4RQKA

Crystal structure of pdk1 in complex with atp and the pif-pocket ligand rs1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
286
structure length
285
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title A small-molecule mimic of a peptide docking motif inhibits the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 285
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rqkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rqkA01
4FG7A 1QPCA 2IW9A 3R8UA 3VBWA 2DQ7X 5JGAA 4APPA 5FEEA 2JAMA 3MVHA 1ZOGA 3EMGA 2I6LA 3OXIA 5J8IA 2IVSA 3H9RA 3PP1A 5JH6A 5LOHA 3GUBA 5K4JA 3HX4A 1MRUA 4MK0A 2WOUA 4EH6A 3DCVA 3KRLA 4OBPA 1PRYA 3O7LB 3QBNA 4H3PA 4PDPA 1GIHA 3IOKA 3MFUA 4ZJJA 5AP2A 5DT0A 5IA0A 4XX9A 3RCJA 4UALA 2W17A 3P7AA 1U4DA 3F5PA 2OKRA 4S33A 4AQCA 5LWNA 3WF5A 2PL0A 3OW4A 4C3RA 4DFXE 1GZOA 5BVOA 1UWJA 3R63A 3BE9A 3CD8A 3NR9A 4QYFA 2X0GA 4YLJA 5GJGA 3DPKA 5CZHA 4O2ZA 4C4FA 5I5ZA 5I9ZA 1M2RA 3CJGA 3UVRA 2WZJA 3DBCA 3S3IA 2Y4IC 4FTTA 1L8TA 4BDKA 4HVIA 2GNIA 3EQBA 3FYKX 4FYOA 3UIMA 5AFVA 1QCFA 4L45A 5KMIA 1M52A 4C62A 3TL8A 4AGUA 2UZLA 4IWDA 1BX6A 1O6YA 4K33A 4A9RA 3BYSA 5C1QB 1XH5A 2UW5A 2WELA 3EFJA 3H9FA 4RC3A 2VWUA 3KRRA 5HG5A 3R7OA 4DH8A 4YO4A 1WMKA 4F9WA 2YCSA 5EDPA 3ZU7A 4FEQA 5EHOA 4FT3A 5JQ5A 3KQ7A 4G6LA 2QC6A 1J91A 3EQGA 5J9ZA 3VUGA 3LMHA 1M2PA 1WBTA 1OBDA 3U4WA 1UNLA 4FK6A 4OTRA 2WB8A 4ONAA 4TWCA 4ENXA 2C6LA 3V3VA 2IW8A 2XCHA 1YDSE 4QMYA 3P79A 5JKGA 2PK9A 3DV3A 4WNOA 3A7IA 3BRBA 1H08A 3DKFA 4GCJA 4GS6A 3IG7A 3IW5A 3ANQA 2VWIA 4JT3A 3V5WA 1PW2A 4L67A 4UXQA 2PVMA 2B52A 3G15A 3NUSA 2HENA 3B8QA 4OT5A 4FIHA 4L52A 5BVFA 1H27A 2WMUA 5AR4A 3DK3A 4GK3A 2YIXA 4X3JA 3MV5A 4EC9A 4FZ6A 3MPTA 3QTRA 4FVRA 4RGJA 2YCRA 4U40A 5I9WA 1QPJA 4FNXA 4CRSA 2XM9A 2P4IA 4LV8A 4QTEA 4AX8A 3PYYA 3M1SA 3OMVA 4GSBA 4L43A 4AZEA 2RSVA 4UB7A 5I3OA 1XWSA 2VTPA 4CLIA 2V22A 3FI8A 3KFAA 3NYOA 2WFYA 3Q53A 4FUXA 4DGNA 5LVPA 2QCSA 2XIYA 4M0YA 2PMIA 3ZO3A 4PPCA 3HVCA 4FKTA 2CLQA 2WKMA 4QP4A 3HRCA 3RMFA 1Q41A 4CRLA 4FICA 3BYOA 2H34A 2UW9A 3LE6A 4J7BA 4BWKA 2J0MB 3DA6A 4ZLYA 2QHNA 3EN6A 4BI1A 4I41A 3NDMA 5E8WA 3QRIA 3LJ0A 4G6OA 2QO7A 3SD0A 4FT7A 4L3LA 3D2IA 5IA2A 5ICPA 2PVHA 2PVLA 3QD0A 1SVEA 3VS1A 4QPAA 2R64A 2VN9A 4RC2A 5HBHA 4MXXA 1A9UA 2WMAA 3OD6X 5I9VA 2YITA 2YLFA 1SM2A 1WBPA 4N4SA 4AZWA 4MD8E 4K9YA 4B0GA 2IVVA 1NA7A 4R3RA 5IQCA 2YDKA 4FNWA 5CQUA 3U54A 2GS6A 2A2AA 4I22A 4RX9A 5FP6A 4J71A 5A6NA 1K3AA 1REJA 1O9UA 3FL5A 2R3FA 3FQEA 2C0OA 3FHRA 3EQRA 3AT4A 1PHKA 2R3KA 2YACA 2XIKA 3C7QA 4YLKA 4FVPA 2QKWB 4IJ9A 2ONLC 4PF4A 5FEDA 4DFYA 3OUNB 3F7ZA 5EOBA 3UIUA 3DXPA 5KO1A 3D15A 2BRMA 5L8JA 3I7CA 1SNUA 3QC9A 4RA5A 3ET7A 3ACJA 1WBWA 3EIDA 4H39A 5CAQA 5FD2A 3FSFA 4FKRA 2JDRA 3DBDA 4OW8A 3P78A 4EK5A 3IONA 4W9XA 1Q62A 2IG7A 4FZ7A 3WARA 1P4FA 2W0JA 3JUHA 5D10A 4G1WA 4KABA 4QP9A 1E1VA 3ZONA 4KIQA 4WKQA 1OBGA 3QX2A 5D7AA 3ATTA 1W98A 4G9CA 3UIBA 3TIYA 3ZC6A 4D9UA 2FYSA 3HV6A 2HELA 2OJFE 3VIDA 5FXQA 4NEUA 4JDHA 3HGKA 4H05A 3KVXA 4GEOA 3LPBA 5HIDA 3QA0A 4RVKA 1PF8A 3NZ0A 3Q9YA 3UO4A 3FAAA 2J50A 2G2IA 4K18A 2IZSA 1SMHA 3CC6A 5H8BA 1W7HA 3TKUA 4QQCA 4EH8A 4CG8A 2YA9A 4I6BA 4BF2A 3RVGA 5I4NA 4PY1A 2XP2A 5C9CA 4GIHA 3EN4A 4KS8A 4WSQA 1FBNA 4YTCA 1JWHA 1UKHA 3BBWA 5A4TA 3KREA 4WSYA 3LMGA 3A4OX 3G0EA 1Q99A 4FV2A 4KWPA 4PWNA 3VHKA 4B8LA 4RRVA 4O1PA 4FZDB 4CSVA 2B1PA 3W2SA 3P4KA 4O6LA 3DJ6A 4X2FA 4BCKA 1DAWA 1TQPA 4L8MA 4FTIA 5IDNA 3R30A 2PYWA 2QOFA 4IM0A 4QMNA 3JY9A 2B0QA 5L6OA 4FK3A 4RZVA 5GNKA 5ITAA 2XNOA 5CI7A 2WD1A 3QA8A 4K11A 4AWIA 3QC4A 4XRJA 4ZMFA 5B0XA 2WGJA 4AAAA 4Y83A 4ZTHA 3PRFA 4CZYB 2OJIA 4RX7A 3POOA 3T3UA 1YWNA 5F20A 5J87A 1OPLA 3C4ZA 4IW0A 1R0PA 4Y46A 5DPVA 3ZLWA 3PP0A 3R6XA 3ZEPA 2CN8A 2EXCX 2X7FA 3UMWA 4AOIA 3ORMA 4IX4A 4YTHA 3LM0A 3MVLA 3OF0A 1YDTE 4U3YA 3FMKA 4R5SA 5FBNC 2O8YA 4JAJA 1MQ4A 2R0UA 2UVZA 5ANEA 4DITA 3Q04A 3KY2A 5HLNA 4TTHB 4BBMA 3QQGA 4BN1A 3QZFA 4O38A 4BWXA 4YMJA 4DTBA 4AGWA 4L00A 3QCXA 3DDQA 2EU9A 3ORLA 3WF6A 4PRJA 2YCFA 5LCKA 5HNGA 3L8PA 5HGIA 5J5SA 3EKNA 3UG1A 4JAIA 4U79A 2W1DA 2WPAA 4TWPA 4QPSA 2I40A 1YKRA 1JKLA 3G51A 4X3FC 5EDQA 4CNHA 4O86A 4LMUA 4QP7A 4V0GB 4JQ7A 4D58A 5T3QA 4DG3E 4Y73A 4YPDA 3EQHA 3RAIA 2BIYA 2BAKA 4H1MA 3QZHA 2Z7RA 3W8QA 2HW6A 2YFXA 3RK7A 4UWYA 4CEGA 4FUYA 4UMRA 4WRSA 3RWPA 2XZSA 4MQ2A 4JL9A 2B9IA 2OLCA 2C5OA 5CS6A 3IKAA 4IC7A 5IQAA 1ZWSA 2VRXA 4ITJA 1Y6AA 4FV6A 4EJNA 5IF1A 4BRXA 1P5EA 2NRUA 2GTMA 2V0DA 3I79A 3PIXA 4QP3A 5JN2A 5GZAA 1PMVA 4RC4A 3R7UA 5CXZA 3WE4A 4DA5A 5HTIA 4K0YA 3ZFMA 3UC4A 4PQNA 4QMWA 3QQUA 4EOMA 5HVYA 4G6NA 3A4PA 3EQPA 3A61A 3DAEA 1ZAOA 2BAJA 3MN3A 4LOPA 4MNFA 3UG2A 3SOAA 1E1XA 2PSQA 2QU6A 1OL7A 2IZTA 2IO6A 2OJGA 2KTYA 4O0WA 4FZFB 5DLSA 5DVRA 3REPA 4IFCA 4QYYA 5E9EA 2Z8CA 5I9XA 2R3OA 1U59A 2WMQA 3P1AA 3OTUA 3GENA 3CKXA 2CDZA 5HX6A 3BELA 5A14A 1P4OA 3RAKA 3U6HA 3KXGA 2R2PA 3OBGA 5IMEA 3NIEA 1YQJA 1WFCA 3ITZA 4G34A 1OIRA 4ANQA 3G2FA 5DG5A 3BYUA 3FV8A 3LFEA 3CBLA 3DGKA 3TNHA 5C26A 3E88A 4F9AA 1ZZLA 3PE2A 3KGAA 3HP2A 3R04A 4JBPA 4U6RA 3VS7A 4LG4A 4NJDA 4TZRA 1OIYA 3MH1A 4YC6A 2VTHA 5BUJA 4IAIA 4HGLA 4PV0A 3ORZA 4B9DA 3P7BA 4YZCA 4UX9A 3LCKA 5HEZA 3PG3A 3NUXA 3LCTA 4EORA 5A46A 4H1JA 3PPKA 5T6KA 3FI3A 1Q8UA 4OUCA 3C4EA 4AF3A 3FKNA 5KCVA 2VNWA 5DT4A 2GU8A 4AW0A 1IA8A 4QO9A 4I20A 3NUAA 5AAFA 3D0EA 4IANA 5E8SA 1NVRA 4LL0A 4JG6A 2QOQA 4EOIA 5HIBA 4QP1A 1PXOA 2GSFA 5TO8A 3W55A 3VUIA 2OJJA 5GIOE 4E5BA 2BHEA 2X6DA 1W83A 4CT1A 3OCBA 5E8TA 3BGQA 3KMMA 5M4FA 2W5BA 1S9IA 4RIOA 2X7OA 3QUDA 4MD9E 4OBOA 3R83A 1JKKA 1QL6A 1MRVA 4Y5QA 3WOWA 4WNKA 3LFAA 4RJ3A 2OFUA 2VTIA 1BMKA 4G3GA 3UYSA 2RFDA 2WO6A 3OOGA 2GNGA 2ITXA 4ZZOA 5KMNA 2OIBA 5M4UA 2XK4A 1PJKA 3VJNA 1L3RE 3WBLA 3LLAA 4EC8A 2XA4A 5TOZA 4BDJA 2WTIA 3UPXA 2IWIA 3E8CA 5CALA 4NJ3A 1H1PA 2I0VA 2WQEA 4J99A 4XHKB 4E4MA 2UW7A 4UN0C 5JGBA 1G8SA 3EQDA 3NX8A 1LUFA 4FL3A 4KIPA 2Z2WA 4YZMA 5H3QA 4IMYA 2Z60A 4W4WA 4USFA 5J1VA 5J7HA 1PXNA 2QD9A 3NNVA 4NFNA 3LFCA 4W4YA 1KE5A 4PL4A 2XIZA 2GDOA 2R3GA 1UA2A 3ENHA 4UMTA 4WG5A 3DFCB 3BLHA 2UZEA 4KB8A 4PTEA 4YJQA 2QOKA 3C4XA 4ACCA 4XP3A 3S1HA 2UZBA 5CEPA 2QOHA 5CQWA 3MY0A 2CCIA 2Z7QA 2X7GA 1VZOA 4KKGA 3ZO4A 4NW6A 3LFBA 3CGFA 2PUIA 1F5QA 3KB7A 5B2MA 3NRMA 3H30A 3LCDA 1ERKA 2W5AA 5DN3A 4DEBA 3NCGA 1F0QA 5IA3A 2OZAA 3PXRA 2ZV8A 3HEGA 2F2UA 3ETAA 4UZDA 1CTPE 5FLFA 4YP8A 4M68A 2ETKA 4ZS0A 1OKVA 5AR8A 2VU3A 1AQ1A 3PPZA 5JFXA 2FSMX 2IW6A 4IZYA 5LVLA 2HY81 3HMMA 3TN8A 5HZNA 2Y6OA 5JRQA 1JSUA 1KE8A 3KVWA 3F9NA 2I7QA 4NL0A 1XH7A 3E93A 4IAZA 5LMKC 4W9WA 2X2KA 5DA3A 3PJ2A 3IECA 1H26A 4FIJA 3KU2A 5AV2A 4A4OA 4L7FA 4TYHB 3U6IA 3BHYA 5DYJA 1Y6BA 4UMUA 1PXPA 4FKOA 1Q8YA 4ACMA 4BDGA 4QP6A 4DEHA 1JKTA 2YIRA 4E7WA 3NUPA 2R7IA 2ZV9A 3BWFA 2YHVA 2OWBA 3H0ZA 5H9BA 3FLNC 3RZFA 3QQHA 4QNYA 4HZRA 4IH8A 2P2IA 1DI8A 2UVXA 3MFTA 4ID7A 1R3CA 3DT1A 5E92A 4Q9ZA 5DH3A 3ORXA 4TYIA 5B2KA 3CP9A 2X2MA 5BMMA 2UZVA 3GC8A 4DT9A 2W9FB 4H3QA 3UO5A 4C0TA 4R1VA 4GUBA 3FLYA 4YJRA 3M2WA 3W2PA 1NW1A 5L2QA 1PYEA 2NO3A 2WQBA 2OXXA 4YUQA 2BAQA 4EH2A 2F49A 1HCKA 4E1ZA 1JSTA 3G6HA 3U9CA 1XO2B 4M15A 4N6YA 2HOGA 2PZ5A 2CHLA 4YSJA 2A4LA 1JQHA 4IIRA 5CSWA 3KXHA 3VJOA 3FL4A 3E64A 5IA4A 3OC1A 3O8TA 1GJOA 1YXTA 3V5LA 2OIQA 4DINA 3N4UA 4PNKA 1RDQE 3TM0A 3GP0A 2JDSA 4O0UA 4MVFA 3U51A 2W4OA 2BKKA 3Q6WA 3DTWA 3DK7A 5KMMA 2R3IA 2Y0AA 4O22A 2Y8OA 4JJRA 1JVPP 3D7TB 3F2NA 4FTMA 1T45A 3DBFA 2XM8A 1ZOEA 4NUSA 1Y8GA 4EH3A 4V05A 5IEVA 5IZFA 5IQIA 3KC3A 2E9OA 4U0IA 4ERKA 3AMAA 3WF8A 3FEGA 3RPOA 3LLTA 4PP7A 3MVMA 3VC4A 3KXZA 3OG7A 3LXPA 3NGAA 4IEBA 5FWKK 5CAOA 3GFWA 3QTSA 5AR2A 3RBWA 3GCPA 4FSYA 5JZNA 5AM6A 2ZAZA 4I0TA 1ZXEA 3JS2A 3VUMA 3GU6A 3RK5A 5M4CA 4KSQA 1CKJA 3D5VA 3Q9XA 2BROA 5ACBC 3W8LA 4FMQA 5IMXA 2QR8A 3EN5A 4YJPA 2WMWA 3ALOA 2VTTA 3PA4A 4I0SA 1QPEA 4MXCA 4Z7GA 3S4QA 4QMSA 3DBQA 1Q4LA 2IVUA 2JBPA 3ROYA 3KMUA 4FTLA 4LL5A 2ONLA 3ZO1A 3NUUA 5M56A 4C57A 3L9MA 2C5YA 4U9AA 4RIYA 4RA4A 4DFNA 2FSOX 4LMNA 4FEUA 3I6WA 4E20A 4D2VA 3C5IA 4IBMA 4Q2AA 4BBFA 3DAKA 2PY3A 5CVFA 4IB5A 4WIHA 3TUCA 2XKCA 3ELJA 2ESMA 4G17A 4YBKA 2ZB1A 5M06A 3NNWA 4QYHA 1K9AA 3OEZA 2P55A 4JI9A 4NW5A 1Q3DA 3BWJA 3WZDA 4N57A 3DFAA 2FH9A 5D12A 3R2BA 4L01A 2B9JA 4RX8A 3SC1A 3ZZWA 3R9RA 3CJFA 1YDRE 5K9IA 4ZLOA 3PUPA 4ASEA 4KAOA 2J4ZA 4JG7A 4HPUE 5L2IA 5LXMA 3O23A 4JRVA 2F7ZE 3V8WA 3ZMMA 5HO6A 3EH9A 2UZOA 3FZOA 3LZBA 4J98A 5CU2A 5KZIA 3TZ7A 3SGCA 4D1ZA 4YJVA 3SXRA 2UW0A 4FSRA 5J9LA 4FVQA 2VX1A 4IX5A 2XBJA 3NPCA 2B53A 4YTIA 3AQVA 4L68A 4RZWA 1ATPE 3M11A 2WTKB 5AV0A 3D5WA 3R1QA 3HV4A 4LGGA 4FOCA 4L44A 3A62A 3D5UA 1GZ8A 4YJUA 4EHGA 4FTNA 5KBQA 3EFWA 2XK7A 3AC1A 2XKFA 3PXKA 2XEYA 2PUNA 3LJ1A 3SA0A 4D4VA 2R4BA 4TYEA 3EOCA 1ZYLA 3TUBA 3C9WA 3POZA 3KMWA 4M13A 3OCGA 4X2KA 4A9TA 2GS2A 4XBRA 3R2YA 4JDIA 1YHVA 1UNGA 3LFFA 5AP5A 3PLAE 4CTBA 4AA0A 3ORKA 2WU6A 4IVDA 4PPAA 4TYGA 4MQ1A 4R5YA 4YC8A 4O81A 3V6SA 2W1IA 3OCSA 4IWQA 4RVTA 3GVUA 4GRBA 3QFVA 4WA9A 5A54A 5F9EA 4KUJA 5DFPA 3EFKA 5AV4A 4G5JA 5HIEA 4OTFA 4AOJA 5E4HA 4BCIA 4KKEA 5BUEA 5DRDA 2VWZA 2QHMA 3R9OA 4AN2A 1WBSA 3F66A 4FTOA 4FZAB 4V01A 4U80A 4S31A 1VYZA 4KSPA 4OBQA 4X6QC 1ZMWA 2DUVA 5EQYA 4TNBA 3UP7A 1IR3A 4F63A 4KNBA 5L2TA 1Y57A 1AD5A 3O7LD 1URCA 5EQPA 2P2HA 3FLQA 3QL8A 3GB2A 3QTXA 2HZ4A 3OCTA 3DQXA 3QF9A 3R01A 3ZUUA 1ZYSA 4NIFA 2YDIA 3F7WA 5E8VA 3TZ8A 3KL8A 4RQKA 3LIJA 4LI5A 4F7LA 5A9UA 5ANOA 5E90A 3MJ2A 2VTAA 2IJMA 2W5HA 2XMYA 4Y72A 4PP9A 1RJBA 5CEKA 2X39A 3FY0A 4EK3A 5DGZA 1FGIA 2VWYA 3BU3A 3FBVA 3QX4A 3UVQA 3V5QA 4B7TA 2OO8X 1OL1A 4FKJA 3G6GA 2F57A 3LCSA 4M3QA 4HVHA 4NKSA 4QRCA 3ZYAA 2UW8A 1IG1A 3P5KA 4GU6A 3HUCA 2WTDA 4UY9A 3MPMA 2WHBA 4E8AA 3GU7A 4BFMA 3HA8A 2PVNA 3H9OA 3KF4A 3OW3A 2R3NA 2VD5A 1H8FA 2IZRA 3BHHA 3V51A 3PA3A 1DI9A 2EXEA 3KXNA 5EM8A 2QOLA 3BBTB 3NCZA 4FSWA 3DAJA 4S34A 1PXIA 3RWQA 3Q4ZA 4P5ZA 5IQBA 1YI4A 5H8GA 2O2UA 4U3ZA 4O82A 4UZHA 5CF6A 3JY0A 4BWPA 3AMBA 1Z57A 4GUEA 3PWYA 5GJDA 1WAKA 3QKLA 4ZSLA 4YU2A 5DEYA 3HYHA 4UMQA 4FOBA 1Y91A 4B99A 1GIIA 4XJ0A 4FIEA 2CKQA 4BR3A 4BI0A 3UMXA 1FQ1B 4DN5A 4F6WA 2BMCA 4LUEA 4F9CA 1KV1A 1MP8A 2ETRA 4NU1A 4XV1A 4RVMA 3O0GA 2OU7A 3LFQA 5HQ0A 2VTRA 4MX9A 3RZBA 4AE9A 1XKKA 2W1FA 4CKIA 4X2NA 1PKGA 3FC2A 1ZYJA 2CKEA 3TV7A 2OXYA 4KS7A 5HU9A 3KULB 5CSVA 5FRIA 4AN3A 3QD4A 4F99A 2GTNA 1NY3A 4RVLA 3RPYA 4CFWA 4CYIA 2YM6A 4YHJA 4BZNA 4DYMA 4GMYA 4E4NA 2F7XE 2HWOA 3PVUA 3AC5A 3ANRA 5FP5A 3V01A 2OZAB 1KOAA 2ITWA 3MY1A 3K54A 4XLVA 4HVGA 2Y4IB 3LM5A 2RG6A 1U54A 1IAHA 1OIQA 2J6MA 1UVRA 3GU8A 4ZAUA 5AR5A 1M7NA 3IW8A 2OF4A 3CY2A 4XUFA 5DEWA 2PHKA 3LXKA 4YLLA 2PMLX 2XYUA 2LAVA 4ZLZA 3C51A 1BL7A 3UJGA 2RFSA 4IM3A 1H01A 3WIGA 5CF5A 4DC2A 3VUKA 4ZTMA 4X21A 3MVJA 2C47A 4FTAA 2BILB 1NT2A 4P4CA 4EOJA 5E1SA 4BGQA 4LFIA 2XIXA 4HNIA 3VW8A 1YVJA 3ORNA 4FT5A 2XVDA 3PDTA 4M14A 1KUTA 4QYGA 5E8YA 3MPAA 2ITQA 5G6VA 4ZZMA 4FG8A 3TNPC 4BCJA 4DCAA 2YIYA 3V5PA 3IQ7A 4IB3A 3EHAA 4XV2A 1XHAA 3FMNA 3PIZA 2QI8A 3O50A 1OVEA 3A7FA 4II5A 2C3KA 4IDTA 2WQOA 3AXWA 4IC8A 3GXLA 3RCDA 4UV0A 2XNPA 3NUNA 3NUYA 3NW6A 4IDVA 1LR4A 3D5XA 1V0BA 4OTPA 5J95A 4C2VA 3VRZA 3EB0A 4C33A 3K2LA 2HXLA 4XG7A 5B2LA 2EVAA 4I6QA 5J79A 3QRTA 3LFNA 3E92A 4M66A 3ULZA 3FLWA 4JOAA 1WVXA 4A4XA 2W05A 4Z7HA 1PXKA 3EQIA 5BNJA 4A7CA 2Q83A 1M7QA 5K0KA 4S32A 3SRVB 1FGKA 2YERA 1YHWA 3WYYA 2HY0A 1XH6A 3IW6A 4I92A 5L6PA 5A6OA 4P5QA 4ASXA 4E5AX 3CSVA 3B2TA 4I5CA 4E5WA 4HGTA 2Z02A 3CIKA 2VTQA 5JRSA 3EL8A 3QRKA 4JBQA 3CQWA 4K8AA 4YBJA 5LMKA 2PUPA 3WIKA 1H24A 1OIUA 2Z7LA 3NW7A 1XBAA 4FT0A 3IGGA 4IXPA 1OUKA 2UZWE 4OAVB 4QTDA 1W0XC 4IVAA 5EOLA 2JITA 3PLSA 1S9JA 1FVTA 2JGZA 3FMMA 3WF7A 4J52A 3F2RA 1JBPE 1CKPA 4ZSEA 2VNYA 3COMA 2XF0A 2IN6A 3EYHA 2WTCA 3UGCA 2C5NA 3HMNA 4I6FA 5AP3A 3SOCA 3ZDUA 2XYNA 3ZZEA 4RJ6A 1Q8WA 5FM3A 1UU9A 2BPMA 5CY3A 3BZ3A 1X8BA 5IUIA 4FEXA 4WHZA 3VUHA 4ORKA 5AAEA 4IE9A 4EBWA 4RIYB 3HNGA 5A4EA 3VN9A 3HAVA 2V5QA 5HLPA 4ASZA 3JVSA 2E9PA 2HCKA 3V5JA 2DYLA 1BL6A 4DGOA 3MIAA 3I4BA 4OR5A 4QT1A 4RT7A 3R22A 3E62A 4DHFA 5EKOA 4FNZA 3L1SA 3S0OA 5AEPA 3PZEA 3HV5A 3R1SA 4BCQA 2WNTA 4EI4A 4JR7A 3G9NA 2YZAA 4I24A 4R6VA 2J51A 4OTDA 3V5TA 4PMPA 4LQMA 3QD2B 2WOTA 1Z9XA 2I1MA 2VO0A 5HG9A 4E26A 3W2QA 2VX0A 5EG3A 2J5FA 1J1CA 2FB8A 3E3BX 5GZ9A 1FMKA 1ND4A 4DLIA 4Y85A 4D28A 3PRIA 5EM6A 3WF9A 1B39A 4IAYA 4U5JA 4X2JA 3R8ZA 3RPVA 1RW8A 1OPKA 2BRBA 2YJRA 3R7IA 2REIA 4EBVA 2FA2A 3MTLA 4FC0A 4QMLA 5M07A 5HX8A 3QLFA 5KMLA 3C4WA 4IWOA 4R8QA 4AG8A 3BKBA 5EW8A 5IU2A 5J9YA 5LVMA 4F08A 2YJSA 3DDPA 4C36A 5D9HA 2H9VA 4Z55A 2SRCA 3F69A 4ZIMA 3KKVA 3B8RA 2OICA 4HCVA 1GZKA 1OKWA 2QLUA 3VBYA 5CLPA 2OSCA 3EQCA 3FZRA 5FG8A 4EKLA 5CU6A 5J5TA 4D55A 2CKPA 3LXNA 5M08A 2GNLA 1FVVA 3MYGA 2C5VA 4C4GA 4BDHA 4AZVA 2PWLA 5EI8A 4ARKA 4H3BA 4ZMEA 5L2SA 3Q9ZA 3ZTXA 4M12A 2BRGA 2ZMDA 3SQQA 3F61A 4FV1A 4CLJA 1U5QA 4DFLA 5HORA 2O0UA 4C4IA 2CSNA 1V1KA 3DKOA 3OHTA 4M8TA 3OS3A 5LQFA 5L6WL 1ZLTA 2JFLA 2B7AA 1E9HA 4C3FA 1PMNA 2VTOA 3OFMA 4PMTA 3DKGA 1G8AA 3RALA 4I93A 1Y8YA 4CFNA 4QYEA 5D1JA 2JDVA 5AX9A 1JSVA 2YM4A 1SVGA 2XNMA 5AP7A 3SW7A 1H0WA 2GHGA 2DS1A 2OG8A 3NAXA 4FV5A 3Q4UA 2JKQA 5M44A 3BEGA 4X2GA 4PDSA 3QRJA 1OGUA 4RJ8A 5A4CA 5EQEA 4NIFB 3E87A 3P9JA 4EZ5A 4X3FB 1YWVA 2C0TA 1JKSA 3D4QA 2OBJA 3Q6UA 4IJPA 4O0VA 4TW9A 3CLYA 3DLZA 2WMTA 4MNEA 5ANIA 4MXAA 3OEFX 3HUBA 1UKIA 3BE2A 4TPTA 4XP0A 2R0IA 3BU5A 2PPQA 4W8DA 3QCYA 1U46A 4ITIA 4Y8DA 3MBLA 5M09A 5JFVA 3GFEA 2W99B 4K2RA 3OTVA 2VO3A 3EKKA 3FPQA 3U9NA 4FSNA 4K6ZA 3GEQA 3G5DA 5M53A 3D9VA 4DH1A 2QG7A 5ETFA 2BDFA 1NVSA 2GS7A 3N4VA 4DE4A 2BUJA 5CNNA 1KE6A 2YAAA 3L8VA 4I0RA 4QMZA 4UWCA 2OGVA 2F9GA 4H58A 4BTJA 4ACGA 3FE3A 3QU0A 2ZM1A 1CM8A 3LOKA 4KRDA 5CTPA 2OZOA 2DWBA 5C27A 2VTNA 4FL1A 2JIIA 3TG1A 4L9IA 1BI7A 1REKA 5IKWA 3L9PA 3LVPA 4E93A 4IZAA 3QGYA 1MQBA 2GMXA 3GBZA 3I5NA 2CGXA 2QOCA 4OTGA 3DBEA 4RLLA 4MAOA 4JS8A 3RAHA 3CPBA 4ZTSA 1HCLA 4AW5A 3MFSA 4BDIA 4C59A 5CF4A 4HPTE 2IVTA 2JD5A 2C0IA 1ZY5A 3MY5A 2FVDA 3HA6A 2EB3A 3Q5IA 5EHYA 4NT4A 3RPRA 4FYNA 3TI1A 3OUKA 3EZVA 4S30A 3TNWA 5CASA 4C2WA 3ZFYA 4NCTA 4O7TA 1BI8A 2X1NA 3L8SA 4C3PA 3BYVA 3V8SA 3FKLA 2P33A 1Q3WA 4M69A 4M67A 4L3PA 1URWA 4YHFA 5A4QA 3FUPA 3QALE 2XK8A 3E8DA 4DGLC 3DZOA 4I3ZA 3HL7A 3GC0A 4WD5A 4AA5A 3DXNA 3FY2A 2C6DA 3R7YA 2Q0NA 3RM7A 4CMTA 3R9DA 3WZUA 2J90A 5FM2A 4F7NA 3NVMB 4RWLA 4QP8A 5E8ZA 4JX7A 3QZIA 4XG8A 4Z16A 4N6ZA 5KHXA 4A4LA 4F1TA 2XNNA 4JDKA 3SG8A 2YM8A 3MB7A 2OH4A 2X8IA 2UZTA 4PL3A 1U5RA 2EUFB 4QTCA 3VULA 5LMAA 2J0LA 3WZKA 4D4RA 4E4XA 1JPAA 3ERKA 4K77A 2F4JA 3COHA 2I0YA 3AGLA 4DG0E 1YOLA 2EB2A 1H28A 1LEZA 2WIPA 3FQHA 2HXQA 3KXMA 2PMNX 3PPJA 3Q32A 5BUIA 5L3AA 2J9MA 3UQGA 2JIUA 4HYUA 3ZXZA 4P90A 3HV7A 3RGFA 4E6CA 3FLZA 2ETMA 3ZBFA 4LRMA 4RJ4A 3A8WA 4BHZA 4XG2A 3DOGA 3C1XA 5K4IA 4ZK5A 3DY7A 4JQEA 4Y5HA 4E6QA 3KEXA 4R1YA 1OL2A 5FGKA 4KD1A 5IUHA 2C1BA 4J95A 4GG7A 2GFSA 5K5NA 3F5UA 2R3PA 4ZY4A 4KBKA 4MKCA 4PX6A 4D2TA 2XKDA 4GK4A 4L7SA 4I94A 2J0JA 4EUUA 3ZH8A 4YR8A 4NK9A 3DNDA 3QAME 4QMTA 1DM2A 3A7HA 5CU3A 2ERKA 3QQKA 4UYAA 2ZDTA 4E6DA 2ZM3A 5KKRC 1PMUA 2RG5A 2ITOA 4FKSA 4AZTA 2UW4A 2XEZA 2CLXA 3HV3A 4G3EA 2PVYA 3I5ZA 4FSUA 4I4FA 3DK6A 3NEWA 4GYGA 4ZP5A 3AC2A 4RPVA 3FZ1A 3MH2A 2JKKA 3QQFA 3DLSA 3VUDA 3ZSGA 3PJ1A 2C1AA 4P7EA 4YHTA 3OT8A 3OXZA 1Q8TA 3TXOA 5AX3A 4MTAA 2VO7A 5BVEA 4CFUA 5JT2A 2EWAA 1V0PA 1APME 3GGFA 3PVGA 3VQUA 3ZHPC 4KBAA 3TZMA 2A19B 3P08A 4RX5A 2UW6A 4GVAA 3COIA 3FWQA 5AJQA 3FPMA 4FT9A 2VAGA 2C6OA 3FMEA 4AT3A 2QG5A 5ANDA 4C7TA 4RMZA 3C4FA 4BTMA 4IAAA 4EWQA 3S00A 4P2KA 3G9LX 3UNZA 1ZMVA 1YOJA 1YW2A 4RWJA 4JR3A 4G9RA 4AT5A 4FR4A 2HYYA 4RFMA 4XEYA 4EK8A 3PVWA 3AD4A 5CVGA 1NVQA 2Y9QA 3VS4A 1ZYDA 1H1SA 4EL9A 5HG8A 3NIZA 3R8VA 3IPHA 2R9SA 5AIKA 4PNIA 2X4ZA 4IX3A 4WO5A 3ZUTA 2JBOA 3CCNA 5HE3A 5KMOA 4FEWA 1PXLA 4U41A 5HD7A 5FQDC 3TZ9A 5HVJA 2BZIB 2UW3A 4MH7A 3PFQA 3OWKA 2B54A 3SV0A 3TACA 3QD3A 4ZTNA 3LQ8A 3QWKA 4RBLA 4U7ZA 4CKJA 1FOTA 2XNGA 1OPJA 1GAGA 1OUYA 5CX9A 3GU5A 3CTQA 3OVVA 5D11A 4QQJA 3N4TA 2XK6A 4TYJA 2R7BA 3FMDA 4IVBA 3PJ3A 4EONA 3UNJA 2JFMA 5IPJA 1J7LA 3Q2MA 2Y4PA 4XBUA 2G2FA 4FG9A 4FL2A 4YZBA 2WQMA 2QO2A 5CAUA 2AUHA 3Q52A 1OKZA 5GJFA 2VWWA 3W2CA 2JKOA 2H6DA 3RHXA 3FZTA 4QPMA 1YXXA 5JSMA 3Q60A 3PJ8A 4IQ6A 3VBXA 2C6KA 3BLRA 4B6LA 3TDVA 2NRYA 2HK5A 5HKMA 4C37A 2YWVA 1G5SA 5HCZA 2B9HA 3QCQA 5CXHA 2W9ZB 2PMOX 3CTHA 3UODA 4BKYA 3ZRMA 2NPQA 1W84A 2JKMA 5EM7A 5BVDA 4TY1A 3E7VA 2BHHA 2LGCA 2JLDA 3VS2A 2YIQA 4QOXA 5AP4A 4XV9A 3ATSA 2GNFA 4FTRA 3SW4A 1ZARA 2QU5A 5AM7A 4OTIA 4LRJA 4L6QA 4FX3A 4FGRA 2IZUA 3GC7A 3LMIA 3ID6C 3VVHA 4EK6A 5EFQA 3EZRA 1PMEA 2ZVAA 4IAFA 4F6SA 3GQIA 4YO6A 4ZTRA 3R7GA 5TE0A 3LAUA 2BDWA 2QO9A 2X2LA 4KRCA 4G31A 2I0HA 5IH4A 5KX8A 3Q2JA 2WTWA 4YPSA 3O96A 3W2RA 3VBQA 5EYMA 4BVUA 4HCUA 1V0OA 3C50A 4EYJA 2QKRA 4AN9A 3FDNA 2PE0A 2J0KA 5L8LA 3OWJA 2Y7JA 3T9IA 4F6UA 3BHUA 2CN5A 3BQRA 3I60A 2JC6A 4UBAA 1BLXA 4D4SA 5CAPA 1XH4A 3S2PA 4FV0A 2GHLA 2ITUA 1UU3A 3MFRA 3DQWA 4BI2A 4DEDA 1GY3A 3C0IA 4IAKA 3KF7A 4WRGA 4LGDA 4O21A 4AS0A 5FBOA 4D2SA 3LFSA 4ZSAA 5B7VA 3RM6A 1A06A 2WAJA 1M17A 3KRWA 5IQHA 1XBBA 4PTCA 4FV4A 3BQCA 3C13A 2QURA 2XNEA 3FXXA 4CFFA 4EH5A 3U87A 2WU7A 5FXRA 5F94A 4YJNA 4ANSA 5IH5A 3R73A 4RG0A 2X8DA 3KK9A 5D7VA 2PULA 4BY9E 3I0QA 4XH6A 4WT6A 3TEIA 5FDPA 2GQGA 2Y6MA 2W1ZA 3CY3A 3ORPA 4YTFA 5IG1A 5LVOA 4GKHA 5C01A 5H8EA 5M57A 4O6EA 2XJ0A 3GCUA 5HE2A 3T9TA 1W82A 2I0EA 3CE3A 3QUPA 5FUTA 2G15A 3ZXTA 3FZSA 5DBXA 3PTGA 4GJ2A 4MNEB 5I9UA 4KA3A 1MRYA 4I6HA 4MD7E 1ZOHA 4OGRA 2WMVA 2P3GX 1H00A 5IUGA 2VGOA 2ITYA 4XS2A 1SVHA 4G16A 4XG9A 3V8TA 5EM5A 4JBOA 4EZ7A 1OB3A 4B4LA 3VS6A 5AA9A 5IQFA 3UPZA 1YWRA 3PJCA 2GNHA 4TWOA 5E8UA 5BVKA 4BDEA 1FMOE 2KULA 4C38A 2C3IB 4NCTC 5HI2A 3ZEWA 3UVPA 2ZV2A 2PVRA 3VW6A 3BV2A 5FDXA 1H1RA 4FSQA 1I09A 1VYWA 4DAWA 1KOBA 4MWIA 4JIKA 2BZHB 1ZY4A 3O71A 4A9SA 4EZ3A 5HO8A 4L46A 5HNBA 5E8XA 4CCBA 4BGGA 4ZZNA 1O6LA 3P23A 4V0GA 4F1MA 4XP2A 5ETIA 3EL7A 5BVWA 4EQUA 3U6JA 2UZUE 3KRJA 3PWDA 2BIKB 4JDJA 4MBJA 3BX5A 1H1QA 3CD3A 3HRFA 4XOYA 4QMMA 2R3JA 4QMQA 4CQGA 3CTJA 4DT8A 5IISA 4FV8A 5C8NA 5EK7A 2WTJA 4Q5EA 1PYXA 3HDMA 3AOXA 2B4SB 3VHEA 5M4IA 3W1FA 2PZPA 1RE8A 1YXUA 2HAKA 2C4GA 4RWIA 2YCQA 2V62A 1SYKA 3A2CA 5E91A 4M69B 3VNTA 2YM5A 4R3CA 4J1RA 5LWMA 4M0ZA 1JAMA 5BQ0A 1Z5MA 5EYKA 3SVVA 3OZ6A 4GH2A 4D1SA 3SXFA 4WNPA 4BDAA 3OP5A 3P86A 3ACKA 4DTKA 4QP2A 4XYFA 4C4JA 4FIGA 3MH3A 3FLSA 4YZ9A 4IHPA 4TL0A 2W4KA 3BIZA 4DCEA 4YJOA 1FINA 4W4VA 4AZSA 3NW5A 2BZJA 3PY0A 5TT7A 2PZYA 5EKNA 3F2AA 1YXSA 4YC3A 5AUZA 3W2OA 4ANLA 4BYJA 4MF0A 5BMSA 3RHKA 4APCA 2CCHA 2G1TA 4R3PA 4XMOA 3HECA 4A9UA 3IGOA 4FNYA 4BZOA 3MI9A 4JVGA 1JOWB 3F3WA 4F65A 3RPSA 3F5GA 4FTCA 2J2IB 4MXZA 3DU8A 1OKYA 3FXZA 2C6EA 3MH0A 2C6IA 2VTLA 4F0GA 1XR1A 3NAYA 4JIAA 5A4LA 4FKUA 3C4CA 1WZYA 3QYWA 4BDCA 3PZHA 4RIWA 2CGWA 2OJ9A 2ZYBA 4FKGA 5BYYA 4BIEA 3ZS5A 3T3VA 4NFMA 3O51A 2GQRA 4CTCA 5FTOA 3A7GA 5DE2A 1F3MC 4GW8A 3QUEA 3DJ7A 3TKIA 1YI3A 3GCVA 2VWXA 1GNGA 5LVNA 3R02A 3UTOA 2JDOA 2JEDA 3U55A 4XOZA 4IFGA 3R0TA 3PXFA 2C6TA 3ZSIA 3HDNA 2ITTA 1CKIA 2XNBA 4KIOA 5EW9A 3ZRLA 4EOOA 3KN6A 4A06A 3SHEA 2UV2A 4O0XA 1H1WA 4NM3A 4I1ZA 4WBBB 3OOMA 3QHWA 4YJTA 3NMUF 5AUWA 5JZJA 5I0BA 4EK4A 2B9FA 2FGIA 3MDYA 3TJCA 4EWHA 3N51A 3EWHA 4JBVA 1BKXA 4GK2A 3ROCA 5CEQA 5HCYA 2QOOA 3H10A 1WVYA 4CQEA 2YWPA 3N9XA 4GU9A 4BTKA 3BHVA 4UMPA 3UZRA 3IOPA 1JLUE 5AP6A 5C03A 1H07A 2GFCA 3PY1A 3ZRKA 1J1BA 4NM7A 4IVCA 3JXWA 4TKSA 5AUTA 5KHWA 1BYGA 5E7RA 5CSPA 4O7RA 1KWPA 2YIWA 2JIVA 2PVJA 3NWWA 3ZLXA 2X4FA 5AUUA 3HP5A 4GYIA 5CWZA 1IA9A 4NSTA 2BVAA 3C5UA 2C3LA 1LP4A 2ITZA 3B2WA 4O27B 4M84A 5TKDA 4LM5A 4FF8A 3NS9A 3ZLSA 4EQCA 2XJ2A 5KMKA 3L8XA 1UU7A 5DOSA 3U4UA 4HYHA 4CG9A 2E9UA 4NZWB 3R7VA 5JQ8A 3SLSA 3NLBA 3R8MA 4WG3A 4BCHA 1TQIA 4AFEA 3NYVA 3CR0A 1GOLA 2XJ1A 5AAGA 2WMRA 4EKKA 4ZOGA 3R9HA 3RNIA 5BYLA 1KSWA 5DNRA 4CV8A 2X9EA 3IO7A 4XLIA 1SZMA 4CVAA 4G3DA 4C61A 4U43A 1IAJA 4OTWA 5LMBA 4TNDA 5M51A 2X9FA 3E8EA 3QTQA 5BYZA 5DR9A 1TVOA 4YNEA 4BIDA 2HW7A 4TXCA 3KA0A 4JNWA 4AU8A 2EXMA 4I23A 3HAMA 5ANGA 3F88A 3FMJA 4I21A 4JLCA 3VF8A 2ITPA 4NM5A 3LHJA 2V55A 4LV5A 3ZC5A 5F1ZA 4BHNA 2J7TA 2QODA 3P7CA 3LW0A 3TIZA 3AC8A 2VWVA 2CKOA 4DTAA 1Q5KA 1TKIA 2RFNA 5H2UA 4C34A 5L2WA 1PY5A 3G0FA 4EHZA 3O8PA 5DWRA 3LXLA 3O17A 1WBVA 3H3CA 5DHJA 3UOHA 1XH9A 4TYHA 4DGMA 4H36A 5IDPA 3RP9A 4WOVA 1YRPA 2QR7A 3CPCA 5DT3A 4DH7A 4YSMA 4RFZA 2HWPA 2GHMA 2VX3A 2W1GA 4HOKA 3UE4A 2OXDA 4GG5A 2OW3A 4AT4A 1J3HA 4NH1A 3AG9A 5F95A 2WQNA 3MWUA 4Q5HA 4ZY6A 4E3CA 4EHEA 3BLQA 2XBAA 2YABA 3PSBA 4FSTA 3TKHA 1XH8A 2WTVA 2G9XA 4CT2A 5KNJA 4XV3A 3FC1X 4DGGA 4OT6A 2VV9A 2C3JA 4XRLA 2F7EE 2H96A 5IA5A 2CPKE 4MWHA 3R8PA 4ALVA 5HE1A 2R3MA 3ZFXA 2GPHA 4JRNA 5HVKA 2PZRA 3CKWA 3Q4CA 4QQTA 5T68A 4FBXA 4G2FA 3BI6A 3L9NA 2OIDA 4RIXA 4CFXA 4ASDA 3QKMA 3UQCA 5CZIA 4D2WA 1CSNA 3MA6A 3FI2A 3K3JA 1G3NA 2IPXA 3F3TA 4LOQA 5DR2A 4BKZA 4BGHA 5K0XA 4HYSA 5LARA 2Q0BA 2QNJA 3GCSA 4CFMA 4EOKA 5HLWA 3C0GA 5F4NA 2PVKA 1STCE 4U97A 4K1BA 3F6XA 3IW7A 2A0CX 4D5HA 5BX0A 4JG8A 5ACKA 3ZM9A 3D7TA 5A3XA 4Q9SA 3LJ2A 4W4XA 3U8WA 3W33A 3QLGA 4IZ5A 5IA1A 4CCUA 4FKVA 4PTGA 3QQJA 3FKOA 4RJ5A 3UIXA 4U8ZA 3L9LA 3VQHA 4O96A 1OI9A 5JEBA 3GU4A 3WZEA 5IQDA 2OF2A 4O7LA 3EYGA 4RSSA 4FV7A 3K5UA 1WCCA 1OZ1A 4CD0A 1ZMUA 4BC6A 3QCSA 5AWMA 3NVKI 3AD6A 4PDYA 4PUZA 4GT3A 2O5KA 2YLEA 5HHWA 3WI6A 4O7NA 1AGWA 3KRXA 2XH5A 2UZDA 3TNIA 2NNWB 5FTQA 4WUNA 3PG1A 3GCQA 3PSCA 2UVYA 4AW2A 4BDDA 4HVDA 1XJDA 3QRUA 3FYJX 5KUPA 2O64A 4D9TA 4DFBA 2W1EA 3IDPA 4QTBA 1PKDA 5EI6A 3WYXA 5TR6A 2C68A 3IK3A 4EEVA 3A8XA 3PXYA 4BL1A 5IQEA 1QMZA 3IW4A 4V04A 3AC4A 4IB0A 4LRKA 3ZCLA 3ZO2A 2XCKA 3QXOA 4Z3VA 5DMZA 2G01A 2RF9A 3F5XA 4BICA 4EH4A 4UYNA 3CS9A 2RKUA 4U42A 2XS0A 4FKIA 3COKA 3HRBA 1R1WA 4GIIA 4RLKA 5M55A 4GV1A 4D5KA 5HBJA 5J7BA 1VR2A 4GVJA 5EH0A 4O1OA 4DFZE 4GL9A 2CJMA 5EYCA 4USEA 4F4PA 2JDTA 5ETCA 4BYIA 2V7OA 3QZGA 5JGDA 3SDJA 3QQLA 4U44A 1K2PA 2O63A 4R7IA 2CGVA 1YOMA 2H8HA 3D83A 4S2ZA 5L4QA 3BGZA 4OTHA 5TF9A 2RL5A 4FV3A 4ZJVA 5CEMA 1OL6A 4U45A 4QQ5A 5DR6A 4F09A 3TT0A 3A60A 5G1XA 4ANMA 4G3FA 1NXKA 3KCKA 2W4JA 3MS9A 2O3PA 2VTMA 3OBJA 4QMPA 1H4LA 4YNOA 3UO6A 1CMKE 2YAKA 4R7HA 4XG4A 2E2BA 4BCPA 3FXWA 4C4HA 4DBNA 5HTCA 3FMHA 2CNUA 4FTQA 4IX6A 2XK3A 4QNAA 2BALA 5EYDA 3VBVA 4FSZA 3TCPA 2BR1A 2VUWA 3CXWA 3FSKA 5KBRA 3JYAA 4DH5A 3GQLA 3IDCA 4FA2A 1M14A 1GZNA 4A9YA 1YXVA 1J7UA 5JMSA 5CT7A 2F2CB 3EN9A 4C8BA 3E63A 3HMIA 4NYEA 4FTUA 3OWLA 2AYPA 5DIAA 4F64A 5L8KA 4CMOA 4HYIA 4ERWA 1H0VA 4J96A 3QTZA 3K3IA 4AXAA 2RFEA 4J8MA 3I81A 1IASA 4TT7A 5E1EA 4EQMA 4MBIA 4F1OA 3UYTA 4CKRA 5AUXA 2VTSA 3UOLA 4BCGA 4O0TA 4O0SA 4HVSA 2ZMCA 5CEIA 1CDKA 2YDJA 2YISA 3A99A 4X6RA 5HESA 1H25A 3LCOA 4F0IA 3VS0A 5K5XA 2ERZE 4RFYA 3K5VA 3ZSHA 2GNJA 4A07A 4LOOA 4EOSA 1WVWA 3PXZA 4CXAA 1MUOA 3NNUA 2BZKB 3Q4TA 4PMMA 2ZDUA 3TDWA 2V7AA 4IZ7A 4U81A 4IB1A 4IADA 3TV4A 5AADA 3RAWA 1T46A 2PZIA 4MXOA 4MYGA 4ANBA 4DEIA 2YN8A 2CNQA 3OT3A 5CT0A 3BCEA 3GOKA 4BIBA 3AMYA 4FIFA 4EH7A 5EI2A 3CGOA 3PIYA 3BHTA 4RIWB 3E5AA 1DAYA 5LCJA 3UNKA 1UU8A 2ITNA 3I6UA 2W1CA 2AC5A 1KV2A 3ZM4A 4O7WA 2C69A 5AUVA 4PPBA 4BTFA 4KIKA 4OTQA 3LKMA 3TUDA 3E3PA 4GKIA 2YEXA 3SKCA 1UNHA 4ZSJA 2VWBA 3PE1A 3JVRA 5CSXA 3AGMA 4MEDA 1O6KA 1FPUA 3MB6A 4JQ8A 1OITA 1U54B 4O0YA 3RNYA 2BDJA 4FI1A 3QHRA 4O91A 3QTIA 3II5A 4QMXA 2X8EA 4NM0A 3PVBA 4WUAA 4Y95A 5EW3A 4WG4A 3W16A 4PDOA 3E7OA 3G33A 3THBA 5HD4A 3MESA 4BDFA 4ACHA 3QYZA 4B8MA 3RINA 5HBEA 3UOJA 3AT2A 5C4LA 3R00A 2PTKA 5JFWA 2QQ7A 4MF1A 5DI1A 5EDRA 5HICA 4PL5A 2C6MA 3MSSA 4CMUA 2CNVA 4YJSA 4KKHA 3TTIA 4YZNA 5I9YA 2VTJA 4EOPA 4FE2A 4N0SA 3ALNA 3GC9A 3DB8A 3ORIA 3ODZX 5HCXA 5AV1A 4KINA 5JK3A 2OFVA 3R1NA 1R0EA 3OY3A 4WBOA 3VS3A 5ETAA 3F3ZA 3MW1A 2PE2A 4HZSA 1R78A 4AZFA 2XRUA 1YHSA 2A1AB 4TRLA 4J97A 3RKBA 5CVHA 3CQUA 3TJDA 3W18A 3VRYA 1LPUA 2HIWA 4NWMA 1XBCA 3QKKA 2QOIA 3KULA 2QLQA 3BYMA 4BCMA 3OWPA 2BCJA 3RI1A 1XQZA 3S95A 2PE1A 4ZEGA 3F82A 3MTFA 2C5XA 5K3YA 4F7SA 1KE9A 5ANKA 4C02A 3NSZA 4E4LA 4F0FA 3UZTA 3D14A 4DLJA 2RIOA 4FKLA 5CU4A 2WMSA 5DRBA 3QWJA 3BU6A 3W10A 2BRNA 2W7XA 4DEEA 2ACXA 2W1HA 4XG6A 3ZDIA 4ANOA 2FO0A 2G2HA 3G90X 4M7IA 3ZBXA 4CGAA 3PA5A 1OL5A 2PUUA 3TWJA 5AA8A 3M42A 3D7ZA 3OXTA 1Q8ZA 4FKWA 2P0CA 3DJ5A 3HLLA 3H4JA 2R3RA 4G5PA 4L53A 4BCFA 4C35A 2X81A 4RWKA 4ENYA 4W8EA 1FVRA 3PY3A 5KKRB 3BGPA 4HCTA 5FTGA 3VWAA 2W96B 4F70A 1EH4A 4ZJIA 1PXJA 2XUUA 5BPYA 4XNEA 2W06A 3FQSA 2QVSE 2XB7A 4O7SA 5GZ8A 4EJ7A 5HG7A 2BTRA 2OH0E 4D2RA 2BFXA 3HZTA 3NYXA 3DXQA 1ZYCA 4D0WA 5GIPE 2QOBA 2X6EA 4DFUA 1UWHA 2GCDA 2WEVA 4GJ3A 2E9NA 5CEOA 1J7IA 4ACDA 3R21A 3OROA 4O2PA 1JNKA 4N70A 4O0RA 3EJ1A 3DB6A 3SG9A 2GQSA 5ANJA 4AE6A 3FMLA 1Q61A 2CGUA 3EQFA 3FZPA 4EOQA 3VAPA 3ORTA 3EN7A 4QMUA 5GHVA 2HZIA 5BVNA 1WBNA 4HW7A 1PXMA 3MA3A 1DS5A 2WEIA 4R7BA 4C58A 4O7VA 3RTPA 4FKPA 4EOLA 2YM7A 4MXYA 3R9NA 4O83A 3GT8A 4DBXA 3DZQA 3KXXA 4PMSA 4LGHA 3LQ5A 4ANNA 5C4KA 4RIXB 2FSTX 3VBTA 3VUTA 4WNMA 3AT3A 3DNEA 3MGYA 2YZLA 1VEBA 5C8KA 1B38A 4O84A 3GNIB 3H0YA 3SRVA 3ZOSA 3I1AA 4UXLA 3WZJA 2CMWA 1W8CA 4I4EA 4MHAA 4UWBA 5EHLA 2AC3A 4BCNA 3D94A 3NYNA 4GT4A 1OM1A 3IDBA 3QXPA 3DTCA 4QMVA 5FEQA 2A27A 3VO3A 2O65A 3Q5ZA 4DEAA 4FSMA 5CSHA 3D2KA 3V6RA 1GIJA 2ITVA 4I5PA 5AR3A 3ZUVA 4OAUC 2ZOQA 3Q96A 3HMOA 3V04A 3FI4A 3UBDA 4IWPA 3GI3A 4QD6A 3AC3A 3QTUA 2J0IA 1R39A 3PXQA 3SXSA 4YURA 4ITHA 4CZUA 1TQMA 4LUDA 4KBCA 3HKOA 3ULIA 5IEXA 4FEVA 3BEAA 4AA4A 4AACA 2NP8A 2FSLX 4ALWA 4MCVA 2YM3A 1M2QA 4FODA 3SAYA 2ZB0A 2XKEA 1A48A 5C8MA 4GFOA 4AUAA 5CENA 4AGDA 3JR1A 3JPVA 3F3VA 4AOTA 4R78A 1ZRZA 3UP2A 3P0MA 2WXVA 3UQFA 5KZ0A 3UOKA 2QONA 4D4YA 4L42A 4MBLA 5AV3A 1YI6A 4HNFA 2R5TA 2UUEA 4EYMA 1QPDA 2R3QA 4XG3A 4JXFA 4FTKA 5AP0A 5HE0A 5HTBA 5AMNA 3WE8A 5CANA 4Z9LA 3O8UA 4GFMA 3QTWA 3KK8A 4BB4A 3TNQB 5IH6A 2VZ6A 4DF3A 4UEUA 2OI4X 2WTKC 4XCUA 3VS5A 3DS6A 2WMBA 3CQEA 5LJJA 5I3RA 3KN5A 3RJCA 4TWNA 4AP7A 3NNXA 4I5HA 4ZY5A 5J1WA 3O2MA 4I5MA 3MJ1A 3TTJA 4E6AA 4FTJA 4YGAA 4FKQA 4CYJA 4EH9A 1IEPA 4EUTA 2HZNA 4HJOA 3R7EA 3FHIA 3W32A 3BPRA 2PVFA 2C30A 4ZXTA 4BDBA 2PU8A 4IM2A 4NKAA 4TN6A 1P14A 3A7JA 4FV9A 3GOPA 4ZTLA 4C4EA 2OK1A 2R3LA 4QMOA 2ZJWA 3OY1A 4NTTA 3EFLA 2ZM4A 4BZDA 5HNIX 2JAVA 4QTAA 3Q3BA 4OLIA 1I44A 2UZNA 2J5EA 5JFSA 2WIHA 3T8OA 4HGEA 5CAVA 3C0HA 2RGPA 4L3JA 4ZS4A 3R1YA 4GT5A 5CNOA 3PSDA 2VGPA 1RQQA 4FGBA 4ALUA 5CU0A 1OECA 4F7JA 2E9VA 3VF9A 1WBOA 2XK9A 3Q9WA 4ZSGA 4NTSA 3AD5A 1Q97A 3R28A 5AR7A 5HO7A 3I0OA 2B55A 2BKZA 3UDBA 3MIYA 3UC3A 1IRKA 5AIRA 1HOWA 1LEWA 1ZZ2A 2Z7SA 5GINE 3FJQE 3BV3A 5KE0A 5KMJA 1BUHA 4F9BA 4AW1A 4FIIA 4USDA 4DH3A 3WILA 4O7YA 2WMXA 1VJYA 5IQGA 4EHVA 4D1XA 3ZLYA 3SX9A 2ZV7A 4DG2E 4E73A 4R77A 3IS5A 3KCFA 3HMPA 4RQVA 3ENMA 4IACA 1B6CB 5AUYA 3F3UA 2HZ0A 5HU3A 4J8NA 4JX3A 2R3HA 4BCOA 2BRHA 4G3CA 4RJ7A 4BBEA 3LQ3A 4HGSA 4CFVA 4O7ZA 4AFJA 4X0MA 3UZPA 1KE7A 2XIRA 4X7QA 3E8NA 1SNXA 3DKCA 3I7BA 3ODYX 3R71A 4LYNA 3R8LA 1UV5A 4BKJA 4M97A 5HOAA 4D2PA 5CF8A 5IEYA 2FUMA 3RK9A 3QGWA 3CEKA 5FXSA 5CYIA 1OMWA 5AP1A 4ZTQA 2XRWA 4CV9A 4D0XA 4GFGA 4X3FA 3TV6A 2BTSA 1Q24A 2VO6A 1P2AA 4CZTA 5D41A 4J53A 4F9YA 3LFDA 2BFYA 4KIKB 4AGCA 5CI6A 4DEGA 4YZDA
chains in the Genus database with same CATH superfamily
4FG7A 1QPCA 2IW9A 3R8UA 3VBWA 2DQ7X 5JGAA 4APPA 5FEEA 2JAMA 3MVHA 1ZOGA 3EMGA 2I6LA 3OXIA 5J8IA 2IVSA 3H9RA 3PP1A 5JH6A 5LOHA 3GUBA 5K4JA 3HX4A 1MRUA 4MK0A 2AEGA 2WOUA 4EH6A 3DCVA 3KRLA 4OBPA 1PRYA 3O7LB 3QBNA 4H3PA 4PDPA 1GIHA 3IOKA 2X0PA 3MFUA 4ZJJA 5AP2A 5DT0A 5IA0A 4XX9A 3RCJA 4UALA 2W17A 3P7AA 1U4DA 3F5PA 2OKRA 4S33A 4AQCA 5LWNA 3WF5A 2PL0A 3OW4A 4C3RA 4DFXE 1GZOA 5BVOA 1UWJA 3R63A 3BE9A 3CD8A 3NR9A 4QYFA 2X0GA 4YLJA 5GJGA 3DPKA 5CZHA 4O2ZA 4C4FA 5I5ZA 5I9ZA 1M2RA 3CJGA 3UVRA 2WZJA 3DBCA 3S3IA 2Y4IC 4FTTA 1L8TA 4BDKA 4HVIA 2GNIA 3EQBA 3FYKX 4FYOA 3UIMA 5AFVA 1QCFA 4L45A 5KMIA 1M52A 4C62A 3TL8A 4AGUA 2UZLA 4IWDA 1BX6A 1O6YA 4K33A 4A9RA 3BYSA 5C1QB 1XH5A 2UW5A 2WELA 3EFJA 3H9FA 4RC3A 2VWUA 3KRRA 5HG5A 3R7OA 4DH8A 4YO4A 1WMKA 4F9WA 2YCSA 5EDPA 3ZU7A 4FEQA 5EHOA 4FT3A 5JQ5A 3KQ7A 4G6LA 2QC6A 4DHZA 1J91A 3EQGA 5J9ZA 3VUGA 3LMHA 1M2PA 1WBTA 1OBDA 3U4WA 1UNLA 4FK6A 4OTRA 2WB8A 4ONAA 4TWCA 4ENXA 2C6LA 3V3VA 2IW8A 2XCHA 1YDSE 4QMYA 3P79A 5JKGA 2PK9A 3DV3A 4WNOA 3A7IA 3BRBA 1H08A 3DKFA 4GCJA 4GS6A 3IG7A 3IW5A 3ANQA 2VWIA 4JT3A 3V5WA 1PW2A 4L67A 4UXQA 2PVMA 2B52A 3G15A 3NUSA 2HENA 3B8QA 4OT5A 4FIHA 4L52A 5BVFA 1H27A 2WMUA 5AR4A 3DK3A 4GK3A 2YIXA 4X3JA 3MV5A 4EC9A 4FZ6A 3MPTA 3QTRA 4FVRA 4RGJA 2YCRA 4U40A 5I9WA 1QPJA 4FNXA 4CRSA 2XM9A 2P4IA 4LV8A 4QTEA 4AX8A 3PYYA 3M1SA 3OMVA 2AQXA 4GSBA 4L43A 4AZEA 2RSVA 4UB7A 5I3OA 1XWSA 2VTPA 4CLIA 2V22A 3FI8A 3KFAA 3NYOA 2WFYA 3Q53A 4FUXA 4DGNA 5LVPA 2QCSA 2XIYA 4M0YA 2PMIA 3ZO3A 4PPCA 3HVCA 4FKTA 2CLQA 2WKMA 4QP4A 3P5JC 3HRCA 3RMFA 1Q41A 4CRLA 4FICA 3BYOA 2H34A 2UW9A 3LE6A 4J7BA 4BWKA 2J0MB 3DA6A 4ZLYA 2QHNA 3EN6A 4BI1A 4I41A 3NDMA 5E8WA 3QRIA 3LJ0A 4G6OA 2QO7A 3SD0A 4FT7A 4L3LA 3D2IA 5IA2A 5ICPA 2PVHA 2PVLA 3QD0A 1SVEA 3VS1A 4QPAA 2R64A 2VN9A 4RC2A 5HBHA 4MXXA 1A9UA 2WMAA 3OD6X 5I9VA 2YITA 2YLFA 1SM2A 1WBPA 4N4SA 4AZWA 4MD8E 4K9YA 4B0GA 2IVVA 1NA7A 4R3RA 5IQCA 2YDKA 4FNWA 5CQUA 3U54A 2GS6A 2A2AA 4I22A 4RX9A 5FP6A 4J71A 5A6NA 1K3AA 1REJA 1O9UA 3FL5A 2R3FA 3FQEA 2C0OA 3FHRA 3EQRA 3AT4A 1PHKA 2R3KA 2YACA 2XIKA 3C7QA 4YLKA 4FVPA 2QKWB 4IJ9A 2ONLC 4PF4A 5FEDA 4DFYA 3OUNB 3F7ZA 5EOBA 3UIUA 3DXPA 5KO1A 3D15A 2BRMA 5L8JA 3I7CA 1SNUA 3QC9A 4RA5A 3ET7A 3ACJA 1WBWA 3EIDA 4H39A 5CAQA 5FD2A 3FSFA 4FKRA 2JDRA 3DBDA 4OW8A 3P78A 4EK5A 3IONA 4W9XA 1Q62A 2IG7A 4FZ7A 3WARA 1P4FA 2W0JA 3JUHA 4O4CA 5D10A 4G1WA 4KABA 4QP9A 1E1VA 3ZONA 4KIQA 4WKQA 1OBGA 3QX2A 5D7AA 3ATTA 1W98A 4G9CA 3UIBA 3TIYA 3ZC6A 4D9UA 2FYSA 3HV6A 2HELA 2OJFE 3VIDA 5FXQA 4NEUA 4JDHA 3HGKA 4H05A 3KVXA 4GEOA 3LPBA 5HIDA 3QA0A 4RVKA 1PF8A 3NZ0A 3Q9YA 3UO4A 3FAAA 2J50A 2G2IA 4K18A 2IZSA 1SMHA 3CC6A 5H8BA 1W7HA 3TKUA 4QQCA 4EH8A 4CG8A 2YA9A 4I6BA 4BF2A 3RVGA 5I4NA 4PY1A 2XP2A 5C9CA 4GIHA 3EN4A 4KS8A 4WSQA 1FBNA 4YTCA 1JWHA 1UKHA 3BBWA 5A4TA 3KREA 4WSYA 3LMGA 3A4OX 3G0EA 1Q99A 4FV2A 4KWPA 4PWNA 3VHKA 4B8LA 4RRVA 4O1PA 4FZDB 4CSVA 2B1PA 3W2SA 3P4KA 4O6LA 3DJ6A 4X2FA 4BCKA 1DAWA 1TQPA 4L8MA 4FTIA 5IDNA 3R30A 2PYWA 2QOFA 4IM0A 4QMNA 3JY9A 2B0QA 5L6OA 4FK3A 4RZVA 5GNKA 5ITAA 2XNOA 5CI7A 2WD1A 3QA8A 4K11A 4AWIA 3QC4A 4XRJA 4ZMFA 5B0XA 2WGJA 4AAAA 4Y83A 4ZTHA 3PRFA 4CZYB 2OJIA 4RX7A 3POOA 3T3UA 1YWNA 5F20A 5J87A 1OPLA 3C4ZA 4IW0A 1R0PA 4Y46A 5DPVA 3ZLWA 3PP0A 3R6XA 3ZEPA 2CN8A 2EXCX 2X7FA 3UMWA 4AOIA 3ORMA 4IX4A 4YTHA 3LM0A 3MVLA 3OF0A 1YDTE 4U3YA 3FMKA 4R5SA 5FBNC 2O8YA 4JAJA 1MQ4A 2R0UA 2UVZA 5ANEA 4DITA 3Q04A 3KY2A 5HLNA 4TTHB 4BBMA 3QQGA 4BN1A 3QZFA 4O38A 4BWXA 4YMJA 4DTBA 3W0RA 4AGWA 4L00A 3QCXA 3DDQA 2EU9A 3ORLA 3WF6A 4PRJA 2YCFA 5LCKA 5HNGA 3L8PA 5HGIA 5J5SA 2XAMA 3EKNA 3UG1A 4JAIA 4U79A 2W1DA 2WPAA 4TWPA 4QPSA 2I40A 1YKRA 1JKLA 3G51A 4X3FC 5EDQA 4CNHA 4O86A 4LMUA 4QP7A 4V0GB 4JQ7A 4D58A 5T3QA 4DG3E 4Y73A 4YPDA 3EQHA 3RAIA 2BIYA 2BAKA 4H1MA 3QZHA 2Z7RA 3W8QA 2HW6A 2YFXA 3RK7A 4UWYA 4CEGA 4FUYA 4UMRA 4WRSA 3RWPA 2XZSA 4MQ2A 4JL9A 2B9IA 2OLCA 2C5OA 5CS6A 3IKAA 4IC7A 5IQAA 1ZWSA 2VRXA 4ITJA 1Y6AA 4FV6A 4EJNA 5IF1A 4BRXA 1P5EA 2NRUA 2GTMA 2V0DA 3I79A 3PIXA 4QP3A 5JN2A 5GZAA 1PMVA 4RC4A 3R7UA 5CXZA 3WE4A 2XALA 5HTIA 4K0YA 3ZFMA 4DA5A 3UC4A 4PQNA 4QMWA 3QQUA 4EOMA 5HVYA 4FRFA 4G6NA 3A4PA 3EQPA 3A61A 3DAEA 1ZAOA 2BAJA 3MN3A 4LOPA 4MNFA 3UG2A 3SOAA 1E1XA 2PSQA 2QU6A 1OL7A 2IZTA 2IO6A 2OJGA 2KTYA 4O0WA 4FZFB 5DLSA 5DVRA 3REPA 4IFCA 4QYYA 5E9EA 2Z8CA 5I9XA 2R3OA 1U59A 2WMQA 3P1AA 3OTUA 3GENA 3CKXA 2CDZA 5HX6A 3BELA 5A14A 1P4OA 3RAKA 3U6HA 3KXGA 2R2PA 2A98A 3OBGA 5IMEA 3NIEA 1YQJA 1WFCA 3ITZA 4G34A 1OIRA 4ANQA 3G2FA 5DG5A 3BYUA 3FV8A 3LFEA 3CBLA 3DGKA 3TNHA 5C26A 3E88A 4F9AA 1ZZLA 3PE2A 3KGAA 3HP2A 3R04A 4JBPA 4U6RA 3VS7A 4LG4A 4NJDA 4TZRA 1OIYA 3MH1A 4YC6A 2VTHA 5BUJA 4IAIA 4HGLA 4PV0A 3ORZA 4B9DA 3P7BA 4YZCA 4UX9A 3LCKA 5HEZA 3PG3A 3NUXA 3LCTA 4EORA 4AXDA 5A46A 4H1JA 3PPKA 5T6KA 3FI3A 1Q8UA 4OUCA 3C4EA 4AF3A 3FKNA 5KCVA 2VNWA 5DT4A 2GU8A 4AW0A 1IA8A 4QO9A 4I20A 3NUAA 5AAFA 3D0EA 4IANA 5E8SA 1NVRA 4LL0A 3NFGB 4JG6A 2QOQA 4EOIA 5HIBA 4QP1A 1PXOA 2GSFA 5TO8A 3W55A 3VUIA 2OJJA 4QDVA 5GIOE 4E5BA 2BHEA 2X6DA 1W83A 4CT1A 3OCBA 5E8TA 3BGQA 3KMMA 5M4FA 2W5BA 1S9IA 4RIOA 2X7OA 3QUDA 4MD9E 4OBOA 3R83A 1JKKA 1QL6A 1MRVA 4Y5QA 3WOWA 4WNKA 3LFAA 4RJ3A 2OFUA 2VTIA 3W0PA 1BMKA 4G3GA 3UYSA 2RFDA 2WO6A 3OOGA 2GNGA 2ITXA 4ZZOA 5KMNA 2OIBA 5M4UA 2XK4A 1PJKA 3VJNA 1L3RE 3WBLA 3LLAA 4EC8A 2XA4A 5TOZA 4BDJA 2WTIA 3UPXA 2IWIA 3E8CA 5CALA 4NJ3A 1H1PA 2I0VA 2WQEA 4J99A 4XHKB 4E4MA 2UW7A 4UN0C 5JGBA 1G8SA 3EQDA 3NX8A 1LUFA 4FL3A 4KIPA 2Z2WA 4YZMA 5H3QA 4IMYA 2Z60A 4W4WA 4USFA 5J1VA 5J7HA 1PXNA 2QD9A 3NNVA 4NFNA 3LFCA 4W4YA 1KE5A 4PL4A 2XIZA 2GDOA 2R3GA 1UA2A 3ENHA 4UMTA 4WG5A 3DFCB 3BLHA 2UZEA 4KB8A 4PTEA 4YJQA 2QOKA 3C4XA 4ACCA 4XP3A 3S1HA 2UZBA 5CEPA 2QOHA 5CQWA 3MY0A 2CCIA 2Z7QA 2X7GA 1VZOA 4KKGA 3ZO4A 4NW6A 3BL9A 3LFBA 3AKJA 3CGFA 2PUIA 1F5QA 3KB7A 5B2MA 3NRMA 3H30A 3LCDA 1ERKA 2W5AA 5DN3A 4DEBA 3NCGA 1F0QA 5IA3A 2OZAA 3PXRA 2ZV8A 3HEGA 2F2UA 3ETAA 4UZDA 1CTPE 5FLFA 4YP8A 4M68A 2ETKA 4ZS0A 1OKVA 5AR8A 2VU3A 1AQ1A 3PPZA 5JFXA 2FSMX 2IW6A 4IZYA 5LVLA 2HY81 3HMMA 3TN8A 5HZNA 2Y6OA 5JRQA 1JSUA 1KE8A 3KVWA 3AKLA 3F9NA 2I7QA 4NL0A 1XH7A 3E93A 4IAZA 5LMKC 4W9WA 2X2KA 5DA3A 3PJ2A 3IECA 1H26A 4FIJA 3KU2A 5AV2A 4A4OA 4L7FA 4TYHB 3U6IA 2XANA 3BHYA 5DYJA 1Y6BA 4UMUA 4LV7A 1PXPA 4FKOA 1Q8YA 4ACMA 4BDGA 4QP6A 4DEHA 1JKTA 2YIRA 4E7WA 3NUPA 2R7IA 2ZV9A 3BWFA 2YHVA 2OWBA 3H0ZA 5H9BA 3FLNC 3RZFA 3QQHA 4QNYA 4HZRA 4IH8A 2P2IA 1DI8A 2UVXA 3MFTA 4ID7A 1R3CA 3DT1A 5E92A 4Q9ZA 5DH3A 3ORXA 4TYIA 5B2KA 3CP9A 2X2MA 5BMMA 2UZVA 3GC8A 4DT9A 2W9FB 4H3QA 3UO5A 4C0TA 4R1VA 4GUBA 3FLYA 4YJRA 3M2WA 3W2PA 1NW1A 5L2QA 1PYEA 2NO3A 2WQBA 2OXXA 4YUQA 2BAQA 4EH2A 2F49A 1HCKA 4E1ZA 1JSTA 3G6HA 3U9CA 1XO2B 4M15A 4N6YA 2HOGA 2PZ5A 2CHLA 4YSJA 2A4LA 1JQHA 4IIRA 5CSWA 3KXHA 3VJOA 3FL4A 3E64A 5IA4A 3OC1A 3O8TA 1GJOA 1YXTA 3V5LA 2OIQA 4DINA 3N4UA 4PNKA 1RDQE 3TM0A 3GP0A 2JDSA 4O0UA 4MVFA 3U51A 2W4OA 2BKKA 3Q6WA 3DTWA 3DK7A 5KMMA 2R3IA 2Y0AA 4O22A 2Y8OA 4JJRA 1JVPP 3D7TB 3F2NA 4FTMA 1T45A 3DBFA 2XM8A 1ZOEA 4NUSA 1Y8GA 4EH3A 4V05A 5IEVA 5IZFA 5IQIA 3KC3A 2E9OA 4U0IA 4ERKA 3AMAA 3WF8A 3FEGA 3RPOA 3LLTA 4PP7A 3MVMA 3BLAA 3VC4A 3KXZA 3OG7A 3LXPA 3NGAA 4IEBA 5FWKK 5CAOA 3GFWA 3QTSA 5AR2A 3RBWA 3GCPA 4FSYA 5JZNA 5AM6A 2ZAZA 4I0TA 1ZXEA 3JS2A 3VUMA 3GU6A 3RK5A 5M4CA 4KSQA 1CKJA 3D5VA 3Q9XA 2BROA 5ACBC 3W8LA 4FMQA 5IMXA 2QR8A 3EN5A 4YJPA 2WMWA 3ALOA 2VTTA 3PA4A 4I0SA 1QPEA 4MXCA 4Z7GA 3S4QA 4QMSA 3DBQA 1Q4LA 2IVUA 2JBPA 3ROYA 3KMUA 4FTLA 4LL5A 2ONLA 3ZO1A 3NUUA 5M56A 4C57A 3L9MA 2C5YA 4U9AA 4RIYA 4RA4A 4DFNA 1XMLA 2FSOX 4LMNA 4FEUA 3I6WA 4E20A 4D2VA 3C5IA 4IBMA 4Q2AA 4BBFA 3DAKA 2PY3A 5CVFA 4IB5A 4WIHA 3TUCA 2XKCA 3ELJA 2ESMA 4G17A 4YBKA 2ZB1A 5M06A 3NNWA 4QYHA 1K9AA 3OEZA 2P55A 4JI9A 2NYAA 4NW5A 1Q3DA 3BWJA 3WZDA 4N57A 3DFAA 2FH9A 5D12A 3R2BA 4L01A 2B9JA 4RX8A 3SC1A 3ZZWA 3R9RA 3CJFA 1YDRE 5K9IA 4ZLOA 3AKKA 3PUPA 4ASEA 4KAOA 2J4ZA 4JG7A 4HPUE 5L2IA 5LXMA 3O23A 4JRVA 2F7ZE 3V8WA 3ZMMA 5HO6A 3EH9A 2UZOA 3FZOA 3LZBA 4J98A 5CU2A 5KZIA 3TZ7A 3SGCA 4D1ZA 4YJVA 3SXRA 2UW0A 4FSRA 5J9LA 3O5AA 4FVQA 2VX1A 4IX5A 2XBJA 3NPCA 2B53A 4YTIA 3AQVA 4L68A 4RZWA 1ATPE 3M11A 2WTKB 5AV0A 3D5WA 3R1QA 3HV4A 4LGGA 3BL7A 4FOCA 4L44A 3A62A 3D5UA 1GZ8A 4YJUA 4EHGA 4FTNA 5KBQA 3EFWA 2XK7A 3AC1A 2XKFA 3PXKA 2XEYA 2PUNA 3LJ1A 3SA0A 4D4VA 2R4BA 4TYEA 3EOCA 1ZYLA 3TUBA 3C9WA 3POZA 3KMWA 4M13A 3OCGA 4X2KA 4A9TA 2GS2A 4XBRA 3R2YA 4JDIA 1YHVA 1UNGA 3LFFA 5AP5A 3PLAE 4CTBA 4AA0A 3ORKA 2WU6A 4IVDA 4PPAA 4TYGA 4MQ1A 4R5YA 4YC8A 4O81A 3V6SA 2X0QA 2W1IA 3OCSA 4IWQA 4RVTA 3GVUA 4GRBA 3QFVA 4WA9A 5A54A 5F9EA 4KUJA 5DFPA 3EFKA 5AV4A 4G5JA 5HIEA 4OTFA 4AOJA 5E4HA 4BCIA 4KKEA 5BUEA 5DRDA 2VWZA 2QHMA 3R9OA 4AN2A 1WBSA 3F66A 4FTOA 4FZAB 4V01A 4U80A 4S31A 1VYZA 4KSPA 4OBQA 4X6QC 1ZMWA 2DUVA 5EQYA 4TNBA 3UP7A 1IR3A 4F63A 4KNBA 5L2TA 1Y57A 1AD5A 3O7LD 1URCA 5EQPA 2P2HA 3FLQA 3QL8A 3GB2A 3QTXA 2HZ4A 3OCTA 3DQXA 3QF9A 3R01A 3ZUUA 1ZYSA 4NIFA 2YDIA 3F7WA 5E8VA 3TZ8A 3KL8A 4RQKA 3LIJA 4LI5A 4F7LA 5A9UA 5ANOA 5E90A 3MJ2A 2VTAA 2IJMA 2W5HA 2XMYA 4Y72A 4PP9A 1RJBA 5CEKA 2X39A 3FY0A 4EK3A 5DGZA 1FGIA 2VWYA 3BU3A 3FBVA 3QX4A 3UVQA 3V5QA 4B7TA 2OO8X 1OL1A 4FKJA 3G6GA 2F57A 3LCSA 4M3QA 4HVHA 4NKSA 4QRCA 3ZYAA 2UW8A 1IG1A 3P5KA 4GU6A 3HUCA 2WTDA 4UY9A 3MPMA 2WHBA 4E8AA 3GU7A 4BFMA 3HA8A 2PVNA 3H9OA 3KF4A 3OW3A 2R3NA 2VD5A 1H8FA 2IZRA 3BHHA 3V51A 3PA3A 1DI9A 2EXEA 3KXNA 5EM8A 2QOLA 3BBTB 3NCZA 4FSWA 3DAJA 4S34A 1PXIA 3RWQA 3Q4ZA 4P5ZA 5IQBA 1YI4A 5H8GA 2O2UA 4U3ZA 4O82A 4UZHA 5CF6A 3JY0A 4BWPA 3AMBA 1Z57A 4GUEA 3PWYA 5GJDA 1WAKA 3QKLA 4ZSLA 4YU2A 5DEYA 3HYHA 4UMQA 4FOBA 3UDZA 1Y91A 4B99A 1GIIA 4XJ0A 4FIEA 2CKQA 4BR3A 4BI0A 3UMXA 1FQ1B 4DN5A 4F6WA 2BMCA 4LUEA 4F9CA 1KV1A 1MP8A 4BJJA 2ETRA 4NU1A 4XV1A 4RVMA 3O0GA 2OU7A 3LFQA 5HQ0A 2VTRA 4MX9A 3RZBA 4AE9A 1XKKA 2W1FA 4CKIA 4X2NA 1PKGA 3FC2A 1ZYJA 2CKEA 3TV7A 2OXYA 4KS7A 5HU9A 3KULB 5CSVA 5FRIA 4AN3A 3QD4A 4F99A 2GTNA 1NY3A 4RVLA 3RPYA 4CFWA 4CYIA 2YM6A 4YHJA 4BZNA 4DYMA 4GMYA 4E4NA 2F7XE 2HWOA 3PVUA 3AC5A 3ANRA 5FP5A 2IEWA 3V01A 2OZAB 1KOAA 2ITWA 3MY1A 3K54A 4XLVA 4HVGA 2Y4IB 3LM5A 2RG6A 1U54A 1IAHA 1OIQA 2J6MA 1UVRA 3GU8A 4ZAUA 5AR5A 1M7NA 3IW8A 2OF4A 3CY2A 4XUFA 5DEWA 2PHKA 3LXKA 4YLLA 2PMLX 2XYUA 2LAVA 4ZLZA 3C51A 1BL7A 3UJGA 2RFSA 4IM3A 1H01A 3WIGA 5CF5A 4DC2A 3VUKA 4ZTMA 4X21A 3MVJA 2C47A 4FTAA 1TFFA 2BILB 1NT2A 4P4CA 4EOJA 5E1SA 4BGQA 4LFIA 2XIXA 4HNIA 3VW8A 1YVJA 3ORNA 4FT5A 2XVDA 3PDTA 4M14A 1KUTA 4QYGA 5E8YA 3MPAA 2ITQA 5G6VA 4ZZMA 4FG8A 3TNPC 4BCJA 4DCAA 2YIYA 3V5PA 3IQ7A 4IB3A 3EHAA 4XV2A 1XHAA 4QDEA 3FMNA 3PIZA 2QI8A 3O50A 1OVEA 3A7FA 4II5A 2C3KA 4IDTA 2WQOA 3AXWA 4IC8A 3GXLA 3RCDA 4UV0A 2XNPA 3NUNA 3NUYA 3NW6A 4IDVA 1LR4A 3D5XA 1V0BA 4OTPA 5J95A 4C2VA 3VRZA 3EB0A 4C33A 3K2LA 2HXLA 4XG7A 5B2LA 2EVAA 4I6QA 5J79A 3QRTA 3LFNA 3E92A 4M66A 3ULZA 3FLWA 4JOAA 1WVXA 4A4XA 2W05A 4Z7HA 1PXKA 3EQIA 5BNJA 4A7CA 2Q83A 1M7QA 5K0KA 4S32A 3SRVB 1FGKA 2YERA 1YHWA 3W0MA 3WYYA 2HY0A 1XH6A 3IW6A 4I92A 5L6PA 5A6OA 4P5QA 4ASXA 4E5AX 3CSVA 3B2TA 4I5CA 4E5WA 4HGTA 2Z02A 3CIKA 2VTQA 5JRSA 3EL8A 3QRKA 4JBQA 3CQWA 4K8AA 4YBJA 5LMKA 2PUPA 3WIKA 1H24A 1OIUA 2Z7LA 3NW7A 1XBAA 4FT0A 3IGGA 4IXPA 1OUKA 2UZWE 4OAVB 4QTDA 1W0XC 4IVAA 5EOLA 2JITA 3PLSA 1S9JA 1FVTA 2JGZA 3FMMA 3WF7A 4J52A 3F2RA 1JBPE 1CKPA 4ZSEA 2VNYA 3COMA 2XF0A 2IN6A 3EYHA 2WTCA 3UGCA 2C5NA 3HMNA 4I6FA 5AP3A 3SOCA 3ZDUA 2XYNA 3ZZEA 4RJ6A 1Q8WA 5FM3A 1UU9A 2BPMA 5CY3A 3BZ3A 1X8BA 5IUIA 4QEBA 4FEXA 4WHZA 3VUHA 4ORKA 5AAEA 4IE9A 4EBWA 4RIYB 3HNGA 5A4EA 3VN9A 3HAVA 2V5QA 5HLPA 4ASZA 3NFFB 3JVSA 2E9PA 2HCKA 3V5JA 2DYLA 1BL6A 4DGOA 3MIAA 3I4BA 4OR5A 1XMMA 4QT1A 4RT7A 3R22A 3E62A 4DHJA 4DHFA 5EKOA 4FNZA 3L1SA 3S0OA 5AEPA 3PZEA 3HV5A 3R1SA 4BCQA 2WNTA 4EI4A 4JR7A 3G9NA 2YZAA 4I24A 4R6VA 2J51A 4OTDA 3V5TA 4PMPA 4LQMA 3QD2B 2WOTA 1Z9XA 2I1MA 2VO0A 5HG9A 4E26A 3W2QA 2VX0A 5EG3A 2J5FA 1J1CA 2FB8A 3E3BX 5GZ9A 1FMKA 1ND4A 4DLIA 4Y85A 4D28A 3PRIA 5EM6A 3WF9A 1B39A 4IAYA 4U5JA 4X2JA 3R8ZA 3RPVA 1RW8A 4AAYA 1OPKA 2BRBA 2YJRA 3R7IA 2REIA 4EBVA 2FA2A 3MTLA 4FC0A 4QMLA 5M07A 5HX8A 3QLFA 5KMLA 3C4WA 4IWOA 4R8QA 4AG8A 3BKBA 5EW8A 5IU2A 5J9YA 5LVMA 4F08A 2YJSA 3DDPA 4C36A 5D9HA 2H9VA 4Z55A 2SRCA 3F69A 4ZIMA 3KKVA 3B8RA 2OICA 4HCVA 1GZKA 1OKWA 2QLUA 3VBYA 5CLPA 2OSCA 3EQCA 3FZRA 5FG8A 4EKLA 5CU6A 5J5TA 4D55A 2CKPA 3LXNA 5M08A 2GNLA 1FVVA 3MYGA 2C5VA 4C4GA 4BDHA 4AZVA 2PWLA 5EI8A 4ARKA 4H3BA 4ZMEA 5L2SA 3Q9ZA 3ZTXA 4M12A 2BRGA 2ZMDA 3SQQA 3F61A 4FV1A 4CLJA 1U5QA 4DFLA 5HORA 2O0UA 4C4IA 2CSNA 1V1KA 3DKOA 3OHTA 4M8TA 3OS3A 5LQFA 5L6WL 1ZLTA 2JFLA 4AXFA 2B7AA 1E9HA 4C3FA 1PMNA 2VTOA 3OFMA 4PMTA 3DKGA 1G8AA 3RALA 3UDSA 4I93A 1Y8YA 4CFNA 4QYEA 5D1JA 2JDVA 5AX9A 1JSVA 2YM4A 1SVGA 2XNMA 5AP7A 3SW7A 1H0WA 2GHGA 2DS1A 2OG8A 3NAXA 4FV5A 3Q4UA 2JKQA 5M44A 3BEGA 4X2GA 4PDSA 3QRJA 1OGUA 4RJ8A 5A4CA 5EQEA 4NIFB 3E87A 3P9JA 4EZ5A 4X3FB 1YWVA 2C0TA 1JKSA 3D4QA 2OBJA 3Q6UA 4IJPA 4O0VA 4TW9A 3CLYA 3DLZA 2WMTA 4MNEA 5ANIA 4MXAA 3OEFX 3HUBA 1UKIA 3BE2A 4TPTA 4XP0A 2R0IA 3BU5A 2PPQA 4W8DA 3QCYA 1U46A 4ITIA 4Y8DA 3MBLA 5M09A 5JFVA 3GFEA 2W99B 4K2RA 3OTVA 2VO3A 3EKKA 3FPQA 3U9NA 4FSNA 4K6ZA 3GEQA 3G5DA 5M53A 3D9VA 4DH1A 2QG7A 5ETFA 2BDFA 1NVSA 2GS7A 3N4VA 4DE4A 2BUJA 5CNNA 1KE6A 2YAAA 3L8VA 4I0RA 4QMZA 4UWCA 2OGVA 2F9GA 4H58A 4BTJA 4ACGA 3FE3A 3QU0A 2ZM1A 1CM8A 3LOKA 4KRDA 5CTPA 2OZOA 2DWBA 5C27A 2VTNA 4FL1A 2JIIA 3TG1A 4L9IA 1BI7A 1REKA 5IKWA 3L9PA 3LVPA 4E93A 4IZAA 3QGYA 1MQBA 2GMXA 3GBZA 3I5NA 2CGXA 2QOCA 4OTGA 3DBEA 4RLLA 4MAOA 4JS8A 3RAHA 3CPBA 4ZTSA 1HCLA 4AW5A 3MFSA 4BDIA 4C59A 5CF4A 4HPTE 2IVTA 2JD5A 2C0IA 1ZY5A 3MY5A 2FVDA 3HA6A 2EB3A 3Q5IA 5EHYA 4NT4A 3RPRA 4FYNA 3TI1A 3OUKA 3EZVA 4S30A 3TNWA 4BJJB 5CASA 4C2WA 3ZFYA 4NCTA