4RQQB

Crystal structure of human fab pgdm1400, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
239
Chain Sequence
QLVQSGPEVRKPGTSVKVSCKAPGNTLKTYDLHWVRSVPGQGLQWMGWISHEGDKKVIVERFKAKVTIDWDRSTNTAYLQLSGLTSGDTAVYYCAKGSKHRLRDYALDDDGALNWAVDVDYLSNLEFWGQGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human anti-HIV-1 antibody PGDM1400 light chain
publication title Recombinant HIV envelope trimer selects for quaternary-dependent antibodies targeting the trimer apex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 239
sequence length 240
chains with identical sequence D, H
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rqqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rqqB01
4P2QD 3HZVA 3C8DA 1BQHB 4M61B 2ZCHL 1VB9A 3OGCB 4ZAKD 2CKBB 3DWTA 4JKKA 1VHPA 4JLRA 4WWKB 1NGXA 1O0VA 3PL6C 4G3YH 1D9KA 5CSBA 5KSUA 4CGTA 2VSDA 5C09B 4AENB 3BDYL 5JNYB 2AEQH 4FFYL 3O4OC 3L3HA 3LB6D 4JZJC 5DEGB 4R26L 5FGCB 5C08A 4ETQB 1QACA 1SY6A 3PWUA 1UJTA 4ODHL 1RUKH 3HPLA 2ZCLH 3WJLC 5T1LA 1KB5B 2AJZB 4YR6A 2EDWA 1MFAL 5ITFA 4GOSA 3K8KA 4OD3L 4LIQL 5TFSH 3RZCD 3NTCH 1MCWW 2Q8BH 5EN2B 4EQ2A 4XNZC 2VXVH 4KRNA 4OF3A 3D85D 5DHVB 5DK2A 2E7LC 5FCSH 2BY2A 3SDXA 5FUOH 3TBSB 1CE1H 1VGKA 1TLKA 1OLLA 1WV7T 4HKXB 4D9RD 1YMMA 4ZNEE 2DI8A 1MCOL 4HW6A 4UAOC 1VESA 1P2CA 3HLAA 2BMKA 2C1PA 1BFOA 2VDQH 4HF5L 4FQCL 4HXBL 1CDJA 1EZVY 3EOBB 4P3DA 3SE9L 4Z7WB 3GMOB 1CTOA 5KVGL 3X11A 1FFOA 3HE6B 2XA3A 4I2XA 4H26B 2DRUA 4C4KO 4ONFH 3QZWG 2KKQA 2WNGA 2DTSA 5IFJB 3WL9A 1I7ZA 3BFOA 3DARA 1EBAA 3PWPA 3UTZA 3HI5L 3OV6A 1Q72L 4X4ZA 3TIEA 3VXPA 3SDAB 1FC1A 4KXZH 4WFFE 4P3CH 4LHUD 2J6EA 3NCBB 4L4TB 4ZDHA 2I5YH 2J7LA 1CICB 1J0IA 1CS6A 3VFPB 1N4XL 2HMID 1YN7A 1XCTB 4GKSA 5D7LA 3QDGA 4MCZA 5J89A 3FFCD 2C4FT 2Q76A 3D2UA 2XQBH 3VDAA 4AMKL 4ZS7H 3C08H 5IF0B 1A9BA 4DOHB 4L1HA 1T03L 4Y4HD 5FYLE 1RULH 5ID1A 3QJFA 3RI5F 4OFKA 4R96A 4QTHB 5KOMC 2BHZA 2PN5A 3WFZA 4K23L 1JPTL 4M6MH 3TCXA 1RY7B 2R2BA 1TZIB 4CVXB 4TPRH 1G6RA 4HH9A 3HMWH 4HS3A 1J1OH 1O5DT 4Y16A 5DJDB 1QR1B 4CADA 4B7IA 3IKCA 1UB5B 3OAYK 3JVGC 3Q48A 1K2DA 3PXJA 2NW2A 2P8PA 1E4XI 3DYMA 4MJ5A 4PJAA 1MQ8A 5AG8A 3VFRB 2VN4A 3L3JB 5JIHA 2DQEH 2DAVA 1U6AL 2P5WB 1FZJB 3U7WH 4UIMB 4S1DC 5IVZA 1NGZB 4R6UA 3FRPG 4GMTL 2BNQA 1WZKA 1ZWIA 2GW5A 2DQCH 3LEXA 2OS7A 3LV3B 3CFCH 4HULB 3UBXI 1QBLL 4PRPA 4LAJH 1E27B 5FAAA 4HS6A 1NAKH 5C6WH 4K9EL 4PRHD 1V7NL 4LPWA 4LSQH 4TN9A 3WKMH 2ENYA 5F1SA 3QDMD 4H8WC 4UIKL 2FATH 3I3BA 5BRZE 3MV01 4LPUA 4UQ2B 1SEQL 2B5IC 3SDDB 4BFEA 1XGTB 3P73A 1X5IA 4IOIA 4JZNA 2B1HL 2IGFL 2BHUA 1HWHB 1FGVL 3I6KB 4ZAKB 3KPSE 2DTML 2DBLH 3RX5A 4UI2A 4NN5C 2VL5A 5DDHA 1WIPA 1KV3A 4X9FA 1NUNB 1BQLL 4KUCD 4F57H 2VZ3A 1IAMA 2IH3B 1EMTL 3GI9L 5CGTA 5I73C 2V2TB 1SY6L 5IFHH 3RIFK 5JW4N 1Z3GL 3VFMA 4RFOH 3CDGB 1JNNL 4NSKB 4R7NB 5D8JH 2CK0H 2NQCA 2FEEL 2SEBA 1NGYB 1T21B 1JBJA 3O9WB 1YC8A 4RIRA 1FGNL 2FJGB 2ZUSA 1AGDB 1KFAH 1QRKA 4GO6B 3RZCB 4ZNEA 1UWEH 1LDPL 3VXUE 1N0LA 4QWWD 2PW1B 1XCQA 4QLRA 4MAUL 2B1AH 3D6GA 4X8XA 5CHNA 5AAMA 3T3ME 5EH1A 1EHLH 3VD4A 1NJ9B 1PW3A 2MKWA 1XR8A 4YHOL 4LAQL 1NLDL 1CXHA 4X9BA 3VD5A 1HOCB 5FGBA 5JW5A 3HAEB 4BSWB 1W0WA 1G0YR 4XP5L 3T2NL 4FFVD 4XWGH 1F3RB 2EE6A 3W2DH 4GAGH 4GG6B 4G8IA 4JO3L 2DIBA 1UWXH 3ARBB 2J6EL 5J12B 3STZA 3I02B 3BZ4A 3O3UN 5EZLB 4UTBH 5KVDH 3QIBC 3GMPA 1HH6B 2YHGA 1MFBH 2XTLA 5FYJL 5C0DA 4ORZC 2I07B 1X5LA 1KELH 1Y6KR 3HNVH 3KPMB 1DFBL 3NBNA 2BDNL 2DI7A 4NZRL 3T08A 3LH2H 1KYOK 1ZTXL 5HYEA 1AGBB 4BZ1H 1ZA3A 4LCYB 3L3KB 3MRGA 1DDHA 3DVNA 4H20L 1CVRA 8CGTA 2W9EH 3B2VL 4HXAH 2AEPH 4KVNH 1BD2D 5CP3A 3VXSB 4LGRB 3IDNB 5D1XD 2B2XL 1HQ4A 2C3XA 3JWOL 4XCEA 4X5XB 1XF1A 1RZ8A 2R29L 2Y36L 4PGZA 1IL1A 4XBPB 1MLCB 2V2WA 2WUCL 4TNVF 1PX3A 5C0FB 1J0KA 4XBEH 2DM7A 4J2XA 4XPAH 3TESA 2XV6B 1N8ZA 3QUXC 2YRLA 1DQJA 1ZANL 4N0UE 4NO3B 1KNOA 2DL9A 4HUUA 1X7QA 3DX8B 1RJCA 3IFLH 2HTLC 3IU4L 4ODSH 1QSFE 4OF8A 5DC4B 1U41A 1MY7A 1NGWB 1MHEA 4MGXA 1W72A 3VXOA 1AE6L 1R5WA 4N8VA 2N7BA 1D6EB 1YY9C 1F3JB 2FX9H 1FVCA 4MHHG 3VWJA 1U58A 2O61A 1H3VA 3BHBB 3BZEB 1DBBH 3I6LD 4PBXA 1Z9SA 3F62A 4RISH 4I0PA 3V5DB 1PSKH 5SX4H 4R97B 4AT6A 2FLBT 1U92A 3S34H 1ETZB 4OQ1A 3P0YL 5DJZA 1L7IL 3QXDA 5ABDE 4H1LG 4J4PA 1LP9B 3LSOB 3GUTA 4LSVL 3MR9A 2Y6SD 3QDMB 32C2A 5CSZA 3MLXH 4G9FE 4P9ML 4RRPG 3PDDA 3OQ3B 4JGJA 5DS8A 3WIIL 3U0TB 4M62H 1CLOL 1LWRA 4EN3A 4KJYB 2PR4L 1OAQH 3MRKA 4S1QH 3F7YB 4AIZB 4NM8H 1DL7H 4N0CC 1RIVL 3R8QA 1P84J 4YHPB 1U2HA 2X4UA 3DPBA 4GT7A 4FFZH 4YHKL 3VG0H 1NBVH 3IJHA 4OLYH 1NBZB 1VPOH 1FO0H 3EHBC 5HHNB 4A2LA 2LV4A 5JLZA 3ULVC 1M71A 4DVRH 3OKEA 4JVUA 2R0LL 3FJTA 4XXCA 3VXUA 4WU7A 3UZVB 2K3TA 2BVTA 1VEMA 2YUXA 1LGVA 5C71A 3ZTJH 3LS4L 5I6XC 5D1QC 4EXPX 5CKGA 2W1NA 5I1KH 3WUWG 2W65A 4D9QE 4YE4H 1RZFH 2DDQL 2FX7H 1YEKH 3RWJB 4U1JB 3S5LG 5T3XH 1M1SA 1INDL 2H3NA 2UUDK 1QLEH 4M9PA 4P4RA 3TH4T 4KTEH 4OCLC 3HNSH 1WLHA 5D6DC 2EO1A 5D1ZD 3IJSA 1UADC 1RZGB 4XX1G 1CLZL 1TITA 4Q9CA 1GJIA 4HAGA 4OV6F 3SE3C 1FFNA 3FN9A 3R1GH 3IFNH 1CGYA 2LVEA 5DFWH 4Z6AT 4LKCA 4D0BA 1N7ML 4LSPH 1DQLL 1VGEL 5D2NE 5AD0A 5D4QA 5KN5B 4P59L 3K7UA 3LKNB 2F5BH 3VXQA 1M7XA 2IH1A 4HC1L 1NC2A 3TP4A 5CEXA 4HIJA 5IV2B 1RV6X 3ULVF 2QJDA 1YJDH 2HYMA 1G1CA 2APWA 4LMQE 3X14A 3O41B 3RWEB 3ZKND 1S8DB 2VWEE 2BNUB 3QEHB 5DJ0A 2A9NL 3P4OB 4UTAL 1FNSL 4G43B 2N7AA 1CXKA 2IAMB 3QI9D 5BO1L 1BZQK 4MMXC 1MI5D 1T5WB 2EDBA 3QDJD 4YFEA 1A14H 3FO9A 2L0DA 3FOLA 3FB8A 4O2FB 4OZ4A 1UB6A 3ULUC 2OTUA 5D1XB 1FL5B 1A6VH 1IQWL 4LLMB 1GGYA 3WNKA 1GZPA 3DJ9A 4X4MA 5HD8D 5C0CD 4N0UA 2CLZB 5ADOL 4GRLD 3ETBF 4PGDB 1TETL 5LJYH 2GIYA 2FHCA 2YZ1A 4EUPH 1QSFA 1C08A 4OLWL 5AYUL 4E5XA 2GT9B 2OK0L 1ZHNA 3LEVL 1WBYB 2A74B 3PWJB 1T6WA 1SEBB 4R90L 1KJ2B 3HE6A 4OGYH 3VXTA 5C0GB 1W72L 3UO1H 1R0AH 2DN7A 4ZFOB 4JGUA 1L9MA 4K7PY 5IVXE 5HHME 3V5KB 1Y0LB 4FFWD 1KENH 5I1EH 5KS9B 5TE4H 5D9SA 3BPCB 5DSCB 1VKXA 1QFWH 4Z18A 3E3QE 2P24A 2CUHA 1BOGA 2JB5H 4YDLC 3KVQA 4O9HH 5HPMB 3O2WL 5D7SL 3S88L 3JV5A 4AZ8A 5HYQA 5JMRA 2V9RA 3OJMB 1U91B 4G9FA 4ONGH 3BZDA 1U8OB 1ERNA 1Q1JH 3T4YA 1MWAB 2GSGA 2Q7NA 1MFEH 1MCDA 4GW4B 1XR9B 4LF3A 1UYWL 1I8IB 2P5EA 2C3VA 3S37L 4ONHB 3ULUF 2EH7H 3FQXA 4YUEL 5IB5B 3MRLB 1A9EB 1JP5A 5ESVA 4LSTL 3FB7A 1J12A 1SJHB 3CSYA 4PJ7B 5DI8B 2ZSWB 1MVFA 4LLUB 4XNMB 4K7FA 3QPXL 5I76A 2IPTL 1WICA 5FHAH 5JHLH 4NM4H 3KR3L 3DX7B 4MQ7B 2VZVA 4DUWA 4G6MH 3HUJB 3D18B 4ISVB 2EXYC 1S5HB 4L9LC 4Q9RL 2RIKA 2P8LA 2Z93B 3B8SA 4P4KD 1YN6B 1EH9A 4RQQB 5CSGA 1I9RL 4Q74A 3Q1SL 1KEGL 5JO5B 2AXHA 5BVPL 3HZMB 4QHUA 3MOBH 4XNQA 2GFBB 4BFIA 2LAGB 5ISZE 5KSBF 1D7FA 3BIAX 3RVWD 3ZKMC 4QXWA 1OHQA 3LV3A 3QZWB 3LN5B 3V8CA 4UUJA 4L3AA 5FO7A 3CLEH 4G8FA 2X4OA 4FNLH 4K8RL 1T2QH 4BYHA 1CXFA 1KCVH 3OXRB 5IROA 1TMCB 5D2NA 5TDOB 1HILB 1MCWM 4ZQKB 5JOFA 5CMAA 3QG7L 4KMLB 2XN9A 3DVIA 2X4PB 3MLRL 5D1ZB 3ZTNL 4XRCB 2CKBL 4JHWH 2VLKE 3NIDE 3T3PE 5JDJA 4XAKD 2VLJE 4OFYD 4ZO6A 1XGTA 4JM2C 3PHOA 1HHIB 5HGHA 5DZOA 1E4WL 1G9NH 4FQLL 2J5LC 5INCB 3U36B 1BZ7A 4TULH 1PLGL 5JHDE 4GRWH 4P9HC 4OZIF 2AEQL 3BUYB 1X5XA 4NKOA 4M1DH 1EX0A 4XCNB 4P5MB 4WEMB 5DD6B 1I9IH 5I1AA 3OKDB 4S2SB 5HYSG 3WHXB 2HLFC 5EO1B 3TGXA 4UV7L 3M1BB 1BJ1J 1G7MB 5BW7A 3ZT5A 1XF3B 5F3BB 1Q9OB 3VWKA 5DEFB 1Q94B 3G6DH 1T21A 1MJUH 3QI9B 1WAAE 3SY0A 3O6FD 2EZ0C 4PG9B 3QDJB 3C5JB 2DLHA 5DFTA 2XG5A 2VXVL 5CGMA 4K3JH 3WFHB 5MEND 1K6QH 5FUOL 2BVEA 1CE1L 3ZDXF 1J88A 4IS6B 4JY6B 2BZDA 2Z92A 5JW4R 4JFHD 3D9AH 1OAZH 4JPIB 3OHXA 4LK4A 2VDQL 4Z7UE 3RKDC 3EJJX 5DVNA 1YECH 4GRLB 4JM2F 3S3PA 6FABH 1MSPA 1OAXL 4Y5YA 4U1MB 5IVXA 4HKBA 1D5XA 1FHGA 5C0EB 3SO3B 4ONFL 5ICZA 4ZUVA 2R4RL 4UOW1 3OR7A 5C92A 1XGYH 3QWRA 3FQUB 4PLJC 2E5EA 2VLRE 2FH6A 4RX4D 2HWZH 1U8NB 1NMCB 2AQ3A 4P3CL 2NMSA 3OL2A 4UMGA 2I24N 4CDGC 4EIZC 5F9OH 2W07A 3U9PL 1LMKA 3K2MC 2DWDB 2NXZD 4TUOB 3C08L 4MJ4A 4JRXE 5T3ZD 5HJ3A 4LCYA 2XACC 3L3KA 1JF5A 3TH3T 5I8EA 1RULL 1IT9H 2BY0A 2BVOA 1L9NA 2R23A 3VXSA 2EDTA 4TOYH 1B2WL 1AXTH 5T1KD 4ODTH 1AJ7L 3ALXA 4KK5D 3RGHA 3WNMA 2AJXL 5B3NA 3BKJH 1OWRM 1WZ1H 1FV1B 3GJFH 1U3HA 3H0TB 4OUOA 3QFJD 4TPRL 3QNXA 4IRJD 1A6ZB 1J1OL 2R56H 4PJEB 3MCKA 1DBML 1J0HA 1FJ1A 3H3BC 4XC3L 4ZO8A 4HUWB 3A67H 3DLQR 4QNPE 4OF0A 5TQ2L 3DUHA 4J8RA 4B7LA 4C83A 1F5WA 4EOWH 3WIFB 3U7WL 4P4KB 3P77B 3QHTC 4WHYG 1LO5A 1T66C 5MEQA 2FD6L 3HZYA 1X4YA 1XT5A 4MA8H 3GMNA 4CDHA 4W4OA 3EO0B 3INUL 5HHPA 3UPRB 3TO4D 1F3JA 1GAFL 4K3GA 2R1XA 3CFCL 1A1MB 3RL1A 1NC4D 5LG1A 4QRSA 3KDMB 3EYUL 5GGTH 2F15A 1NSNH 1JGVH 1KTDA 5GIRA 3W82A 3P4NB 2VLKA 2VLJA 4PRBA 3ARZA 4XI5D 2Q6WA 4QRTB 3BEVB 1BQUA 5IM7B 1R24B 4L5FH 4KXZI 4WNQA 3H7BB 4OM1H 3S97C 1LP9A 3CDFA 3X3GH 4KKCC 1FCGA 1EZVX 4M8VA 1A2YB 5JHDA 1CZ8H 1TPXC 1WIUA 5GS3A 3U0TA 5TE6H 2DBLL 1ED3A 2GHWB 1FYTE 4KJYA 3P4MB 3VE0B 5L2KE 4R7DB 1P4LB 3MLWH 4F57L 2YK1H 4WV1B 4PD4J 4QOKA 1GXEA 5SWSA 4M7JH 4X83A 4Y8DC 5IFHL 3FQWB 5DMKB 4QHNB 1JYWA 2EC8A 2FJFB 1EEZB 5D8JL 1LQSR 1FO0A 1WAAA 4I0PC 2BY3A 2ARWA 1Q9LA 3KWWB 4JQXC 4OLUH 5D7IA 1RUAL 3O3EB 3OJ2C 3NCEB 1IEBA 4IOFD 4PJHB 4XPHH 1CGXA 4MD5B 3TBVB 2HT3D 5KW9H 3O3BB 1KFAL 3FT3B 1FNHA 3IJYB 3GI8L 1BOYA 1K4CB 5IWLA 3O6FB 3SGEH 2B1AL 1G7LB 3C5ZD 1L6ZA 4UNTA 2X89D 2J2ZA 4KJWC 5MENB 1EHLL 3TVMB 3P9MB 4MNGB 4HZLA 3C6LB 5I71B 1QLRA 5IB2B 4PTTB 4Z7OE 1OP3K 5GS1A 2IBGA 3HC0B 2P4AB 4YEFA 2IEPA 1ZGLM 2AV7B 4TVPH 1AGFB 3D39D 2X7LA 4NHUA 3ARRA 3QUYA 4ZUUB 5B8CC 3MROA 4YBHA 4PG2A 1IGTB 4MJIA 2D7TL 1YEIH 5DD1L 1HDMA 4NKIH 5A16B 3PWNA 3QT2A 4Y1AA 3B2UD 1QLFA 3O6KL 5CUSL 4H1LB 5EC2A 3N85L 4UTBL 5KVDL 3B83A 2N56A 1MFBL 2E6JA 4CUCA 4P2RE 4PUBH 5IV2A 1KELL 1XF5B 2OXHA 4LOUD 3ARFD 5D70H 1G7JB 3B6SA 3EYQD 1S8DA 2GTWA 2VZUA 5IG7B 1T22B 4LMQI 3G5XB 4WHTA 3GK8H 4ZO7A 2EECA 4BZ1L 3WS3A 2R69H 2NY1C 3EDEA 3SBWA 5IHZA 1FG2B 2F8XC 2W9EL 2AEPL 4KVNL 1T5WA 3B9EA 2VDRH 1YYLL 1RIHH 5GGSB 4YK4C 5LAXA 4JFDD 3PP4H 2XTJE 4CJ0A 2Y5EA 4GH7B 4KWUA 5IIEB 3QO1B 4O2FA 5ENWB 4S10A 5T1KB 1G7IA 4NDMB 3SOBH 3KYOA 2NY4C 4LLMA 5KSAD 4B50A 4PJ9A 3EOTL 1RPQA 4UT7H 3RNKA 1QBMH 4XPAL 3WNLA 5EO9A 2HKFH 1MCNA 4NQCA 2GT9A 4HIXH 4EUPA 5DMIH 4N90E 2DQHL 3TV3L 3PWJA 3PWLA 3DYOA 4MS8C 4ODSL 4DQOH 4HMCA 4OJFL 2ITCA 1I1AA 3R4DA 4RZCB 1T7WA 4G6AD 1JTOA 1NLBH 1UC6A 2H2SC 4YDVB 3T3MF 3JV4B 4GAYA 1KTRL 2X4NA 3NIGE 1PKQE 5CBAB 1NUGA 3WLBB 5A2JH 2XA8H 4RISL 4HFUH 4ODXA 4LSRH 3TO4B 4PGBB 1XGQB 3OKNA 3RGVD 1OSZA 5DJAB 5FO8B 3ISWA 1NC4B 4R9HA 3Q0HA 1P5VA 4JREC 1U91A 1U8OA 4JO2L 4Z7VB 4PY8J 1MWAA 3TBWB 2FX8H 5T33H 3RVXD 4ZSOE 1FYTA 3MLXL 5L88H 1KCLA 2LU3A 1IGYA 5IB5A 1KB9K 4ZFGH 3MRLA 3V5HA 2VZSA 5EPMB 1AC6A 5ID0A 4S1QL 1S3KL 1XGPA 2ZOLA 3PQYE 4YHZH 2R0ZL 4NM8L 4ODWB 5GXBB 1DL7L 3OG4B 3NN8A 5CP7A 2AKRB 1MIML 2IQ9H 4FFZL 3VG0L 2EYSA 1FNLA 2C26A 2NX5B 1VPOL 1FO0L 5CBEB 1KG0B 2VABA 1T1WB 1GGCH 4DVRL 4L8CA 3LPWA 2G60H 1T7XA 5A2KH 3RWIB 5E8DH 1JNLL 3HKFA 1M4KA 1XIWC 4F58H 4M3JA 5JO5A 4XWOC 1HXYA 4J1UA 3ROOA 4NNXB 4AH2A 3EAKA 1IRAY 2GFBA 5GS2D 4YE4L 3MACH 3TCLA 5JOPE 2VLLB 1IGFH 4U05A 1YEKL 4I5BB 4PY7B 4FXGB 4AM0A 5T3XL 1DEEA 4KMTH 1QLEL 3HS0A 4BH7A 3C5ZB 2X6MA 1W8NA 4JJ5B 3HNSL 4FQXC 1UXWA 2WWKT 3L3GB 4LLDA 3QIWB 3KPRE 3OXRA 4Q2ZB 3AFLA 2XXMB 4ZD3H 1FZKB 3IFNL 4MXWH 3BYYA 1CFNB 3Q3GA 4LSPL 3D39B 2XYCA 3DGGB 3PF2A 3MNWA 1ACYH 1TVHA 5SX4I 5FOJA 1S7XB 3KLAB 4OCXH 1QRNA 2F5BL 2MJWA 3OAZH 4JFXB 4BK5A 1ZSDA 1FNAA 3VRLF 1HCVA 4PJBE 4R0LC 1CQKA 1S9KC 2ICCA 3SKMA 3ZKSD 2ICWJ 3ARXA 4Z5RA 3TT1H 3MRDA 2C1OB 3SJVE 1SMAA 4LLYA 4NQEB 3DX9B 3ARFB 3MUGA 1BIIB 2NYYD 4M93B 1E6OH 3MV8B 4OCSH 5SWZE 1U93B 1JVKA 5BS0D 3GBNH 4G8EB 3MLPA 1UENA 2ZUQB 5CJOH 3HRPA 4ZYKB 2HJLB 1M7IB 2GKIA 3MC0A 4YO0B 1MCHA 3QHZL 1F8TH 5FCUH 4LCIH 3MRIA 5DGRA 4JFDB 2IG2H 1FL6B 3ARYA 1I3GH 3WSQH 2QSVA 3CUPB 4W6XB 4MA7L 1YY8A 4JKMA 3V7AE 4IS6A 1KPVB 4ZG1A 1L0XA 1KCUL 2VWEC 5KSAB 1U8KB 3BVNB 3GMMB 4HDIA 4JGMA 5C0RH 5CJQH 1LNUA 1R3IL 2W91A 4UQ3B 3MFFB 4WO4B 3MRHB 2Y06L 4OBSA 3FQTA 3WJJC 3WNOA 4DK3A 5C0EA 4OGYL 4X5WB 4CVWA 2YBRB 4YPGA 1PKQA 1BAFH 4TVPE 4U1NA 3HI1B 3QFDB 4HJJH 5I1EL 3EKCA 4OI7A 4XTRD 3TO2A 3Q5TA 3KAAA 1U8JA 1JJUA 1H8OA 3L1OL 1GOFA 1QFWL 1G6VK 2EKJA 5ILTH 1ZHKB 5I2IB 3MV9E 1BJMA 3EOAB 3H6JA 3BP4A 3CFEB 4ONGL 1MWAL 5E6ZA 4YAQB 2DWDA 4F7CB 4TUOA 1TJIH 1EAJA 2GITB 5L6YL 1MFEL 4HUVB 3SKUD 1FN4A 5EBWB 3ILQD 2VZ1A 2FO1A 4FTVD 2EH7L 4OZFG 3NPZB 2QADD 4OKDA 3TN0D 4F7EB 2BJMH 2DM2A 5EZIL 4PJ5E 1HEZA 5FKPB 4HLJA 3UTSA 1OT1A 4TTGA 5IKCB 5INDA 1I8MA 4YDIL 4NM4L 3E3QC 3VI4E 4PJGE 1IBGL 3JTSB 3F58H 3K74B 5DRZA 5E99H 2B8OT 1A6ZA 3RVUD 1IFHL 3ARGC 4R3SA 3PGDB 2IANB 3UJTL 4LLQB 3VDBA 4OF6A 4HUWA 4XP1L 1MCBA 4Y4KD 1YEFH 1DZBA 4BJLA 1I3UA 3IT8D 1U0QA 4FN0A 3WIFA 1B6DA 2XWJB 5FM4A 3MLVH 3P77A 4TTDD 3O4LE 3MJ8A 4PLKC 3RL2A 1FNEA 3MLZH 5LWYH 5HI3D 1I1YB 1UQSA 4L8BB 1BBJA 2ATKA 1A3RH 4EBQL 2LAAA 1FIGH 3C2SA 3CDYA 4F7PB 1U95B 3JWDL 1T7ZA 4OTXL 1WT5A 3CLEL 5GSRB 4P23D 3KDMA 2CXGA 1T2QL 3C60B 1KCVL 5GGTA 1KIQB 3E0GA 3EYSL 4MCYB 3ZKXB 3BEVA 3KPOB 1R24A 2YPLE 5IVXF 4BFGA 1LVEA 1F11A 3PNWA 4F9PA 1QFWI 3LKPB 3U0PA 3LKQA 1TQCB 5D96C 3EJYD 4Y19A 2OMBA 5EU3A 1IEAB 3D3VD 1G9NL 5E8PB 3LQZB 2P1YA 4R4FH 4ZUWA 3G5YB 4K7PX 4TSCH 5TE7L 4N8CH 4M1DL 1M05A 1HSAA 1OTUC 2ZG3A 4DCQA 5SWZA 1OGTB 5F1NA 1I9IL 1MUJB 1KACB 3TA3C 1FRGL 2DKUA 4U6TA 3HR6A 3HAEH 3U1SH 3RVTD 3G6DL 5E6ID 1A7RH 2PTTB 2WBJC 3OAYH 1K8IB 1MJUL 4D3CL 5FIEA 3IETB 3F7RA 4KI5C 2YEZA 3BQUB 5BS0B 2X4TB 3ARQA 4KK8D 4M7LT 3EYVA 1A0QL 2EIZB 1AHWA 3IJYA 4M5ZL 4PY8I 4KMQA 5AUMA 5GGRA 2OJZL 4NRZA 5I19H 2QBWA 1C5BH 1FZOB 2O26U 4DGIH 1JGUH 3SQOH 1LEKA 2AJUH 4U1LB 3C6LA 1OAZL 5IB2A 4PTTA 4I77H 2D7OA 4MWFB 4OCRH 3JUYA 4YXHH 5J1SC 1YECL 3HC0A 4PJDA 3BGFB 3KS0H 3T77A 3DTXB 6FABL 2AV7A 4R2GC 3NABH 3TBYA 4M1GH 1FVEB 4U6HB 2ITDA 5GS0H 1DQMH 3QXVA 1GC1H 4WFGD 4XCFH 2CO7B 3H42L 4I4WB 3CVHB 5I9QB 2Q7YA 4PRAA 2HWZL 2EXWC 4WI2A 4H1LA 4PJXE 2XNAA 4K94L 4JRYD 3MV9A 4U6XB 4X7FC 1IM3A 2HRPH 3LKOB 4JN2B 4LU5H 3HNTH 3VD9A 4PGCA 5E2VH 3GSRA 3OJVC 2AK4D 5F9OL 4PJIE 5I30H 3L5WA 3SGDH 2CLRB 2DMKA 3EO9L 4P46A 3T3PF 4KI5F 2OR8A 1IGMH 3JBG7 3UEZA 4D8PA 1J0JA 4Z78A 1X3DA 1OM3H 3GO1L 2X5PA 4WFHE 5J3HC 5F9JA 3SDCC 5GS1C 5I8OH 3O3DA 1JK8A 4NHCH 4MD4A 1JRHH 4I9WE 25C8H 2PYEB 3BH9A 4ODTL 2A6DA 4XVSH 2B4CC 3DUSA 1RJYB 3ARED 4PJGA 2FBJH 4Z7WE 3BAEH 3QPQC 1GOHA 1FVDB 4M03A 5BV7C 2QADB 3BKJL 1WZ1L 3OG6B 5GRYA 5LGKA 1MIEL 2Y1VA 4OLVL 3SGKC 2VXTH 3REWB 4APQA 2PXYC 3WD5H 2R56L 3LDBC 3WUWA 3RUGA 4NJ9H 1OOAA 4P5KA 1P1ZA 5JXEC 4L4TE 1LK3H 1NCCH 1U8MB 1WAAF 3NZHL 3S5LA 5FB8B 1H9VA 2W60B 4HG4J 5J4MA 2D7MA 1HNGA 3DV6B 3RDTD 3NIFE 3ULSA 4Y4KB 4KI1A 3VFVB 1KIPA 4KJPC 1RMFH 4QXTB 5IVOA 5CZVL 1T0MA 1N59A 2M26A 1ZLSH 4Q7DA 1SQ2N 4IIQA 1N5YH 5E1AB 4Z7UF 3HC4H 3WLBA 1OQOA 1IAOA 4JFZL 4DKFL 5GGTL 1CDGA 2F54D 3I84A 1JGVL 1RFDH 2YPLA 4Y5VB 4BSVB 5CZXC 1OQXA 3BD5A 4JPWH 4KDTA 4P23B 2XKUA 2I60L 2Z0BA 4L5FL 1FORH 1IAKB 1X6NA 2E7CA 3GIVA 4GRMB 4KY1L 2ZCKH 1A3LH 4X9GA 2AERT 4JKPH 5A2IH 5DJCA 5C07A 1CZ8L 4AEIH 4RAHA 1OPGL 1YNLH 2QEJA 5DD3H 1Z9OA 4CAGA 1JGLH 4WHCA 3MLWL 1I1AC 3D3VB 2P5WE 2WW8A 3UTTA 3MBED 3GGWA 2R1YB 2XICA 2PTUA 4E0RB 1K85A 3KLHC 1BIHA 2C9AA 1KG0A 5BQ7B 2APFA 4OLUL 4XCCH 1IGJA 3CXHJ 1UCTA 1MJJA 4XPHL 4FQPA 5IGXH 1A7PH 3CZJA 4YNYB 5KW9L 43C9B 2J1KA 3KJ6H 3BWAB 4OD2A 2D0HA 1UACH 1YNKH 4RCAA 1TZGH 5E8OA 5F7NC 2H9GB 4FXGA 2AXFA 4F3FB 1PQZB 4P2QE 5GSVA 2ENSA 5EU6E 4JJ5A 4QNPF 2HT4D 1VACA 1HHHA 3QUZD 1PVHA 1DUYA 3DIFB 4TVPL 3PHQB 3O11A 4MXQC 4NQDE 1DANT 4UINH 1RJZA 1YEIL 4YWGH 3DMMC 4OZGB 2VRAA 4YDKL 4UT9H 2IBZY 4GLRH 3V6FB 5DK0B 1SBSH 3BMWA 4OIAA 2CLVB 3EDFA 5FGRA 2X1OA 1JNHA 5IK3B 1KIRB 3WLWD 1S7XA 4PJCE 4WY7H 1UVQA 3DO3A 4M4RA 2WBKA 2ED9A 1KJ3H 4JFYB 3RVVD 5J13B 3B3IA 3MXVH 1IGIL 1NUFA 1TJGH 3HMXA 4NZUL 5HGBA 1BWWA 5DR5L 4JRYB 3E6HB 4GBXD 5IOPB 2AV1B 3EOYG 2IWGA 1I9EA 3VGAB 2AQ2A 3NCCB 3FONB 3T0EB 1FCCA 4DZ8B 4NQVA 4X6CE 2R69L 2AK4B 3ELAT 3O45B 5TQ0L 1TXKA 2IALA 1U93A 3UBXG 4JANA 1KF9B 1RIHL 4JDVB 4UT6H 2GJ6D 1KSRA 3PP4L 4HHAA 3SEPA 4MYWB 4EVNB 3V4UH 1KCRH 5GJTH 1ZLVH 3QRFM 3LY6A 1HWGB 1CIUA 3SOBL 4ZO9A 2AI0H 4JFQB 5HPOA 3W0WD 5E9DA 1LD9B 2C5DC 4GG6E 1MCRA 1MRCH 3P0GB 4OQTA 4U1HA 4YGAB 1LK2A 4YZFE 3QQ4B 5DJ8A 2UUDH 4DVBB 3DRQA 1U8KA 3KPPB 4XHJD 3RY6C 1CCZA 4HIXL 3MRMA 2A6JA 3MJ7B 5CJXC 3VU2A 3SGEI 3T0BA 4U3CA 1UZ8B 5H8DA 2HKHH 4DQOL 4JZOB 2DLFH 1F90L 2V2XB 4YHLH 1YPZB 4JG0L 4NT6B 2IPUG 1EO8L 1NLBL 2XTJC 4NUJA 3VGGA 3BPOC 3RDTB 3HI1A 3FFCE 5LQBL 3OX8B 2EYRA 2FB4H 5C7XL 3WFBH 3QAZC 4PB9H 2X2YA 5HHOD 1T89A 4Q9QH 4JDZA 4X4YA 5I74B 3K4DA 2J8UB 1TIUA 3E2HB 1Z6JT 2IQAA 4G8GD 4YQXH 2F54B 4NIKB 2YXMA 1A1OA 5BVJA 5CGYC 3OF6A 5T33L 5I0ZA 4XP6L 5EBWA 3FO1A 4Q6IA 1NMAH 5L88L 3B9KC 3GIZL 5E0QA 3MREA 1MRFH 2MHAA 3N1QC 4ZFGL 4PJFE 4RGND 5HGAA 5HYSA 1XGUB 3RI5K 1B88A 3VXMD 2CRIA 1CE6B 3O8XC 4Q6YA 3MA7B 4YHZL 4H5SA 3FTGB 1VFAB 3HPJA 3SKJH 2C4FU 4K71C 4YHIA 1DUZB 5IBLD 2IQ9L 3ARDB 3MRCA 3GSNB 2FBOJ 1JN6A 3IU3A 3MBEB 3FO2A 5I16A 3EYFB 2IANA 4LLQA 3MRJA 4LPXA 5F7LB 2R4SL 4MAYA 5KANI 2DICA 2EIBA 2V5YA 3IXAB 2G60L 2FR4A 4M5YL 3LS5L 3BEWA 2UWEA 3CFBA 1LO2L 3DETC 1HSBA 3QBTB 3SKNB 2DWEA 1R3KA 5BXFA 2FNBA 5I1JH 5JA9A 1UM5H 43CAA 4DZBA 4P2QA 4PGEA 3MACL 3O3AB 4LEOB 5EU6A 4PRHE 3LRGA 4PJ8C 1ITCA 3VD3A 5C0IA 4YDJA 3QDME 3MNVA 3ARGD 1I8KA 4NC1E 4KMTL 4WRLA 3ILPB 4NQDA 4MZ2A 2QQNH 1J10A 3J8F7 4LDOB 5KAQF 2MQ3A 5BOZG 5L9DL 4ZD3L 2YUZA 4L8SB 3O0RL 4XC1H 1GGIL 5FUZL 3FQNA 4PJCA 5E70A 4XZUB 3I6GB 2AP2A 3NIGF 2Z91A 3BW9B 4OKVB 1A64A 3OZ9H 4CVZA 4GQ9H 4OCXL 4L29B 4OD1L 3C5SA 3HMXL 1OD9A 1S7QB 4L9DA 2Z4QB 4MNQB 5ECJE 4OZFB 1S7TB 4JZJB 3D85A 5FOBA 5TF1H 4Z7NE 5J9PB 2BC4A 1MCFA 2VE6B 4FZ8H 4GBXB 3RA7H 3T65B 3HG1D 4OCSL 4XCYB 3SCMD 4KHXH 1P4BL 1K8IA 2R2CA 3G04A 2CR3A 1DVFC 5TPWL 4ZNCD 3BQUA 3P2TA 5SWQB 5JZ7C 2XKNB 2ZUVA 2ATPA 1F8TL 5B39A 4LCIL 4AEHH 2XWTB 3TZVC 1W2KT 2IG2L 4M02A 4Y4FD 4NBXB 4NC0B 2NTFB 3P4LA 4CMHC 1A22B 1GL4B 4Y2DA 3MSPA 4OUUA 4OQTL 5K9KB 2FH8A 4JHAL 1KCSH 5AZEH 1IGCL 4S0TD 3NZ8A 4LHUA 1WBXB 3W0WB 5CJQL 1FLRH 2ID5A 1T04B 1QFUH 5HI4C 4I48A 1JWMB 4LRIC 3E1F1 4GKNA 1WVZA 3FFCA 5IJVB 3TFKC 2GJZA 2OTWB 2NPLX 1BAFL 1AO7B 3KXFD 4G6KH 5GGVL 4EEEA 4WIQA 3U30C 4M6OH 4MD0A 4QRPE 4HJJL 3TPUB 3H3PL 3FOMB 2ICEA 2W0LA 4ZXBA 3B43A 3ESVF 4NN7C 4WUKH 1P4IH 5DQ9B 1OP9A 2EIEA 5ILTL 3KNBB 1BD2E 3GBMH 4I18C 5DVOA 4JFFD 2ED7A 5IB1A 1JZ6A 3W5MA 5HHOB 5IFAH 1PGRB 2CLRA 2QQLH 2EDNA 4V1DE 4LCWE 2X42A 2CDFA 5JDSB 4NQSB 4G8GB 3G5VB 4YHMH 5L7XL 1KBGH 5KG9B 3PABB 2EYTB 4HIHB 2ED8A 2E8ZA 4GFTB 4GXUM 5E95B 4MQXD 2DMBA 4PJBF 1N2RB 4XVUC 1RJYA 4XGZA 5D5ME 2BOBB 4RGNB 3BI9X 1XFPA 4IRSD 3HE7D 3MLTA 2BNRA 4NKMB 5I1IL 2QHLA 1RJLB 3F58L 3AAZB 4TNVK 2GI7A 4JAMA 4MA1B 5FDWB 3CAFA 4MA3B 5I8CA 3GMRB 1SYSB 3D48R 4FQHB 5D93C 3TF7C 2FL5B 4XH2A 4P48A 3V4PH 2R2HB 4W68A 1HYSD 3TJHC 2W60A 3L7EB 4PRHA 4D9LH 3REVB 3I6LE 1KYOJ 5I66B 2EDYA 1MNUH 3MLVL 4OM0H 3SGJC 4NYLA 3VFVA 4N0RA 3T0DA 3LVEA 1KCKA 5IR1A 4RMQA 2ESVE 4LEXH 1PZ5A 3P11H 1A7OL 2I9TB 3EGSA 5F6IC 5EU5A 4HKZB 3HHRB 2XKSA 1JF1B 1HXMB 4OIIH 2QSTA 4YIQB 4C56B 4OGXH 3IGAA 5IEHB 4H8WH 3W39A 3RNQA 4PBVC 3OSKA 4GUPB 5GRJH 5ERWA 2IPKA 3VFOA 1EUTA 4HMDA 2VDKH 3G6JE 3M8OL 3QO0B 2B5IB 2Z31D 2UYLA 4GRMA 1TQBB 2FIRT 4WDIB 1N64H 1CFTA 1VFOA 3ROLA 1G0DA 2VDLH 4O5LL 5B3JF 4XB7A 1J9CT 4R4FL 4NN5B 3K8MA 4ZPVB 4TSCL 2PETA 1UA6H 5FYKH 3BO8A 1KLUA 2NNAA 1CFQB 3BXNA 5F9DC 2Z8WC 4U33A 4KPHH 5I73B 3WNPA 4JKWA 3LN4A 2AXGA 1QSZA 4DW2L 2NY0C 4F2MB 3RP1A 1NMBH 2APVA 4GW1B 4JRWA 1OGAB 5ICXB 5E2JA 1P9MC 1R3JA 1G9EA 1NKRA 5H94B 4LP4A 5IJKA 3NFPA 2W9LA 1C5CH 5F7EH 1IAIH 3HG1B 5DUBA 3FT4B 3QIUC 4KDTC 3SCMB 4N9GB 1XF4B 4RFNB 3DECA 5FKAA 3JSSA 1E28A 5FA3B 4LLVB 3OKMA 5D6CB 5BZDB 3UROR 4QRRA 1CGSH 3VI4F 2H45A 4PJGF 5I19L 1C5BL 4ZFFA 1T83A 1NCWH 5MEOA 5DVLA 4BELD 1XAUA 5JPMA 4OF7A 5K9QI 2GY7B 3EBAA 4I77L 1H5BC 1F3DH 5F7YC 3PHSA 3RTQC 1S7WA 3FHAA 4E41A 3JV6A 5T5FH 4NZTH 2V5RA 4M1GL 2MWCA 2PO6D 5HGDB 5GS0L 1DQML 4QRPA 3HB3D 4MX7B 2MCPL 1QQDA 5T3ZH 5C0AB 1QSEA 1KIRA 3DNKA 1CR9H 2K7PA 1K9TA 1MOEA 3LKSB 4LU5L 4DFIA 4V1DA 1ZT4B 3TYFA 1GYAA 4LHJB 4LCWA 1MI5E 5E2VL 5DRWA 2GSIB 4WWKC 4P2CG 4TUKH 5IW1A 3QEGL 1NL0L 3AMLA 5GQBA 1NFKA 2NY5L 2WIIB 1I3RB 5IB3A 4I3GA 1IGML 2X70A 3CZFA 3T0WA 3VI3E 1RZKC 5JW4Q 1JMZA 4JFFB 1RSFA 1RAMA 2F53D 4XXDA 1EGJH 5D5MA 2R8SH 1JRHL 2VC2H 1ORQA 2VDPL 5C0CE 2A1WH 1P7QB 2DQDL 4N8VG 4ZPTB 4F9LC 4M48L 1K3ZA 2CRYA 3QA3A 2IPUK 4D0CA 3ECBA 3WN5B 1D9KD 15C8L 1D5MB 2DKMA 3CH8A 2FYYB 1ZV5A 4IRSB 4HH8A 4JFQA 5IQ7H 1PYWA 1ES0A 2RR3A 1BQSA 1EBPA 1ORSB 1OARH 3CFKA 4U6VH 4DVBA 2G5RA 3NAAH 4RMWA 2ZKHH 2V7NB 5C08D 2D7QA 1E6JH 3QQ3B 1ND0A 3DO7B 1HZHL 2W0FB 5F89B 2XWBB 2ESVA 5BJTB 5C6TH 1I9JH 4ENED 5JOEA 5DURD 3VFNB 3CC5A 3GSXB 1UG9A 2G75B 3T04D 3QXAB 4KHTH 3F6LA 1F6AB 5D7JD 3FN3A 4LNRA 4ELKA 4Y5XA 1N5YL 2H6PB 2FO4A 3HC4L 3P30H 3FB5A 1PAMA 1R3LB 4KK9D 1INQA 2FSEA 3X3FH 5DMGC 5CKAA 1S7VA 4NFCA 1YMMD 1G7HB 2MSPA 4HV8B 4U1IA 3SDAC 1UJ3A 1JYNA 4ZFZA 1FORL 3BP7A 3U46B 1CICC 3THML 5T1MB 1A3LL 4IMKC 3SPVA 1IE5A 4PJXF 3DHJA 4ESKA 1F4HA 4AEIL 5F9WC 3CH1B 4QY8A 3CPLB 1YNLL 5DD3L 3L95A 3SGDI 3X13B 1OAKH 1XH3A 1JGLL 1WSST 1QO3B 1LO0L 3MO1B 4OT1H 3UBXB 3PWPD 1UGNA 2HVKB 2XPGB 4S11A 4PJIF 3RU8L 3A6BH 1VFAA 3V79C 2J88L 1DTUA 2LABA 3W9DA 1HCFX 2AABL 3DX6B 3CVIL 3PV6B 1A4KA 1JRHI 1Z9LA 3VA6A 1JPGB 3TT3H 4WW1A 3VRIA 2I9LB 5EOCH 3ULVH 1T1YA 5FYJD 2W38A 4CMMB 3IRZA 4F33A 4EI5D 5D7LD 4G6JL 2D4FA 3DURB 3MOAH 4IMLB 1JYVA 1I4FB 4OCNC 5E8NB 3PGFH 4O51B 3ZDYF 2WSKA 3CCHA 1A7PL 2HN7A 4Z7WF 1CFVL 4N0YL 5I6XB 5D1QB 4LCCB 2V7HA 1AIFB 4NFBA 1WEJH 5DLMH 3KJ6L 3ARPA 3KYNA 4NNPL 5EIVA 2O5XH 1V8HA 4Q6IC 5D72L 2EH8H 4EQ3A 3QCVL 5C8JB 1TZGL 4X7SH 1S9VA 3F8UB 2QSQA 3EW3B 5DTFB 4QRUB 1H0DB 1T3FA 3ZMRA 5C0JB 4WW2B 4XAKE 4X5LA 1EO5A 3QEQE 1FAIH 1WC7B 4D94A 4WUUD 5DJYA 4Y16D 3JXAA 4U7KA 4UINL 2E9BA 1TENA 5D7KD 3TM6A 4YWGL 4KROC 1ZT7B 1Q8MA 1KJMA 4XPGH 3VRJB 5FV2A 1JWUA 1CD0A 1C12B 1W0VB 4M00A 1IKNC 5HYIA 5JUEH 3PL6A 1D5IL 1U8HA 1YDPB 2BNQD 4I13B 4P99A 5C2UB 3DBXB 3BRDA 2R1WA 3SDDC 3Q5OA 3MMEA 2ZP0T 2H8PA 3OGOE 1S9YB 4LSDA 3KPQB 5KTEH 4ZAKC 1RHHB 5J9PA 3O81A 5GISL 3MLYH 5HYJA 2A83B 3PIQB 5DYOB 3BE1H 2GAZB 4KRPD 3WJLA 5T1DH 3CFJB 5C0CA 5MENE 1N6QH 1HHKB 1Q9KA 3VFWB 1TFHA 4HT1L 1PG7L 3LMJL 4ZOAA 5DGQA 2F5AH 1U42A 2F53B 3LB6C 3V4UL 3KYMA 5GJTL 2YD2A 1OB1B 4LKXA 1J87A 3ULUH 3HZVB 3BDXA 4NP4L 2E7LA 5E2UL 2YMXH 2GTZA 4JFED 3AU1B 4JLRB 2MCG1 5EFIA 1NGXB 5DC0A 1MRCL 4G5ZH 1D9KB 3VMNA 4I3RH 3RZCC 5BMFH 5KSUB 2YD9A 3KHQA 5KZCD 3BJLA 3RPIA 3L3HB 2Y7QA 1VEPA 1J05A 1F4YH 4U1SA 2HKHL 1WCBA 2DLFL 5C08B 3V4VH 3PWUB 3UYPA 1P7HL 5K9OA 3HPLB 1AO7A 1CDIA 2XRAL 5T1LB 4QCIA 4YR6B 5ACZA 5ITFB 4P0DA 1S9XA 5DRXA 2IC2A 3LKRA 2FB4L 4XNXH 1KIUA 1DCLA 5T3ZE 4FQ2L 5EUKA 5JTWA 4WGWB 4Q9QL 2VLMD 4RMVA 2COQA 4FOMA 5DK2B 4Y8AA 4GLRI 4YGVA 2YA2A 4YDLB 4JO4L 3KNBA 3SDXB 3PP3H 1R3HB 3IDGA 4YQXL 5J12C 1VGKB 3DXAA 4LVHB 3KLDA 1YMMB 1NCBH 5F1OB 4JDTH 1WUNT 2VOTA 4Y7MA 3HLAB 1P2CB 2BMKB 1V3JA 1NMAL 1BFOB 5KG9A 3UPCA 4ONOA 3MCLL 5J6HA 3QFJE 3TBTA 3GNMH 4KK6D 2CH8A 3MUJA 4XMPL 2HMIC 2IBZX 2HAZA 1M7DA 3X11B 1FFOB 4I2XB 4N9OB 4RAVA 4ZS6D 1Z0NA 1I7UA 1ZVHA 1GC1C 3B5GA 5GS2H 1I7ZB 3PWPB 4X6CF 3UTZB 1CDCA 2CPCA 4Y4HC 5I15H 3TIEB 4G42A 5FDWA 3WNNA 2QQKH 2FHBA 4ZDHB 1IC7H 3JVGA 2Y4SA 1JGDA 1JMXA 1LDSA 5ALBH 2D7NA 2DQIH 1IC4H 3CSPA 1YN7B 4GKSB 5D7LB 3QDGB 4MCZB 1J8KA 2Y5TA 1DQDH 1FFRA 2C3HA 3T09A 3F5WA 2Q76B 1QA9A 3D2UB 3IDYB 5I1JL 4HK0A 1UKSA 7CGTA 1A9BB 1N26A 2CRZA 3AS3A 5MEPB 1HYRC 3GRWL 4Z7VE 4U0RB 1BP3B 5DJ2B 5ID1B 3QJFB 5C6PB 3QEQA 4GG6F 2V17L 5KSVA 4YZFF 2Y25A 1AGCA 3IAPA 4C56A 4XNYH 1LO3H 2XZCL 1YA5A 2R2BB 4B0MM 4MMZC 3VGFA 4GUPA 1G6RB 1NKOA 4HH9B 4HS3B 4XC1L 2DBJA 1ZLWK 5F88A 4Y16B 5HHVL 1UM4L 5TF0A 5B38A 5J56B 3IKCB 3IFOA 1K2DB 2NW2B 3OZ9L 4GQ9L 5E94B 4MJ5B 2W92A 4PJAB 1CQYA 1H3GA 3PWVA 2OXGA 4P9HH 2UVEA 1NDGA 1A5FL 2K7QA 4NC1C 3VWJD 2X9WA 4ODVH 4WTXA 2BNQB 1ZWIB 5TF1L 1REIA 3LEXB 3UTQA 3EO1A 3GSOA 1WTLA 4HSQA 3A6CH 4RBPH 5IMMA 4J3TA 3RA7L 2BSSA 4PRPB 1MVUA 1RZJH 3BN3B 3QCTH 1KN4H 3E8UL 5H94A 4PJFF 4KHXL 5FYJU 4HS6B 2Q87A 4J4PD 1FFQA 4X6DE 4QHKI 1MFCL 3FFDA 1EFQA 5K59F 4P2OD 5ANMA 1DN0A 3H9SD 4KVCL 1I1FA 3BYTA 4KH2A 3C2AL 5FO9A 4AEHL 5BZDA 5DJXA 1KN2H 5DD5L 3P73B 5CEYA 4CKVX 4EN3D 4IOIB 4JZNB 3TNMA 2UZXB 3OBAA 4N68A 4NJAH 3GZKA 5MERA 1S5IH 2PTVA 1KCSL 4OLZH 2UV3A 5AZEL 1ZMYA 2VL5B 5DDHB 1OTTD 2YD1A 1FLRL 2XOTA 3RAJL 4M8QA 5EZOH 1N6VA 3IDIA 1CDYA 1J8HE 4QWWC 5KZCB 4K2UH 1EV2E 4YJZL 4PYHA 1HKFA 3HC3L 3VFMB 2FRGP 3VXUD 4G6KL 2E9WA 1QFPA 1CLCA 2LTQB 2SEBB 3K4ZA 3LIZH 4WI3A 1LE9B 5IJKC 2YRZA 4XP4H 4QHLA 4WUKL 3QIBA 4J3WA 1CD9B 1H3PH 1KTLA 1P4IL 1SM3H 4U7SA 3ZYIA 4RIRB 3BGAA 4LPVA 1PY9A 4HPYL 4FFVC 1NBQA 1XCQB 4NO0A 2OZ4H 4P5TD 1G7PA 4RMRA 4JFDE 5CHNB 2PNDA 3QFJA 4KUCF 5GHWH 3MUHL 4HS8H 4K8RD 2EE2A 5FV1L 1XR8B 3UZQA 4PP1D 4OLXH 4JM4H 1DBJH 1EGJA 4PRNA 5ALCH 1W0WB 5GGUA 1YYMH 1CTNA 2R0KL 4Z7NF 5AWNL 5I18L 4O4YL 1CDHA 4HZAA 1AR2A 4OFPA 1D5MA 1NC2D 4G8IB 1GIGH 3MJGX 3ULUE 3M07A 5LXGL 2JCCE 3MGOA 2OBGA 3GMPB 3QUXA 3MRNA 4I0KA 2H32H 1ZHBA 5D1XC 3EZJB 4OSUH 3O2DH 5J6GA 1U9KA 3WHE0 3OKOA 3V6OE 2HFTA 4RSVA 3H9YA 5BCAA 2XWBA 1MPAH 3GFUA 1MNUL 2MFNA 5JQ6H 1ZA3B 3GSXA 4X98A 3MRGB 5GGSY 1MEXH 3DVNB 5KJRL 4HQQL 3P11L 1BVKA 2M1KA 3WO3B 3MV7E 4HX1A 4OIIL 2O5ZL 1HQ4B 4TNWF 4NKDA 4OGXL 2JTDA 3CFIC 1IMHC 1RZ8B 2FJHA 1G7HA 4H8WL 1IL1B 2V2WB 1C8PA 3C8HA 3S36X 3VW3H 1NCDH 5KSBE 1QSFD 2VDKL 1SVZA 5HVFB 4OFDA 2BSRA 4AL8L 3NFNA 1N8ZB 3M17A 1N64L 1DQJB 3HE6D 3ZTJG 3BKCL 4Q0XH 1KNOB 3LHPH 4HUUB 1T7YA 1CF8H 1I7TB 3T1WA 4LASH 1K4DA 1X7QB 4XMKH 2Y23A 4GSDL 1CN4A 1Q0YH 3P9LA 4M3KB 4JPVH 5FYKL 2XPGA 4LBEA 4EXKA 1VENA 1MHEB 1AD9A 3LD8B 3PE9A 3BGMB 3NCYP 1W72B 3I2CH 4KPHL 1MFDH 3VXOB 4POZD 1R5WB 4AQ1B 4LP5A 4N8VB 2Y6SC 4Y5XC 2VL4A 1FVCB 1JPGA 3VWJB 2O61B 4X6DA 4DN4H 1Y18A 3VG9C 3RBGA 4I0PB 1MREH 3DURA 2Y07H 5I0DA 2P48B 2W9DH 3S35L 1C5CL 5F7EL 1XGRB 4MJ6A 1U92B 5CAYB 2R2EA 4EKXA 1NFIA 2P5ED 2DQTH 35C8H 5DJZB 5D1QA 1AIFA 1ADQA 4ALAL 1GCFA 5EZJA 3GUTB 3KPSB 1CGSL 32C2B 5CSZB 4JO1H 5C8JA 4TSAL 5EU7E 4PB0L 2K9UA 4O02H 1KB9J 1F00I 3MRBA 1VFMA 5DS8B 1UCBL 3N9GH 4CN4A 1J8HA 3MRKB 3S6CA 2P45B 2FLRT 5LCVH 1EJOL 2CK2A 1GVIA 3LRHA 4HUKB 1MCLA 3EZ8A 4NZTL 1KULA 2X4UB 3SE3A 3WIHA 2BFVH 3IJHB 2VH5H 1OAYL 3JWDC 3VH8G 2ZOKA 4HGWA 3QWOA 2DQGL 4WI7A 5C2BH 5JLZB 3TH2T 1M71B 5DJ6A 3OKEB 2NW3A 2Q86A 2BXZA 1RUML 1FQ9C 4RGMB 1CFBA 3VXUB 4WU7B 3DSFL 5D1ZC 5FECA 3TYGL 3D0LA 1NEZG 1YEDA 2G2RA 5E8EA 1N5AA 5BS0E 4BH8A 2P49B 2W65B 1DEDA 2YOCA 2WUBH 1JFQH 1EK3A 3QJHA 2F58H 3G6JF 1G7QA 3O6LL 1KLGB 3IDXH 5IHUH 3MA9H 2H3NB 1PG7W 4RNRA 4TYUA 4K55A 3QUMH 2ADGA 1EGJL 2R8SL 3FCTA 4KC3B 2XN9D 2VC2L 4L4VA 4YK4B 3IJSB 2A6KA 2A1WL 2GCYB 4IHOA 4GG8A 1FFNB 5CD3B 2BVUA 3ZKNC 1HKLH 1I75A 1RVFH 2J8OA 3BT2L 4LKCB 5F7DA 3WFCH 3WXWH 4D0BB 2R0WH 5HY9A 1F6LL 5AD0B 4K7PH 5L8LB 1QVOA 3QI9C 3WO4B 3AU1A 1IAII 1OCWL 3VXQB 3V6OA 2IH1B 1OARL 2CDGA 1N0XH 1NC2B 2BY1A 3NAAL 4HIJB 5DHYB 2ZKHL 2HP4A 4FS0A 1RQ5A 5CEXB 2WP3T 3JWNC 1RIUL 2HFFA 3MODH 5E2WH 3X14B 3IDMA 1MLBB 3NCJH 1QUNA 2Q3AA 3VWKD 4WCYL 5DJ0B 1JI1A 3V9FA 4MXVE 5HD8C 3MV7A 3O9WD 5EWIH 5GGQH 3D25A 4KHTL 2VXQH 2QHRH 1MFNA 3NACH 4GRLC 4NUGH 5C3LD 5I1HL 4BK4A 1U3YA 2J3SA 1SJEA 2XT1B 4PBWD 5F96H 3FO9B 3FOLB 1P7KA 3SO3C 5J7CC 3FB8B 5KSBA 4OZ4B 1P6AB 1UB6B 4FTVE 1E4XL 3D69A 2OTUB 1OW0A 1R3HA 1NMCC 3ARTA 4JREB 5E00A 1A1NA 1GZPB 2LQRA 4LLAA 4F15C 4DN3H 4N0UB 4FFWC 2R9HD 3KPNA 2ZUWA 4JVWA 1SVCP 3VXRA 5HHMD 1QSFB 1C08B 5I8KL 1X5AA 4E5XB 5ITBH 3K81A 1ZHNB 4WU5A 3TWCL 4LL9A 1JL8A 4LSSL 3QWRD 3PDOA 3VXTB 3ARBD 4NRYA 1X6LA 4XPFL 4G7YH 2WANA 3VI3F 4X80H 5AZ2H 5EOCL 5HDLA 3ULVL 4NN6B 4U1GC 3IFPA 5D9SB 4L9LA 4OZIA 2YWYA 2Q20A 4LARL 3LEYL 4JEGB 1VKXB 3AXLA 1PEZA 2P24B 3MOAL 4H88L 1BOGB 1INEH 3PGFL 2B7DT 1FP5A 5HYQB 5CD5D 4X8JB 4G9FB 2BOCA 1ADQL 1DR9A 3B8YA 3T4YB 2PW2A 2GSGB 1PD6A 2EEBA 3VXSD 2VDOH 4LF3B 5MEPA 1QP1A 4EDWH 2CDEB 2P5EB 5DJ2A 2C3VB 1A7QH 4FQIL 4X7SL 3FQXB 4OCWH 4O58H 3NCFB 4TUJA 1T6VN 2KQNA 5ESVB 4P4KC 3MTRA 4ZUTB 4U1KA 1A4JA 3EYOA 3FB7B 1U3HD 3CSYB 1KEML 2VB5A 2XZQH 2NXYD 2EDJA 3R0MA 1HH9A 3VXNA 4K7FB 1TZHA 3WIHL 4Z95H 5I76B 4X9HA 4XVTH 5JIKA 2DJ4A 1LEGB 3RVWC 4XPGL 1AQDA 2P8LB 5CILH 4WEUD 2EDFA 4JM2A 3V0VA 4UDUA 5E94A 3GKZA 5IBTL 2F19L 4XMLH 5JUEL 5BZWA 2VERN 4HIEA 1X5JA 4WI5A 4FABH 5DD0H 4QHUB 3HFMH 2YD5A 4XNQB 5CJBA 1A7NH 4BFIB 3MBXH 5KAQG 4KKNA 5I1LA 1CIDA 3MLYL 3QG6A 2H41A 1E4KC 4PRIA 2AGJL 2VQ1B 4UUJB 4PJEF 1N6QL 1YEJL 2DM3A 2VLJD 5FO7B 1MQKH 4G8FB 2X4OB 3MX0A 2XZAH 1DE4A 4JKLA 4AYFA 2Z8SA 2F5AL 4NNYA 5D2NB 1JCKA 4XBGA 5JOFB 2NY3D 5CMAB 2VITA 2XN9B 3ULUL 2KBGA 1J1PL 3UTPE 1YQVL 3B5HA 5C0ND 3VGEA 2YMXL 2XY1A 4OZGE 5DZLA 3PHOB 3I85A 2VIRA 5HGHB 5EA0L 4G5ZL 4L4JA 4ELME 4QOKD 3GSUA 5SWSD 5BMFL 2VXSH 4WFGE 1BZ7B 2X4SA 4LVNB 3O6FC 3V6ZA 1OL0A 2A6IA 3S4SG 3W11C 4NKOB 4EDXA 2M8XA 5EG6C 5I1AB 4JPKH 1TTUA 3VWKB 1TDQA 1JZ7A 2C3GA 7FABH 1LE9A 5F8QC 3SY0B 4WHDA 4N0FA 3LQAC 1NAMH 2BXYA 4L8DA 4C55A 2YKLL 2IMMA 3TN0A 1T2XA 1NQBA 4KDVA 4MQTB 4ACPA 4KZEH 1B4RA 4G80A 4E42A 5KVEH 3Q6FA 5T3XD 5JR1H 2YUWA 2OZ4A 2ERJC 1MCPH 1NCBL 2Z92B 5LGHH 1NGQL 1TVBA 1HINL 4JDTL 2O5YH 3OHXB 3IDUA 3T4AA 1BJ1H 2KZWA 3QUYD 4UBDD 3GNML 4MJID 2HFGL 3FHQA 1CXEA 4Y5YB 4JFOA 5IVXB 4HKBB 5HHMB 1D5XB 2Z8RA 4Y1AD 2NXZC 2WV3A 3V0WL 4R4ND 5ICZB 4ZUVB 1CGVA 2IFFL 3OR7B 4ETYA 3U4AA 5I15L 1BFSA 5FM8A 1V3KA 3OTTA 4O2EA 4RMSA 1HIMH 2QQKL 5CFHA 1IC7L 1ZEAH 1PDKA 5EO0A 5FM5M 3F7PC 4UV4L 5ALBL 4IBLT 2A77L 5HHQA 2H32A 2DQIL 4KK5C 3GMLA 5DEZA 4QTIH 3O2DA 2IAMD 2YSSA 2J8UE 2F54E 5HJ3B 4IRJC 3P0VL 2Y72A 1TCMA 2AK1H 3IVKA 5I8EB 3MGAA 4MDJA 2BVOB 2R23B 1AR1D 1JV5A 5DXWA 3OKKA 1QG3A 4W70A 1ZLUH 5CCKH 4XNYL 1LO3L 4PJ9D 2BRQA 2FZ3A 2YN3A 4BKLA 4UILH 3FMGH 1U3HB 4KAQL 1G6RL 4WVRA 4NO2A 3NFSL 4Y2OA 3QNXB 4NQCD 2BRRH 2NXYB 5FF6A 4MSWA 5F97E 1JWSA 3MCKB 3TO4C 1R5IA 1FJ1B 1JZ5A 2JJSC 3V7AG 4LSUL 3KJ4C 3ZL4L 2VR4A 5FDYA 3I9GL 5E6IA 2E27L 1E0OB 4MZ3A 3W9EA 1I7TA 1Q9WA 4J8RB 4C83B 1BBDH 4XNUH 4P9HL 4XI5C 1SHMA 4FQQA 1X4XA 1LO5B 4RMTA 3X12A 3QEUB 2QR0A 3BGMA 1IVLA 3HZYB 1B6UA 5MEQB 3GMNB 4LCUA 4D2NA 2YD4A 1URLA 2AJYL 5HHPB 4XVJL 1MJ8H 2DYPA 2RQ8A 2R1XB 1VDGA 2NCMA 3RL1B 3UCRA 3QCTL 1AD0B 1NFDE 4QRSB 3JTTA 4JQXA 3WFDH 5BRZA 3VRLE 1EFXA 1KTDB 4PR5A 4X99A 5GIRB 1XGRA 2VLKB 2VLJB 4PRBB 2Q6WB 2G5BA 5E5UB 5EBLA 2EDKA 1FYTD 2AJVH 3DHMA 5K33A 2MMXA 4HWEL 1OWWA 3QHFL 4WNQB 4PS4H 3KPSA 4ELMA 4HJGA 3NPSC 2NY3B 5JHDB 3NGBC 4Z76A 1HN1A 3ZYOA 1S5IL 4OLZL 1ED3B 3U82B 3EFDL 2YA1A 1TJHH 3OXSB 1MRDL 4IOFC 1CT8A 1FDLH 2KH2B 2HT3C 4IDJL 5EZOL 5ESQA 4OZHE 2VO5A 4QOKB 5SWSB 1ZS8A 3CK0H 4K2UL 2X1XR 5B8CA 3C5ZC 4IEFB 4Z7VF 1EAPA 2VAAA 2F8OA 3AS1A 1FO0B 2WWMD 3T0AA 1Q9LB 4M43L 5F7UA 5D7IB 4J3UA 1RK1A 3L5JA 5KANG 2P44B 1IEBB 3GHEL 4KKBD 5EUOE 3BUTA 1RK0A 2ZCHH 5LGJA 3LOWA 3TJEL 1H15A 3AREA 1DANU 1VEOA 2OZ4L 2QTEA 3KPLA 2D03H 1QYGL 2GJ6E 2C3WA 1KLGA 1HHJA 2BVPA 5GHWL 4HS8L 4HZLB 3B2UC 3RRQA 3U7YH 1QLRB 2YPVL 4FFYH 5GS1B 4JR9L 3QUMA 4OLXL 2WAHA 1DBJL 2MPAH 4JM4L 4R26H 1WFUA 2B4CH 3UJJH 2GCYA 2BVQB 2X7LB 3W0WE 4NHUB 3QUYB 4LOUC 3ARFC 5CD3A 4M93C 3MROB 3EYQC 5BV7H 4MJIB 1HDMB 1QRND 1A6TA 5ESAB 3PWNB 5DQJA 1MFAH 4OD3H 2A38A 4B5EA 2ZUQC 4Y1AB 1QLFB 5F8RC 1GIGL 5MP6L 5E1HB 5EC2B 1U8PA 2WK2A 4XAWL 4X0KA 5C0BE 5DHYA 1DBKL 3MRPA 4X6DF 4F7MA 4OSUL 1L4IA 1ONQB 4U49A 1FSKB 4H25A 5FYLL 4WFED 5DO2D 3B6SB 1MLBA 2GTWB 2VISA 2H1PL 4WHTB 1GPOL 5JQ6L 3WS3B 5KSAC 5IHZB 1PX4A 2WWKO 1ZOXA 4Q97A 4I8DA 2CGRH 1QTYT 4G8GE 3SE9H 5I75B 1V05A 1CL7L 3IAGC 3VH8B 5LAXB 4M7KL 2YC1A 1DLFH 4QXGH 4S0SD 1UXSA 1YMHA 5JXAL 1G7IB 3HI5H 4YXKH 3KYOB 5SX5H 3VGHA 2AEIT 4G6AC 1NCDL 2D3VA 4PJ9B 5IMKA 3VXME 1CI5A 4DUVA 5IMOA 3RNKB 3V6OC 5GRXG 1S7SA 2RB8A 5EO9B 2ZSVA 4RFEA 3V6BR 1II4E 4JN1H 2V9TA 4DWHA 1YEHL 4NQCB 5F7MC 4DKDC 3L5IA 4EUPB 3LHPL 3LRSA 4URTB 1AP2A 4U3XA 4LASL 4KKAD 3RGVC 3MQIA 3PWLB 2FEDD 1CFSA 2ITCB 3HN3A 1I1AB 3LCYA 2EEAA 3BKYH 4ERSL 4WJ5A 3RVXC 4GAYB 2X4NB 5FM5O 5GJSH 2F74B 3FZUD 4DUXA 4OGZA 5F1IA 4K3HA 1P69B 4ODXB 2RCSL 1YUHA 2Y07L 4K3EH 3OKNB 1OSZB 1QEWA 2HFEB 1J11A 1OW0C 4X8JA 1XIWA 2CIKA 3VCLB 1IKFH 1RHFA 3MRRA 5E7BA 3VFTA 5E24E 3L3DA 1FYTB 2CDEA 1IGYB 2JELH 3QNYA 2JCCF 4O2CA 2AEWA 1WWCA 3UTSD 4OZHA 3V5HB 1YEGH 3J7HA 4ZUTA 3RKPA 5ID0B 1MCSA 4GMTH 1XGPB 2ZOLB 3DV4A 4FQXA 3WDHA 3BP6A 1VFUA 3NN8B 4OI9A 5CP7B 2CO6B 1RURH 5F70A 4LRNL 2BFVL 4DKEL 1L0QA 2EYSB 3GSWA 1CL7I 2VZTA 4QO1A 1LEGA 1BEYL 1H3XA 1U8QB 4RGOL 3C9NA 4KKLD 4NOFA 5C2BL 4HKJA 2VABB 1IZKA 5EUOA 1UWGH 4FG6D 5DRNA 4L8CB 3L3OA 3ZKXC 1A6AA 4UIKH 3T2OA 2GJ6A 3UTOA 1SEQH 1CG9A 3MRQA 3HG1E 4R0LA 5EU7C 1HXYB 4J1UB 3ROOB 1V7ML 4AH2B 2YA0A 2B1HH 3TCLB 2IGFH 1JFQL 1FGVH 2X4QA 5F6HJ 3HR5A 2DTMH 3IDXL 4AM0B 2YZ8A 5IHUL 3SE4C 1DEEB 3ARWA 2VQ1A 3HS0B 4BH7B 4EJ1C 1BQLH 2AJSH 2NLJA 4KJQD 3VFSA 3QUML 4OV5A 1NANH 1UXWB 3QNZA 2E6QA 3GI9H 4LLDB 5FHBH 5ETUA 1Z3GH 2HJFB 1WZLA 4PLNC 1TNMA 5D2LE 3T2PA 1CDBA 4PV8A 4NOBA 2ORBH 4F8QA 1RVFL 4Y19D 3WFCL 3Q3GB 2R0WL 5IHBA 4KI5E 2J12B 4K7PL 2NYYC 3MNWB 1TVHB 5C0BA 1K3IA 2JJTC 1JNJA 4MNHA 1QRNB 4E9LA 1FGNH 1ZSDB 4G3YL 3AGVA 4JG1H 1B3JA 1N0XL 2J4WH 1LDPH 5SWZD 3KXFE 4NQUA 1G9MC 3RBSA 4BZ2H 4MAUH 3SKMB 3CXDH 4GRWB 5TDNA 2OP4H 5I17A 2KL6A 4Z5RB 2XQYG 1U3JA 3MRDB 3WJJA 4PLOB 5F7HA 4LLYB 1RUKL 3LZFH 5J11C 3MUGB 4YHOH 2ZCLL 2VXQL 2XTJB 1JUFA 2X10A 4LAQH 2QHRL 3NACL 4NUGL 3BGFC 2OL3H 1RZJC 2NZIA 4LQ1A 4JFFE 3SDYH 1AFVH 5IESH 5TFSL 3NTCL 3T2NH 2PF6A 3SKOA 2Q8BL 3CMGA 3W11D 4OFIA 4CNIA 1NAMA 3VXMA 2K1MA 3MRIB 1U36A 3TVMD 1WWAX 3C6LD 2J6EH 1YY8B 1OVZA 2ADFH 5L2JA 3O6MH 3TEUA 3MNZA 1SJXA 4XTRC 4TVPD 1QZ1A 4HDIB 5ITBL 5K9QG 1LNUB 2BDNH 2HA1A 1ZTXH 5IB4A 1OSPH 5FK9A 2JIXA 3FQTB 4H20H 3B2VH 4YPGB 1PKQB 3MV9D 4H0HB 4G7YL 4U1NB 2DIAA 3ILQC 3QXUA 4NZJA 1RZIA 2B2XH 3TO2B 1QNZH 3EJZD 4MVBD 3ARGA 1U8JB 2FIKA 3JWOH 2I5YL 2QADC 1ZGLA 4BA8A 5KVFH 2Y36H 3TN0C 4LIQE 2ADIA 2WUCH 2W59A 3FT2A 1O7SA 4P46D 3CSBA 4CW1A 2JK5A 2NY6D 3BP4B 4RWYH 4AY0A 1BX2A 3WDIA 5J1AA 1L0YA 5T5NF 1T4KA 2XQBL 4ZS7L 1FN4B 1B0WA 2MNUA 3MYJA 3RVUC 1ZANH 4HJ0D 3AY4C 4R4BA 1A7QL 2YD8A 4OCWL 3QXWA 4O58L 3IU4H 3GHBH 5B4MD 3QQ9D 4Y4KC 1JZ2A 1HEZB 4M6ML 1JZ4A 3OB0H 3UTSB 1AE6H 2XY2A 4APQD 3R06A 4TTDC 5CIPH 4Z95L 5INDB 1I8MB 5HI3C 1S7RA 4BQ8A 3B5TA 3HAEG 4MXVF 3HMWL 2OJEA 5DRZB 2VR9A 5IMLA 1K8DA 5F3HB 4R3SB 2JJVA 5CILL 2JJWA 3T8XA 4Y5VC 5B39G 4P23C 4U7MA 1S9WA 3P0YH 2E3VA 1L7IH 2DQEL 5ISZA 4LSVH 5EORH 1EXUA 4FABL 5KVMC 3MJ8B 4OGAD 3RL2B 3HFML 1FNEB 4HWZA 3QEUA 1KXVC 4YHNA 1UQSB 3VA2C 1D5ZA 2DQCL 4Y4FA 4LHUG 1BBJB 2JB6A 1N6UA 1CLOH 1GZQA 2ATKB 4KUZH 1FPTH 3TA3A 3EJYC 3FQRA 2PR4H 3GKWH 5DHXB 5D2LA 1AD0A 1MQKL 1V5JA 3S96A 1RIVH 2WBJA 2XZAL 1NAKL 3K1KC 3UC0H 4YHKH 2VDMH 1HE7A 3WKML 4LSQL 4Z77A 1DVFB 1FC2D 2FATL 4EI6A 5FFLA 3QUKA 5C07D 1F11B 3PNWB 4HCRH 3U0PB 4PJBB 3LKQB 3IF1A 4Y19B 3KXFA 4LPTA 3ZSSA 3RVTC 1BZ9A 5E2TH 5EU3B 5E6IC 3ZT7A 4DEPC 3U2SA 3GJEA 1VFBB 3UTTD 2VXSL 2WINA 3OXSA 4ZUWB 5ACLA 2DQFA 3SJVB 4KK8C 2DDQH 1M05B 2NX5D 1HSAB 4DCQB 1BVLA 1KPRA 5F7FA 5SWZB 5F1NB 1INDH 1WBZA 1T0NA 1UKTA 4HAFA 4RFOL 3ZYJA 2CK0L 1T5XA 2H26B 7FABL 2GQHA 1WFOA 3GSQA 4KFZC 3G08A 3GBLA 2B39A 2QKIA 3C6SA 2UZYB 2YEZB 4QRQA 4JB9H 1NAML 1N7MH 1X5KA 2BSTA 3WFEH 1DQLH 1VGEH 3QQNA 3EYVB 4HIIA 1MHHA 1AHWB 2F53E 1UWEL 3BIKA 1FG9C 3RWHA 4P59H 5AUMB 5GGRB 1HI6A 5KVEL 4Z7UA 5JR1L 4NRZB 1T1XA 5LGHL 4HC1H 1LEKB 1I3VA 2NY2D 3QIWD 1B0GA 3SDCA 1FZMA 4OAWA 3E6FA 3STLB 4HG4K 4PJDB 1XZ0A 4QHMA 3VGAC 4CJ1A 3T77B 3LPGA 1ITBB 2BVQA 2A9NH 2EKSA 2HJKA 3L7FA 1FNSH 4UTAH 3TBYB 2ITDB 1D6VH 1PJ9A 2VLRA 4XWGL 5BO1H 4NQXA 4U2ZA 4M1CD 4GAGL 5ESAA 3UXFA 3W2DL 4YBQD 2DMCA 4MQSB 3SGKA 2Q7YB 4PRAB 1KOAA 5EOTA 2PXYA 2XNAB 1HIML 3MV9B 4XHQA 3PDGA 4HLZH 1IM3B 1QSVA 2JKXA 1ZHLA 1X44A 3K46A 5JXEA 1ONQA 4PGCB 1IQWH 3GSRB 3HNVL 3AREC 1A02N 4JRXA 4QTIL 4NQED 3OKLA 1AGEA 3L5WB 3MV8D 1MAMH 5ADOH 3LH2L 5LKNA 4P46B 4PTUA 1TETH 2ADJA 5J57B 4D8PB 2NY6B 4OZGF 4OLWH 4Z78B 2OK0H 3K80A 4PJ5B 1CWVA 4HXAL 5F9JB 3LEVH 3O3DB 1JK8B 1ZKAA 4MD4B 4ELMF 3OPZH 4JFPA 4QT5B 4LHQB 4R90H 3BH9B 3VH8A 5F7KC 2V5MA 3ALPA 2A6DB 4V2BA 3DUSB 2DQUH 4PJGB 1EEYA 3DI2B 5B22A 3RDTC 5E9DD 4UB0H 3FMGL 5FUCC 5F21B 1NEZA 1UKQA 3QULB 4S1SH 3HI6H 4XBEL 3AMKA 2NZ9D 4APQB 2Q3ZA 3WUWB 2FDBP 2L7UA 3WMSA 3RUGB 3VFGH 5I74C 4WO4D 4P5KB 3O2WH 1P1ZB 3AB0B 3E2HC 1NEUA 4BQCA 3S5LB 1T1ZA 3A6OA 3IFLL 5E4EB 1BBDL 4J3OC 3ULSB 2A73A 1UYWH 1KIPB 4C59B 3GMQA 3OAZK 1T0MB 1N59B 5L8KB 1HQRA 1WWWX 4IIQB 2FX9L 2F74A 4LFHG 1DBBL 1T0PB 3GSVB 4DTGH 1IAOB 3WFDL 3WE6A 1PSKL 2DLIA 2OI9B 2YPLB 2HTKD 2IPTH 2HFEA 3OF6D 1R5VA 3S34L 1MH5B 4JQIH 3KR3H 3HTLX 2AJVL 3MBEC 4Z0XB 2F8VA 3VCLA 4Q9RH 5FA4A 2JJUA 2PO6A 2WQRA 4PS4L 4A6YH 4KQ4H 4NO5A 1GOGA 3CX5K 3GIVB 4M4PA 4WUUE 4UDTA 5L2KA 3ZDZE 4Z0BH 5DJCB 5C07B 4X6BA 4M62L 1ULVA 3Q1SH 1KEGH 5D7KE 4N1EA 3MUY1 1TJHL 1JF6A 1OAQL 1WCQA 3LAFA 4PJAE 4N5UA 4RDQF 5CINH 2OCFD 5IW6A 3BMVA 2J8UF 3UTTB 4L3EE 1D3CA 2WLZA 3GGWB 2IAND 4U6YA 2BNQE 1NBVL 4OLYL 4MAYD 1BF8A 3DMMA 1U8QA 3BDBA 4K8RH 1AY1H 3RIAF 3BPNB 4PRDA 1F42A 2DL2A 3QH3A 3PG2A 1IGJB 3TIDA 3CSGA 2HT4C 4L8SC 3QUZC 1MJJB 1EERB 3QG7H 1NBYA 3MLRH 3ZTNH 5EU6D 2CKBH 1EO7A 5E5MA 1KUMA 1VADA 5I1KL 1IARB 1CD8A 3ALWA 3Q6GH 4OD2B 1RZFL 2D03L 2FX7L 1ZVYA 3CFDA 4NQDD 1E4WH 5E8OB 4FQLH 1RZKH 2AXFB 2MQ0A 2QQQA 3C60D 3WLWC 5GSVB 3U7YL 1PLGH 2PCPA 5JIIA 3RVVC 4KTEL 1VACB 1HHHB 2MPAL 4JFEE 1DUYB 2NY2B 2X1WL 1QOKA 2B4CL 3UJJL 2HJFA 3O11B 4GBXC 5AAWA 2XQYK 1Q38A 1RJZB 3R1GL 1KB5H 2R15A 3IYLW 4UV7H 5BV7L 4BSJA 2H2PD 4PJXB 5E6YA 3IRPX 3WKNA 4CRPA 2DJUA 1JNHB 4P2RA 4G9DA 1UVQB 5D7JA 3TNNA 1NFDF 3B3IB 5DHVH 4PJIB 4HEPG 3RY6A 5HGBB 1C5DA 2D31A 5GRVL 1F02I 1YJDL 2OR9H 3V0AC 5CJXA 2X9YA 1FE8H 1RUPH 5DFVD 4NQVB 4OCMC 3BJ91 4Z9KB 3OAUH 2VLME 3T2QA 4CU8A 1BPVA 3KGRA 2IALB 1F2QA 2CGRL 4OF5A 2HG5B 3BQUD 4JANB 5JORB 1OAXH 2MKLC 4W6YB 2OL3A 1I85C 4XHJC 1A14L 5I1DA 1LEIA 4HHAB 1DLFL 3H2WA 4OZHF 4QXGL 2R4RH 4Y2DD 3PGCA 4YXKL 1A6VL 4MDIA 1E4JA 5EBMA 3RJQB 4F37K 3MJ6A 2ICWA 3D87B 5E9DB 4U1HB 4JN1L 1LK2B 5DJ8B 3DRQB 4FQ1H 3B9KA 4EI5A 2APTA 1G1YA 3MRMB 5F9WB 2A6JB 4JVPA 3U9PH 5EUOF 2A0LD 4KGLA 5C3TA 3X17A 5GS0D 4ODUB 4L3CA 2P7TA 3O2VH 1YEEH 5JMOC 4QEGA 4RMUA 3O8XA 1FL3A 2DM4A 1K5NA 5CEZH 1U8IA 5IVNA 3H9HB 3UO1L 1R0AL 3G5ZA 4NUJB 3BKYL 4ZXBD 1AI1H 1B2WH 1KENL 5GJSL 2EYRB 1AJ7H 5TE4L 4LPYA 4RGNC 2AJXH 4X6FA 5B3JE 4K3EL 3L9RA 5GPRA 4HUXA 4JDZB 2IADA 4X4YB 1KC5H 2JB5L 3IDJA 4O9HL 2E7MA 1WIOA 2IQAB 4MA1C 4ZSOA 1YQ2A 4WUUA 1DBMH 1Q1JL 1A1OB 4J3VA 3CNKA 5IBLC 5BVJB 4XC3H 4HK3J 1IKFL 1F4XH 3S4SA 1GH7A 3FO1B 2PYED 1EHXA 4Q6IB 1T20A 2IBBA 4PJ8A 5TQ2H 2KDGA 2JELL 3MREB 3PQYA 2MHAB 3PV7A 5HGAB 2KPNA 5HYSB 1YEGL 1MAJA 4L3EA 3C8KA 1CVSC 2BNRD 1W0YT 2FD6H 4H5SB 3C09B 1UEYA 1H8NA 3F12A 3ES6A 3HPJB 3INUH 3DGCR 1JHTA 1GAFH 4YHIB 1RURL 5CIPA 5FHAL 4OCYH 5KOVC 5JHLL 3GJFA 3MRCB 1JN6B 2AAVA 4KROB 3IU3B 4G6ML 5AEAA 1SMOA 3EYUH 3FO2B 3DOSA 4GXVH 5F3HA 1UH4A 5I16B 1UWGL 3MRJB 4MAYB 3CIQA 3UAJD 2AJ3A 2FR4B 4U31A 3UDWA 4PREA 3BEWB 2UWEB 3FRUA 4CN6A 3CFBB 4IRZH 3RZWA 1HSBB 4JY4A 5BXFB 2DWEB 1R3KB 1PG7X 3ET9F 5SV3A 1TQBC 3MOBL 43CAB 3BZFA 2GK0A 4P2QB 4DZBB 4PGEB 1F58H 5EU6B 2ZUTA 3EFFA 5C0IB 4YDJB 4HD9A 1UM6H 3WS6C 3MNVB 1I8KB 3H9SE 4WI4A 4JFEA 3KPRA 1JTTA 3D0VA 3S36H 2AJSL 1CGUA 3IS1X 4NQDB 5ICYA 2FWOA 4FNLL 1M6OA 1QD0A 4D0DA 5C9JA 5FHBL 5CLTA 2BERA 4HFWA 1DVFA 1IC5H 2VTFA 5H37H 4A2MA 2ORBL 3FQNB 4PJCB 1CD1A 2VDNH 4JHWL 3TZVA 4HBCH 3GB7B 2Z91B 4F7TA 1RUAH 4PJBA 4HCRA 1B0RA 1U8LA 3EUUA 1DLHA 4CVZB 3SCMC 3RHWF 3HRZA 1NDMA 4RFNC 3C5SB 2Y9RT 1F4AA 1VFBA 4JG1L 3GM0A 4TULL 3GI8H 2J4WL 1OTSD 3G6AA 3SJVA 3QXTA 4BZ2L 4X6CB 1EA9C 4GW5A 4QXUH 3CXDL 2OP4L 4FMKA 1I1RA 3D85B 1S78D 5FOBB 4LRIA 4Y4FC 4GXUN 2BC4B 4X4XA 5EU4B 3C87A 3LZFL 3S3JA 4GAJH 2OL3L 2VQTA 3MYZA 2H26A 3SDYL 3MZTA 1AFVL 3G04B 4RAUA 5IESL 4XPTH 4QRRD 5DD1H 2D7TH 2EC9T 3N1FC 3DUUA 2ATPB 4U4BA 2RFXA 5B39B 4K3JL 1K6QL 4I18A 3O6KH 5CUSH 1YNTA 3IS0X 3WUZA 3N85H 1AKJA 4Y2DB 2ADFL 4OUUB 4QKXB 3O6ML 4E41D 4HC1A 1KJVA 3D9AL 4LFHD 3NZ8B 2P8MB 1AXSA 4LHUB 4ZUSA 4QRPD 5DWUH 3STLA 4PP2A 5A3ID 4GS7B 1OSPL 4I48B 4NRXA 5C09E 3RX7A 1HHGA 4GKNB 5GZOD 3FFCB 1QSED 5FGCE 2GJZB 3HCVA 4LNVA 3L3IA 4UU9A 4ZOBA 2CD0A 1NANI 1XGYL 1YYLH 4MD0B 4Y4HB 1IM9A 4V1DD 3P40A 3VJ6A 4LCWD 1QNZL 2ICEB 4ZXBB 1FNGB 2EDDA 4MQXC 3TC9A 5KVFL 1JPST 3L5XH 3T0ED 1FFPA 3WN5C 2FEEI 4IJ3B 5D2LF 5B38G 4IRSC 3EOTH 4RWYL 2NR6D 5IB1B 3HE7C 1LO4H 1J1XH 3SGJA 2YPKA 4PJFB 2CDFB 1C1EH 4X4ME 3F7VA 3HZKA 4PJ5A 2ARJA 1IT9L 2DQHH 3TV3H 1TCRA 4QT5A 3GHBL 4TOYL 1AXTL 3AC0A 4OJFH 1XF2A 3ZDYE 3QISA 1HYSC 4XGZB 4TNWK 4FXKA 3N06B 3MLTB 2BNRB 5F1KC 3QULA 4JAMB 2D0GA 4N5ED 2HRLA 3LN9A 5I8CB 3DRTA 2G9HA 5L0QB 2ESVD 3A67L 1MCIA 2LFGA 1N3NA 3O4LA 4XH2B 3RWFA 4JO2H 4EOWL 1C16A 2ICWI 4PRHB 4UOW0 5EORL 4P2OA 4NYLB 3H9SA 1OT2A 1QR4A 1MF2H 3L6FA 5GZND 1ZVSA 4G7VH 4MA8L 4QGTA 3CMOH 4X7DC 3U6RA 2OSLA 5IR1B 5TGBA 1I7RA 1PZ5B 2Z31C 4DOHE 1B90A 1IC1A 4KUZL 2HT2D 3EGSB 1FPTL 5EU5B 2P5EE 3ZT6A 3GKWL 3M45A 1S3KH 5CEZE 3GSVA 1P9MA 2R0ZH 3MRFA 3I75B 3MV11 1NSNL 2OR7A 4J23A 1MIMH 1F4WH 3IGAB 3UC0L 2VDML 2ZJSH 1MH5A 3W39B 3QIUA 3RNQB 3VFUA 1JGEB 5ERWB 4YC2B 2IPKB 2WIMA 4Z0XA 5HI5D 3VFOB 2OLDA 4OM1L 3X3GL 3G9VA 4HCRL 2UYLB 3OR6