4RQFA

Human seryl-trna synthetase dimer complexed with one molecule of trnasec
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
475
structure length
451
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTMMDKVEFVHMLNATMCATTRTICAILENYQTKKGITVPEKLKEFMPPGLQELIPFVKPAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords selenocysteine tRNA
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 130
structure length 451
sequence length 475
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqfA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqfA02
3BJUA 5C53B 2PMEA 3V7CA 4YYEA 1YB3A 2ALYB 1RIQA 1X2HA 3MF2A 3RACA 2P5IA 1USYC 2FYKA 4H2XB 4YROA 4J15A 3HXXA 2ODRC 1HTTA 3TEGA 1E1OA 4KQEA 4YDQA 2IY5B 2E65A 4BW9A 4YPFA 4YRGA 4HWSA 1EOVA 4TVAA 4K88A 4TTVA 3NEMA 2EL9A 1QF6A 3MF1A 3IKLA 4EX5A 4UP9A 4YRCA 4YRFA 4H2UA 4YRIA 2EJ9A 1EVLA 3HTZA 1X54A 1PYSB 4XEMA 1G5IA 2RHSA 1SETA 1Z7NA 1WPYA 3HFZA 4E51A 4YRQA 4BWAA 11ASA 3RUXA 3V8KA 4TVWA 2Q7GA 3HY1A 1YFTA 3P8YA 2DTHA 4DPGA 4CS3A 1NJ5A 2ALYA 1ASYA 2ZR2A 1KOGA 3KFUA 2ZT8A 4RMFA 2EAYA 4H2TA 4HWTA 4P75A 4YCVA 4HA8A 4YCWA 2DZ9A 2Q5HA 3VQWA 3A74A 2Q7EA 1EIYB 5E3IA 1G51A 1B76A 1HXDA 4CH5A 1IL2A 2ZT7A 3RKXA 2CJBA 3NELA 3REUA 1NNHA 2DDZA 4P3OA 4XU2A 1SERA 1JJCA 4TVAB 2CGHA 1PYSA 3RKWA 3A5YA 3V8JA 3V8LA 4OP0A 4PG3A 2ZINA 4X5OA 2DU5A 2QHVA 4XEOA 2RHSB 2DQ0A 2ZT5A 4HWRA 2P0LA 4KR3A 2PMFA 1E1TA 4YRTA 4WJ3M 4H2SA 1BIAA 4LNSA 3WQZA 1L0WA 4P74A 3HRIA 3HFVA 1H4VB 1YFSA 2I4LA 4YRMA 1SRYA 2J3LA 2DXTA 4P74C 1EIYA 3A7AA 3L1AA 3HXWA 5ELNA 4TQFA 3V7SA 1NYQA 1X01A 3UGQA 2I4OA 2EJFA 1X56A 4H2WA 2ARTA 3BFMA 4L87A 1JJCB 3LSQA 4YCUA 3RKYA 3EFRA 3UH0A 4CH4A 1FYFA 1KMMA 2J3MA 4WF2A 2DU7A 1J5WA 3V7RA 2QHTA 3A32A 3RL6A 5K1XA 1H4QA 3FJPA 3L4GA 3QO7A 4K86A 2HNIA 4G85A 2Q7HA 1SESA 2EJGA 4P3NA 4HWOA 3IG2A 4TQDA 4P72A 1ADJA 3A7RA 1WNLA 4O2DA 2EWNA 4YRPA 4P71C 1NJ8A 4OLFA 1ASZA 3LSSA 4H2YA 4P72C 3I7FA 4G84A 2ZR3A 3VQVA 2DKGA 3VBBA 2E1HA 4EO4A 1C0AA 4CS4A 4XTZA 3E9IA 4ZTZB 4YRNA 3E9HA 4NCXA 2CJAA 3LC0A 4XTXA 3R07A 1X55A 2ZZEA 3HXUA 4XTUA 1NJ1A 4KR2A 3L2ZA 4UP7A 3NETA 2QHSA 1YGBA 3UGTA 3UFGA 3REXA 5C52B 3TUPA 1EQRA 2ZNJA 2AMCB 5KNNA 4XTVA 2ZGWA 2ZIOA 3EFSA 3RIRA 4TWAA 1LYLA 5HGQA 3L4GB 4XU3A 4XU0A 1EFWA 2ZXFA 3HXZA 4YREA 1E22A 1BIBA 1BBUA 1KMNA 2C8MA 1B70A 3HRKA 2ZZGA 3PCOB 4Q15A 4PHCA 2ZTGA 3M4QA 2ZNIA 3P8VA 3M4PA 4YRLA 3HXVA 4WJ4A 2ODRD 3G1ZA 3ICAA 2DZCA 4K87A 3A31A 4H2VA 3PZCA 3VQXA 4XTYA 2DVEA 4TVYA 2E5AA 4HWPA 2ARSA 3A7UA 3RF1A 2E10A 4RQFA 2XGTA 4CH3A 1N9WA 3QO8A 4AH6A 3P8TA 4YRJA 3QTCA 2QHUA 3QO5A 4CS2A 2AKWA 4YP0A 2E64A 2AMCA 4P3PA 3ERRA 5ELOA 1B7YB 4UP8A 1ADYA 1NJ6A 2G4CA 4YRRA 4CH6A 4HVCA 2DQ3A 2RHQA 3A5ZA 1HC7A 4P71A 1E24A 3TEHA 5C51B 1NJ2A 3PCOA 4WI1A 1YFRA 4YRKA 4XU1A 3DSQA 3MEYA 3QNEA 4ZIBA 1Z7MA 1B70B 2CJ9A 2ZZFA 12ASA 2ZT6A 4RQEA 3VQYA 1WQWA 1GGMA 4Q6GA 4H2XA 1EVKA 3OD1A 1B8AA 4UPAA 1BBWA 2DEQA 2CIMA 4ZTUB 2IY5A 3CMQA 3NENA 4P75C 3RGLA 2C7IA 2Q5IA 2ZCEA 2DTIA 2DXUA 1NYRA 2E3CA 2I4NA 3HY0A 1B7YA 1X2GA 5F5WA 4P73A 1W66A 1WU7A 2AKWB 2DTOA 1WLEA 2E41A 1G5HA 3W3SA 1VQZA 1WYDA 1H4SA 4P73C 4XTWA 1ATIA 2XTIA 3HFZB 3HXYA 1WQ7A 2RHQB 4RDXA 2ARUA 3TEHB 5K1PA 4H02A 3IKMB 2I4MA 2DJZA 2ZIMA 1H4TA 4DQ2A 1USYA 3IALA 4YRSA 1QE0A
chains in the Genus database with same CATH superfamily
5C53B 2YI8A 4WFBV 5EYPB 3JD1A 3OMAB 1R3LC 3MF2A 4UCTA 1NH2D 5L3DA 1XEQA 4WFGA 5C8YA 3MDSA 5DN6G 2HP8A 1HTTA 3H1JH 1GK9A 4YDQA 2IY5B 1XHXA 3GVMA 4DV3O 2E65A 3BEHA 1Q6HA 3E22B 5KHGA 1H8EG 4BW5A 3MAQA 3IKLA 1KP3A 4UP9A 4YRCA 5B1AB 3RN4A 1JOYA 3UM7A 4MVUA 4H2UA 4LP8A 3IJ4A 1AR4A 3J7AU 1K92A 1NVPB 1X54A 5B1OA 4DR7O 2HLDG 2QWQB 1G5IA 2RHSA 1Z7NA 2EX3A 2QWOB 4YRQA 3U0ZA 4LF9O 3HKBB 4I9QA 3V8KA 4ZBMA 3RWRD 2DTHA 3FD9A 5LMUO 5FPOA 1MSWD 2QTOA 2P4VA 1MOFA 4WFHA 4Q20A 1FJGO 4YJ2B 4HA8A 2EULA 1F7YA 4YCWA 1XUQA 5JVDA 2N74A 4WCEV 2BE3A 2BOCC 1GTOA 4WFAV 4W4KA 2DE0X 2JEUA 2F43G 1WA8A 3OEHG 3A74A 5IYZA 4NXNO 1N8RW 1IL2A 1T5EA 1JVMA 3NELA 3REUA 4X1KB 3B8NA 4XU2A 1NU1H 1SS3A 1K4CC 2YICA 3E8BA 2QWPB 3AG4B 3AK3A 3SR2C 3T1HB 1Y74A 1RSOB 1OCRC 3HKEB 3SGIA 3HR0A 3RYCA 4LBEC 4OP0A 4PG3A 4UB8Z 4YHHB 4O4LB 1VQNV 3P3PA 4I0XA 1YTFB 2P0LA 4KR3A 5EIBC 3LDCA 2PMFA 2XAFA 1SQBH 2JIZG 2WLMA 2DMXA 4YRTA 1R3IC 4EFBA 1K8AW 4IT5A 4LVIA 5BY1A 3SPIA 2XAGA 3CRCA 2ITDC 2R9RB 4FFBA 2M6YA 4O4IB 3E89A 4B3TO 3P30A 3HRIA 3I5DA 4ICGA 3HB3B 2WSSG 3F7YC 5D5QA 1CEZA 3J81N 4E2LA 2UXBB 4P74C 3FYIB 4AHCA 4MVOA 3UCSC 1QHTA 4GYCB 4LFCB 3OEEG 1PM9A 3RYIB 4DR1O 1I94O 2LP7A 2E5LB 1US6A 1QR8A 3MQZA 4J7KA 2Q69A 3T4DA 1X01A 2EIJB 1AI4A 1PNMA 3FFQA 4F6RA 1NJIW 3A0RA 1EZVH 3HKDB 2ARTA 2HKOA 4L87A 1X4TA 2P22C 3RKYA 2QWRB 2NS6A 4JTDB 1KMIZ 2AXTZ 2JK5C 4TOIA 1S76D 2DYSB 2Q73A 4LNUA 4ZI7A 5BZBA 1NTKH 1KMMA 1V54C 2B9ZA 5CB4B 3CD6V 3W7TA 3CC7V 1R6TA 4J42A 3BVOA 1H4QA 3B40A 2F66C 5JH7B 2HNIA 4JASA 1JJOA 2YSUB 2OIGA 4P3NA 4G27B 1M57C 5GTIZ 4TQDA 5L3GA 3GWKC 3CJHB 1YVWA 2GUZA 4IGGA 2VRZA 5LP6B 1NH2B 3N2GB 1N32O 1FFXB 5IJ9B 1YCIA 2ZE8A 3ABLB 3TXQA 4P71C 3LSSA 1OCZC 1TUBA 4JZGA 3I7FA 1Z5VA 3JSLA 2GBOA 3UT5A 2DKGA 3JASB 3VBBA 4EB6A 2E1HA 1N0JA 3JALB 2F4VO 5J2TA 2WLNA 2HR3A 4MVSA 4CS4A 4B3MO 4MSWC 2A3QA 2Z3YA 1H2MA 4X1IA 4UV8A 4X64B 4LFBO 3JATA 2IJIA 1YSCA 2Y4UA 3R07A 3L74H 2YS8A 2N05A 3ZIAG 3ZEDA 1NJ1A 4G28B 1MMMA 4NYKA 4JI8O 3AG7A 5CA1A 1N33O 4LF4B 4DK1A 1EBOA 3BFRA 1ZUQA 3L75H 4MTFA 4DR5O 1F23A 5C52B 1VQKV 1EQRA 5J2UA 1GO3F 5CA0A 3T1YO 3AEIA 2JGDB 4TWAA 4DYLA 5GONA 3H1KH 1LYLA 5HGQA 5EIBD 3OD4A 1TUEB 3ZBHA 4YIPA 3T2MA 5KMGB 1E1QG 5L3EA 4UCUA 3IGAC 4OX9O 2E76B 5EBMC 1KMNA 1RM1C 1Q6IA 3B2EE 3CEIA 4TV8A 5JCOA 2WLIB 3L70H 5IY5B 4TSFG 2CK3G 2ZTGA 3SPJA 4C7UA 4MW8A 3ZRWB 3N2KB 4O2AA 5J9PC 4WJ4A 4IHJB 2DZCA 4K87A 4QNHB 2KB1A 4XTYA 4JV5O 4JI6B 4HWPA 4I50B 2ARSA 3A7UA 4LVKA 4R8CA 4RQFA 3F5TA 1IDSA 1V55C 3QO8A 1GN4A 3M8AA 3FYEB 3PJSK 2CGOA 4PA4A 1BMFG 3EVKA 3ASOB 4HNAB 2A79B 2X6CA 2QHUA 1NS1A 2AMCA 4PELA 2VQEB 2AHZA 5B3SB 4UP8A 2VWJA 1M4UA 1ADYA 3HKCA 1NJ6A 4CH6A 4DW1A 2DQ3A 3JD4A 3A5ZA 3FB5C 2HHHO 2WLHA 4P71A 4JI1O 2N04A 5HFMA 2B1GA 2GSMB 3BY6A 4WI1A 5JJJB 1YFRA 2PTMA 2GTAA 2R9AA 4B08A 4YRKA 3DSQA 2F93B 4J7JA 1SF9A 3G67A 4JTCB 2WLLB 2UXNA 1GRJA 5EYPA 1B70B 2PYLA 2ZZFA 2UUBB 3SPGA 5FLXN 4N21A 1L8DA 4DUYB 2YIBA 2IU3A 1QLEC 2OCHA 4ZTUB 3B8MA 5AG2A 2IY5A 5LYJB 4DV4O 3LNNA 3E22A 1JX9A 2ZCEA 4FLWA 5IYDO 1OJHA 1B7YA 1BHBA 3K9SA 3RYHA 3ABMB 4JI3O 2E75B 5F5WA 4P73A 1W66A 4GX2A 2E41A 2BCCH 2Q4PA 3MHHC 4YY3B 1VQZA 5BXZA 4JZ2A 1SA0B 4GUNA 4K35A 1H4SA 4ZHQA 5EC2C 4XTWA 3C3SA 4X65B 3C90A 1TGOA 1WQ7A 3AG2C 1L0NH 2CUGA 3X2QB 1JJ2U 4DV5B 2ARUA 3GWOA 3TEHB 2KSDA 3H1LH 2QEXV 5EC1C 1HNZB 1XBLA 4MVQA 1XNQO 2IH1C 3K5LA 1KP2A 2BTQB 4YYEA 1OZ0A 1YB3A 5JWPA 4FLZA 1XILA 3BHPA 3F7VC 4JYCA 4NR1A 1VQ9V 2P5IA 1USYC 1BSMA 4DRXA 2RDCA 5CBFA 2PY5A 4MVZA 4YPFA 4X1KA 3WB1A 1XMOO 4LWSB 4TTVA 2EL9A 2IJHA 4WFEA 2CTPA 3MF1A 3HKEA 3TGUH 2PF4E 4DV2B 2CH7B 1OHHG 4HZ3A 2UU9O 3CCMV 5B1BB 3B77A 4O4LA 2ADQB 1EVLA 3HTZA 4GKJB 1SETA 1AJNA 1Y6XA 4ZOLB 4UCOA 1WPYA 1EZJA 3HFZA 3W7UA 1COWG 3KZIZ 1Z5WA 1VQOV 2UXCB 1M90W 1H2GA 3A8TA 5L3CA 3AG1B 5A2QN 4O4JB 1XMQB 2BSKA 4I4TB 3SPHA 4HAMA 1CXZB 2K1EA 1NJ5A 1TA8A 2F23A 2ALYA 1ASYA 3CPWU 4FM0A 3G80A 3ZHQA 4RMFA 2EAYA 2XAQA 3T1HO 3IC7A 4TV9B 3Q4HB 2XASA 2LO1A 4DR6B 4I7ZB 4LF5B 4DV1B 2EZPA 1HNXB 4YHHO 3CX5F 3ASNB 1RPRA 3CSXA 4AQYO 4GKKO 4CBCA 5KHJA 3KKYA 1G51A 1KBHA 1B76A 5DECA 1BHAA 4QJFB 1HXDA 2QM4A 3RKXA 1SERA 3QVNA 2CGHA 4LF8B 5LGTA 3E86A 1PYSA 1HNWO 2CTWA 5IE9A 1QBZA 4LCUC 1AILA 2LFSA 4GX1A 1NQTA 2ZINA 3K9AA 2DU5A 3QF7A 3OTOO 3SDLA 4XEOA 2GDSA 5H5NA 4X8AA 1QCEA 2DYRB 2ADPA 2EJRA 2EIKC 1OCOB 1G1XB 2EILB 2UUAB 3STZC 4LFCO 3WG7C 2WLJA 3C3TA 4X66B 1E1TA 2YEVB 1Q43A 4I55B 4JAUA 4NB5A 1YJWV 2A8EA 4WJ3M 4RO2A 2OWOA 2BOBC 4H2SA 3JAKB 5JH7A 2JS5A 5LA6B 2ZKOA 4LNSA 1L0WA 2OCCC 2JS3A 4LF7B 3CJHA 1JPXA 1R6KA 5LP6A 1UJWB 1DF4A 1H4VB 4MVRA 1H2SB 4YRMA 3N2GA 4JAVA 2KG7B 1FFXA 5IJ9A 1IBLB 2J3LA 4LR3A 4J7ZA 2DXTA 3LDEA 5E1AC 3ABKB 4PI2A 1KYOF 1EIYA 3EXAA 3FAVB 3CMAV 5IT9N 3L1AA 3HXWA 4TQFA 3JASA 3JALA 4RWUA 2RQ6A 4PI0A 5IYBO 4K3AA 1X56A 3OGCC 4UVBA 4QE7A 1EN6A 3CXHF 4X62O 3RFRA 2D2CB 1BE3H 1QQCA 4YCUA 1FD9A 3EFFK 5ITZA 3EFRA 2P4KA 1KD1W 1VQ7V 3UH0A 1WB8A 4CH4A 4TWKA 1XI1A 1J5EO 2PI5A 1F4MA 5DM6V 1H38A 4JYAO 1J5WA 1TVKB 3H9VA 1F51A 4UB6Z 4U3JB 4FFKA 3D8CA 2V4DA 4FLVA 2JGDA 4X88A 3RL6A 1Q90D 3FJPA 1I0HA 1W2BU 5LHHA 4Z1VA 1SZXA 1GM8A 4H44B 1BT8A 4FPPA 4X20B 3JSNA 3W7WA 1AB3A 4HWOA 2FL4A 3IG2A 2Y0IA 5EZYB 1NR7A 1OCCC 1QVGU 3A7RA 1SQXH 4O4HB 3BCCH 3OT7A 4DV0B 2EWNA 4YRPA 1NJ8A 2RCVA 1JFFA 1VARA 3N2KA 4H2YA 4D7TA 4G84A 2ZR3A 4EKWA 4DV6O 4I9WA 3VQVA 4IHJA 1W0JG 4JI7O 4HT4A 3OUFA 5B66Z 1QNMA 1C0AA 4I50A 1QVFU 1VQ5V 4YRNA 1YXBA 1N36B 1IBMB 2CJAA 1SQVH 2GHYA 4B3RB 4PV1B 1VQMV 1CPYA 4XTUA 1VF5B 4HNAA 1N0NA 4YJ3B 4OPAA 3NETA 2QHSA 2FKXA 4X9QA 4XDKA 3WB0A 4EEQA 2P06A 5IJ0B 3CC4V 4R7CA 3REXA 2RMKB 1AP6A 3RBZA 2CGNA 3NXSA 4XTVA 2ZIOA 1YEWA 3P3NA 3LSUA 4XU3A 2DWEC 4H33A 4JI6O 2ZM6B 5F2VO 1K34A 1GKFA 3HXZA 2P6JA 3BABA 4YREA 3THOA 5C93A 2WLLA 4P2ZA 1B70A 2LFRA 3OAAG 2UUCB 3PCOB 4Q15A 5E79Z 3SPCA 2LW1A 3N27A 3M4QA 3M4PA 2ILMA 4K0KB 5JCOC 3G1ZA 4PHZA 3LUTB 1R73A 3VQXA 3PZCA 5FL7G 2DVEA 1VQ4V 3JARB 3RF1A 2PI4A 4RUEA 2H94A 4NKGB 1GH6A 2HVKC 4BAYA 2QTSA 4JI5B 2OIEA 3CYOA 2EIMB 4YRJA 3K04A 2ZXWC 3QTCA 3RYFB 4PJ0Z 1TAEA 2YI9A 3SJAC 4CS2A 5IDJA 1R1BA 3ETQA 4LFAO 4MS2A 4QE9A 5KX5B 1M56B 2ZE6A 2IU0A 2G4CA 4WBNA 3CCSV 2EINC 4DUYO 2ZT9B 1HC7A 2IBZH 5LOVB 4DV3B 1LNQA 3EHBB 3TJTA 3TEHA 3FX7A 4TT3G 4KXRA 5JJNB 5C51B 1NJ2A 3OW2U 2QKCA 1KKCA 3RVZA 1XREA 1IVSA 1SQFA 4JI0O 3QNEA 5KLVH 1ZL8A 4U7OA 4X1YB 3ETGA 1U96A 3CRMA 4FZ1A 1A32A 2QR4A 1VP7A 4B7KA 3TETA 2UXDO 4GLXA 2ITCC 3SJQC 4LF9B 1B8AA 1BBWA 1YF2A 3CMQA 3T1CA 4H37A 4P75C 3RGLA 1X59A 5LXTB 5LMUB 5EBWC 4DV5O 2DXUA 1NYRA 5H6RA 3DTUB 2RNBA 2ODMA 1NTMH 1AR5A 1XQ8A 3O65A 2W0XA 5JQGA 1FJGB 3JD3A 3CCRV 1P84F 1G5HA 5B1AC 1HW7A 1WYDA 2GV9A 3ZHSA 4Z2WA 4A5UB 5LHIA 4P73C 4FIPC 4NXNB 4MT8A 2QDOA 1E1RG 2RHQB 4RDXA 4O4JA 4IL6Z 2YIDA 2ZQMA 4I4TA 1KKDA 1GMGA 2XUMA 3LNMB 2I4MA 1H4TA 2A0LA 4DV2O 4TV9A 3K5MA 3APQA 2PMEA 3A0BZ 2DJVA 3TK1A 1RIQA 2LW7A 3FB8C 1X2HA 4JYYA 4NXMO 1JA8A 3RACA 1IX9A 1PD3A 4UCVA 1V9PA 5B5EZ 4GKJO 4H2XB 1PPJH 4J15A 2YC0A 5JVDB 2ODRC 3ML0A 4UFZA 1XNRO 1BS3A 1RPOA 4LVLA 1E1OA 4KHPB 3RT3C 2R72A 4BW9A 4YRGA 2UXCO 1XMQO 3NEMA 2JVDA 1LUWA 2Q0OC 4LF6O 2QE7G 4B3TB 5H2FZ 1EFRG 3JD0A 4YRIA 2EJ9A 1H2NA 1VF6C 3AG4C 1MG1A 2QGNA 4B3SO 4PA7A 4XEMA 1Y74B 1I08A 4MTOA 1ENVA 2CE4A 4DR2B 4ZKIA 4DK0A 4LF5O 1KC8W 4UCRA 1AJQA 4DR1B 1I94B 11ASA 2PGGA 1BZKA 3D36A 3RUXA 2NR5A 4I0XB 2F95B 2YEVA 4GZRB 3SYOA 2Q7GA 3JAKA 5LA6A 1YFTA 4JI2O 3SJCC 5GW7A 3AG3B 3ZN1A 1ZWIC 3QG5A 1Q5OA 2JRIA 4CS3A 2CAZC 1HR0O 4BR6A 2HEPA 3KFUA 1IURA 4FFBB 2KG7A 3WU2Z 4HWTA 3ZMZA 4P75A 4YCVA 4KFMA 3FAVA 3BAAA 2YXLA 2Q5HA 1P7BA 3VQWA 2YXHA 4HBNA 4MW3A 2XOKG 2QA4V 2VQFO 4QPJA 4AILC 2QSAA 5BR8O 2ZT7A 3KCXA 2CJBA 4DO2A 4U3FH 3JAWB 4TVAB 4X89A 2EIJC 4E4EA 2MK3A 3A5YA 2YIBD 2HG5C 3M99B 4UXNA 2K9PA 5CN0A 3V8LA 4PD4F 4X5OA 1EN5A 1U97A 1N32B 4JGSA 2QHVA 3HKBA 4UV9A 1TVKA 2DYSC 2DQ0A 2ZT5A 4ZI7B 4HWRA 5H6QA 4J9ZB 3SYQA 3IC9A 3B09A 2LJ2A 1BIAA 4X20A 3CCJV 1SZTA 1I5XA 3E35A 3DXRB 3D3IA 5FNVB 4ABMA 1GN6A 2P90A 4GX5A 2BTOA 3HFVA 4YJ2A 2Q0AA 2B1IA 4O4HA 1NZ6A 2YUAA 4UVCA 1GN3A 1MA1A 4TUYB 4FZ0A 5CBHA 1N33B 2XT9A 1AP5A 3R65A 4J10A 4LH6A 1VEWA 5CA3A 3A7AA 1FFTB 1YITV 5ELNA 5LP6C 2AGAA 1GN2A 3I56V 2DN9A 3P32A 1NYQA 2X6AA 3ABLC 4FLXA 2I4OA 1VF6A 2QM7A 1OCRB 3WFVA 3H01A 1RSOA 4HYOA 3UO3A 3UT5B 1IBKB 4EB6B 3BFMA 3FKSG 1MABG 5J2TB 1JJCB 2KKWA 5L3FA 3CCEV 1FPOA 4YJ3A 2Y69B 1P7GA 3JATB 3ZHUA 1ZX3A 5IWAB 1YJNV 4PA6A 2HVJC 1FYFA 5IJ0A 3TXSA 1NBMG 4IYHA 3OUSA 4DV0O 2DU7A 1WP7A 3V7RA 1VQ6V 2QHTA 3A32A 3F5WC 1FS0G 4DUZB 4LH7A 1PNKA 2Y4TA 3SJBC 1DLBA 4FK5C 1SC5B 5K1XA 3ZHTA 4O4IA 3A0HZ 1WN7A 4K86A 4JV5B 4G85A 2Q7HA 1SESA 4NTXA 4IYIA 1YTFD 3L71H 3ZMUA 2EJGA 4K8XA 5GONB 4H0LB 4P72A 1WP8A 1WAZA 1IXBA 3RYIA 2QJ1A 4DW0A 4O2DA 3CCVV 4OLFA 2Q6AA 1KUQA 1PL4A 1JR9A 1BQZA 4TV8B 2E74B 3OTFA 3W7SA 2JJ1G 3HKDA 5IY5C 5LL6Y 3ZMTA 5KHHA 3M7MX 4EO4A 3OGIB 2G38A 3JARA 3AK1A 4XTZA 1ROPA 4ZTZB 2HHHB 4NCXA 4PA3A 1X55A 2ZZEA 2ZM6O 3RYFA 4KR2A 1V54B 3OM3B 3K0DA 2XTAA 1K33A 2UXBO 4PA9A 5CB4A 2QWNB 4FLYA 3K08A 1WJZA 3CHXA 1L1FA 1B06A 5KX5A 4JAAA 2E5LO 2VWKA 3TUPA 3ASOC 4JPRA 2ZNJA 2AMCB 3WB2A 3EFSA 1M57B 5B3SC 1FXKB 3L4GB 2IW5A 4DV4B 3DGEA 2HJDA 1M9NA 4XU0A 2DW4A 4FMTA 4IIJB 4JYBA 1EFWA 1K5QA 2ZXFA 1S0VA 1IZ3A 2NN4A 1OCZB 1N4CA 2A06H 3CCLV 2C8MA 2NNUA 3HRKA 4X1YA 2XHBA 3OR6C 4KUMA 3L73H 2OT5A 1XDCA 3K57A 2ZNIA 3G71V 5KA5A 3HXVA 3ICAA 1AI6A 3A31A 4H2VA 2YDEA 4TVYA 3CB2A 2E10A 2AHYA 5B1NA 5LXTA 2XGTA 1MNGA 1BQ0A 1N9WA 3K59A 3UO2A 1P49A 4UVAA 4JTAB 1WB7A 4B7EA 2O57A 3DC6A 4GCZA 3P8TA 4MTXA 4AH6A 3JCZA 1XNQB 4YP0A 2E64A 1R6NA 4P3PA 3ERRA 4MVMA 4P9PA 1YZBA 2FMLA 1B7YB 3RYHB 3ABMC 1GAXA 2IJKA 3MD0A 3K5NA 4K8ZA 5KMGA 2WWWA 2RHQA 4OPHA 5CMUA 1LUVA 2QKSA 4X64O 1R3KC 4ZHQB 3GB7C 1SKVA 1RM1B 4J11A 1K73W 1E24A 1PP9H 1XMOB 5LGUA 1HP8A 2WLIA 4FVMA 1ZAUA 1JCHA 1AVMA 1S5HC 2OTLV 1G4YB 3X2QC 4PDMA 3MEYA 1RP3B 1Z7MA 3ZRWA 2UU9B 4LF4O 1O9HA 3ZHRA 12ASA 4RQEA 2ZT6A 1HDJA 1M1KW 1GM9A 1BCCH 1JMKC 3FB6C 4Q6GA 4H2XA 1EVKA 3S3WA 1I7FA 3UQ8A 4WF9V 3FB7C 1LR1A 1V55B 4UPAA 1FYJA 4F6EA 2DEQA 1Y76B 4BIUA 5KHKA 2D3OW 4DRXB 5TISZ 3SYPA 1H8HG 3K3WA 2C7IA 3ZN0A 4P30A 1YI2V 2DTIA 5EBLC 3W7XA 2E3CA 1NTZH 1ZSPA 3RGBA 2I4NA 1D5NA 3HY0A 1YDXA 2NLJC 1W59A 1XL6A 2PYJA 2AZ0A 1WPBA 2AKWB 1VQLV 3G6BA 3W3SA 4I5SA 5H9CA 5LMNB 1I5YA 2X0LA 3L9DA 4DR4B 5B1BC 3RVYA 5BMVB 2Q9LA 2Y69C 4AQYB 2P67A 4GKKB 3ZRXA 1Q86W 1ATIA 1VF7A 2XTIA 3HFZB 3HXYA 4Z1MG 4KHPO 1YHQV 3ABTA 2DJZA 3E8HA 3VOUA 1XHZA 3CCUV 2BSKB 1HNWB 3AG1C 3G6EV 3IALA 1K7DA 4YRSA 4P9OA 2P5OA 2W6JG 4G2KA 3BJUA 2VQEO 2DWDC 3V7CA 2ALYB 1QLEB 4DR3B 2PUSA 1Q7YW 3OTOB 1Y66A 5LYJA 4LVJA 2AZ2A 2FYKA 4YROA 3ZCCA 4DR2O 3HXXA 2FTKA 1Y67A 2GTSA 3TEGA 4KQEA 1AJPA 4DV7B 1B6QA 3ASNC 4JI4B 4HWSA 1EOVA 3JAWA 4TVAA 1N34B 4K88A 2JDIG 2R70A 1QF6A 1PL0A 1BGYH 4EX5A 4YRFA 1Q6UA 3ZRVA 5KUMA 1SA0A 4XDJA 1XOUA 2UUBO 1PYSB 2LQTA 4PDRA 1IXMA 1R3JC 1SQPH 3AG2B 4E51A 1G8MA 2W0FC 4N23A 4BWAA 3JYCA 4O2BB 4YIOA 4NTWA 3ZRSA 4TVWA 2MW2B 3HY1A 2DYRC 4FM2A 3P8YA 2OTJV 1OCOC 2EILC 1THZA 4DPGA 4UCSA 3DXRA 5FNVA 1QLNA 3D36C 3E2EA 4X62B 3ZX6A 2BTQA 2ZR2A 1KOGA 4DR7B 2ZT8A 4H2TA 2H8PC 2WA3A 4TUYA 1FXKC 3A2FA 4QIWF 2LGWA 4CC5A 2DZ9A 1J5EB 4YY3O 3LDDA 4EFEA 4JYAB 1ZLZA 5C8YB 4X65O 2Q7EA 2ZD9A 3ABKC 5E3IA 1EIYB 4KP4A 4LWSA 1H2KA 4CH5A 4FLUA 1DTOA 2CH7A 1NNHA 2DDZA 4P3OA 1MSDA 2ZE5A 1XL4A 3U10A 1JJCA 5GTHZ 1GM7A 2QM8A 3CRQA 1HNZO 3RKWA 2ZDIC 3V8JA 4ZOLA 5KAIZ 5JJEB 5DEDA 2YIAA 2P7TC 3BA9A 5ITZB 2Q68A 4D6TH 3H1IH 2RHSB 5LBQA 2HFEC 1SQGA 4DV6B 4JI7B 1S72V 3RW0A 2Q8VA 2EBOA 3JD2A 3MHSC 3WQZA 3K5OA 1CP9A 4P74A 1IBKO 2W6IG 3Q4HA 1D5AA 2KQXA 3UKMA 3CP1A 4BIOA 1YFSA 2I4LA 3E8GA 1AI7A 2ZE7A 1SRYA 2EZOA 3H1HH 5A9GA 4CZZA 4FJCC 3R66A 3CMEV 1L0LH 5IWAO 4J80A 2VS0A 4L8JA 5D5PA 1PNLA 2XNDG 1QR9A 3HPLC 3V7SA 4FLTA 4DUZO 1JFFB 1WA8B 3UGQA 5IYZB 1K97A 1OV9A 3CXCU 2EJFA 2Q5ZA 4H2WA 1PV0A 5IYCO 3S3XA 1Z2GA 3LSQA 1ZTEA 3OE7G 3ZMVA 1UFIA 1DGSA 3IAYA 3IFXA 2EIKB 3RYCB 4DR6O 3JAMN 4DV1O 4R6ZA 3WG7B 1FKAO 1Q81W 1K9MW 1HNXO 2J3MA 4WF2A 4OGQB 1S5JA 4I55A 2ETNA 1E79G 2EJ7A 2Z0AA 4NVPA 2WA4A 2JGUA 2OCCB 2YXYA 1FXKA 3SYAA 1NKDA 3ABUA 3QO7A 3L4GA 1QU7A 2AW9A 5KAFZ 4IIJA 1YIJV 4LF8O 5KHIA 2ATKC 5CBGA 3D3QA 1VQ8V 1FXVA 1ADJA 1WNLA 2Z5UA 2FYUH 1ASZA 2V1DA 1W0KG 4P72C 4LFAB 2UUAO 4U7NA 4R50A 1PKXA 2FB5A 4X66O 2QKAA 2ZDIA 1AROP 1AR1B 2JEXA 4UUJC 3K0GA 3E9IA 1VIBA 4F6RB 3E9HA 1KU9A 4GT1A 5FPRA 5KUKA 3K58A 3LC0A 4XTXA 1Q82W 4LF7O 3HXUA 3T4ZA 3CRAA 4YXWG 3L2ZA 2IM9A 5LHGA 1VQPV 1IBLO 4JI0B 3O9OA 4UP7A 4U3JA 1KQSU 4LNUB 1YGBA 3UGTA 4RAIA 2XAJA 1DF5A 3UFGA 2EIMC 2IJJA 2B5UA 5EK0A 1SQQH 3ZJZA 3G4SV 2F4VB 2H3OA 4QPKA 1D2DA 1AI5A 1NVPD 2OYQA 3OMIB 1BL8A 1MZEA 2UXDB 1JQ0A 5KNNA 2ZGWA 4B3MB 3RIRA 1G6UA 1K4DC 4DXWA 4LFBB 1OCCB 1H2LA 1M56C 3ZMSA 5EZYA 4WBNB 1URFA 3K79A 3BRCA 2JJ2G 3STLC 5LGNA 2RN9A 4JI8B 3CCQV 1E22A 4CC6A 1BIBA 1BBUA 2GUZB 2ZZGA 3KG2A 3APOA 1RFYA 2M7WA 4DR5B 4PHCA 3JCUZ 3L72H 2WAMA 3ETEA 4LVMA 3U11A 3K06A 2Y0PA 4GX0A 1K3EA 3T1YB 3CS5A 3P8VA 1TUBB 1Y4MA 1ZL8B 4YRLA 2ODRD 4WFFA 2Q67A 3J80N 3ZS8C 1Y76A 2R9IA 1NI8A 3BPZA 2E5AA 1Q8IA 3B4SA 3TCUA 4J9YB 4CH3A 3OMNB 4X1IB 4OX9B 4FM1A 3CC2V 2L6LA 1M5IA 4D7SA 3PN1A 2A7WA 3QO5A 2AKWA 2CDYA 5CA1B 1S5LZ 2X7RB 1J95A 3ETDA 5ELOA 1F4NA 4NXMB 3ZHVA 5BMVA 5JQGB 3CWBH 5J2UB 1YJ9V 5HFLA 1ORQC 3CRRA 5CA0B 4YRRA 2WLKA 1XNRB 1B3QA 4HVCA 3K03A 3KCYA 3OFNG 2UXXA 1N36O 1S77D 1IBMO 5KA6A 2ARHA 4B3RO 1Q3EA 1HWYA 1NT2B 3PCOA 4OXSA 1FAFA 2Y48A 4QGPA 4XU1A 3AK2A 4LF6B 1P4RA 4ZIBA 1UPGA 3OR7C 4JF3A 2CJ9A 2X6BA 3VQYA 2DOSA 1WQWA 2HJFC 4B3SB 1DK1A 1GGMA 1VMGA 4J41A 2C2AA 4PDVA 4XDLA 4XBFA 3OD1A 3BA8A 4F4LA 4O2AB 5LMNO 2L35A 4LC1A 2PZSA 1WPXA 2WPDG 4JI1B 4DR4O 4RUFA 2CIMA 3I55V 3NENA 2ZXWB 1KB9F 4JI2B 1EN4A 2Q5IA 1S3JA 4H13B 3E83A 2F1MA 3DC5A 1NR1A 1HR0B 4MTGA 4W4LA 2UUCO 1X2GA 1MZFA 1B04A 1WU7A 4BIZA 1M93A 2DTOA 1WLEA 2EINB 1O9GA 1KECA 3SYCA 4DR3O 4O2BA 4PDLA 4K0KO 5L3BA 5LOVA 1K5SA 1FXHA 3CE2A 3HKCB 2A9HA 3E8FA 2VQFB 2IH3C 5BR8B 2RJZA 4ASUG 1WNSA 2CTRA 1EM1A 4KL1A 5K1PA 3NR7A 2V7QG 4DV7O 4H02A 4JI5O 3IKMB 4JI4O 4NTYA 2ZIMA 1N34O 3ICXA 4DQ2A 4AI8A 4JI3B 2CTQA 2LGQA 1USYA 3AG3C 2XAHA 1QE0A
chains in the Genus database with same CATH topology
3BJUA 2W6JG 4G2KA 2PMEA 2IH1C 4WFBV 2DWDC 3V7CA 5C53B 1KP2A 4YYEA 3JD1A 1OZ0A 3OMAB 1YB3A 2ALYB 1QLEB 3TK1A 1R3LC 1Q7YW 3FB8C 1Y66A 1RIQA 1X2HA 3MF2A 3RACA 3F7VC 4JYCA 1VQ9V 2P5IA 1NH2D 4LVJA 5L3DA 1USYC 1PD3A 4WFGA 3ZCCA 2FYKA 4H2XB 4YROA 4J15A 3HXXA 5CBFA 5DN6G 4LVLA 2FTKA 2ODRC 3ML0A 1RPOA 4MVZA 1HTTA 3TEGA 1E1OA 1GK9A 4KQEA 4YDQA 2IY5B 1AJPA 2E65A 4BW9A 1B6QA 4YPFA 3ASNC 3V7SA 3BEHA 4YRGA 4HWSA 1EOVA 4TVAA 4K88A 1H8EG 2JDIG 4BW5A 4TTVA 3NEMA 2EL9A 1QF6A 1PL0A 2IJHA 4WFEA 3MF1A 3IKLA 4EX5A 2QE7G 1KP3A 4UP9A 4YRCA 1OHHG 1EFRG 4HZ3A 5B1AB 4MVUA 3UM7A 3JD0A 1JOYA 4H2UA 4YRFA 4YRIA 4LP8A 3CCMV 2EJ9A 3ZRVA 5KUMA 5B1BB 1K92A 3B77A 3AG4C 4XDJA 5B1OA 1NVPB 1MG1A 1EVLA 2HLDG 4PA7A 1PYSB 1X54A 4XEMA 1G5IA 4MTOA 1ENVA 4PDRA 2RHSA 1SETA 4ZKIA 1IXMA 1Z7NA 1AJNA 1R3JC 1WPYA 1EZJA 3AG2B 1KC8W 3W7UA 1G8MA 2W0FC 1AJQA 3HFZA 4YRQA 1COWG 4N23A 4BWAA 11ASA 3JYCA 1VQOV 3D36A 3RUXA 2YEVA 3SYOA 3ZRSA 4TVWA 3V8KA 4ZBMA 1M90W 2Q7GA 1H2GA 3HY1A 2DYRC 1YFTA 2OTJV 3P8YA 1OCOC 2DTHA 5L3CA 3AG1B 2EILC 1THZA 4DPGA 5GW7A 3AG3B 3ZN1A 1ZWIC 1QLNA 3SPHA 3E2EA 1MSWD 4HAMA 4CS3A 2K1EA 2QTOA 1MOFA 1NJ5A 2ALYA 1ASYA 2ZR2A 3CPWU 1KOGA 3KFUA 4WFHA 2ZT8A 4RMFA 4Q20A 2EAYA 4H2TA 2XAQA 4HWTA 2H8PC 3ZMZA 3IC7A 4P75A 4YCVA 1FXKC 2XASA 4HA8A 4QIWF 4YCWA 4KFMA 2DZ9A 2Q5HA 3LDDA 4WCEV 2EZPA 2BOCC 1P7BA 1GTOA 4WFAV 3VQWA 3ASNB 1RPRA 4MW3A 2JEUA 2F43G 2XOKG 3OEHG 4CBCA 3A74A 2ZD9A 3ABKC 2QA4V 1G51A 1B76A 5E3IA 1BHAA 2Q7EA 4KP4A 4QPJA 4QJFB 1N8RW 1HXDA 4CH5A 1IL2A 2ZT7A 1DTOA 3RKXA 2CJBA 1JVMA 3NELA 3REUA 1NNHA 4DO2A 2DDZA 4P3OA 3B8NA 4XU2A 1XL4A 1SERA 1JJCA 1K4CC 4TVAB 1GM7A 2QM8A 3E8BA 3AG4B 4X89A 2CGHA 2EIJC 5LGTA 3E86A 2I4LA 2MK3A 1PYSA 3RKWA 1OCRC 1QBZA 3A5YA 2ZDIC 4LCUC 2HG5C 2LFSA 3M99B 4GX1A 4LBEC 4UXNA 5CN0A 4OP0A 3V8JA 3V8LA 4PG3A 1NQTA 3K9AA 2ZINA 1VQNV 2P7TC 4X5OA 2DU5A 4JGSA 2QHVA 4XEOA 2Q68A 4UV9A 4X8AA 1QCEA 2RHSB 2DYRB 2EJRA 2DYSC 1YTFB 2EIKC 1OCOB 2DQ0A 2ZT5A 5LBQA 2EILB 3STZC 4HWRA 5H6QA 2HFEC 3WG7C 2P0LA 2WLJA 3LDCA 1E1TA 2XAFA 2PMFA 4KR3A 2JIZG 2WLMA 1S72V 4YRTA 3RW0A 2YEVB 4J9ZB 1R3IC 4JAUA 3SYQA 1YJWV 2A8EA 4WJ3M 1K8AW 4RO2A 2EBOA 2BOBC 4H2SA 4LVIA 3JD2A 3MHSC 3SPIA 1BIAA 4LNSA 3WQZA 2XAGA 3CCJV 1SZTA 2ITDC 1CP9A 1I5XA 2R9RB 3E35A 2OCCC 1L0WA 3D3IA 4P74A 3E89A 2P90A 2W6IG 3P30A 4GX5A 3HRIA 3HFVA 1JPXA 3UKMA 1R6KA 2B1IA 3CP1A 3HB3B 1UJWB 1DF4A 1H4VB 4MVRA 3E8GA 1YFSA 1AI7A 2WSSG 1SRYA 2EZOA 3F7YC 4YRMA 4JAVA 4UVCA 1CEZA 2J3LA 4CZZA 4FJCC 4E2LA 5CBHA 2DXTA 3LDEA 5E1AC 4P74C 3ABKB 3FYIB 3CMEV 4MVOA 3R65A 1EIYA 3CMAV 5CA3A 3OEEG 1FFTB 3A7AA 1YITV 3L1AA 3HXWA 5ELNA 2LP7A 4TQFA 1PNLA 1QR8A 2XNDG 1QR9A 3HPLC 3MQZA 2Q69A 3T4DA 3P32A 3I56V 2X6AA 3ABLC 1NYQA 1X01A 2EIJB 3UGQA 2I4OA 1K97A 1AI4A 1PNMA 2QM7A 5IYBO 3CXCU 1OCRB 3A0RA 3H01A 3WFVA 1NJIW 3OGCC 1X56A 4UVBA 2EJFA 4HYOA 4H2WA 2ARTA 5IYCO 3BFMA 2HKOA 3FKSG 4L87A 4QE7A 1MABG 1JJCB 3LSQA 4YCUA 5L3FA 3RKYA 3CCEV 3EFFK 3OE7G 4JTDB 3ZMVA 1KD1W 2NS6A 3EFRA 2Y69B 2JK5C 1VQ7V 3UH0A 1S76D 2DYSB 3IFXA 2EIKB 4CH4A 4TWKA 1YJNV 4PA6A 2HVJC 1FYFA 4R6ZA 3WG7B 1Q81W 2PI5A 1F4MA 5DM6V 5BZBA 1NBMG 1K9MW 1KMMA 2J3MA 4WF2A 1H38A 3OUSA 2DU7A 1V54C 1J5WA 3V7RA 1VQ6V 2QHTA 3A32A 3F5WC 1F51A 1FS0G 1E79G 1PNKA 3CD6V 3W7TA 3CC7V 4X88A 1DLBA 2OCCB 4FK5C 3RL6A 5K1XA 1FXKA 3SYAA 3FJPA 1H4QA 1NKDA 3ABUA 3QO7A 3L4GA 4K86A 2HNIA 1W2BU 5LHHA 4JASA 1GM8A 1SESA 2YSUB 4FPPA 3W7WA 1YIJV 2Q7HA 4G85A 1YTFD 3ZMUA 4G27B 2EJGA 2ATKC 5CBGA 4P3NA 1M57C 4HWOA 3IG2A 4TQDA 5L3GA 1VQ8V 4P72A 1FXVA 1ADJA 1NR7A 1OCCC 1QVGU 3A7RA 1WNLA 1NH2B 4O2DA 2EWNA 2Z5UA 3ABLB 4YRPA 4P71C 1NJ8A 3CCVV 4OLFA 1ASZA 2Q6AA 3LSSA 2V1DA 1W0KG 1OCZC 4H2YA 4P72C 3I7FA 4U7NA 4R50A 2ZR3A 4EKWA 4G84A 1PKXA 4I9WA 3W7SA 3VQVA 2ZDIA 1W0JG 1AROP 2JJ1G 5IY5C 1AR1B 3VBBA 2JEXA 2DKGA 3OUFA 3ZMTA 2E1HA 4HT4A 4EO4A 1C0AA 4UUJC 3K0GA 2WLNA 2HR3A 4MVSA 1QVFU 4CS4A 4XTZA 3E9IA 4MSWC 1VQ5V 1ROPA 4ZTZB 2Z3YA 4YRNA 3E9HA 4NCXA 4GT1A 4PA3A 4UV8A 5KUKA 2CJAA 2IJIA 1YSCA 3LC0A 4XTXA 1Q82W 3R07A 2GHYA 1X55A 1VQMV 2ZZEA 3ZIAG 3HXUA 1CPYA 4XTUA 3T4ZA 1NJ1A 4YXWG 4KR2A 1V54B 3OM3B 4G28B 3L2ZA 5LHGA 1VQPV 3K0DA 1K33A 4PA9A 3NETA 4UP7A 2QHSA 1KQSU 1YGBA 3UGTA 1EBOA 4RAIA 2XAJA 4XDKA 1DF5A 3UFGA 3K08A 3CC4V 2EIMC 2IJJA 1L1FA 2B5UA 4R7CA 5EK0A 4MTFA 3REXA 1F23A 3ZJZA 3G4SV 5C52B 3TUPA 1VQKV 1EQRA 3ASOC 4JPRA 1GO3F 4QPKA 1AI5A 1NVPD 2ZNJA 3RBZA 3OMIB 1BL8A 2AMCB 3NXSA 1JQ0A 5KNNA 4XTVA 3AEIA 2ZGWA 2ZIOA 3EFSA 3RIRA 1M57B 4TWAA 1K4DC 5B3SC 1FXKB 4DXWA 1LYLA 4ZTUB 5HGQA 2IY5A 3L4GB 2IW5A 1OCCB 1TUEB 1M56C 3ZMSA 3DGEA 2DWEC 4XU3A 1M9NA 4H33A 3T2MA 4XU0A 2DW4A 4FMTA 4JYBA 1E1QG 5L3EA 1K34A 1GKFA 1EFWA 1K5QA 3K79A 3IGAC 2ZXFA 1S0VA 2JJ2G 3STLC 5LGNA 3HXZA 2P6JA 3CCQV 1E22A 4YREA 1BIBA 1OCZB 5EBMC 5C93A 1BBUA 1KMNA 1RM1C 2WLLA 3CCLV 2C8MA 4P2ZA 1B70A 2NNUA 3HRKA 2LFRA 3KG2A 3OAAG 3OR6C 2WLIB 2ZZGA 3PCOB 4Q15A 2M7WA 4KUMA 5IY5B 4PHCA 4TSFG 2CK3G 2ZTGA 2WAMA 3ETEA 3SPJA 4LVMA 3SPCA 2OT5A 3K06A 3M4QA 4GX0A 1K3EA 4MW8A 3ZRWB 2ZNIA 3P8VA 3M4PA 1Y4MA 3G71V 5KA5A 5J9PC 3HXVA 2ODRD 4WFFA 4YRLA 2Q67A 3G1ZA 3ICAA 4WJ4A 1AI6A 2DZCA 4K87A 3A31A 4H2VA 3LUTB 1R73A 2KB1A 4QNHB 2R9IA 5FL7G 3PZCA 4XTYA 3VQXA 2DVEA 4TVYA 2E5AA 4HWPA 3HTZA 1VQ4V 2ARSA 3A7UA 3RF1A 3TCUA 4LVKA 4R8CA 2E10A 2PI4A 4RQFA 2AHYA 4J9YB 4RUEA 2H94A 5B1NA 2XGTA 4CH3A 3OMNB 1V55C 1N9WA 3QO8A 2HVKC 4BAYA 3FYEB 4UVAA 3CC2V 3PJSK 4JTAB 3CYOA 2EIMB 4AH6A 4GCZA 3P8TA 4MTXA 4YRJA 3K04A 2ZXWC 3QTCA 4PA4A 1BMFG 3ASOB 2A79B 2X6CA 2QHUA 3JCZA 3QO5A 4CS2A 2AKWA 5IDJA 2E64A 2X7RB 4YP0A 1R6NA 4PELA 2AMCA 4P3PA 2AHZA 3ERRA 1J95A 4MVMA 3ETDA 4P9PA 5B3SB 1B7YB 1F4NA 4MS2A 4QE9A 5ELOA 4UP8A 3ABMC 1M56B 1YJ9V 5HFLA 1ORQC 2IJKA 3MD0A 2IU0A 1ADYA 1NJ6A 2G4CA 4YRRA 4CH6A 3CCSV 2WLKA 2WWWA 2EINC 4HVCA 2DQ3A 3K03A 2RHQA 3JD4A 3A5ZA 3FB5C 3OFNG 5CMUA 1HC7A 2UXXA 2WLHA 1S77D 2QKSA 4P71A 1R3KC 5HFMA 1LNQA 3EHBB 3GB7C 5KA6A 1RM1B 1K73W 1E24A 2B1GA 3TEHA 2GSMB 4TT3G 5LGUA 1HWYA 5C51B 2WLIA 3BY6A 1NJ2A 4OXSA 3OW2U 2Y48A 3PCOA 1YFRA 4WI1A 1JCHA 3RVZA 4YRKA 1S5HC 4XU1A 2OTLV 1G4YB 1P4RA 4PDMA 3X2QC 3DSQA 3MEYA 3QNEA 4ZIBA 1Z7MA 3OR7C 4JTCB 3ZRWA 2WLLB 2UXNA 4JF3A 1B70B 2CJ9A 2X6BA 12ASA 4U7OA 4RQEA 2ZT6A 2ZZFA 3VQYA 1WQWA 2HJFC 1M1KW 3ETGA 1GM9A 1GGMA 3FB6C 2C2AA 4PDVA 3SPGA 4XDLA 4XBFA 4H2XA 1EVKA 4Q6GA 3OD1A 4N21A 3TETA 4WF9V 4F4LA 3FB7C 1V55B 2ITCC 3SJQC 1B8AA 1BBWA 4UPAA 4LC1A 2IU3A 1QLEC 1WPXA 2WPDG 3B8MA 4RUFA 2CIMA 2DEQA 4BIUA 4E51A 3CMQA 3T1CA 3I55V 4H37A 2D3OW 3NENA 4P75C 1JX9A 2ZXWB 3SYPA 1H8HG 3RGLA 3K3WA 2C7IA 2Q5IA 5EBWC 1S3JA 3ZN0A 3E83A 2ZCEA 4P30A 1YI2V 2DTIA 5EBLC 3W7XA 2DXUA 1NYRA 5H6RA 2E3CA 5IYDO 2I4NA 3HY0A 1NR1A 4MTGA 3DTUB 2NLJC 1B7YA 1BHBA 3ABMB 1X2GA 5F5WA 1XL6A 4P73A 1W66A 4GX2A 1WU7A 4BIZA 2AKWB 3JD3A 3CCRV 1VQLV 2DTOA 1WLEA 2E41A 1G5HA 2EINB 5B1AC 3W3SA 1KECA 3MHHC 4I5SA 5H9CA 3SYCA 1I5YA 2X0LA 1VQZA 1WYDA 4PDLA 5B1BC 5L3BA 3RVYA 1H4SA 1K5SA 5LHIA 5EC2C 4P73C 4XTWA 2Y69C 1FXHA 2P67A 3ZRXA 4P9OA 4FIPC 2A9HA 3E8FA 1Q86W 1ATIA 2XTIA 4MT8A 3HFZB 3HXYA 2IH3C 1WQ7A 1E1RG 3AG2C 2RHQB 4RDXA 3X2QB 4ASUG 1JJ2U 2ARUA 4Z1MG 3GWOA 1YHQV 2ZQMA 3TEHB 5K1PA 2V7QG 4H02A 3ABTA 1KKDA 1GMGA 2QEXV 3IKMB 3LNMB 2I4MA 1EIYB 5EC1C 2DJZA 3E8HA 2ZIMA 1H4TA 4DQ2A 3VOUA 3CCUV 3AG1C 3G6EV 1USYA 1K7DA 2A0LA 3IALA 4MVQA 4YRSA 3AG3C 2XAHA 1QE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJU A;  5C53 B;  2PME A;  3V7C A;  4YYE A;  1YB3 A;  2ALY B;  1RIQ A;  1X2H A;  3MF2 A;  3RAC A;  2P5I A;  1USY C;  2FYK A;  4H2X B;  4YRO A;  4J15 A;  3HXX A;  2ODR C;  1HTT A;  3TEG A;  1E1O A;  4KQE A;  4YDQ A;  2IY5 B;  2E65 A;  4BW9 A;  4YPF A;  4YRG A;  4HWS A;  1EOV A;  4TVA A;  4K88 A;  4TTV A;  3NEM A;  2EL9 A;  1QF6 A;  3MF1 A;  3IKL A;  4EX5 A;  4UP9 A;  4YRC A;  4YRF A;  4H2U A;  4YRI A;  2EJ9 A;  1EVL A;  3HTZ A;  1X54 A;  1PYS B;  4XEM A;  1G5I A;  2RHS A;  1SET A;  1Z7N A;  1WPY A;  3HFZ A;  4E51 A;  4YRQ A;  4BWA A;  11AS A;  3RUX A;  3V8K A;  4TVW A;  2Q7G A;  3HY1 A;  1YFT A;  3P8Y A;  2DTH A;  4DPG A;  4CS3 A;  1NJ5 A;  2ALY A;  1ASY A;  2ZR2 A;  1KOG A;  3KFU A;  2ZT8 A;  4RMF A;  2EAY A;  4H2T A;  4HWT A;  4P75 A;  4YCV A;  4HA8 A;  4YCW A;  2DZ9 A;  2Q5H A;  3VQW A;  3A74 A;  2Q7E A;  1EIY B;  5E3I A;  1G51 A;  1B76 A;  1HXD A;  4CH5 A;  1IL2 A;  2ZT7 A;  3RKX A;  2CJB A;  3NEL A;  3REU A;  1NNH A;  2DDZ A;  4P3O A;  4XU2 A;  1SER A;  1JJC A;  4TVA B;  2CGH A;  1PYS A;  3RKW A;  3A5Y A;  3V8J A;  3V8L A;  4OP0 A;  4PG3 A;  2ZIN A;  4X5O A;  2DU5 A;  2QHV A;  4XEO A;  2RHS B;  2DQ0 A;  2ZT5 A;  4HWR A;  2P0L A;  4KR3 A;  2PMF A;  1E1T A;  4YRT A;  4WJ3 M;  4H2S A;  1BIA A;  4LNS A;  3WQZ A;  1L0W A;  4P74 A;  3HRI A;  3HFV A;  1H4V B;  1YFS A;  2I4L A;  4YRM A;  1SRY A;  2J3L A;  2DXT A;  4P74 C;  1EIY A;  3A7A A;  3L1A A;  3HXW A;  5ELN A;  4TQF A;  3V7S A;  1NYQ A;  1X01 A;  3UGQ A;  2I4O A;  2EJF A;  1X56 A;  4H2W A;  2ART A;  3BFM A;  4L87 A;  1JJC B;  3LSQ A;  4YCU A;  3RKY A;  3EFR A;  3UH0 A;  4CH4 A;  1FYF A;  1KMM A;  2J3M A;  4WF2 A;  2DU7 A;  1J5W A;  3V7R A;  2QHT A;  3A32 A;  3RL6 A;  5K1X A;  1H4Q A;  3FJP A;  3L4G A;  3QO7 A;  4K86 A;  2HNI A;  4G85 A;  2Q7H A;  1SES A;  2EJG A;  4P3N A;  4HWO A;  3IG2 A;  4TQD A;  4P72 A;  1ADJ A;  3A7R A;  1WNL A;  4O2D A;  2EWN A;  4YRP A;  4P71 C;  1NJ8 A;  4OLF A;  1ASZ A;  3LSS A;  4H2Y A;  4P72 C;  3I7F A;  4G84 A;  2ZR3 A;  3VQV A;  2DKG A;  3VBB A;  2E1H A;  4EO4 A;  1C0A A;  4CS4 A;  4XTZ A;  3E9I A;  4ZTZ B;  4YRN A;  3E9H A;  4NCX A;  2CJA A;  3LC0 A;  4XTX A;  3R07 A;  1X55 A;  2ZZE A;  3HXU A;  4XTU A;  1NJ1 A;  4KR2 A;  3L2Z A;  4UP7 A;  3NET A;  2QHS A;  1YGB A;  3UGT A;  3UFG A;  3REX A;  5C52 B;  3TUP A;  1EQR A;  2ZNJ A;  2AMC B;  5KNN A;  4XTV A;  2ZGW A;  2ZIO A;  3EFS A;  3RIR A;  4TWA A;  1LYL A;  5HGQ A;  3L4G B;  4XU3 A;  4XU0 A;  1EFW A;  2ZXF A;  3HXZ A;  4YRE A;  1E22 A;  1BIB A;  1BBU A;  1KMN A;  2C8M A;  1B70 A;  3HRK A;  2ZZG A;  3PCO B;  4Q15 A;  4PHC A;  2ZTG A;  3M4Q A;  2ZNI A;  3P8V A;  3M4P A;  4YRL A;  3HXV A;  4WJ4 A;  2ODR D;  3G1Z A;  3ICA A;  2DZC A;  4K87 A;  3A31 A;  4H2V A;  3PZC A;  3VQX A;  4XTY A;  2DVE A;  4TVY A;  2E5A A;  4HWP A;  2ARS A;  3A7U A;  3RF1 A;  2E10 A;  4RQF A;  2XGT A;  4CH3 A;  1N9W A;  3QO8 A;  4AH6 A;  3P8T A;  4YRJ A;  3QTC A;  2QHU A;  3QO5 A;  4CS2 A;  2AKW A;  4YP0 A;  2E64 A;  2AMC A;  4P3P A;  3ERR A;  5ELO A;  1B7Y B;  4UP8 A;  1ADY A;  1NJ6 A;  2G4C A;  4YRR A;  4CH6 A;  4HVC A;  2DQ3 A;  2RHQ A;  3A5Z A;  1HC7 A;  4P71 A;  1E24 A;  3TEH A;  5C51 B;  1NJ2 A;  3PCO A;  4WI1 A;  1YFR A;  4YRK A;  4XU1 A;  3DSQ A;  3MEY A;  3QNE A;  4ZIB A;  1Z7M A;  1B70 B;  2CJ9 A;  2ZZF A;  12AS A;  2ZT6 A;  4RQE A;  3VQY A;  1WQW A;  1GGM A;  4Q6G A;  4H2X A;  1EVK A;  3OD1 A;  1B8A A;  4UPA A;  1BBW A;  2DEQ A;  2CIM A;  4ZTU B;  2IY5 A;  3CMQ A;  3NEN A;  4P75 C;  3RGL A;  2C7I A;  2Q5I A;  2ZCE A;  2DTI A;  2DXU A;  1NYR A;  2E3C A;  2I4N A;  3HY0 A;  1B7Y A;  1X2G A;  5F5W A;  4P73 A;  1W66 A;  1WU7 A;  2AKW B;  2DTO A;  1WLE A;  2E41 A;  1G5H A;  3W3S A;  1VQZ A;  1WYD A;  1H4S A;  4P73 C;  4XTW A;  1ATI A;  2XTI A;  3HFZ B;  3HXY A;  1WQ7 A;  2RHQ B;  4RDX A;  2ARU A;  3TEH B;  5K1P A;  4H02 A;  3IKM B;  2I4M A;  2DJZ A;  2ZIM A;  1H4T A;  4DQ2 A;  1USY A;  3IAL A;  4YRS A;  1QE0 A; 
#chains in the Genus database with same CATH topology
 5C53 B;  2YI8 A;  4WFB V;  5EYP B;  3JD1 A;  3OMA B;  1R3L C;  3MF2 A;  4UCT A;  1NH2 D;  5L3D A;  1XEQ A;  4WFG A;  5C8Y A;  3MDS A;  5DN6 G;  2HP8 A;  1HTT A;  3H1J H;  1GK9 A;  4YDQ A;  2IY5 B;  1XHX A;  3GVM A;  4DV3 O;  2E65 A;  3BEH A;  1Q6H A;  3E22 B;  5KHG A;  1H8E G;  4BW5 A;  3MAQ A;  3IKL A;  1KP3 A;  4UP9 A;  4YRC A;  5B1A B;  3RN4 A;  1JOY A;  3UM7 A;  4MVU A;  4H2U A;  4LP8 A;  3IJ4 A;  1AR4 A;  3J7A U;  1K92 A;  1NVP B;  1X54 A;  5B1O A;  4DR7 O;  2HLD G;  2QWQ B;  1G5I A;  2RHS A;  1Z7N A;  2EX3 A;  2QWO B;  4YRQ A;  3U0Z A;  4LF9 O;  3HKB B;  4I9Q A;  3V8K A;  4ZBM A;  3RWR D;  2DTH A;  3FD9 A;  5LMU O;  5FPO A;  1MSW D;  2QTO A;  2P4V A;  1MOF A;  4WFH A;  4Q20 A;  1FJG O;  4YJ2 B;  4HA8 A;  2EUL A;  1F7Y A;  4YCW A;  1XUQ A;  5JVD A;  2N74 A;  4WCE V;  2BE3 A;  2BOC C;  1GTO A;  4WFA V;  4W4K A;  2DE0 X;  2JEU A;  2F43 G;  1WA8 A;  3OEH G;  3A74 A;  5IYZ A;  4NXN O;  1N8R W;  1IL2 A;  1T5E A;  1JVM A;  3NEL A;  3REU A;  4X1K B;  3B8N A;  4XU2 A;  1NU1 H;  1SS3 A;  1K4C C;  2YIC A;  3E8B A;  2QWP B;  3AG4 B;  3AK3 A;  3SR2 C;  3T1H B;  1Y74 A;  1RSO B;  1OCR C;  3HKE B;  3SGI A;  3HR0 A;  3RYC A;  4LBE C;  4OP0 A;  4PG3 A;  4UB8 Z;  4YHH B;  4O4L B;  1VQN V;  3P3P A;  4I0X A;  1YTF B;  2P0L A;  4KR3 A;  5EIB C;  3LDC A;  2PMF A;  2XAF A;  1SQB H;  2JIZ G;  2WLM A;  2DMX A;  4YRT A;  1R3I C;  4EFB A;  1K8A W;  4IT5 A;  4LVI A;  5BY1 A;  3SPI A;  2XAG A;  3CRC A;  2ITD C;  2R9R B;  4FFB A;  2M6Y A;  4O4I B;  3E89 A;  4B3T O;  3P30 A;  3HRI A;  3I5D A;  4ICG A;  3HB3 B;  2WSS G;  3F7Y C;  5D5Q A;  1CEZ A;  3J81 N;  4E2L A;  2UXB B;  4P74 C;  3FYI B;  4AHC A;  4MVO A;  3UCS C;  1QHT A;  4GYC B;  4LFC B;  3OEE G;  1PM9 A;  3RYI B;  4DR1 O;  1I94 O;  2LP7 A;  2E5L B;  1US6 A;  1QR8 A;  3MQZ A;  4J7K A;  2Q69 A;  3T4D A;  1X01 A;  2EIJ B;  1AI4 A;  1PNM A;  3FFQ A;  4F6R A;  1NJI W;  3A0R A;  1EZV H;  3HKD B;  2ART A;  2HKO A;  4L87 A;  1X4T A;  2P22 C;  3RKY A;  2QWR B;  2NS6 A;  4JTD B;  1KMI Z;  2AXT Z;  2JK5 C;  4TOI A;  1S76 D;  2DYS B;  2Q73 A;  4LNU A;  4ZI7 A;  5BZB A;  1NTK H;  1KMM A;  1V54 C;  2B9Z A;  5CB4 B;  3CD6 V;  3W7T A;  3CC7 V;  1R6T A;  4J42 A;  3BVO A;  1H4Q A;  3B40 A;  2F66 C;  5JH7 B;  2HNI A;  4JAS A;  1JJO A;  2YSU B;  2OIG A;  4P3N A;  4G27 B;  1M57 C;  5GTI Z;  4TQD A;  5L3G A;  3GWK C;  3CJH B;  1YVW A;  2GUZ A;  4IGG A;  2VRZ A;  5LP6 B;  1NH2 B;  3N2G B;  1N32 O;  1FFX B;  5IJ9 B;  1YCI A;  2ZE8 A;  3ABL B;  3TXQ A;  4P71 C;  3LSS A;  1OCZ C;  1TUB A;  4JZG A;  3I7F A;  1Z5V A;  3JSL A;  2GBO A;  3UT5 A;  2DKG A;  3JAS B;  3VBB A;  4EB6 A;  2E1H A;  1N0J A;  3JAL B;  2F4V O;  5J2T A;  2WLN A;  2HR3 A;  4MVS A;  4CS4 A;  4B3M O;  4MSW C;  2A3Q A;  2Z3Y A;  1H2M A;  4X1I A;  4UV8 A;  4X64 B;  4LFB O;  3JAT A;  2IJI A;  1YSC A;  2Y4U A;  3R07 A;  3L74 H;  2YS8 A;  2N05 A;  3ZIA G;  3ZED A;  1NJ1 A;  4G28 B;  1MMM A;  4NYK A;  4JI8 O;  3AG7 A;  5CA1 A;  1N33 O;  4LF4 B;  4DK1 A;  1EBO A;  3BFR A;  1ZUQ A;  3L75 H;  4MTF A;  4DR5 O;  1F23 A;  5C52 B;  1VQK V;  1EQR A;  5J2U A;  1GO3 F;  5CA0 A;  3T1Y O;  3AEI A;  2JGD B;  4TWA A;  4DYL A;  5GON A;  3H1K H;  1LYL A;  5HGQ A;  5EIB D;  3OD4 A;  1TUE B;  3ZBH A;  4YIP A;  3T2M A;  5KMG B;  1E1Q G;  5L3E A;  4UCU A;  3IGA C;  4OX9 O;  2E76 B;  5EBM C;  1KMN A;  1RM1 C;  1Q6I A;  3B2E E;  3CEI A;  4TV8 A;  5JCO A;  2WLI B;  3L70 H;  5IY5 B;  4TSF G;  2CK3 G;  2ZTG A;  3SPJ A;  4C7U A;  4MW8 A;  3ZRW B;  3N2K B;  4O2A A;  5J9P C;  4WJ4 A;  4IHJ B;  2DZC A;  4K87 A;  4QNH B;  2KB1 A;  4XTY A;  4JV5 O;  4JI6 B;  4HWP A;  4I50 B;  2ARS A;  3A7U A;  4LVK A;  4R8C A;  4RQF A;  3F5T A;  1IDS A;  1V55 C;  3QO8 A;  1GN4 A;  3M8A A;  3FYE B;  3PJS K;  2CGO A;  4PA4 A;  1BMF G;  3EVK A;  3ASO B;  4HNA B;  2A79 B;  2X6C A;  2QHU A;  1NS1 A;  2AMC A;  4PEL A;  2VQE B;  2AHZ A;  5B3S B;  4UP8 A;  2VWJ A;  1M4U A;  1ADY A;  3HKC A;  1NJ6 A;  4CH6 A;  4DW1 A;  2DQ3 A;  3JD4 A;  3A5Z A;  3FB5 C;  2HHH O;  2WLH A;  4P71 A;  4JI1 O;  2N04 A;  5HFM A;  2B1G A;  2GSM B;  3BY6 A;  4WI1 A;  5JJJ B;  1YFR A;  2PTM A;  2GTA A;  2R9A A;  4B08 A;  4YRK A;  3DSQ A;  2F93 B;  4J7J A;  1SF9 A;  3G67 A;  4JTC B;  2WLL B;  2UXN A;  1GRJ A;  5EYP A;  1B70 B;  2PYL A;  2ZZF A;  2UUB B;  3SPG A;  5FLX N;  4N21 A;  1L8D A;  4DUY B;  2YIB A;  2IU3 A;  1QLE C;  2OCH A;  4ZTU B;  3B8M A;  5AG2 A;  2IY5 A;  5LYJ B;  4DV4 O;  3LNN A;  3E22 A;  1JX9 A;  2ZCE A;  4FLW A;  5IYD O;  1OJH A;  1B7Y A;  1BHB A;  3K9S A;  3RYH A;  3ABM B;  4JI3 O;  2E75 B;  5F5W A;  4P73 A;  1W66 A;  4GX2 A;  2E41 A;  2BCC H;  2Q4P A;  3MHH C;  4YY3 B;  1VQZ A;  5BXZ A;  4JZ2 A;  1SA0 B;  4GUN A;  4K35 A;  1H4S A;  4ZHQ A;  5EC2 C;  4XTW A;  3C3S A;  4X65 B;  3C90 A;  1TGO A;  1WQ7 A;  3AG2 C;  1L0N H;  2CUG A;  3X2Q B;  1JJ2 U;  4DV5 B;  2ARU A;  3GWO A;  3TEH B;  2KSD A;  3H1L H;  2QEX V;  5EC1 C;  1HNZ B;  1XBL A;  4MVQ A;  1XNQ O;  2IH1 C;  3K5L A;  1KP2 A;  2BTQ B;  4YYE A;  1OZ0 A;  1YB3 A;  5JWP A;  4FLZ A;  1XIL A;  3BHP A;  3F7V C;  4JYC A;  4NR1 A;  1VQ9 V;  2P5I A;  1USY C;  1BSM A;  4DRX A;  2RDC A;  5CBF A;  2PY5 A;  4MVZ A;  4YPF A;  4X1K A;  3WB1 A;  1XMO O;  4LWS B;  4TTV A;  2EL9 A;  2IJH A;  4WFE A;  2CTP A;  3MF1 A;  3HKE A;  3TGU H;  2PF4 E;  4DV2 B;  2CH7 B;  1OHH G;  4HZ3 A;  2UU9 O;  3CCM V;  5B1B B;  3B77 A;  4O4L A;  2ADQ B;  1EVL A;  3HTZ A;  4GKJ B;  1SET A;  1AJN A;  1Y6X A;  4ZOL B;  4UCO A;  1WPY A;  1EZJ A;  3HFZ A;  3W7U A;  1COW G;  3KZI Z;  1Z5W A;  1VQO V;  2UXC B;  1M90 W;  1H2G A;  3A8T A;  5L3C A;  3AG1 B;  5A2Q N;  4O4J B;  1XMQ B;  2BSK A;  4I4T B;  3SPH A;  4HAM A;  1CXZ B;  2K1E A;  1NJ5 A;  1TA8 A;  2F23 A;  2ALY A;  1ASY A;  3CPW U;  4FM0 A;  3G80 A;  3ZHQ A;  4RMF A;  2EAY A;  2XAQ A;  3T1H O;  3IC7 A;  4TV9 B;  3Q4H B;  2XAS A;  2LO1 A;  4DR6 B;  4I7Z B;  4LF5 B;  4DV1 B;  2EZP A;  1HNX B;  4YHH O;  3CX5 F;  3ASN B;  1RPR A;  3CSX A;  4AQY O;  4GKK O;  4CBC A;  5KHJ A;  3KKY A;  1G51 A;  1KBH A;  1B76 A;  5DEC A;  1BHA A;  4QJF B;  1HXD A;  2QM4 A;  3RKX A;  1SER A;  3QVN A;  2CGH A;  4LF8 B;  5LGT A;  3E86 A;  1PYS A;  1HNW O;  2CTW A;  5IE9 A;  1QBZ A;  4LCU C;  1AIL A;  2LFS A;  4GX1 A;  1NQT A;  2ZIN A;  3K9A A;  2DU5 A;  3QF7 A;  3OTO O;  3SDL A;  4XEO A;  2GDS A;  5H5N A;  4X8A A;  1QCE A;  2DYR B;  2ADP A;  2EJR A;  2EIK C;  1OCO B;  1G1X B;  2EIL B;  2UUA B;  3STZ C;  4LFC O;  3WG7 C;  2WLJ A;  3C3T A;  4X66 B;  1E1T A;  2YEV B;  1Q43 A;  4I55 B;  4JAU A;  4NB5 A;  1YJW V;  2A8E A;  4WJ3 M;  4RO2 A;  2OWO A;  2BOB C;  4H2S A;  3JAK B;  5JH7 A;  2JS5 A;  5LA6 B;  2ZKO A;  4LNS A;  1L0W A;  2OCC C;  2JS3 A;  4LF7 B;  3CJH A;  1JPX A;  1R6K A;  5LP6 A;  1UJW B;  1DF4 A;  1H4V B;  4MVR A;  1H2S B;  4YRM A;  3N2G A;  4JAV A;  2KG7 B;  1FFX A;  5IJ9 A;  1IBL B;  2J3L A;  4LR3 A;  4J7Z A;  2DXT A;  3LDE A;  5E1A C;  3ABK B;  4PI2 A;  1KYO F;  1EIY A;  3EXA A;  3FAV B;  3CMA V;  5IT9 N;  3L1A A;  3HXW A;  4TQF A;  3JAS A;  3JAL A;  4RWU A;  2RQ6 A;  4PI0 A;  5IYB O;  4K3A A;  1X56 A;  3OGC C;  4UVB A;  4QE7 A;  1EN6 A;  3CXH F;  4X62 O;  3RFR A;  2D2C B;  1BE3 H;  1QQC A;  4YCU A;  1FD9 A;  3EFF K;  5ITZ A;  3EFR A;  2P4K A;  1KD1 W;  1VQ7 V;  3UH0 A;  1WB8 A;  4CH4 A;  4TWK A;  1XI1 A;  1J5E O;  2PI5 A;  1F4M A;  5DM6 V;  1H38 A;  4JYA O;  1J5W A;  1TVK B;  3H9V A;  1F51 A;  4UB6 Z;  4U3J B;  4FFK A;  3D8C A;  2V4D A;  4FLV A;  2JGD A;  4X88 A;  3RL6 A;  1Q90 D;  3FJP A;  1I0H A;  1W2B U;  5LHH A;  4Z1V A;  1SZX A;  1GM8 A;  4H44 B;  1BT8 A;  4FPP A;  4X20 B;  3JSN A;  3W7W A;  1AB3 A;  4HWO A;  2FL4 A;  3IG2 A;  2Y0I A;  5EZY B;  1NR7 A;  1OCC C;  1QVG U;  3A7R A;  1SQX H;  4O4H B;  3BCC H;  3OT7 A;  4DV0 B;  2EWN A;  4YRP A;  1NJ8 A;  2RCV A;  1JFF A;  1VAR A;  3N2K A;  4H2Y A;  4D7T A;  4G84 A;  2ZR3 A;  4EKW A;  4DV6 O;  4I9W A;  3VQV A;  4IHJ A;  1W0J G;  4JI7 O;  4HT4 A;  3OUF A;  5B66 Z;  1QNM A;  1C0A A;  4I50 A;  1QVF U;  1VQ5 V;  4YRN A;  1YXB A;  1N36 B;  1IBM B;  2CJA A;  1SQV H;  2GHY A;  4B3R B;  4PV1 B;  1VQM V;  1CPY A;  4XTU A;  1VF5 B;  4HNA A;  1N0N A;  4YJ3 B;  4OPA A;  3NET A;  2QHS A;  2FKX A;  4X9Q A;  4XDK A;  3WB0 A;  4EEQ A;  2P06 A;  5IJ0 B;  3CC4 V;  4R7C A;  3REX A;  2RMK B;  1AP6 A;  3RBZ A;  2CGN A;  3NXS A;  4XTV A;  2ZIO A;  1YEW A;  3P3N A;  3LSU A;  4XU3 A;  2DWE C;  4H33 A;  4JI6 O;  2ZM6 B;  5F2V O;  1K34 A;  1GKF A;  3HXZ A;  2P6J A;  3BAB A;  4YRE A;  3THO A;  5C93 A;  2WLL A;  4P2Z A;  1B70 A;  2LFR A;  3OAA G;  2UUC B;  3PCO B;  4Q15 A;  5E79 Z;  3SPC A;  2LW1 A;  3N27 A;  3M4Q A;  3M4P A;  2ILM A;  4K0K B;  5JCO C;  3G1Z A;  4PHZ A;  3LUT B;  1R73 A;  3VQX A;  3PZC A;  5FL7 G;  2DVE A;  1VQ4 V;  3JAR B;  3RF1 A;  2PI4 A;  4RUE A;  2H94 A;  4NKG B;  1GH6 A;  2HVK C;  4BAY A;  2QTS A;  4JI5 B;  2OIE A;  3CYO A;  2EIM B;  4YRJ A;  3K04 A;  2ZXW C;  3QTC A;  3RYF B;  4PJ0 Z;  1TAE A;  2YI9 A;  3SJA C;  4CS2 A;  5IDJ A;  1R1B A;  3ETQ A;  4LFA O;  4MS2 A;  4QE9 A;  5KX5 B;  1M56 B;  2ZE6 A;  2IU0 A;  2G4C A;  4WBN A;  3CCS V;  2EIN C;  4DUY O;  2ZT9 B;  1HC7 A;  2IBZ H;  5LOV B;  4DV3 B;  1LNQ A;  3EHB B;  3TJT A;  3TEH A;  3FX7 A;  4TT3 G;  4KXR A;  5JJN B;  5C51 B;  1NJ2 A;  3OW2 U;  2QKC A;  1KKC A;  3RVZ A;  1XRE A;  1IVS A;  1SQF A;  4JI0 O;  3QNE A;  5KLV H;  1ZL8 A;  4U7O A;  4X1Y B;  3ETG A;  1U96 A;  3CRM A;  4FZ1 A;  1A32 A;  2QR4 A;  1VP7 A;  4B7K A;  3TET A;  2UXD O;  4GLX A;  2ITC C;  3SJQ C;  4LF9 B;  1B8A A;  1BBW A;  1YF2 A;  3CMQ A;  3T1C A;  4H37 A;  4P75 C;  3RGL A;  1X59 A;  5LXT B;  5LMU B;  5EBW C;  4DV5 O;  2DXU A;  1NYR A;  5H6R A;  3DTU B;  2RNB A;  2ODM A;  1NTM H;  1AR5 A;  1XQ8 A;  3O65 A;  2W0X A;  5JQG A;  1FJG B;  3JD3 A;  3CCR V;  1P84 F;  1G5H A;  5B1A C;  1HW7 A;  1WYD A;  2GV9 A;  3ZHS A;  4Z2W A;  4A5U B;  5LHI A;  4P73 C;  4FIP C;  4NXN B;  4MT8 A;  2QDO A;  1E1R G;  2RHQ B;  4RDX A;  4O4J A;  4IL6 Z;  2YID A;  2ZQM A;  4I4T A;  1KKD A;  1GMG A;  2XUM A;  3LNM B;  2I4M A;  1H4T A;  2A0L A;  4DV2 O;  4TV9 A;  3K5M A;  3APQ A;  2PME A;  3A0B Z;  2DJV A;  3TK1 A;  1RIQ A;  2LW7 A;  3FB8 C;  1X2H A;  4JYY A;  4NXM O;  1JA8 A;  3RAC A;  1IX9 A;  1PD3 A;  4UCV A;  1V9P A;  5B5E Z;  4GKJ O;  4H2X B;  1PPJ H;  4J15 A;  2YC0 A;  5JVD B;  2ODR C;  3ML0 A;  4UFZ A;  1XNR O;  1BS3 A;  1RPO A;  4LVL A;  1E1O A;  4KHP B;  3RT3 C;  2R72 A;  4BW9 A;  4YRG A;  2UXC O;  1XMQ O;  3NEM A;  2JVD A;  1LUW A;  2Q0O C;  4LF6 O;  2QE7 G;  4B3T B;  5H2F Z;  1EFR G;  3JD0 A;  4YRI A;  2EJ9 A;  1H2N A;  1VF6 C;  3AG4 C;  1MG1 A;  2QGN A;  4B3S O;  4PA7 A;  4XEM A;  1Y74 B;  1I08 A;  4MTO A;  1ENV A;  2CE4 A;  4DR2 B;  4ZKI A;  4DK0 A;  4LF5 O;  1KC8 W;  4UCR A;  1AJQ A;  4DR1 B;  1I94 B;  11AS A;  2PGG A;  1BZK A;  3D36 A;  3RUX A;  2NR5 A;  4I0X B;  2F95 B;  2YEV A;  4GZR B;  3SYO A;  2Q7G A;  3JAK A;  5LA6 A;  1YFT A;  4JI2 O;  3SJC C;  5GW7 A;  3AG3 B;  3ZN1 A;  1ZWI C;  3QG5 A;  1Q5O A;  2JRI A;  4CS3 A;  2CAZ C;  1HR0 O;  4BR6 A;  2HEP A;  3KFU A;  1IUR A;  4FFB B;  2KG7 A;  3WU2 Z;  4HWT A;  3ZMZ A;  4P75 A;  4YCV A;  4KFM A;  3FAV A;  3BAA A;  2YXL A;  2Q5H A;  1P7B A;  3VQW A;  2YXH A;  4HBN A;  4MW3 A;  2XOK G;  2QA4 V;  2VQF O;  4QPJ A;  4AIL C;  2QSA A;  5BR8 O;  2ZT7 A;  3KCX A;  2CJB A;  4DO2 A;  4U3F H;  3JAW B;  4TVA B;  4X89 A;  2EIJ C;  4E4E A;  2MK3 A;  3A5Y A;  2YIB D;  2HG5 C;  3M99 B;  4UXN A;  2K9P A;  5CN0 A;  3V8L A;  4PD4 F;  4X5O A;  1EN5 A;  1U97 A;  1N32 B;  4JGS A;  2QHV A;  3HKB A;  4UV9 A;  1TVK A;  2DYS C;  2DQ0 A;  2ZT5 A;  4ZI7 B;  4HWR A;  5H6Q A;  4J9Z B;  3SYQ A;  3IC9 A;  3B09 A;  2LJ2 A;  1BIA A;  4X20 A;  3CCJ V;  1SZT A;  1I5X A;  3E35 A;  3DXR B;  3D3I A;  5FNV B;  4ABM A;  1GN6 A;  2P90 A;  4GX5 A;  2BTO A;  3HFV A;  4YJ2 A;  2Q0A A;  2B1I A;  4O4H A;  1NZ6 A;  2YUA A;  4UVC A;  1GN3 A;  1MA1 A;  4TUY B;  4FZ0 A;  5CBH A;  1N33 B;  2XT9 A;  1AP5 A;  3R65 A;  4J10 A;  4LH6 A;  1VEW A;  5CA3 A;  3A7A A;  1FFT B;  1YIT V;  5ELN A;  5LP6 C;  2AGA A;  1GN2 A;  3I56 V;  2DN9 A;  3P32 A;  1NYQ A;  2X6A A;  3ABL C;  4FLX A;  2I4O A;  1VF6 A;  2QM7 A;  1OCR B;  3WFV A;  3H01 A;  1RSO A;  4HYO A;  3UO3 A;  3UT5 B;  1IBK B;  4EB6 B;  3BFM A;  3FKS G;  1MAB G;  5J2T B;  1JJC B;  2KKW A;  5L3F A;  3CCE V;  1FPO A;  4YJ3 A;  2Y69 B;  1P7G A;  3JAT B;  3ZHU A;  1ZX3 A;  5IWA B;  1YJN V;  4PA6 A;  2HVJ C;  1FYF A;  5IJ0 A;  3TXS A;  1NBM G;  4IYH A;  3OUS A;  4DV0 O;  2DU7 A;  1WP7 A;  3V7R A;  1VQ6 V;  2QHT A;  3A32 A;  3F5W C;  1FS0 G;  4DUZ B;  4LH7 A;  1PNK A;  2Y4T A;  3SJB C;  1DLB A;  4FK5 C;  1SC5 B;  5K1X A;  3ZHT A;  4O4I A;  3A0H Z;  1WN7 A;  4K86 A;  4JV5 B;  4G85 A;  2Q7H A;  1SES A;  4NTX A;  4IYI A;  1YTF D;  3L71 H;  3ZMU A;  2EJG A;  4K8X A;  5GON B;  4H0L B;  4P72 A;  1WP8 A;  1WAZ A;  1IXB A;  3RYI A;  2QJ1 A;  4DW0 A;  4O2D A;  3CCV V;  4OLF A;  2Q6A A;  1KUQ A;  1PL4 A;  1JR9 A;  1BQZ A;  4TV8 B;  2E74 B;  3OTF A;  3W7S A;  2JJ1 G;  3HKD A;  5IY5 C;  5LL6 Y;  3ZMT A;  5KHH A;  3M7M X;  4EO4 A;  3OGI B;  2G38 A;  3JAR A;  3AK1 A;  4XTZ A;  1ROP A;  4ZTZ B;  2HHH B;  4NCX A;  4PA3 A;  1X55 A;  2ZZE A;  2ZM6 O;  3RYF A;  4KR2 A;  1V54 B;  3OM3 B;  3K0D A;  2XTA A;  1K33 A;  2UXB O;  4PA9 A;  5CB4 A;  2QWN B;  4FLY A;  3K08 A;  1WJZ A;  3CHX A;  1L1F A;  1B06 A;  5KX5 A;  4JAA A;  2E5L O;  2VWK A;  3TUP A;  3ASO C;  4JPR A;  2ZNJ A;  2AMC B;  3WB2 A;  3EFS A;  1M57 B;  5B3S C;  1FXK B;  3L4G B;  2IW5 A;  4DV4 B;  3DGE A;  2HJD A;  1M9N A;  4XU0 A;  2DW4 A;  4FMT A;  4IIJ B;  4JYB A;  1EFW A;  1K5Q A;  2ZXF A;  1S0V A;  1IZ3 A;  2NN4 A;  1OCZ B;  1N4C A;  2A06 H;  3CCL V;  2C8M A;  2NNU A;  3HRK A;  4X1Y A;  2XHB A;  3OR6 C;  4KUM A;  3L73 H;  2OT5 A;  1XDC A;  3K57 A;  2ZNI A;  3G71 V;  5KA5 A;  3HXV A;  3ICA A;  1AI6 A;  3A31 A;  4H2V A;  2YDE A;  4TVY A;  3CB2 A;  2E10 A;  2AHY A;  5B1N A;  5LXT A;  2XGT A;  1MNG A;  1BQ0 A;  1N9W A;  3K59 A;  3UO2 A;  1P49 A;  4UVA A;  4JTA B;  1WB7 A;  4B7E A;  2O57 A;  3DC6 A;  4GCZ A;  3P8T A;  4MTX A;  4AH6 A;  3JCZ A;  1XNQ B;  4YP0 A;  2E64 A;  1R6N A;  4P3P A;  3ERR A;  4MVM A;  4P9P A;  1YZB A;  2FML A;  1B7Y B;  3RYH B;  3ABM C;  1GAX A;  2IJK A;  3MD0 A;  3K5N A;  4K8Z A;  5KMG A;  2WWW A;  2RHQ A;  4OPH A;  5CMU A;  1LUV A;  2QKS A;  4X64 O;  1R3K C;  4ZHQ B;  3GB7 C;  1SKV A;  1RM1 B;  4J11 A;  1K73 W;  1E24 A;  1PP9 H;  1XMO B;  5LGU A;  1HP8 A;  2WLI A;  4FVM A;  1ZAU A;  1JCH A;  1AVM A;  1S5H C;  2OTL V;  1G4Y B;  3X2Q C;  4PDM A;  3MEY A;  1RP3 B;  1Z7M A;  3ZRW A;  2UU9 B;  4LF4 O;  1O9H A;  3ZHR A;  12AS A;  4RQE A;  2ZT6 A;  1HDJ A;  1M1K W;  1GM9 A;  1BCC H;  1JMK C;  3FB6 C;  4Q6G A;  4H2X A;  1EVK A;  3S3W A;  1I7F A;  3UQ8 A;  4WF9 V;  3FB7 C;  1LR1 A;  1V55 B;  4UPA A;  1FYJ A;  4F6E A;  2DEQ A;  1Y76 B;  4BIU A;  5KHK A;  2D3O W;  4DRX B;  5TIS Z;  3SYP A;  1H8H G;  3K3W A;  2C7I A;  3ZN0 A;  4P30 A;  1YI2 V;  2DTI A;  5EBL C;  3W7X A;  2E3C A;  1NTZ H;  1ZSP A;  3RGB A;  2I4N A;  1D5N A;  3HY0 A;  1YDX A;  2NLJ C;  1W59 A;  1XL6 A;  2PYJ A;  2AZ0 A;  1WPB A;  2AKW B;  1VQL V;  3G6B A;  3W3S A;  4I5S A;  5H9C A;  5LMN B;  1I5Y A;  2X0L A;  3L9D A;  4DR4 B;  5B1B C;  3RVY A;  5BMV B;  2Q9L A;  2Y69 C;  4AQY B;  2P67 A;  4GKK B;  3ZRX A;  1Q86 W;  1ATI A;  1VF7 A;  2XTI A;  3HFZ B;  3HXY A;  4Z1M G;  4KHP O;  1YHQ V;  3ABT A;  2DJZ A;  3E8H A;  3VOU A;  1XHZ A;  3CCU V;  2BSK B;  1HNW B;  3AG1 C;  3G6E V;  3IAL A;  1K7D A;  4YRS A;  4P9O A;  2P5O A;  2W6J G;  4G2K A;  3BJU A;  2VQE O;  2DWD C;  3V7C A;  2ALY B;  1QLE B;  4DR3 B;  2PUS A;  1Q7Y W;  3OTO B;  1Y66 A;  5LYJ A;  4LVJ A;  2AZ2 A;  2FYK A;  4YRO A;  3ZCC A;  4DR2 O;  3HXX A;  2FTK A;  1Y67 A;  2GTS A;  3TEG A;  4KQE A;  1AJP A;  4DV7 B;  1B6Q A;  3ASN C;  4JI4 B;  4HWS A;  1EOV A;  3JAW A;  4TVA A;  1N34 B;  4K88 A;  2JDI G;  2R70 A;  1QF6 A;  1PL0 A;  1BGY H;  4EX5 A;  4YRF A;  1Q6U A;  3ZRV A;  5KUM A;  1SA0 A;  4XDJ A;  1XOU A;  2UUB O;  1PYS B;  2LQT A;  4PDR A;  1IXM A;  1R3J C;  1SQP H;  3AG2 B;  4E51 A;  1G8M A;  2W0F C;  4N23 A;  4BWA A;  3JYC A;  4O2B B;  4YIO A;  4NTW A;  3ZRS A;  4TVW A;  2MW2 B;  3HY1 A;  2DYR C;  4FM2 A;  3P8Y A;  2OTJ V;  1OCO C;  2EIL C;  1THZ A;  4DPG A;  4UCS A;  3DXR A;  5FNV A;  1QLN A;  3D36 C;  3E2E A;  4X62 B;  3ZX6 A;  2BTQ A;  2ZR2 A;  1KOG A;  4DR7 B;  2ZT8 A;  4H2T A;  2H8P C;  2WA3 A;  4TUY A;  1FXK C;  3A2F A;  4QIW F;  2LGW A;  4CC5 A;  2DZ9 A;  1J5E B;  4YY3 O;  3LDD A;  4EFE A;  4JYA B;  1ZLZ A;  5C8Y B;  4X65 O;  2Q7E A;  2ZD9 A;  3ABK C;  5E3I A;  1EIY B;  4KP4 A;  4LWS A;  1H2K A;  4CH5 A;  4FLU A;  1DTO A;  2CH7 A;  1NNH A;  2DDZ A;  4P3O A;  1MSD A;  2ZE5 A;  1XL4 A;  3U10 A;  1JJC A;  5GTH Z;  1GM7 A;  2QM8 A;  3CRQ A;  1HNZ O;  3RKW A;  2ZDI C;  3V8J A;  4ZOL A;  5KAI Z;  5JJE B;  5DED A;  2YIA A;  2P7T C;  3BA9 A;  5ITZ B;  2Q68 A;  4D6T H;  3H1I H;  2RHS B;  5LBQ A;  2HFE C;  1SQG A;  4DV6 B;  4JI7 B;  1S72 V;  3RW0 A;  2Q8V A;  2EBO A;  3JD2 A;  3MHS C;  3WQZ A;  3K5O A;  1CP9 A;  4P74 A;  1IBK O;  2W6I G;  3Q4H A;  1D5A A;  2KQX A;  3UKM A;  3CP1 A;  4BIO A;  1YFS A;  2I4L A;  3E8G A;  1AI7 A;  2ZE7 A;  1SRY A;  2EZO A;  3H1H H;  5A9G A;  4CZZ A;  4FJC C;  3R66 A;  3CME V;  1L0L H;  5IWA O;  4J80 A;  2VS0 A;  4L8J A;  5D5P A;  1PNL A;  2XND G;  1QR9 A;  3HPL C;  3V7S A;  4FLT A;  4DUZ O;  1JFF B;  1WA8 B;  3UGQ A;  5IYZ B;  1K97 A;  1OV9 A;  3CXC U;  2EJF A;  2Q5Z A;  4H2W A;  1PV0 A;  5IYC O;  3S3X A;  1Z2G A;  3LSQ A;  1ZTE A;  3OE7 G;  3ZMV A;  1UFI A;  1DGS A;  3IAY A;  3IFX A;  2EIK B;  3RYC B;  4DR6 O;  3JAM N;  4DV1 O;  4R6Z A;  3WG7 B;  1FKA O;  1Q81 W;  1K9M W;  1HNX O;  2J3M A;  4WF2 A;  4OGQ B;  1S5J A;  4I55 A;  2ETN A;  1E79 G;  2EJ7 A;  2Z0A A;  4NVP A;  2WA4 A;  2JGU A;  2OCC B;  2YXY A;  1FXK A;  3SYA A;  1NKD A;  3ABU A;  3QO7 A;  3L4G A;  1QU7 A;  2AW9 A;  5KAF Z;  4IIJ A;  1YIJ V;  4LF8 O;  5KHI A;  2ATK C;  5CBG A;  3D3Q A;  1VQ8 V;  1FXV A;  1ADJ A;  1WNL A;  2Z5U A;  2FYU H;  1ASZ A;  2V1D A;  1W0K G;  4P72 C;  4LFA B;  2UUA O;  4U7N A;  4R50 A;  1PKX A;  2FB5 A;  4X66 O;  2QKA A;  2ZDI A;  1ARO P;  1AR1 B;  2JEX A;  4UUJ C;  3K0G A;  3E9I A;  1VIB A;  4F6R B;  3E9H A;  1KU9 A;  4GT1 A;  5FPR A;  5KUK A;  3K58 A;  3LC0 A;  4XTX A;  1Q82 W;  4LF7 O;  3HXU A;  3T4Z A;  3CRA A;  4YXW G;  3L2Z A;  2IM9 A;  5LHG A;  1VQP V;  1IBL O;  4JI0 B;  3O9O A;  4UP7 A;  4U3J A;  1KQS U;  4LNU B;  1YGB A;  3UGT A;  4RAI A;  2XAJ A;  1DF5 A;  3UFG A;  2EIM C;  2IJJ A;  2B5U A;  5EK0 A;  1SQQ H;  3ZJZ A;  3G4S V;  2F4V B;  2H3O A;  4QPK A;  1D2D A;  1AI5 A;  1NVP D;  2OYQ A;  3OMI B;  1BL8 A;  1MZE A;  2UXD B;  1JQ0 A;  5KNN A;  2ZGW A;  4B3M B;  3RIR A;  1G6U A;  1K4D C;  4DXW A;  4LFB B;  1OCC B;  1H2L A;  1M56 C;  3ZMS A;  5EZY A;  4WBN B;  1URF A;  3K79 A;  3BRC A;  2JJ2 G;  3STL C;  5LGN A;  2RN9 A;  4JI8 B;  3CCQ V;  1E22 A;  4CC6 A;  1BIB A;  1BBU A;  2GUZ B;  2ZZG A;  3KG2 A;  3APO A;  1RFY A;  2M7W A;  4DR5 B;  4PHC A;  3JCU Z;  3L72 H;  2WAM A;  3ETE A;  4LVM A;  3U11 A;  3K06 A;  2Y0P A;  4GX0 A;  1K3E A;  3T1Y B;  3CS5 A;  3P8V A;  1TUB B;  1Y4M A;  1ZL8 B;  4YRL A;  2ODR D;  4WFF A;  2Q67 A;  3J80 N;  3ZS8 C;  1Y76 A;  2R9I A;  1NI8 A;  3BPZ A;  2E5A A;  1Q8I A;  3B4S A;  3TCU A;  4J9Y B;  4CH3 A;  3OMN B;  4X1I B;  4OX9 B;  4FM1 A;  3CC2 V;  2L6L A;  1M5I A;  4D7S A;  3PN1 A;  2A7W A;  3QO5 A;  2AKW A;  2CDY A;  5CA1 B;  1S5L Z;  2X7R B;  1J95 A;  3ETD A;  5ELO A;  1F4N A;  4NXM B;  3ZHV A;  5BMV A;  5JQG B;  3CWB H;  5J2U B;  1YJ9 V;  5HFL A;  1ORQ C;  3CRR A;  5CA0 B;  4YRR A;  2WLK A;  1XNR B;  1B3Q A;  4HVC A;  3K03 A;  3KCY A;  3OFN G;  2UXX A;  1N36 O;  1S77 D;  1IBM O;  5KA6 A;  2ARH A;  4B3R O;  1Q3E A;  1HWY A;  1NT2 B;  3PCO A;  4OXS A;  1FAF A;  2Y48 A;  4QGP A;  4XU1 A;  3AK2 A;  4LF6 B;  1P4R A;  4ZIB A;  1UPG A;  3OR7 C;  4JF3 A;  2CJ9 A;  2X6B A;  3VQY A;  2DOS A;  1WQW A;  2HJF C;  4B3S B;  1DK1 A;  1GGM A;  1VMG A;  4J41 A;  2C2A A;  4PDV A;  4XDL A;  4XBF A;  3OD1 A;  3BA8 A;  4F4L A;  4O2A B;  5LMN O;  2L35 A;  4LC1 A;  2PZS A;  1WPX A;  2WPD G;  4JI1 B;  4DR4 O;  4RUF A;  2CIM A;  3I55 V;  3NEN A;  2ZXW B;  1KB9 F;  4JI2 B;  1EN4 A;  2Q5I A;  1S3J A;  4H13 B;  3E83 A;  2F1M A;  3DC5 A;  1NR1 A;  1HR0 B;  4MTG A;  4W4L A;  2UUC O;  1X2G A;  1MZF A;  1B04 A;  1WU7 A;  4BIZ A;  1M93 A;  2DTO A;  1WLE A;  2EIN B;  1O9G A;  1KEC A;  3SYC A;  4DR3 O;  4O2B A;  4PDL A;  4K0K O;  5L3B A;  5LOV A;  1K5S A;  1FXH A;  3CE2 A;  3HKC B;  2A9H A;  3E8F A;  2VQF B;  2IH3 C;  5BR8 B;  2RJZ A;  4ASU G;  1WNS A;  2CTR A;  1EM1 A;  4KL1 A;  5K1P A;  3NR7 A;  2V7Q G;  4DV7 O;  4H02 A;  4JI5 O;  3IKM B;  4JI4 O;  4NTY A;  2ZIM A;  1N34 O;  3ICX A;  4DQ2 A;  4AI8 A;  4JI3 B;  2CTQ A;  2LGQ A;  1USY A;  3AG3 C;  2XAH A;  1QE0 A; 
#chains in the Genus database with same CATH homology
 3BJU A;  2W6J G;  4G2K A;  2PME A;  2IH1 C;  4WFB V;  2DWD C;  3V7C A;  5C53 B;  1KP2 A;  4YYE A;  3JD1 A;  1OZ0 A;  3OMA B;  1YB3 A;  2ALY B;  1QLE B;  3TK1 A;  1R3L C;  1Q7Y W;  3FB8 C;  1Y66 A;  1RIQ A;  1X2H A;  3MF2 A;  3RAC A;  3F7V C;  4JYC A;  1VQ9 V;  2P5I A;  1NH2 D;  4LVJ A;  5L3D A;  1USY C;  1PD3 A;  4WFG A;  3ZCC A;  2FYK A;  4H2X B;  4YRO A;  4J15 A;  3HXX A;  5CBF A;  5DN6 G;  4LVL A;  2FTK A;  2ODR C;  3ML0 A;  1RPO A;  4MVZ A;  1HTT A;  3TEG A;  1E1O A;  1GK9 A;  4KQE A;  4YDQ A;  2IY5 B;  1AJP A;  2E65 A;  4BW9 A;  1B6Q A;  4YPF A;  3ASN C;  3V7S A;  3BEH A;  4YRG A;  4HWS A;  1EOV A;  4TVA A;  4K88 A;  1H8E G;  2JDI G;  4BW5 A;  4TTV A;  3NEM A;  2EL9 A;  1QF6 A;  1PL0 A;  2IJH A;  4WFE A;  3MF1 A;  3IKL A;  4EX5 A;  2QE7 G;  1KP3 A;  4UP9 A;  4YRC A;  1OHH G;  1EFR G;  4HZ3 A;  5B1A B;  4MVU A;  3UM7 A;  3JD0 A;  1JOY A;  4H2U A;  4YRF A;  4YRI A;  4LP8 A;  3CCM V;  2EJ9 A;  3ZRV A;  5KUM A;  5B1B B;  1K92 A;  3B77 A;  3AG4 C;  4XDJ A;  5B1O A;  1NVP B;  1MG1 A;  1EVL A;  2HLD G;  4PA7 A;  1PYS B;  1X54 A;  4XEM A;  1G5I A;  4MTO A;  1ENV A;  4PDR A;  2RHS A;  1SET A;  4ZKI A;  1IXM A;  1Z7N A;  1AJN A;  1R3J C;  1WPY A;  1EZJ A;  3AG2 B;  1KC8 W;  3W7U A;  1G8M A;  2W0F C;  1AJQ A;  3HFZ A;  4YRQ A;  1COW G;  4N23 A;  4BWA A;  11AS A;  3JYC A;  1VQO V;  3D36 A;  3RUX A;  2YEV A;  3SYO A;  3ZRS A;  4TVW A;  3V8K A;  4ZBM A;  1M90 W;  2Q7G A;  1H2G A;  3HY1 A;  2DYR C;  1YFT A;  2OTJ V;  3P8Y A;  1OCO C;  2DTH A;  5L3C A;  3AG1 B;  2EIL C;  1THZ A;  4DPG A;  5GW7 A;  3AG3 B;  3ZN1 A;  1ZWI C;  1QLN A;  3SPH A;  3E2E A;  1MSW D;  4HAM A;  4CS3 A;  2K1E A;  2QTO A;  1MOF A;  1NJ5 A;  2ALY A;  1ASY A;  2ZR2 A;  3CPW U;  1KOG A;  3KFU A;  4WFH A;  2ZT8 A;  4RMF A;  4Q20 A;  2EAY A;  4H2T A;  2XAQ A;  4HWT A;  2H8P C;  3ZMZ A;  3IC7 A;  4P75 A;  4YCV A;  1FXK C;  2XAS A;  4HA8 A;  4QIW F;  4YCW A;  4KFM A;  2DZ9 A;  2Q5H A;  3LDD A;  4WCE V;  2EZP A;  2BOC C;  1P7B A;  1GTO A;  4WFA V;  3VQW A;  3ASN B;  1RPR A;  4MW3 A;  2JEU A;  2F43 G;  2XOK G;  3OEH G;  4CBC A;  3A74 A;  2ZD9 A;  3ABK C;  2QA4 V;  1G51 A;  1B76 A;  5E3I A;  1BHA A;  2Q7E A;  4KP4 A;  4QPJ A;  4QJF B;  1N8R W;  1HXD A;  4CH5 A;  1IL2 A;  2ZT7 A;  1DTO A;  3RKX A;  2CJB A;  1JVM A;  3NEL A;  3REU A;  1NNH A;  4DO2 A;  2DDZ A;  4P3O A;  3B8N A;  4XU2 A;  1XL4 A;  1SER A;  1JJC A;  1K4C C;  4TVA B;  1GM7 A;  2QM8 A;  3E8B A;  3AG4 B;  4X89 A;  2CGH A;  2EIJ C;  5LGT A;  3E86 A;  2I4L A;  2MK3 A;  1PYS A;  3RKW A;  1OCR C;  1QBZ A;  3A5Y A;  2ZDI C;  4LCU C;  2HG5 C;  2LFS A;  3M99 B;  4GX1 A;  4LBE C;  4UXN A;  5CN0 A;  4OP0 A;  3V8J A;  3V8L A;  4PG3 A;  1NQT A;  3K9A A;  2ZIN A;  1VQN V;  2P7T C;  4X5O A;  2DU5 A;  4JGS A;  2QHV A;  4XEO A;  2Q68 A;  4UV9 A;  4X8A A;  1QCE A;  2RHS B;  2DYR B;  2EJR A;  2DYS C;  1YTF B;  2EIK C;  1OCO B;  2DQ0 A;  2ZT5 A;  5LBQ A;  2EIL B;  3STZ C;  4HWR A;  5H6Q A;  2HFE C;  3WG7 C;  2P0L A;  2WLJ A;  3LDC A;  1E1T A;  2XAF A;  2PMF A;  4KR3 A;  2JIZ G;  2WLM A;  1S72 V;  4YRT A;  3RW0 A;  2YEV B;  4J9Z B;  1R3I C;  4JAU A;  3SYQ A;  1YJW V;  2A8E A;  4WJ3 M;  1K8A W;  4RO2 A;  2EBO A;  2BOB C;  4H2S A;  4LVI A;  3JD2 A;  3MHS C;  3SPI A;  1BIA A;  4LNS A;  3WQZ A;  2XAG A;  3CCJ V;  1SZT A;  2ITD C;  1CP9 A;  1I5X A;  2R9R B;  3E35 A;  2OCC C;  1L0W A;  3D3I A;  4P74 A;  3E89 A;  2P90 A;  2W6I G;  3P30 A;  4GX5 A;  3HRI A;  3HFV A;  1JPX A;  3UKM A;  1R6K A;  2B1I A;  3CP1 A;  3HB3 B;  1UJW B;  1DF4 A;  1H4V B;  4MVR A;  3E8G A;  1YFS A;  1AI7 A;  2WSS G;  1SRY A;  2EZO A;  3F7Y C;  4YRM A;  4JAV A;  4UVC A;  1CEZ A;  2J3L A;  4CZZ A;  4FJC C;  4E2L A;  5CBH A;  2DXT A;  3LDE A;  5E1A C;  4P74 C;  3ABK B;  3FYI B;  3CME V;  4MVO A;  3R65 A;  1EIY A;  3CMA V;  5CA3 A;  3OEE G;  1FFT B;  3A7A A;  1YIT V;  3L1A A;  3HXW A;  5ELN A;  2LP7 A;  4TQF A;  1PNL A;  1QR8 A;  2XND G;  1QR9 A;  3HPL C;  3MQZ A;  2Q69 A;  3T4D A;  3P32 A;  3I56 V;  2X6A A;  3ABL C;  1NYQ A;  1X01 A;  2EIJ B;  3UGQ A;  2I4O A;  1K97 A;  1AI4 A;  1PNM A;  2QM7 A;  5IYB O;  3CXC U;  1OCR B;  3A0R A;  3H01 A;  3WFV A;  1NJI W;  3OGC C;  1X56 A;  4UVB A;  2EJF A;  4HYO A;  4H2W A;  2ART A;  5IYC O;  3BFM A;  2HKO A;  3FKS G;  4L87 A;  4QE7 A;  1MAB G;  1JJC B;  3LSQ A;  4YCU A;  5L3F A;  3RKY A;  3CCE V;  3EFF K;  3OE7 G;  4JTD B;  3ZMV A;  1KD1 W;  2NS6 A;  3EFR A;  2Y69 B;  2JK5 C;  1VQ7 V;  3UH0 A;  1S76 D;  2DYS B;  3IFX A;  2EIK B;  4CH4 A;  4TWK A;  1YJN V;  4PA6 A;  2HVJ C;  1FYF A;  4R6Z A;  3WG7 B;  1Q81 W;  2PI5 A;  1F4M A;  5DM6 V;  5BZB A;  1NBM G;  1K9M W;  1KMM A;  2J3M A;  4WF2 A;  1H38 A;  3OUS A;  2DU7 A;  1V54 C;  1J5W A;  3V7R A;  1VQ6 V;  2QHT A;  3A32 A;  3F5W C;  1F51 A;  1FS0 G;  1E79 G;  1PNK A;  3CD6 V;  3W7T A;  3CC7 V;  4X88 A;  1DLB A;  2OCC B;  4FK5 C;  3RL6 A;  5K1X A;  1FXK A;  3SYA A;  3FJP A;  1H4Q A;  1NKD A;  3ABU A;  3QO7 A;  3L4G A;  4K86 A;  2HNI A;  1W2B U;  5LHH A;  4JAS A;  1GM8 A;  1SES A;  2YSU B;  4FPP A;  3W7W A;  1YIJ V;  2Q7H A;  4G85 A;  1YTF D;  3ZMU A;  4G27 B;  2EJG A;  2ATK C;  5CBG A;  4P3N A;  1M57 C;  4HWO A;  3IG2 A;  4TQD A;  5L3G A;  1VQ8 V;  4P72 A;  1FXV A;  1ADJ A;  1NR7 A;  1OCC C;  1QVG U;  3A7R A;  1WNL A;  1NH2 B;  4O2D A;  2EWN A;  2Z5U A;  3ABL B;  4YRP A;  4P71 C;  1NJ8 A;  3CCV V;  4OLF A;  1ASZ A;  2Q6A A;  3LSS A;  2V1D A;  1W0K G;  1OCZ C;  4H2Y A;  4P72 C;  3I7F A;  4U7N A;  4R50 A;  2ZR3 A;  4EKW A;  4G84 A;  1PKX A;  4I9W A;  3W7S A;  3VQV A;  2ZDI A;  1W0J G;  1ARO P;  2JJ1 G;  5IY5 C;  1AR1 B;  3VBB A;  2JEX A;  2DKG A;  3OUF A;  3ZMT A;  2E1H A;  4HT4 A;  4EO4 A;  1C0A A;  4UUJ C;  3K0G A;  2WLN A;  2HR3 A;  4MVS A;  1QVF U;  4CS4 A;  4XTZ A;  3E9I A;  4MSW C;  1VQ5 V;  1ROP A;  4ZTZ B;  2Z3Y A;  4YRN A;  3E9H A;  4NCX A;  4GT1 A;  4PA3 A;  4UV8 A;  5KUK A;  2CJA A;  2IJI A;  1YSC A;  3LC0 A;  4XTX A;  1Q82 W;  3R07 A;  2GHY A;  1X55 A;  1VQM V;  2ZZE A;  3ZIA G;  3HXU A;  1CPY A;  4XTU A;  3T4Z A;  1NJ1 A;  4YXW G;  4KR2 A;  1V54 B;  3OM3 B;  4G28 B;  3L2Z A;  5LHG A;  1VQP V;  3K0D A;  1K33 A;  4PA9 A;  3NET A;  4UP7 A;  2QHS A;  1KQS U;  1YGB A;  3UGT A;  1EBO A;  4RAI A;  2XAJ A;  4XDK A;  1DF5 A;  3UFG A;  3K08 A;  3CC4 V;  2EIM C;  2IJJ A;  1L1F A;  2B5U A;  4R7C A;  5EK0 A;  4MTF A;  3REX A;  1F23 A;  3ZJZ A;  3G4S V;  5C52 B;  3TUP A;  1VQK V;  1EQR A;  3ASO C;  4JPR A;  1GO3 F;  4QPK A;  1AI5 A;  1NVP D;  2ZNJ A;  3RBZ A;  3OMI B;  1BL8 A;  2AMC B;  3NXS A;  1JQ0 A;  5KNN A;  4XTV A;  3AEI A;  2ZGW A;  2ZIO A;  3EFS A;  3RIR A;  1M57 B;  4TWA A;  1K4D C;  5B3S C;  1FXK B;  4DXW A;  1LYL A;  4ZTU B;  5HGQ A;  2IY5 A;  3L4G B;  2IW5 A;  1OCC B;  1TUE B;  1M56 C;  3ZMS A;  3DGE A;  2DWE C;  4XU3 A;  1M9N A;  4H33 A;  3T2M A;  4XU0 A;  2DW4 A;  4FMT A;  4JYB A;  1E1Q G;  5L3E A;  1K34 A;  1GKF A;  1EFW A;  1K5Q A;  3K79 A;  3IGA C;  2ZXF A;  1S0V A;  2JJ2 G;  3STL C;  5LGN A;  3HXZ A;  2P6J A;  3CCQ V;  1E22 A;  4YRE A;  1BIB A;  1OCZ B;  5EBM C;  5C93 A;  1BBU A;  1KMN A;  1RM1 C;  2WLL A;  3CCL V;  2C8M A;  4P2Z A;  1B70 A;  2NNU A;  3HRK A;  2LFR A;  3KG2 A;  3OAA G;  3OR6 C;  2WLI B;  2ZZG A;  3PCO B;  4Q15 A;  2M7W A;  4KUM A;  5IY5 B;  4PHC A;  4TSF G;  2CK3 G;  2ZTG A;  2WAM A;  3ETE A;  3SPJ A;  4LVM A;  3SPC A;  2OT5 A;  3K06 A;  3M4Q A;  4GX0 A;  1K3E A;  4MW8 A;  3ZRW B;  2ZNI A;  3P8V A;  3M4P A;  1Y4M A;  3G71 V;  5KA5 A;  5J9P C;  3HXV A;  2ODR D;  4WFF A;  4YRL A;  2Q67 A;  3G1Z A;  3ICA A;  4WJ4 A;  1AI6 A;  2DZC A;  4K87 A;  3A31 A;  4H2V A;  3LUT B;  1R73 A;  2KB1 A;  4QNH B;  2R9I A;  5FL7 G;  3PZC A;  4XTY A;  3VQX A;  2DVE A;  4TVY A;  2E5A A;  4HWP A;  3HTZ A;  1VQ4 V;  2ARS A;  3A7U A;  3RF1 A;  3TCU A;  4LVK A;  4R8C A;  2E10 A;  2PI4 A;  4RQF A;  2AHY A;  4J9Y B;  4RUE A;  2H94 A;  5B1N A;  2XGT A;  4CH3 A;  3OMN B;  1V55 C;  1N9W A;  3QO8 A;  2HVK C;  4BAY A;  3FYE B;  4UVA A;  3CC2 V;  3PJS K;  4JTA B;  3CYO A;  2EIM B;  4AH6 A;  4GCZ A;  3P8T A;  4MTX A;  4YRJ A;  3K04 A;  2ZXW C;  3QTC A;  4PA4 A;  1BMF G;  3ASO B;  2A79 B;  2X6C A;  2QHU A;  3JCZ A;  3QO5 A;  4CS2 A;  2AKW A;  5IDJ A;  2E64 A;  2X7R B;  4YP0 A;  1R6N A;  4PEL A;  2AMC A;  4P3P A;  2AHZ A;  3ERR A;  1J95 A;  4MVM A;  3ETD A;  4P9P A;  5B3S B;  1B7Y B;  1F4N A;  4MS2 A;  4QE9 A;  5ELO A;  4UP8 A;  3ABM C;  1M56 B;  1YJ9 V;  5HFL A;  1ORQ C;  2IJK A;  3MD0 A;  2IU0 A;  1ADY A;  1NJ6 A;  2G4C A;  4YRR A;  4CH6 A;  3CCS V;  2WLK A;  2WWW A;  2EIN C;  4HVC A;  2DQ3 A;  3K03 A;  2RHQ A;  3JD4 A;  3A5Z A;  3FB5 C;  3OFN G;  5CMU A;  1HC7 A;  2UXX A;  2WLH A;  1S77 D;  2QKS A;  4P71 A;  1R3K C;  5HFM A;  1LNQ A;  3EHB B;  3GB7 C;  5KA6 A;  1RM1 B;  1K73 W;  1E24 A;  2B1G A;  3TEH A;  2GSM B;  4TT3 G;  5LGU A;  1HWY A;  5C51 B;  2WLI A;  3BY6 A;  1NJ2 A;  4OXS A;  3OW2 U;  2Y48 A;  3PCO A;  1YFR A;  4WI1 A;  1JCH A;  3RVZ A;  4YRK A;  1S5H C;  4XU1 A;  2OTL V;  1G4Y B;  1P4R A;  4PDM A;  3X2Q C;  3DSQ A;  3MEY A;  3QNE A;  4ZIB A;  1Z7M A;  3OR7 C;  4JTC B;  3ZRW A;  2WLL B;  2UXN A;  4JF3 A;  1B70 B;  2CJ9 A;  2X6B A;  12AS A;  4U7O A;  4RQE A;  2ZT6 A;  2ZZF A;  3VQY A;  1WQW A;  2HJF C;  1M1K W;  3ETG A;  1GM9 A;  1GGM A;  3FB6 C;  2C2A A;  4PDV A;  3SPG A;  4XDL A;  4XBF A;  4H2X A;  1EVK A;  4Q6G A;  3OD1 A;  4N21 A;  3TET A;  4WF9 V;  4F4L A;  3FB7 C;  1V55 B;  2ITC C;  3SJQ C;  1B8A A;  1BBW A;  4UPA A;  4LC1 A;  2IU3 A;  1QLE C;  1WPX A;  2WPD G;  3B8M A;  4RUF A;  2CIM A;  2DEQ A;  4BIU A;  4E51 A;  3CMQ A;  3T1C A;  3I55 V;  4H37 A;  2D3O W;  3NEN A;  4P75 C;  1JX9 A;  2ZXW B;  3SYP A;  1H8H G;  3RGL A;  3K3W A;  2C7I A;  2Q5I A;  5EBW C;  1S3J A;  3ZN0 A;  3E83 A;  2ZCE A;  4P30 A;  1YI2 V;  2DTI A;  5EBL C;  3W7X A;  2DXU A;  1NYR A;  5H6R A;  2E3C A;  5IYD O;  2I4N A;  3HY0 A;  1NR1 A;  4MTG A;  3DTU B;  2NLJ C;  1B7Y A;  1BHB A;  3ABM B;  1X2G A;  5F5W A;  1XL6 A;  4P73 A;  1W66 A;  4GX2 A;  1WU7 A;  4BIZ A;  2AKW B;  3JD3 A;  3CCR V;  1VQL V;  2DTO A;  1WLE A;  2E41 A;  1G5H A;  2EIN B;  5B1A C;  3W3S A;  1KEC A;  3MHH C;  4I5S A;  5H9C A;  3SYC A;  1I5Y A;  2X0L A;  1VQZ A;  1WYD A;  4PDL A;  5B1B C;  5L3B A;  3RVY A;  1H4S A;  1K5S A;  5LHI A;  5EC2 C;  4P73 C;  4XTW A;  2Y69 C;  1FXH A;  2P67 A;  3ZRX A;  4P9O A;  4FIP C;  2A9H A;  3E8F A;  1Q86 W;  1ATI A;  2XTI A;  4MT8 A;  3HFZ B;  3HXY A;  2IH3 C;  1WQ7 A;  1E1R G;  3AG2 C;  2RHQ B;  4RDX A;  3X2Q B;  4ASU G;  1JJ2 U;  2ARU A;  4Z1M G;  3GWO A;  1YHQ V;  2ZQM A;  3TEH B;  5K1P A;  2V7Q G;  4H02 A;  3ABT A;  1KKD A;  1GMG A;  2QEX V;  3IKM B;  3LNM B;  2I4M A;  1EIY B;  5EC1 C;  2DJZ A;  3E8H A;  2ZIM A;  1H4T A;  4DQ2 A;  3VOU A;  3CCU V;  3AG1 C;  3G6E V;  1USY A;  1K7D A;  2A0L A;  3IAL A;  4MVQ A;  4YRS A;  3AG3 C;  2XAH A;  1QE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...