW A;  5LHG A;  1UJW B;  3K9A A;  2V7Q G;  2E1H A;  4G28 B;  3P32 A;  4XTV A;  2A0L A;  3ZJZ A;  1GM7 A;  2ZXF A;  1EFR G;  1E24 A;  1NNH A;  1USY C;  3CMA V;  4LBE C;  4LCU C;  2QHT A;  4EKW A;  1EQR A;  1XL6 A;  3CYO A;  3GB7 C;  2ZT6 A;  4KFM A;  4H2Y A;  2JJ2 G;  1JJC B;  4MW8 A;  3ZRW A;  4RDX A;  2X6A A;  2Y69 B;  1SES A;  4ZBM A;  2ALY A;  1YHQ V;  4CH6 A;  2QM7 A;  2ODR C;  2JIZ G;  2GHY A;  5LGT A;  4CH4 A;  4N23 A;  2XAG A;  3QO8 A;  4FK5 C;  1YGB A;  4WFF A;  2ZZF A;  3L1A A;  1K3E A;  4QE7 A;  2ZTG A;  2ZT7 A;  1OCO C;  4MT8 A;  5HFM A;  1MOF A;  2V1D A;  2J3M A;  5L3D A;  3WQZ A;  1M1K W;  4YRK A;  3ZN1 A;  1WYD A;  4P74 A;  4YRC A;  2EIL C;  4X89 A;  4F4L A;  3CCV V;  1QBZ A;  5L3E A;  1NYR A;  4WFE A;  3ICA A;  1W2B U;  2OTL V;  5LHI A;  1G5I A;  1AJP A;  3JD0 A;  3TUP A;  1KMN A;  1PYS B;  4CH5 A;  1K9M W;  3OW2 U;  3EHB B;  3R07 A;  4YP0 A;  4WFA V;  2BOB C;  1RM1 C;  5E3I A;  4P71 C;  5H9C A;  4MSW C;  1H4T A;  2ZDI A;  1B70 A;  3ZRW B;  3SYC A;  2E5A A;  4UPA A;  4TTV A;  2WLM A;  2ZXW C;  4HAM A;  2W0F C;  3LDC A;  3A7R A;  1G8M A;  3SPC A;  4YRO A;  1H38 A;  1K4C C;  5IY5 B;  1VQ6 V;  1USY A;  1K97 A;  1SER A;  1DLB A;  2DKG A;  4NCX A;  3VQV A;  4TVW A;  1ROP A;  4BW5 A;  2IY5 B;  5IDJ A;  1YI2 V;  3BFM A;  2IU3 A;  4BWA A;  2C7I A;  4HZ3 A;  5HGQ A;  2EJF A;  5EBW C;  3A0R A;  2Q6A A;  1GGM A;  4WF9 V;  3PCO B;  2EBO A;  3A5Y A;  4XTX A;  3CXC U;  4MTX A;  4TSF G;  2E64 A;  2G4C A;  2XGT A;  3HXZ A;  3VBB A;  4YRP A;  4H2W A;  5B1B B;  1BMF G;  3BY6 A;  1QVG U;  4H2X B;  1LNQ A;  4Z1M G;  3NEN A;  4YCV A;  1DTO A;  3CC2 V;  2EIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...