4RQQB

Crystal structure of human fab pgdm1400, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
239
Chain Sequence
b'QLVQSGPEVRKPGTSVKVSCKAPGNTLKTYDLHWVRSVPGQGLQWMGWISHEGDKKVIVERFKAKVTIDWDRSTNTAYLQLSGLTSGDTAVYYCAKGSKHRLRDYALDDDGALNWAVDVDYLSNLEFWGQGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human anti-HIV-1 antibody PGDM1400 light chain
molecule tags Immune system
source organism Homo sapiens
publication title Recombinant HIV envelope trimer selects for quaternary-dependent antibodies targeting the trimer apex.
pubmed doi rcsb
total genus 41
structure length 239
sequence length 240
chains with identical sequence D, H
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rqqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rqqB01
3OKLA 4Y19D 3BGAA 5HHPB 2AXHA 2E7LC 3EYSH 1CGWA 2Z31A 4HCRL 4NCC1 1OM3H 2F5BL 2GKIA 5DSCB 1PY9A 1WFNA 2QKIA 4Y5YA 5HHME 1CXFA 3L3IB 3O4LA 4H1LB 4ZD3L 2VC2H 4U1KB 3MRJB 5FOBB 5F9OL 3G6JF 1FDLL 1G7JA 2IAMC 5MEQB 5DGRA 1A6PA 5F7LB 5D1ZD 1FFNA 5DJ8A 3MNWA 5B3NA 4YHIA 4WEMB 1GGCL 3DWTA 3PP3H 4O58L 4M1GL 3U7YH 3VGFA 4U6VH 3PQYB 4LSSL 5LCVH 1CFQB 1LE5B 1KB5H 3QFJB 5I75C 1YNKH 4GW5B 1DQLL 1MUJA 3C08H 4DTGH 1IGCL 3BD4A 4GJTB 3H9SE 5EPMB 3RL2A 5H8DA 5KSAB 1XF3B 4FQ2H 3T0EB 3OAUH 3IS0X 1EX0A 5J1TC 4NUJB 2WIIB 3GDBA 5DO2D 5FB8B 1F45A 4IEFB 4X6CF 4QHNB 5JHDB 4DUVA 2ZCHL 2BY3A 4DKFL 3C60B 3L6FA 2VITA 4FQXC 1RU9L 3VFOB 2R69L 3MRLA 5I18L 4WY7L 5K59F 1CFSB 2BSRB 1MJUL 4PBXA 5EU4B 1EEYB 1WGOA 2W92A 1KIQA 4YHZH 5SWSD 3NPSB 3P11H 1EJOH 2DKSA 3JV4A 3U79A 5JIIA 3ZYIA 3OGOE 1MCKA 1VFOA 4IIQA 1UA6L 3BYTA 4NSKB 3DROB 5CS7A 2JJTA 4DZBB 3ILPA 4PJBE 4WU5A 3MPCA 1AHWC 2DQIL 1QPXA 2AXGB 4WO4A 5TE7H 3LIZH 3CSYB 2VDLH 2XFXA 2NXYB 2QSQA 4GW1B 1KXQE 5K9OA 4P23B 4V2BA 5BRZA 1F97A 2X4RB 3MBEC 2AI0H 2E3VA 3NVQA 2D03L 1S7VA 2DQTL 4BFIA 4DN4H 3LEVL 5DK3A 4XP1H 4DQOL 3LD8C 3A6CH 5E03A 1MWAH 4AZ8A 1RK1A 3FN0H 1SBSH 3QUZA 4PRDA 4O00A 2WUBL 1X5GA 3DRQA 3OKLB 2B1AL 2ZWLT 4NQDA 2HLFD 4NQDB 1NDMB 1SM3L 4Y4FB 5DDHB 2E9IA 1A14L 1EO7A 2PW1B 1UJ3B 4GQPH 4R26L 4CRPA 4NO3A 4NQED 4HXAL 1OQXA 1H3PL 5IQ7H 3BQUC 4FN0A 5DF0A 4TSAL 3FOMB 1TZIB 3ZO0A 2WANA 1K8IA 1B88A 2CMRL 2ADIA 2XN9A 1PW3A 2IAMD 5GGQH 4IDJL 1B2WH 1ZHBB 5GHWL 3DJ9A 3O2WL 3SE4A 4ONHA 1P4IH 4S2SA 3TJEL 3L7FB 1XZ0A 4EDWL 2VXVH 3ULUF 4BFEA 3SE3A 1F2XK 2HVKA 3SKMA 3QUXC 5DJXB 5DJXA 5E7FA 1XH3B 4D9LH 4IRSD 3RVVD 4Z0XA 2IH1A 3QHZH 3BP4B 3BD5A 1KB9K 1JPFB 1HDMA 1U41A 5HYFA 1LO5B 4BQ6A 2BFVL 4UUJA 5B38G 4EN3D 2MCPL 3GFUA 2VAAB 3QIBC 2IH3A 4PJCF 5BRZE 5IOPB 5DEFB 3QDGB 3ARQA 4H5SB 3WIFA 2P1YA 1TQBB 1BZ9B 2A83B 2VDML 4OT1L 4LASH 4U6HA 3WE6B 43CAB 1X7QA 3MA9L 4WFGE 3K4DA 3C2AH 5SX5H 5BV7H 1BBJB 3QXVA 1CT8B 2HJLB 1KTLA 4DW2L 2DQGH 3U7WH 5EU7E 3I3EA 3PWJA 4R0LB 4D9LL 5T33H 5GGSY 3F7YA 2OTUA 3MUY1 5MEPA 4BSVA 1QEWA 4M61B 5ANMB 1D3CA 2YK1H 3HUJE 4DKFH 1S9XB 3IDNA 5KJRH 2Y23A 2MHAA 5IB1A 5CJ8A 5DUPL 1KFAH 5HYIA 1XGTA 1OAKL 3QEGH 2JB5L 3F7PC 4A6YL 5HYEA 1HSBA 3BFOA 3LV3A 4YPGB 1OSPH 1Q1JL 4RBPK 1G7HB 3G08B 4R3SA 2EE3A 2O5XH 5HHOE 4UB0L 4ZYKA 1N2RB 4RISH 5T3XD 4JFHE 1S7VB 3VD5A 5IWLC 5FK9A 4XMPH 1UJTA 1FO0H 2OJZH 3O8XC 3S35L 4Y4FA 5C0CA 3LH2H 1QFUL 1S7UB 5KAQG 4P2RD 3TNMB 2ESVB 1KGCD 1G1YA 2X1WL 1CK0L 5HGDA 4L3CA 5DFWH 2DTML 5I1DB 1BQHA 4HKZA 3EDEA 2XZAL 2XRAH 1U3HC 4M93C 4AMKH 3HI5H 1BQLH 2YEZA 2P5EB 5F7FA 5IM7B 1JGLL 2JTDA 3QG6A 3CLEL 1GGIL 1MHPH 4XXDB 3ARFC 5I1AB 5EO9A 1WVZA 4HJGA 3MV8E 1S8DA 3IKCA 4OFVA 1OM3L 1E0OB 1NUFA 1Q9OA 2FL5B 4JM2A 1S3KL 4EI6A 3HC4L 2X9WA 1X5LA 4HLZH 5GS0C 1VGKB 1YEGH 2UYLB 3BJ91 5B39A 3GHEL 3QO0A 1K3IA 5IMLA 3MLYL 1IL1A 5D1ZC 4LGSB 2WWKT 2XOTA 4G8GE 5BV7B 3W82A 2AKRB 4R97C 1DBJL 1Z5LA 2ARWA 3VXUD 4U1JB 4U1JA 1XZ0B 5AUMB 4U1IB 3OF6D 2EYSB 3FT2B 3HE7C 4ZFOA 4Y19E 3VXME 3GSVA 4NQCB 2YBRA 1DQJA 4BJLA 3HMWL 3R8QA 3ARSA 5IQ9A 4PBWD 3RY5A 5E56A 5D2LA 4PB0H 2GI7A 1HNGA 4L29A 3O0RL 1DLFL 1U92B 2F53D 5BOZG 3MGOA 2YKLL 1U8IB 2B1AH 2I27N 4NO0B 4XBGA 1C5BH 4KTDL 2QKIB 4R4BB 4U05A 3JV5A 4PJEA 3MYJA 5E95B 2CUHA 4JPWH 5JO5B 5D93B 3HC3L 2YPLD 3DYPA 4P2RB 3FQUA 4JY4B 2BY0A 1E6OH 5CJ5A 1A9EB 3ILQC 1HILB 4Y5VA 1DBAL 1CF8H 3DURB 4R97B 2P24A 3BEVB 4EXKA 1ZT7B 4P2QD 5LQBL 2BVYA 3ARBD 3V5DA 4M43H 5AZEH 4LVNC 2DS4A 3D0LB 1WWAX 3VXRB 1NAMA 3BZEA 4R2GD 5FO8A 5JA9A 1FL6A 1D9KA 1I3UA 2J12B 5GGVL 4ZOEA 3RUGB 2YPKA 2NLJB 1ZLSL 4PY7B 5I1AA 1XF1A 4E42A 4JZOA 3HG1D 5DVKA 4TNWF 1YEIH 1KNOB 3S36L 1CLZH 2GSIA 4FG6D 1YN7B 3WIHH 1N0XL 1GSMA 2CD0A 3I02B 3LPFA 1RU9H 3TN0C 1HYSD 3DRTB 3OKKB 5TFSH 3VXMA 1W0YT 4WHCA 4RX4D 3DV6B 3UJIH 2GAZB 2NMSA 2YWYA 1CLYL 5ETUA 4G9FD 2ZG3A 4W81A 4FNLL 5DJ0B 1FNLA 2H26A 3UZVB 1OT1A 5F7EL 4Y1AB 5CJOH 4PRBA 4NQSB 1I1FA 1JGDA 2DYPD 5D7IF 1NMAH 4FXKA 5D7JB 2QSCL 3GM8A 3F7VA 3V5HB 3T65A 1GGIH 1UM4L 3LKQA 1F00I 5DT1L 3KPRA 3WEXA 4UU9A 2ZCKH 4ZFFA 4QRTB 4X6DB 5HDQL 2DBJA 2VERN 3QUYB 5TPWH 2HWZL 4OCXH 5ADPH 3E2HC 3X17A 2AP2A 4FFYH 3RWFB 4XCYA 4UB0H 5CSBA 3ZL4L 2W9DL 1AI1L 5C0ND 3DVNB 4M7JH 5CIPB 3QHFH 2F8XC 3LH2L 5DQDH 5KBNC 5GS2H 4OLXH 3T4YB 4MXWH 5J9PA 2EDKA 1CGXA 1QBAA 3DOSA 1YMHB 1A14H 3IDJA 1W72A 4RMWA 4HZLA 1GZPB 3OJVC 4GKZB 4MDJB 4S1DC 2D0HA 3DETC 5CHNB 3PGDB 4DWHA 1JK8B 3OTTA 4P49A 3EOTH 5IROC 4QXUH 1YN6A 3PNWB 1JNNL 5D5MB 5CEZE 4WHDA 4Y4FD 5F3HA 4I77L 4M6NL 3L3GA 5F96L 5ESQA 5AAMA 2HKHL 4JFFD 4FQLL 5H37G 3SDAC 1F6FB 4PJBA 4DVBA 4OD3H 2OK0H 4HHAA 4PJ9B 3RWEB 4N90D 4FQXB 4FXLA 5KVDL 1I3RA 4PRDB 3K1KC 5DRXA 1RPQA 1OD7A 4EVNB 2B5IC 3RX8A 3FO1A 4ZMAT 1JPTL 1PEWA 3L7FA 3DUUA 5D5ME 5J13C 3GUTA 4APQB 1J0KA 5GGVY 1BWWA 5GSRA 1G9MC 5ILTL 2D7TH 2ZCHH 2IF7A 2EDQA 4KV5E 5EBLA 3VRLE 1QFWI 2NY4D 4Y16B 1H3TA 1TQBC 2YPKB 1VACA 5GJSH 3WUZA 1FC1A 3CGTA 1CFTA 4L3EA 3HPLA 4WTZG 1CD9B 4I3RL 2G75A 5EORH 1I1AC 3DVGB 4YBQC 5KTEH 4XX1E 3QIBB 4ERSL 3N1MC 5JQHC 3OHXA 2F15A 3RKPA 1CG9B 5BOPA 5I16B 3LKPB 1I9IH 2W0LA 4PV9B 3O45A 2EECA 3HNSL 4XC1H 1MY7A 3CC5A 3DXAE 4YO0B 4OZFH 5GS3A 4MA1C 2M8XA 1YEDB 3R06B 3TN0D 5IB4A 2ZZUT 2PYED 4DEPB 1CS6A 4Y1AA 4Z7NE 2EH7L 3FQXB 3FO9A 4L4TE 2FSEA 1KLGB 2Q8BH 3S3SA 1ZAGA 4XPTH 2XV6B 3RVUC 5T3ZH 1CQYA 4YHNA 4I0PA 4RMSA 3MYZA 4DN4L 1NL0H 4I18B 2UUDK 5MENE 3GMRB 1E4KC 4ZUUA 4LGPB 4K9EL 1I1CA 2XWTB 4XP6H 3ARBC 3NABL 4P5TB 3ZHLA 2OR7A 2X89D 1TJIL 3PWNB 4ZSOE 4D8PB 3K7UA 4YHYB 5EB9A 4YZFE 2WBKA 4PJ5E 5E8NA 3RWJA 1WBYB 1YNTA 5HHQA 3A67H 1BFSA 4QHKJ 4ONGH 1FRGH 5EUOB 4RFEB 1HINH 1T0NB 2BNQD 1RUML 1VFAA 4RZCA 3QJHA 2I9TB 3G9VA 4OZ4A 5A40E 3EDKA 2VOTA 1QLRB 5EH1A 3WFEH 3FKUS 2B2XH 1RSFA 4K94L 2EDDA 5DZOA 4NQTA 5TQ2L 4U1HB 1ORQB 4OI8A 3SY0A 1S7QA 1DQTA 4KAQL 3BP5A 1EIBA 4NO2A 2ICES 3P3YA 4MAYC 1OAUL 4HIEB 4X5XA 4ZAKA 1F4YL 3QDAA 3WSQH 4LLVB 2YUVA 4EVNA 1X5AA 2BRRH 3JSSA 3BUYA 3DXAA 5DJAB 4OI7A 3QI9B 1MCPH 4JFZL 3RWEA 2X6MA 4Z7UB 2EXYD 1GAFH 5D2LF 4LU5L 4ODUB 5C0DB 5IEHA 4S1QH 1P7QA 4E5XB 5EBMA 3QEHA 1OT2A 3QEHB 3HCVA 3U9UB 4HJGB 4TQEL 1ZA3B 2J4WH 5I0DA 5TF1L 3T0BA 3KWWA 1GGTA 4M7JL 3VXUB 2VLLA 3ALPA 2X4OB 4KKCD 3F7QA 1AI1H 2ZOKB 3QUML 2DJUA 4Y4HB 5MP6H 1JHKL 5CEYB 3D39B 4AL8L 4WHTB 3MJ7B 3VMOA 4MLSA 2JK5A 2VWEC 5B39G 1I1AA 1J5OH 5BVPH 1EJ6A 4YC2C 5D7IA 1KTDB 4MJ5B 4GMTL 1I7UB 5ID0A 3GMMA 3BHBB 1VEMA 3S37H 5MEOB 3UJJH 4D94A 4PRIE 4YQXH 3DHJA 4MNHA 4LLWA 3ZT7A 4JRYD 4XB8A 5F89B 2G60H 2QR0B 2OYPA 5DFTA 4XP1L 1NCBH 3HA0A 3JVGC 1T03L 5DRZB 4EBQH 5MEND 1VKXA 1N6QH 3CMGA 3IJHA 1HXYB 1T4KA 4RGND 3VFGH 3KR3H 2G2RA 2G2RB 5E5MA 2J88L 1YMMB 1I7TB 5E08L 4YBLC 5IVXE 4APQD 5C0FB 3VGAB 4UMGA 4MAUH 3WNOA 4RMVA 1KIPB 1JPSL 2FX8L 5CEZL 4JDZA 2DM7A 2HKFH 4QCIA 4YE4L 1T2XA 3QEQE 1Y18B 5HD8D 5CSGA 2W59A 2NW2B 3S36H 4KMTH 5HVHB 4N1HB 5GHWH 4I13B 2VR9A 1S3KH 3SOBL 3CCHB 4UIMB 2DMCA 3HZMA 5DD3L 1HYSC 4XXCC 2AXFA 5L7XH 5CLWA 2FECI 3MJ9H 3E1F1 5TGBB 3KXFD 1JF6A 4OLVH 2YPLE 5D7KD 3ULUC 3WL9A 2HTKC 2X70B 3B2UC 4FQ2L 5C0EB 4UILH 4XXDA 1CXIA 1RV6X 2COQA 2DLFL 5IBUG 3DX7A 4RCAA 2RCSH 3MBEA 1FDLH 3JV6A 1WCBA 3ULVL 4YDVA 1PGRB 5F9JB 4NP4H 3I85A 3OZ9H 3KPLB 1UCBH 1BVKA 2L4OA 3GMNB 1AJ7H 2DB8A 5BVJB 3S4SB 4QY8B 5ICZB 1NC4D 5F1IA 5F1IB 3V52H 4OV5A 4KQ4H 4DW2H 4Z95L 1MRCH 4JRYB 4U1SA 1JZ5A 3KPPA 3SKMB 2AJXL 2NY5H 1NFDA 3UTPD 4K07A 5T3ZD 3MLVH 1U0QA 5D93C 3CFKB 5HHNA 5I19L 1JNLL 2DI8A 2B0SH 2GJZA 4LLWB 4FTVD 1KN4H 2XTLA 3EOYG 5IHUL 1ZVSB 4UQ3B 4ODHL 2F5AL 5CJBA 5ALBH 4G7YH 3PGFL 4WUUD 3SJVA 2VE6A 3ARVA 5E2TH 5ALCL 5FCUH 1FIGL 5TDPA 3MV8B 1JHLL 1Z5LB 4XTRD 2OK0L 5I17B 2VDNH 1UH2A 3O6FA 1LDSA 2E7CA 4JM2D 3ZT6A 43CAA 3WV0A 4GKNA 3FB5A 3KLHC 2PYEB 1MI5B 5FYKE 2D4FA 1KCSH 2WUCH 4R8WH 4MNGE 3P30H 3MLXH 4IRZH 3WFZA 3SPVB 3D3VD 5EIIA 4PGEB 2F8OA 5KANI 1N8ZB 5F8RC 2EC8A 1RJLB 1IEAB 1FFNB 3VDBA 1WZMA 4Z5RA 1SJXA 5EU5B 5BO1L 4HXBH 2DF3A 3MJ8A 3S9DB 1OAYH 5GZND 3MV7E 1XGQB 1CVRA 1P4IL 1DBMH 3EHBC 4F7MB 3HRZB 2J5LB 3AM8C 4NKOB 1FFOB 2QSTA 2VIRA 4ISVA 5B8CA 2WSKA 3GBLA 4ZO6A 3QULB 3O3BB 1AGCB 3ARFD 3ZTJH 5F7HA 3LSOA 1DVFD 3GMOB 5EPMA 5T1MA 3RL2B 3SE8H 3RWHB 3LKPA 4NUGL 2IBGA 2YS4A 3MNWB 4OM1H 1M05B 1M7IA 1QSFD 3KPOB 4M93B 1XGRB 1N2RA 3WBDA 3IFOA 1T1YA 4H20L 4OFKA 1QFHA 1ZK9A 4I48B 4PBVC 3TBTA 4KQ3L 3QPXL 3EO9H 1BIHA 3FFCE 4L3EB 1BGXH 5CSZB 3ZDYF 5ADPL 4TSCH 5DDHA 3IFPB 3BQUB 3EGSB 4ZPVA 2ESVA 1WV7T 4U31A 4I0KA 1NGYA 1TNNA 3H42L 4QXTA 2X9XA 5HI5C 1SJEA 1I9JL 1RFDH 3QUZC 1KCRL 4LHUD 4JKKA 1UGNA 2Q76A 3HR5B 1A0QH 4LCCA 3G6DL 5F7WC 2BNQE 5IVNA 2YD9A 5C2UB 2EH8L 3A67L 4XNQB 5JA8B 1E6JL 3HNVH 4LIQE 1XF2B 3DX6A 1LP9F 4LBEA 5L8KB 3IDMB 3IDYC 2HT3D 3P2TA 4JY5H 5IHLB 5EZLA 4XH2A 3U4BH 2WBJB 4JRWA 2DQEL 2ATKA 3HG1B 2KPNA 3HG1A 1IAKB 2HN7A 1RIHL 4KHTH 3BKML 3AS0A 3QIUA 2YPVH 1MCBA 4DZBA 5I1GH 1BFVL 3SDXE 2BNQB 3SGJC 4JR9H 3CX2A 3GJFB 2XQBH 4CJ1A 4UU9B 1JP5A 1RZJL 1BOGA 3R1GH 3QIBD 3UO1L 1WWWX 3VGDA 2ERJB 1LDPL 5D7JD 3F7RA 5DRNB 4UV4L 4L5FH 2ITCA 4X80H 5HYSA 3ARDB 2VLRE 3L3GB 1YYLL 3BIKB 1WT5C 1QNZH 4HS6B 5HHPA 3W5MA 1DJSA 4P5KB 3RKDD 2HVJB 4XP9H 3QI9D 1OAKH 3OZ9L 4X6BB 1NMCB 4HZLB 2EEBA 3P0VH 2DIJA 2APTA 1KTRL 1JJUA 4OCWH 3C5ZA 4P57B 5C6WH 2HP4A 1QRNE 3L5JA 2Y5EA 3ZE1E 4DK3A 4MCYB 5DJDB 3CLFH 1H5BB 5CCKH 5DRWA 1T0MA 4U33A 2UUDH 1N7ML 2XKUA 3L3KA 4G5ZL 1BQHG 3EDDA 2ZSVA 1HYRC 2IBZY 4ZSOB 2D0FA 1LE9B 3V0WH 3VFNB 4KI5E 3MRHA 4HT1L 2MSPA 4CAGA 1EJOL 1MCIA 4PP2A 1G7MA 3PGFH 2CK0H 5F9WB 8CGTA 3HG1E 1J0YA 1WFOA 3MODL 1T89C 1MQ8A 4X8JA 4YO0A 4QRPE 3BDYL 3RFZC 3WFDL 1FH5H 2NY1C 1CL7I 2A77L 2VLJE 4AENA 4PLKC 3C9NA 4U1MA 5FECB 1XGUA 3GMLB 4FQIH 4GAGH 3DBXA 3NFSH 2P8PA 3HE6D 4M03A 2OMBA 5C0BA 1EEZB 3DV6A 4Y4KB 3SO5A 3QISA 2EDWA 4YPGA 4N0YH 3RI5F 3PWPD 3SGJA 5JIHA 5AD0B 4KJYB 1S5HA 3TA3C 3HRPA 4K8RH 5F9DC 3HMXH 4PJXB 3T4AB 4HC1L 3I75B 4Q9CA 1N5YH 2ERJC 3ARDD 3UX9B 2GJ6D 1RUQH 2HH0H 1IILE 2JCCB 2JCCA 4LBEB 1FL3A 4NQDE 3V0VA 5AG9A 4U6TA 2NYYD 1ZLWK 3KLAB 4WJ5A 1P53A 2O93L 3K80A 2CGRL 4FP8L 1BOGB 3P0YL 5CD5D 1MOEA 2B4CL 3ARBA 3UPAA 1DE4B 4F8QA 3CDCA 4KUZH 2XTJC 4QF1B 4XPBH 2WQRA 4KRLB 2YK1L 3OR6B 3ARZA 4PB9L 2DQDL 4POUB 2FEEL 1U8MA 1YEHL 2LU4A 2P48B 4PJAA 5KSVA 1D9KD 3PGDA 5CHNA 1BFVH 4WI9A 3RWCA 1S8DB 1UWGL 4IIQC 5DRNA 2XXMB 2OSLA 5EC2B 5IVXA 4HUNB 1FZJB 1AKJA 3QNZA 1MWAL 1YECL 4X4YB 1MFDH 4JRXA 2HT2D 4LKCA 3QWRA 1EO8H 3MTRA 5F88B 3IXAB 4QRPA 2VDKH 3K1DA 2ZSWB 4WDIB 1ROWA 4N1CA 4XPFL 2VLJA 5DD0H 1LVEA 4JQXA 5ICZA 3HZVA 4JFYA 3RQ3A 1DBBH 1IGIL 1VDGA 2CO7B 4TUKH 1KPUA 1JZ2A 4GBXD 1QBLH 4Q58C 4MGXA 3MRFB 5FUCE 3IKCB 4IOFD 2R2BB 4NKIL 5J1AB 3LZFL 1TQCB 3TV3L 4JY5L 1WT5A 3IB4A 1JGLH 1G6RH 3G6AA 4E9LA 5EZOH 3GBNL 1XF4A 5C6TH 4F57L 4AENB 4NM8H 3O3AB 1AGFB 3P0GB 2J2ZA 4KK6D 4DGYH 2P7TB 4WI2A 3TBSA 2BNUA 4XCCH 4L29B 1RZKH 3GHBL 2JCCE 4AG4H 2VABA 1IVLA 5A2JH 3V4VH 1U8IA 4CUCA 1Q72L 4KZEH 3QQ3A 3TFKC 3RTQC 5I8OH 3GSRB 1HE7A 5GS0L 4NM4L 2D3VA 4Q6YA 1EO5A 3EYQD 3FT4B 4JQVC 1VA9A 5HYQA 2J6EH 5D1QC 5IQ9B 1JWSB 2XZCL 3SO3C 4G7VL 2VE6B 4JEGB 1YQVH 5FYJH 4PGEA 2FH8A 4HBCL 2H45A 3D87B 4OCXL 2MJWA 3BN9D 3EDFA 1OAYL 1GRWA 4DUXA 4RFNC 3AUVA 4JG1L 5C09E 2EIBA 2PTUA 3O3EA 5DJ6B 3EJZD 4HGWB 1ZE3C 5D1ZB 1CGVA 2FWOA 3N1QC 4JKPH 1JUFA 2FBJH 4QNPF 4KJWD 3FRUB 4UILL 1KCLA 3O0RH 5C0IA 4ZODA 1FE8L 2F19L 4XVSL 2P46B 1MFAL 1MJ8H 1CDYA 2JIXA 5IB3B 3LIZL 2X7LB 3G5XA 1N8ZA 3FB8B 1W72L 1UC6A 1KB9J 1ADQH 2D7MA 3H9SA 3N9GH 1U95A 2IAMB 1NBYA 2AI0L 1HXMB 4FTVB 4LPWA 4NRYB 2W9EH 4X9IA 4DAGH 1R3LB 4P99A 3ZHKA 1D5MA 3GHEH 5HBBA 3PDDA 5H94A 1OAXL 2VXQL 1FGNH 4NNXB 1MCJA 2E27L 4EI5D 1P2CA 5EZOL 3O2DL 1NGZA 1F4WL 3CIQA 4L3ED 1MCDA 5CMAB 4XP5H 2YRZA 4HUUA 5L2JA 2L0DA 5H2BB 5J6HA 2A77H 2FLRT 2OL3B 5IW1B 3O8XB 4QXTB 3A6BL 3IS1X 3RNKA 1W0WB 3D18A 1YMME 4NO2B 1S7UA 4OJFH 4R2GB 2GFBB 3IFOB 4MJ6A 1ZHBA 1KF9B 2XZAH 3T08A 1PQZB 5EWIL 1MFEH 4UDUB 2PYEE 3HCVB 1MLBB 5JUEL 3U9UA 4POYA 4M4RA 2LABA 1RUKH 1NL0L 1MJJB 1CICB 4JVWA 2JJVA 3VDCA 1WBZA 4JREC 1I8LA 4MA1B 1SJEB 5B38B 5C0BD 5F9WC 2MTPA 1WITA 4DOHE 1NUDA 1GIGH 5CD3A 4F7PB 2X4OA 3FO0L 3RL1A 2PXYD 4YDIL 3M1BB 3VWJA 5ICYA 4UNTA 5D9SA 4XPBL 4U6YA 2C4FU 1IKNC 3QDGA 4PRHA 1T66D 2QQNL 3EOAA 4BH8B 4XMLH 2YN3A 4LP5A 1TITA 4G8FA 5K9JL 2PKDA 2DQUH 4DKEL 1UB6B 1U6AH 3PHOA 4YBLB 4EOWL 1QVOA 1GGBH 3PGCA 4IMKA 4HG4J 4LIQL 4RWYH 2QQQA 4HKJA 5CWSA 2R0WH 3DTXA 4JFXB 2GK0A 1Q72H 4KZEL 3WKNA 3G5YB 3F58L 4OZGA 2DQJH 2XN9E 3QUMB 2FEDC 4FFZH 1VKXB 5C3LD 5EZIL 5JMRA 4JAMA 3MLRH 3MRRB 1KIQB 3NZ8A 1KOAA 3Q2CA 4OTXH 3OF6A 4NNPH 5L9DL 1MCWM 2FR4A 5E00A 1AD0A 4OD1L 2DAVA 4GW1A 5EG6C 5I71B 3INUH 1UWEL 1RMFL 3U1SH 3T3PE 4XGZB 1T7XA 4WO4B 5FYKL 3TBYA 4TTDC 3MLYH 4KPHL 2VDOH 4Y4HC 3FO2B 3MRGB 4MD5A 5LQBH 1RZJC 1TQCC 1TFHA 5EZIH 3AXLB 2G5BB 1NCUA 5DD1H 5T1KB 1CBVL 4ZNEA 3DPBA 1NGQL 1JNLH 3X3FL 5C08A 5F44A 1CGTA 4K2UH 4ORGA 1CICA 2BMKB 4OAWA 5DK0B 4GAYA 4PRHE 4OQ1A 5HTSA 4MHHI 5C92A 2PXYB 4OBRA 1PY4A 4L3CB 4M1DH 3MREA 1QRNA 4Y4KA 4PP1D 3BRFA 5DTFA 1NKOA 5K9JH 1WIUA 1L0YA 1J9CT 4Z7UA 3DUSB 4JG1H 4G6FB 2AEQH 1G7IB 2V2WA 3UROR 3KYMB 3REWB 4F58H 5FM5M 1DEEA 3BPOC 5C0GB 4QTIL 1NGQH 1MRDH 3KAAA 1CD8A 4KTDH 2H8PA 3PWNA 4D8PA 4Q7DA 4GOSA 1B9ZA 1TZGL 5JOPE 3DGGA 1AQKL 4KDVA 1HZHH 5DGQA 5EWIH 1KCSL 2X4SB 4A6YH 3WN5C 1CQKA 4OZHB 5F7DB 4OZHF 1BPVA 4F7CA 3S5LA 2JJUA 4YR6B 5GGSB 5D8JH 4DN3H 3UP1A 1OPGH 4DZ8B 4IRSB 1FBIL 4ZFGH 1X5XA 4XCCL 4HS8H 5E8OA 1WICA 3JV0A 2IPTH 1J87A 1QQDA 3AB0C 4DGIH 3LN5A 4NZTL 5E2VH 4NUJA 4XPFH 1FG9C 5J4MA 2X10A 5SX5K 1TLKA 1P69B 3BVNA 3A6BH 5E1AA 5GRYA 4RGOH 4G8GD 3QIUB 5C8JA 1LO4L 1TJIH 5A2LH 4WENB 1HH9A 1VGEL 5C0AE 4BZ1L 4K55A 1F3RB 3MRIA 1S78C 4I4WA 4KKNA 5HYJD 4HT1H 1P5UA 3HE6B 1FRGL 3QEUA 2ZUTA 2XG5A 5DJZB 5C0NC 3D3VE 3SGEH 2V9RA 1H0DA 3H3BC 3V8CA 3STZB 2D9QB 4JN2A 3TBVA 2CKBB 2MQCA 5HYSB 3RNQA 3MFGB 4WU5B 1BJMA 4Y4HA 4XCNB 1YA5A 4PJFF 3QWOA 5C71A 4MD0A 5DRWB 4Y19A 5F93C 2BJMH 2ZUQB 5I8KL 5TJWK 4KQ4L 5CP3H 2ADGA 2DYPA 1YEKL 4XAWL 3HLAB 5DURB 2DTMH 5ERWB 4BUGA 5BS0A 3R4DA 2NTFB 5EBMB 2XG4A 2HWZH 2M2DA 2V2XA 3AFLA 3DRTA 4OFDA 5JZ7C 3UTPE 4ONFH 15C8H 2I9LB 1CGUA 3RPIB 3FB6A 5F6IC 3ZT5A 2VLKB 4HBCH 4L9LA 1Z9SA 1Y6KR 5CJQH 1LO3H 4YDJA 4NQSA 4OV6F 2YPVL 2CJUH 2ED7A 3QDJA 5HGBB 4HULB 1BZQK 1YYML 3WN5A 5HPMA 1WFUA 4U3HA 4QHMB 3QDMD 1LDPH 3HB3D 4M5ZL 2CO6B 4WV1A 2FIKB 4P4RB 4LCYB 5JUEH 1HIMH 3MLXL 2NQCA 1NLDH 4IRZL 4L8SB 1LK3L 4NNYA 4OGZA 1I75A 3BH9B 3BH9A 4OCNC 3PIQB 5IF0A 2CIIB 3BZDA 5IJVA 5DWUL 1HCVA 4IS6B 2IEPA 5I18H 3FT2A 3INUL 1RK0A 2IPUG 1W8NA 3OL2A 1YECH 2X4SA 2DDQL 3LRSB 5C0BB 3BZFB 3RAJH 3DYOA 1DQDL 2AJUL 5KANG 1K5NB 5DS8B 1HKFA 4I18A 1HZHL 5CKGA 1IGIH 3RZWA 4URTB 2FIRT 5HY9B 4KZDL 1JFQH 1OGAE 5CIPA 1K4CA 1XR8B 5ESQB 4XTRC 1SVCP 1FNEA 1IAKA 3CZFB 4OGYL 1C5DA 2DWDA 1G0YR 4OUUB 4OUUA 5DD5H 5DJZA 5DUML 2C4XA 2EDTA 2GUOB 4X9BA 2VQTA 3HFML 5EU6D 3WNLA 2ITCB 2PNDA 2DQFB 3N06B 4X7TA 3V9FA 5HYJE 1IAMA 3RY6A 4X98A 3PXJA 4M5YH 4GUPA 1DBML 1QFUH 4P4KD 5IP4A 1FO0L 1XMWA 1R6VA 5INDB 5DHYA 1JMZA 3KNBA 1B3JA 1SM3H 1VACB 2RHEA 3WKMH 1JF1A 4MB4A 1FAIH 3CFIC 5KSUB 2WQ8A 5F9JA 1SBBA 4P0DA 4LLMA 5IVZB 2W0KA 3OKNB 2H9GB 4L4VD 2YA0A 2VSCA 4G80A 1EEQA 4U1NA 1A9EA 4HUVB 4YC2B 1X6LA 4C59B 4N5ED 5CEXB 5DJYA 3C5JB 2BC4B 2FD6L 4PUBH 2DI7A 2P8LA 2E8ZA 3IGAB 3W0WE 5E24E 1IAIM 2JJWA 2FJHA 1YEGL 4FXGA 2IPTL 4F7PA 5CBAA 3VWJC 4M1CC 4JFXA 3RVWC 1S5IL 3UJTH 5CEZH 3OKYA 3DECA 1JZ8A 4PGCB 4NWTH 1IKFH 4JPVH 3HZYA 2VLJD 3AC0A 3CH1A 2X4TB 2YSSB 1HI6A 5TDPB 1RJLA 5E6IB 1ZVYA 1U8NA 4WFGD 4MSWB 2Z4QA 1U8HB 2XPGA 1QZ1A 4AIZB 4E41B 1T7VA 4Z77A 5KW9H 3DMMB 2ZOLA 5IW6A 2AK4B 4W70A 3GSQA 3O6LL 1UQSB 1R5IB 4QTIH 1A4KA 1BZ7A 3BP6B 2AJZB 1HQ4B 1NLBH 1Q9LB 4JE4B 3UPCA 4R0LA 3LKSA 3NN8B 5I1HL 1ZGLB 1L7TH 3HC0A 1FHGA 3MRGA 2LTQC 3ZTNH 3T0VA 2LVCA 2IMMA 1P1ZA 2X09A 3MLTA 3IAPA 5IT2L 4F7EB 4QRSA 1KFAL 5KVFL 1AO7D 1JYXA 2CUMA 3QJFB 2RBLA 3A6CL 5TQ0H 4JQXC 4ODTL 3LEVH 5IUSA 4J1UA 4PJGB 1NCCH 2ZKHL 3H3KA 4I9WD 1WEJH 5E1HB 1R5WA 1KJ2A 4XB7A 4NM8L 1L7TL 3QR2A 4FS0A 3W0WA 5J57B 4Z78B 2PW1A 4OCRH 2IFGA 5I15H 4YDLB 5EOCH 2VC2L 3UAJD 1D5XB 3WS6C 3ZDZE 4PV8B 4ZUVB 4K8RD 3KPLA 2VDRH 4ONHB 5DFVD 1BEYL 2ID5A 1S5IH 1P7HL 4PYGA 3TIEA 4PJGE 4L9LC 1MPAL 2XN9B 3VA2C 2Y5TA 2ICEA 4GAYB 3T2OA 2BC4A 5LVEA 3B6SB 3QO1B 3WFHA 1JBJA 4OUOA 3V6ZB 1JPGA 4HIHB 4XP4H 4TVPD 4HLZG 2H9GA 3T3PF 1D6EB 3VGEA 1G1CA 1FBIH 5J1AA 4XT1C 1UJ3A 3D0VA 5D71L 4OCLC 3X12B 5TFSL 1EGJL 1H8SA 3VXTA 3ZZ1A 2W1NA 3PL6D 5LGKA 4NGHH 4C4KT 2VABB 2R8SH 4ETQA 4HIIA 2X05A 1I1AB 4QTHB 3MLZH 4P48A 3ROOA 1AGFA 4JKMA 5KS9A 4TTGA 4PTUA 1I4FB 4ONGL 3GIVB 2ZOKA 4M8QA 3BSZL 3VGAC 1YN7A 4G8FB 3VXMD 4EIGB 2H2PC 4LSVH 5T1KD 2E7LA 5CILH 5EU6B 4PJDE 1R0AH 1TNMA 5ACZA 2IGFH 3K2MC 1P6FA 3QUXB 1IGFH 5H35A 1A02N 5DLML 4FABH 4AEHL 4EUPA 1C16A 1Q94A 4NC1E 3CJJA 4D9RE 5DA0B 1QFOA 4YFEA 1JVKA 3LKOB 3FMGL 1YNKL 4WFFD 1KTLB 1UVQA 3UYRL 1MREL 5A3IC 4AK1A 1Q9LA 3QFJE 5CP3A 3EYFA 1TTGA 3WNMA 2NW2A 2CGRH 2CQVA 2NW3B 4JRXD 4MNHB 4NZRL 1MAJA 2VB5A 1LP9E 5JO5A 2ZCLH 1HEZB 1BFTA 5EU3A 2XZQL 3H7BA 3AREC 4GW4A 5BO1H 1P1ZB 3TCXA 2H1PL 3GSNB 1UACL 4GS7B 4OGXL 3RWJB 1H15B 4BFGA 5CGTA 1U2HA 2DL2A 4XZUB 4AG4L 4ODBD 4N8VG 5DD3H 5C0EA 1JCKA 1JPTH 2YZ1A 2DKMA 3ZMRA 5H94B 1J7VR 2ZUUA 3G5ZB 5CINL 3QXTA 5CJXA 1J1OL 4XNYH 1MJ7H 3X14B 4B41A 1NANI 2YD1A 3ARYA 3HTLX 3P4NA 2HFFA 3C6SB 3D3VA 4QYOA 4W6XB 5ESAA 1A64A 4NQVB 1BD2B 4DFIA 2FX9L 3BD3A 5D1XB 1MLBA 3PV7A 5D8JL 3ET9F 1NMBL 3NAAH 5GZOD 1D6EA 4MAYB 1IGML 1TZIA 3DX7B 3W39A 5T1LA 3E0GA 5C0DA 2GFBA 2NY4C 3B6SA 5GGQL 3MLWH 1GGBL 3B3IB 4U2ZA 1NFIB 3V6OE 2C1PB 3GO1L 1QSEE 1INQB 2PW2A 3U0WH 1M4KA 4LLDA 3SHSA 3B9KD 4PJIE 1KELL 2KZ1B 1MFAH 1MJ8L 2VLRA 1OAQL 3T8XB 4Y5XC 4MXQC 3MBEB 1ZANL 3T1FA 4Z7OF 1IM9D 3VXSD 4KROC 4R7DA 4I2XB 3T2PA 1OY3B 1OGTB 1QSEB 4JJ5B 2X4NB 1RHHB 4O2FB 2GUOA 5ID0B 5C0RL 4O58H 1T0PB 4FMKA 2DIAA 3OGCA 1FPTL 4LSTL 1J18A 1XCTA 4D9RD 2VH5H 2P5WD 1CLOL 4KI5F 2QADD 4FQJH 4YX2H 3E3QC 3IDJB 4OJFL 2K3TA 2NPLX 4L3EE 2YOCA 3EAKA 1ZT1B 2GEEA 1P84K 1ZTXH 4YBHA 1CDBA 2PN5A 3O6ML 4JFFE 1G0XA 8FABB 3WIFB 3FB7A 2XN9D 1FN4A 3MRBB 3RUGE 4F7TB 2YUZA 3ZKSD 3P9MA 5F3HB 1P7KA 3T77B 5I1LB 2CK0L 2IQ9H 1FYTB 5C6TL 3VD4A 1RZFH 4LGRB 5HPOA 4Y16A 3QXDB 5KVDH 1IGTA 5FYLL 4HWNA 1RFDL 2X4PB 1J0ZA 3QG7L 1OGAD 2CDEB 1A7PH 1CT8A 4FOMA 3MRJA 5I66A 4G8IB 4G8IA 1AQDA 1JTPA 1F4WH 4QHKI 1TZHA 4YNYA 4G42A 4KTEH 2WM0A 4FXGB 5C0BE 4GG8A 2R0KL 1KN4L 4X6FA 1T22B 3U4EB 1T6VN 2CUIA 3O11A 3MFFB 3VXQB 1AO7B 5KVGH 3GI8H 5J6GA 4MJIB 3KXFB 5F97E 3PL6A 4PGBB 1UKTA 3VWJD 3TNNB 4LLUA 4NP4L 2W91A 3Q5TA 5DJCA 4UI2A 2VYRE 1B4JH 3QT2A 4ZSOA 1REIA 1XIWC 2RB8A 2EC9U 3C5ZD 1G9NL 2NTSP 4E42B 3MZTA 1IC7H 5C0GA 1QSED 1RK1B 1UQSA 3VMPA 1I9EA 5E4IA 1SYVB 2AK4D 3HNSH 4LSQH 2FJFB 2OMNA 3J7HA 4LLDB 5EOCJ 5I8EB 3LN9A 1W8OA 2Z8WC 1AR2A 3DHMA 4K94C 3V4VL 4I8DA 1AIFA 4KC3B 4YDIH 3ARXA 2C1PA 1DL7H 1SJVA 3KJ4C 4KVCL 2X4NA 3RY4A 4IOIA 2LVEA 4IRJB 5LBSH 1DQQB 4D0CA 1FVCA 2X1OA 43C9B 5HYSG 5ENWB 2F74A 5GIRB 4S1RL 4GSDL 1IQWL 4W6WB 2P47B 3CXHK 4NGHL 3VI4F 1JYWA 3RWGA 1XF2A 3FHAA 5CP7B 3IYLW 5INCB 2OBGA 2F8VA 2ZJSL 32C2B 5HGGS 4ACPA 2BNRE 1O5DT 4P5TA 4M6OH 4WWKD 2R1WB 2R1WA 2I25N 1C08A 2UZXB 3LN5B 2F9BT 2AERT 1M6OA 1UB5A 3FL7A 5DMIL 4GQ9L 1K8DA 2XKSA 2XQYG 4V1DD 2FX8H 4HLJA 1X5FA 3L5WA 1A6AB 1KIUA 3CX5J 2VN4A 1ZS8B 2AEIT 3VGHA 1QR1B 1ZHNB 1X5JA 1RULL 3ARDA 3TT1L 5I74C 3FONA 5EBLB 4EQ2A 4YGVB 3P9LB 3P9LA 3Q1SH 5HDLA 2AV1A 4JM4L 4E41D 1RJZB 3KPSD 4NQCE 1N4XL 3AS2A 3O9WC 2Z91A 4QRQA 3VRLF 2A6DA 4JN2B 3SBWC 3TBVB 3HE7A 1FYTA 3FQTB 4MXWL 1MH5A 3ZKND 2DLEA 3SDXA 3HE6A 1CFQA 4K3GA 3TBWA 4FQXA 4LEXH 1C5BL 1MHHB 2G75B 4X4ME 3QPXH 2P42B 3SBWA 2B4CC 4QXGH 5DJ8B 4H20H 1DL7L 3H2WA 3PP4H 1KJMB 4U1LB 4XX1G 3CFDB 3QEGL 1EGJA 5J0BA 1QVOB 3PGCB 4J3SA 2N7AA 3KXFA 3VFVB 2IGFL 1T0MB 2ED8A 5CZKA 5EU6A 2I9LA 4M7ZB 4PLJD 1KGCE 1WQVT 1J1XL 2A9ML 2X4UB 2X4UA 4R4FH 5JW3H 2FDBP 1CR9L 1NBVH 3QEQA 4XPGL 2R0KH 1RURH 3LQAH 1JGUH 4AIXA 1AXSA 3O6KL 4IRJA 1BREA 4LCIL 3CVHH 1V5JA 2ZCKL 4Z0BL 5DD6A 2DM3A 4OGYH 3VXRE 2Q6WB 1F4XL 2W0FA 3V6OC 4HS3A 4ZXBC 2HFGH 1HNFA 5ALCH 5FCUL 1FGNL 3WS6A 4X6EA 4TNVF 3BT2H 4QRTA 3M8OH 1QHOA 4JRYA 4U1SB 5KS9E 5MEPB 3WXVH 1OGAB 4HV8B 1XF5B 3SN6N 1HHGA 3F7VB 4CVZB 4J12A 1S9XA 4LQFL 1JE6A 3UBXI 1N7MH 1WFTA 1YMMA 3QXUA 4PY8I 4PJCB 4WUUA 3VG0L 3UC0L 4HGWA 1N0LA 1D5MB 2NXZC 4HWEL 4WRLA 3EOTL 5JDSA 5DK0A 4Y1AE 1NGZB 4L4TA 3WHXA 4J1UB 1K4DA 3QUYA 3RGVC 2AJYL 4JN1H 2R0LL 3UTSB 5C0RH 4NOFA 2X7LA 1YJDC 2X4QA 4GRLB 4LCWA 4MQSB 4IHOA 4XMPL 3WHE1 1IMHC 2J5LC 1NFDE 2MQ0A 3GBMH 1A47A 4UT6L 4ZXBA 1OB1B 5B4MD 1GPOL 5EU6E 4RFOH 2VZTA 1MAML 5C2BL 1CFBA 4CNIB 3IVKA 4POZC 1F6AA 1OAQH 4HKBB 4PRPA 3VRJB 4OV5B 1G7QA 5DI8A 5I74B 2PYFB 1QBBA 4NWUH 1GC1C 1PJ9A 3RIFF 5FF6A 5IHZB 1JYNA 2R0LH 3CSPA 5FYJL 3BKJH 3H9SD 5TE6L 2D03H 4Z9KB 5JHLL 2APBA 5LJYH 4YDVB 1DVFA 4JDVB 4KJPC 2PETA 1GPOH 1T20B 1AFVH 1KCKA 2VXUL 3BHBA 1DDHB 3QNXA 4P3CH 4Z0XB 1MEXL 3O81A 4AM0B 5FO7A 2OCFD 1HHKA 4ODUA 1QUNA 1R3HA 4KKBC 1IGYA 1ES0A 1MNUH 3GSRA 1CDUA 1KENL 4UAOB 1FH5L 1K2DA 3UPRA 3K81A 1WJ3A 3I9GL 3CAFA 1CDGA 4MMXC 5FHAH 2EDHA 4NCDA 4J3XA 2EEDA 2VLLB 4NQXB 4WUUE 4PLOB 3UC0H 1NUGA 4EJ1C 4LFHG 1RJYB 4RSVA 4N8PA 2YEZB 5F89A 1D5BA 5D9SB 3GKWL 5DEFA 3B5TA 3RI5K 5ISZB 3GI9L 1WTGT 2APFA 4PJIA 5FYLH 1OW0C 3WIHL 1MFNA 1IEHA 1AXSB 3TJEH 4F33B 4WHYH 1E27A 3MGOB 2ICWB 3KR3L 3CFJA 4TTDD 4U3CA 4YXKL 5D2NA 4Y5YC 1LD9B 1N6QL 3T3MF 2FB4H 1JGEB 2GIYA 3K4ZA 4J7RA 4U2YA 5FUOL 1WISA 3FRUA 4PJIF 3OXRA 3G08A 5H35B 5SWZE 4GRLC 5I1IL 5F7UA 4ONFL 5E5UB 1HXMA 3SDDA 1L6XA 1TVBA 1MY5A 2O5XL 2H3NB 3NH7L 4IHOB 5FHBL 3S37L 1EEYA 3MX0A 2JJTC 1UKSA 2A2QT 3NZ8B 5TE6H 1K4DB 4HGKC 4GRMB 3O41A 2W38A 4I2XE 4PJ8C 5JDSB 2D2OA 4AEIL 1P2CB 2G5RA 4JFFA 4QRUA 1R3IH 4OFIA 5ITFB 3BPOB 4GW4B 4FTVA 4NRYA 2X1PA 3QCVL 4V2CB 1IC5L 1MLCA 1DLFH 5DEGA 3CVHA 4PR5A 2NCMA 2O5YL 3WDIA 2QV2A 2VDPH 4YFLF 2ADIB 4PGDB 3VGGA 4BZYA 1ZVHA 1ZWIA 3G6JB 4X7FC 3T0WA 2FRGP 1J0IA 1IRAY 1JPSH 2UZIL 1G7JB 5MEQA 1MWAB 1G9MH 1F6AB 1VB9A 3Q1SL 3T2NL 4G6KL 5KW9L 4X0KA 4DGIL 4I0PC 3IKKA 5JPNB 2AJVH 4HH8A 2BOCA 4M6OL 2XQYK 3BAEL 1PX3A 3IFNH 4HIXH 3CU1A 3L3IA 4WI7A 3X3GH 1JNHA 3S5LG 1YYMH 4H1LH 4UINH 1JPGB 1BQLL 4HIHA 2YD4A 3FOLB 4B53A 2ZCLL 3MOBL 1KCUH 2GJJA 2V5SA 2F5AH 3TYFB 5DC4B 1DQQA 4RAUA 4YHLH 4NZRH 3ZKMC 1HDMB 1BD2E 1I4FA 4HAFA 4TSBL 5GZOC 2QHRH 4L8BB 4TVSa 1RJYA 4HH9A 4N0UA 5IOPA 1VFBB 3BO8B 1YEDA 3IETA 2ZPKL 3L3JA 5D1QB 5D7IB 4D3CH 4BSVB 1Y6NR 2P7TA 4NFDA 1YC8A 1JGUL 2NXZD 1XT5A 1V7NL 4BQ8A 1SJHB 5IMKA 3C60C 5TDOB 5C2BH 4H8WC 1EHNA 1AGDB 2AJ3A 1HSBB 4LCWD 1NCNA 4HUMB 5E8DL 4ELKB 3WLBA 4O5LH 3BDXA 4XCNA 2IANA 3B8SA 4RMRA 1HEZA 3HI6H 1D6VH 1T83C 4NKQB 1MHHA 1QEWB 4M61A 5ANMA 3RWFA 1I3GL 3NCJH 4K3HA 3NFPA 3FO1B 5CZXC 4RAHA 4YNYB 5A2KH 4F15C 3MA9H 3QUKA 4XVUD 2OTWB 4XNXL 1ZEAH 4OZHE 1ZA6A 2JELH 4M3KB 1I1RA 5IFJB 4QHLA 1U8OA 1U8OB 3BAEH 4CKVX 2IAMA 3ALXA 4Z8FH 5IB2A 5E2UL 4DGVL 3DRQB 3QXDA 2P5WB 3MUZ1 5IK3B 3UTZA 2BSSB 1NGYB 3MACH 5FA4A 4JZJC 3G5XB 3UTOA 5BXFA 5K33A 4C56E 1KCVL 5E6IA 1CDIA 1WBYA 1RZIB 5L0QB 1FL5B 3BI9X 3GKWH 5FDWB 4WI6A 5DJAA 1JZ3A 4J4PA 5L2KD 1L6ZA 2AJZA 2V5MA 3ZKNC 1OGAA 4HV8A 2IADA 5L8JB 1P4BL 2Y6SD 1BOYA 1OTTC 2WWMC 5EZJB 1Y0LA 2DJ4A 1ZTXL 5CJXC 3L95B 4KK9D 5J12C 2L7JA 4L3AA 4GBXC 3RZCC 1A7RH 3TZVA 4XPAH 2RFXB 3QFJD 4AMKL 35C8H 3S36X 1A4JB 1GGCH 1IM9B 4JRXE 4KK9C 3VXSB 4KRPD 3IJYA 1CXHA 5FHBH 5IEHB 4Y2OA 4HSQA 3FFCA 1BVLA 3CXHJ 1RVFH 2HH0L 1WAAF 3OKEB 4Q9RL 1A6TA 4KGLA 3WO4B 4LARH 4LCCC 5GRJL 4LPUA 4MA3B 1EFXD 2X89A 5FKPA 2I60L 5MP6L 1N4XH 4QRRE 2P4AB 2F5BH 1MRFH 3MRDB 1QNZL 2WUCL 4R8WL 1NAKH 3CSBA 1YZZA 4RMUA 5DHVB 4OLUH 2BNQA 4LLAA 1DN0B 1HILA 2M1KA 3T1WA 1FJ1B 4JRYE 4J6RH 5AYQA 5K93A 2VLKD 2WW8A 5EN2B 3FQUB 4JY4A 4C56A 4C56B 3BPNC 2FO4A 3EOBB 1JK8A 4GRWB 2NY3C 1IFHL 5D70H 3O2DH 4XCEB 5BJTB 3QQ9D 4I3GA 4XVUC 4JO3H 4X4YA 3BKMH 2EDOA 4UBDC 1UZ6F 2P45B 2C3XA 2VDOL 3O6FB 5DD0L 4OLEA 2RQ8A 4XVTH 1CL7H 2AAVA 2D7TL 1KENH 3KPQB 1V3JA 3STLA 1RZ7L 4U0RB 3MRIB 3PWPA 4HMDA 4LPCA 1AGBB 5C9KA 1U36A 3MFFA 5DWUH 1TVHB 2X40A 5LXGL 4YDJB 1XIWD 4X99A 5FGCB 3QP3A 2PCPA 1RY7B 4W6YB 4LVHC 1KJ2L 5KSBE 2P8PB 4FFWC 1L7IL 1AQDB 1SY6H 1QYGL 3QG6B 2PO6D 5IK3A 3FO9B 4EQ3A 3KPRE 3D39D 1NCWH 3L3KB 4FXKB 2ICWI 5BXFB 1MFCH 1GL4B 5AZEL 1T7WA 1IAII 2CJUL 2H26B 2VH5L 1S5HB 1AQKH 2EZ0D 5IJVB 4QRRB 2YMXL 3SDYL 2AQ3A 4KK6C 3WJLC 4L8SA 3HI6L 3WNPA 3I02A 1HQRB 2NZ9D 3KPRB 3QZWG 4X7CC 3WIHA 1Z6JT 5JQ6H 4LEOA 2YD2A 4I48A 3TBTB 4Z7WE 3TZVB 1NEUA 3C8KB 5FYKU 2CDFA 5DURD 4HG4K 4G7VH 4UNVA 5FUZH 3B4NA 2XQBL 2DLIA 5FUCC 5HGBA 3UBXB 1YMHA 2FJFA 2QBWA 1JL8A 4Z7VE 3K3QA 3PXHA 5T1DH 5IMLB 3MCKA 1LO2L 2R9HC 4XC1L 3MRCA 1VADA 1FP5A 2AEPH 2OI9C 4P2OD 3U2SB 4LVOB 4S0TD 4RGOL 3F62A 4NDMA 3M07A 2Z93B 5DA4A 1Q0XH 2E9WA 5GS1B 1A6ZA 1NMAL 4ZS6D 3WFCL 4XBPA 5JW5B 3QDJE 4ESKA 3JTSB 4GRLA 3TJHD 3RU8H 3NFSL 2JIXD 1BZ9A 1FCCA 2A83A 2H32A 3HZMB 5C86A 5D5MA 1A3LL 1MCOH 1HH9B 5FAAA 2ZG2A 4CJ0A 1DQJB 4OT1H 1IZKA 4MJ6B 5LKNA 1K4CB 1ETZA 2DBLL 4LPYA 3RGVD 4TUOA 4P57A 1A7NL 4LOUD 2BVUA 2AJVL 5D6CA 2MKWA 5CCKL 1C7TA 3ZE2F 2R9HD 4CU8A 2GSGB 2BOCB 5DTFB 1I7TA 3EJJX 3N1GC 3JWOL 3ME0A 2DTSA 2LTQB 5K9QG 4G9DB 1PKOA 1ED3B 3T3ME 5J3HD 4Z0BH 4I2XA 3UYPA 1Z9LA 3WLWC 3FN3A 2V17H 2Q8AL 3ULSA 4RISL 1A21A 3L9RA 4Z7WA 4PFEA 3QUMH 2BSED 3UTSE 2X44D 4PJAE 3GMMB 3ULUH 3IDNB 1A7QL 1NC4B 1NFDB 4LF3B 2OJEB 1MREH 1BQHB 2AEQL 5MHSE 2GJ6B 4FZ8H 1W2KT 4ZD3H 1Y6MR 1PG7W 1JGVL 2AV7B 4OQTA 2OLDA 1H3VA 3GMPA 4G6MH 4K3DH 1ZVSA 4PJDF 3FFCD 3CNKA 1S7RB 4Z77B 1CIUA 1RHHA 5HGHB 1CGSL 4K7PH 4RAUB 5GJSL 1AGDA 3C5JA 2NY7H 2GSIB 1EFXA 3I6LE 5GGUB 5GGUA 3BKYL 1NEZB 1C7SA 4LCCB 4PJ5A 3UJIL 4DUWA 3C5SA 3EO0B 2CRMA 3KYMA 2WIMA 3REWA 2Q6WA 5IB3A 5EOTA 2DI9A 4HAGA 1KIPA 1F4AA 3I84A 5CJOL 3WCYA 3WXWH 5A3ID 3CK0L 1P6AB 1B6UA 1JWMA 4DGVH 1OARL 1KCRH 1DBJH 4OD2A 4NHUB 4C57C 2HKFL 4NSKA 4S1SL 4A2MA 4NJ9H 2FZ3A 3HAEH 1EHAA 2IFFL 2VJXA 5DVLA 1S9VB 5I8CB 3JV4B 1UZ8B 3KHQA 2C3HA 1YJDH 4ETYA 1R24B 5D7LE 3RZCA 3VFUA 1BBDL 4O2EA 5GGTA 1FNGB 5HVHC 1A1OA 5GPRA 4HCRA 4POZD 3TIDA 4Y2DD 5ISZD 2AQ1A 1HKLL 2I60H 3D9AL 3SKNB 3E8UL 3AY4A 2ZUQC 4HC1A 3WHE0 2ADFH 2A0LC 4OLXL 4L8DB 1S9YA 4X6DE 4ZXBB 3LMJL 1WBZB 5KSAD 3FTGA 1AKJB 1RURL 2ZNWA 3QO1A 2ICCA 3FAWA 4M6MH 3OPZH 3QIWD 3TIEB 3HAEG 2MPAH 4X80L 3MRPA 5E6IC 5TF1H 3ZYZA 4B7LA 4KUZL 1KIRB 3DX9B 3HC3H 1PLGH 4NN7C 4UT7H 4OZHA 3ARWA 4YIQB 1I8IA 4UDUA 2ESVD 3LQAC 3MRFA 3MBXL 1VSCA 5BS0D 4PRPB 4I9WE 1VESA 1V3KA 2IPKA 5DVOA 2V2WB 3LMJH 5C0AA 3UTTD 3VG0H 4WUKH 3PHOB 2ZG1A 2OM5A 1YDPA 1PX4A 1E4XL 4PJ7B 4OZIB 5FKPB 1R3HB 4GXVH 1IKFL 4JPVL 5ID1A 3VXTB 1EFXB 4UT9L 3QUXA 4HH9B 1ZA3A 4JFEA 1D5BB 4LVNB 3LKRA 3C5SB 4HGMA 4HPYL 5T1LD 3QQ3B 4U1NB 3KJ6L 5F7KC 3UBXG 4PGJA 3CH1B 3RL1B 2KBGA 3ZDXF 4OF6A 4P59H 4M8QB 1SMAA 1EAPA 1XFPA 4RDQG 5F6IB 2ICWA 3WUWG 3RDTD 5DJ6A 4MQXD 1OQOA 1T5XB 3RWDA 5C0FA 2A0LD 5IEKB 1AP2B 3B9DA 1KPRB 4NZTH 5E5MB 2UWEA 3WIIH 4YXHL 3UDWA 4GBXA 5T5FL 4ZG1A 4N0FA 2XPGB 5I76A 4M02A 3RUGF 2XWTA 4MMZC 1MPAH 3MRKA 4N9OB 1HI6B 1JRHL 4K3JH 5F1OB 1HHGB 5JNYA 5I19H 4MCZB 3DVNA 1W72H 3QDGE 5L2KE 1Y18A 5D7KE 3ZKXB 1QRKA 3VXUE 1B0WA 1NUNB 1EEZA 1BFOA 1A3RH 5KN5A 4ORZC 3VH8G 3HE7B 1S9YB 1PDKA 3HPJA 1NCCL 5DJDA 4D0BA 4OZGF 4PJDA 3EW3B 5I8KH 1QFWL 5D1QD 1JGVH 2NNAA 3E6FA 1ZGLA 4HKXB 5CEXA 4F3FB 1ONQA 1HCFX 3H9SB 4P46C 1INDL 3BP7B 2HJKA 1ADQA 3QWRD 3BX7C 4K7FA 3V4PH 4LKXB 1N64H 1PAMA 4PP2B 4JFEE 4MJ4A 4KKBD 4UIKH 4CDHA 1S7SB 4YAQA 4KROB 4D3CL 3PIQA 2VUYA 5IF0B 3WUWB 4Q9QH 1JF5A 1EGJH 5JHDD 1UWEH 3U1SL 4XWOC 4X6CE 3GJEA 2VTFA 3EYVB 3T8XA 4CVZA 4P2QA 4KRPC 4OIIH 4UOJA 3CK0H 2E27H 3UBXA 5D2LE 2E7BA 4QHMA 3QXAB 3BZFA 2Z35A 12E8L 4HIJA 3MRCB 4JFOB 5SWSB 4PJBF 3VXOB 2DQCH 2FGZA 4KHXH 2Y6SC 3DGCR 5K9QI 5SWZD 5DFVC 1JN6A 2F54D 5JIPA 5CUSH 1IQDB 5IBLD 4F7CB 4TSCL 2A73A 2GK2A 3UAJC 2FX7L 3LKRB 5EO0A 4MNGA 2A9NL 1A22B 3TYFA 5D6DC 3BGFB 3P73A 1TCRB 4XXCA 5LWYL 4MQTB 5EC1A 1P9MA 5T3XH 4EKXA 4IOSD 1AE6L 4OD3L 4Y8DC 2NX5B 3BXNB 3TP4A 4NO0A 4GMTH 3H9ZA 3UYRH 4MJIE 1D5IL 1S7TA 3FQRA 5DMGC 5J13B 3ULUD 1J5OL 3CDGA 32C2A 1NGWA 5HVGB 5GJTH 3S96A 1PZUB 4UQ2A 2MFNA 1CWVA 2DKUA 5EN2A 2H6PB 3V6OA 5I1CH 5IT2H 5I6XC 1VFBA 5JXEC 1RUPL 2QTEA 1XGPB 3U46A 5F3BB 3D2UD 4X4XA 4KY1L 1BF8A 4NM4H 1ED3A 2YRPA 3D39E 2DQFA 1MELA 4X7TB 5FB8A 3HNTH 1PLGL 2V5RA 5LCVL 1X5ZA 1EHXA 3IXAA 3RWIA 4M5YL 4XNZC 1L7IH 3C5ZB 2NW3A 4XNZB 3RWHA 2VO5A 5GRVK 4AQOA 4R90H 4JR9L 5I73B 4LFHD 4HUWA 2CDGB 2I07B 2I07A 4TRPL 3K2UH 2C4FT 3B2VH 3NCEB 1IGTB 4DCQB 3W9EA 2HTLC 1VFAB 4XAKE 4P9MH 1KJVB 5JR1L 3NTCH 4R6UA 4ZO8A 5JW4M 4J3TA 1T22A 3MLPA 1JI2A 1CXKA 3LS5L 3QB7C 4WW2F 4JY6B 4WW2B 6CGTA 4XP4L 4BELD 5A16B 3F65A 4YHLL 1KXVC 3BT2L 5FA4B 1NKRA 1KNOA 1NANH 4U7SA 3MA7A 3WS3B 3IDXL 1MJUH 3QUYC 1M7IB 3KPOA 4JGMA 1SEBA 5D1XD 4NNYB 4M62H 3RUGA 1ODAA 3X11A 5I8EA 4H1LG 4MA7H 3DO7B 4OLYH 5I1DA 4YLQT 5BMFL 4WV1B 4WWKA 1GHFH 4YDKL 3V7AG 2XT1B 4R4ND 5F6HI 1OARH 4HDIA 1FYTD 2CKNA 4LSRL 3JWOC 1UYWH 3WLWD 43C9A 1YEEH 3PL6C 2W07A 1XEDA 2Y36L 1UEYA 2WBWB 4Q9BA 3ZDZF 4YXLL 3LDBC 1QSVA 2E9BA 3OX8B 2FL5A 4PRNB 4LCWE 4XH2B 3VW3L 3AS1A 5FGCE 2F54E 5D5MF 1I7RB 1JGDB 3MNVA 3E2HB 4FFVC 3GRWH 5ICYB 4KKLC 4J4PC 4LOUC 1CLCA 2XNAA 3ZKXC 1G6VK 5FCSH 2VZ1A 3GIVA 1VEPA 2PO6B 2VLME 3O4OC 3RKDC 1G7IA 4K8RC 5EC1B 1ZGLP 3P4LA 4O9HH 3I6GA 1BLNB 5J9PB 4L4VA 4PJ9D 5I71C 1LEKB 1HH6B 3ETBF 4XP9L 3CDFA 4O4YL 2A6IB 2LQRA 1QRND 1R3LA 1WAAA 4ZS6C 2NY0C 4L8CA 5GGRB 1AD9A 3NPSC 4JZJB 3QEUB 2JJSC 5C8JB 5GQBA 4QF1A 5BZWA 5DMGD 1J0HA 4XNMA 3MRPB 4FQCH 1EVUA 2BVPB 5D72H 1GZPA 3N1PC 2NY0D 3GJFH 4PRAB 5IFHH 1JZ6A 4J3WA 3V7MA 3RBSA 4DEPC 5DR5L 2WINA 1QQDB 4KI5D 1AC0A 4JM4H 5EIQA 5TE4H 3BKCL 4HQQL 4XNYL 3GJFK 1D5XA 4X7EC 5D7LA 5IBLC 2DMKA 4BZ2H 4LSRH 3QPQC 4C4KO 1A7OH 4Z8FL 4WHYG 1NMBH 3NAAL 4GG6B 3CUPB 1U58B 3C8DA 3PWLB 5DXWA 4Z5RB 3NIGE 4F9LA 3O9WB 1M05A 4RGMB 5IV2B 2E6PA 4ODWA 1A2YB 4M43L 3LN4B 4OB5L 1J11A 1YUHB 4JFPA 1BQUA 4DAGL 4CVWA 2O61B 5HGAA 1JNHB 5TE4L 1ERNA 3MXVL 3RGVA 3VWJB 3QBTB 3TBYB 1LNUA 3C6SA 3D3VB 2V7HA 5TDOA 3PWVB 4HEPG 3GNMH 4MJ5A 4LPVA 2FJHB 3QAZC 4HXAH 1T5XA 1CE1L 3JWNC 4LSQL 4O9HL 3L3DB 5DQ9A 3G04A 4B50A 1HQ4A 4LL9A 4OCYH 1NAKL 3VFNA 3WEXB 4L4TD 4JLRB 3L3JB 1JWSA 1A6WH 3F5WB 3MGAA 1EBPA 3LB6C 4U6XB 4ELMB 4ELMF 1URLA 4KTYA 3MLUH 2JB5H 3EFDL 1UCBL 4TQEH 5GS2D 3BWAA 1WZKA 5JXAL 1YY9D 4X4MA 4LAQH 2X2YA 3OV6A 1QFWH 4FP8H 3GSOB 1AP2A 3VJ6A 1AHWA 4HCRH 3X13A 3GZKA 4YXKH 3ROLB 1E27B 1G84A 4PRPD 4OLZL 4LNVA 1PD6A 3CFCL 2MNUA 3G9AB 5DUMH 5FO9B 5CUSL 2JJSA 4OBSA 1K9TA 3K74B 3MO1A 3H3PL 4N0YL 3VRIB 1CDHA 1GC1H 4GKSB 4JCLA 1TJHH 2IQAA 3ZDYE 4LNRB 4CU6A 2FYYB 1MLCB 4RZCB 2ARJA 3CFEB 4JHWL 2BZDA 5HHNB 5IWLA 4MVBD 5JIKA 1V7ML 4LLQB 5D7JC 3ZYJA 4G6JH 4XBEL 3DMMC 2FBOJ 5L88L 5JLZA 3O41B 1R5WB 3NFNB 3GJEB 1A1NA 1LK2A 4S10A 2ED9A 1QBLL 2OSLB 3X12A 4FZEL 12E8H 1EVTC 1CGSH 4K7PL 1UT9A 4JDVA 3ZSTA 1BD2A 1PQZA 1VFMA 1QO3A 2EDJA 2VZVA 1ZLVH 3MV11 4Y1AD 2DQDH 2ITDB 4Y4KD 3FB5B 4TNVK 2XACC 4WEUD 3UDWC 5JORA 5D7LB 1K2DB 3UPRB 3ARDC 4LARL 2HJFA 1WBXB 5MI0C 2PTVA 4TRPH 1QR4A 1HHKB 4OF3A 4EIZC 4JGJA 4NN6C 4R4NC 1WEJL 1X6NA 1UM5L 3SCMB 2A9MH 1CD0A 4S0SD 1EZVY 4S2SB 1II4E 2XWJA 3GSUB 4OM1L 1LNUB 2AQ2A 3B5GA 3PDOA 3QIWB 3DUHA 3D0VB 5CSZA 3X3FH 3QRGH 2O61A 1AKJD 5LGJA 2YMXH 5A43C 1OLZA 4OGAC 3VFPB 4N90E 1ACYH 4P2QE 4F80A 5L8LB 3EYUL 4OM0L 5DLMH 5MEOA 2DIBA 1AGEA 5C6PB 1DLHB 3S7GA 3L3DA 1A7NH 1KEMH 2HTLD 5CBAB 1YNLL 3KS0J 5JZ7D 2EDRA 4GO6B 4YFLI 1KUMA 4EUPB 5HD8C 3LKSB 5DRZA 4BSWB 1E28B 4G6JL 1F58H 2OTUB 4ZUSA 3OG4B 1Q9KB 1Z0NA 1H5BC 1P4LA 2R2HA 3CFBA 3AMKA 3UTTA 1NEZA 4QWWC 1PSKH 5T3ZE 5GGVH 1T04A 1EPFA 4U6HB 3WFCH 5BZDB 5ICXB 1R5IA 1NCTA 5AEAA 1MIMH 2GTWB 1N3NA 4ZDHA 4AH2B 3D25B 4WU7B 2MHAB 5IB1B 5F21B 3OB0K 2Y72A 1DP0A 4HFUL 4MJIA 2NY6D 3CSYA 3ULUE 3QXWA 1A3LH 1MCOL 5E2JA 1CD1B 5E2TL 4CDGC 3TZVC 4GRWH 3IF1A 3O8XA 3O2WH 4LIQH 1KYOK 4PJEF 2VDQL 1UJ3C 4YFDB 5BCAA 4JCMA 2CXGA 3QNZB 3F58H 4JO2L 5C70A 2WZPD 1E4XH 15C8L 4JDTH 1P84J 3CFEA 2VN7A 1OSZA 1QLRA 3PP4L 4QRSB 1NJ9B 2VL5B 3AAZB 4B0MM 2DM2A 3ARFB 5E9DB 5FUZL 1C5DB 4WW2C 2OR8A 4NZDA 2Q86B 3HI1B 2H2SC 3HE7D 3OX8A 4GAFB 4BQBA 5DMYA 4AIOA 5KSUA 1U3HB 4HIEA 1YPZF 3P0VL 2B1HL 1YPZB 2CLVB 1SMOA 3KPPB 2NXYC 5MENB 4LLMB 5CKAA 3AREB 2R0ZH 5CZVH 3V2AR 5TH2B 1IZJA 1PFCA 1I8MA 4O51B 2YA2A 5FKAB 3OKDB 2H8PB 1WC7A 4WCYH 4QY8A 3S4SA 1MCPL 1T80A 3V5KA 4GW5A 1FLRL 3DO3A 4QEGA 1TENA 3SQBA 1Z3GH 4G3YH 5EFIA 3VD9A 1H3WM 4ZOAA 4O2FA 2XA3A 3PHQB 3MQIA 4PRNA 3BMWA 4FTVE 4R9HA 4WFHD 3G5VA 2YRLA 1FYTE 3I50L 2B7DT 3QEQB 4P46D 4QT5B 2RJMA 1VENA 4PJHB 2Z9TA 4YUEH 2CRZA 4FFZL 5IKCB 1RD6A 1I9JH 4QOKB 1WF5A 3U36B 3JUZA 4B7IA 2CKBA 3LS4H 2BXYA 2EDNA 4JHAH 3OAZK 3D85A 2R4RL 4G7YL 2N1KA 3PJSA 2OZ4A 3BE1L 3PDGA 3AGVA 1XGQA 5GRUH 3RWIB 2KZWA 5KSBB 2J6EA 1A1MA 2FSEB 1T21B 5M7QA 4G6FD 1N5AA 1U8LB 1OPGL 3QRFM 3MRRA 1BF2A 2OR9L 1F3DJ 3B5HA 3BH8B 3SPVA 3QDGD 5T1MB 5I15L 2HG5B 4Y19B 2ESVE 4JG0H 3MROB 5C08B 3K8MA 5HXMA 1R3JA 3G5ZA 1FAIL 1QLFB 4L9LB 3MUGA 4X7SH 1CCZA 2Z8RA 5D7SH 4K23L 3JBG7 2Y25A 4PTTA 2P5EE 3TYGH 5I1JL 4JVUA 5DO2C 1U58A 4HXBL 2Q86A 4MAYA 3O3UN 4AT6A 2VLKA 1OTUC 3HMWH 1MSPA 3VCLA 4F2MA 1WZ1L 1B0RA 4LDEB 4JZOB 4Z7VA 3ZL4H 4HKXA 1V7NH 1U8KB 4IM8A 5BQ7A 4UDTB 2AXJA 2DQIH 1FVEA 4JO2H 3U0WL 1LMKA 1DEEB 4HIJB 2EE6A 4S1SH 4M8VA 5FGSA 2W65A 3IFNL 5DJCB 5DMKA 3SDCA 2IADB 5B38A 1KPVB 5E08H 2A1WL 1KCUL 3LKQB 3FFCB 4PRID 2CIIA 1MI5E 3WFBH 2W60B 1TJHL 4K7PX 1MCEA 3VFWA 3IDMA 3LRGA 3V5KB 1MHCB 5D96B 5AZ2H 3L3OB 2HKHH 2QSVA 3ESUF 3BKYH 1ZEAL 1V7MH 5DC9B 3M8OL 4JHWH 1TJGH 1T1WB 2R2CA 4Q6IC 4NHUA 1HHIB 1FPTH 4LSTH 2YWZA 1OWWA 1CK0H 3P73B 5C9JA 3QCTH 3SGEI 3DV4A 2MWCA 3D69A 4PY8J 2ATKB 4F9PC 5E1AB 4ZPTA 4A6YB 1J8HB 4HWZA 5M94B 1F3DH 3ORJA 3FB7B 1H0DB 4DZ8A 2XZQH 3HI5L 2AJ3B 5DK2B 3HAEB 3CMOH 4X6BA 3U7YL 1GOGA 4MX7A 5I30H 1WWBX 2H41A 2MKLC 3SDXB 5IR1A 2CMRH 2HVJA 4CVUA 2IPUK 3S8WA 4MA8L 5FM4A 3LVEA 1ZSDA 3D48R 1I3RB 1RAMA 1BJ1H 3A0OA 2CDEA 4J23A 4ZUVA 3TVMD 3D9AH 3SEPA 1XCTB 5JDJA 1TZHB 4AL8H 1U3YA 2BNRA 4X0KB 1ZS8A 1HXYA 1T4KB 2E8YA 3TO4C 3BE1H 3ZTNL 1UYWL 3UZEA 1H15A 3V6ZA 4ZYKB 4HF5L 5TPWL 4EXPX 3QQ4B 5D2NE 3CDYA 2BK8A 3HLAA 1R3KB 4WNQB 1P7KB 5A2IH 4KXZI 3TWCH 4G6AC 5HI4C 4H26A 1AXIB 5LWYH 1NBZB 5IB2B 1W0VB 2YD3A 1YDPB 3LRHA 4ONOA 3KYOA 2HFTA 2QQLH 3C09C 1UM6H 5HHXL 4WFED 5FHAL 3EBAA 4MLIA 1A6UH 4JPKL 5D2NB 3VXMB 2XKNA 5A2FA 3MV8D 3QUYD 1INEH 1IT9L 1QBML 4BSWA 1YQ2A 4IS6A 4LCIH 4BUHA 3ECBB 1VEOA 1JNNH 4P46A 4M9PA 4OLWL 1LEGA 3EZJB 1U91B 1FE8H 2F19H 3BQUA 4XVSH 5D4QA 3VFPA 5EZLB 2PO6C 3P4NB 5IGXL 4N9GA 4AIZA 1HINL 1FV1B 3ARGA 4LSUH 3PABA 1DBAH 1LO3L 1NSNH 2MMXA 4P4KB 2VLRB 4L4JA 3TC9A 2R69H 1U8JB 1G7LA 4P9HC 3CFKA 1RZGB 2ZJSH 1SYVA 1HK6A 5FGRA 5DEZA 4YJZL 3T1FB 4WTZA 1UVQB 4JVPA 5HPMB 1VGKA 1KN2H 3VI3E 5HHMB 5KZCB 3O2VH 4M3JA 4YX2L 1FYHB 5HYJA 4JKLA 1M7DA 1NFIA 5LAXB 1IAOA 4QTHA 3NIFF 1IC7L 1HSAB 1UXWA 2DN7A 1INQA 2PW2B 4FQ1L 4I5BA 3TIDB 1AXTL 4R96A 4XI5C 1I1YB 2YD8A 5FM5O 5F7DA 4NKDA 3MV9B 4XHJD 5IMOB 4RRPG 1MVUB 1MVUA 5IQ7L 2ADJB 4KV5F 4D0DB 2XY2A 4HEME 3VFRA 1FORL 2R4SH 5I1JH 4DKDC 3ZLQC 4LSVL 4R4BA 2EC9T 4JN1L 3QDMA 4KY1H 5J11C 1F13A 4GKZA 4MZ3A 4N68A 4Y89A 4H8WH 2HRPH 1G7PA 1LK2B 5GRWA 1CFNA 4P2QB 4WI3A 4HKBA 4KKAC 5CMAA 3DURA 4CBPA 3GM0A 2D4DA 2UV3A 3N50A 5INDA 1IC1A 1GZQB 1U2CA 4IMKC 2AV1B 2DQCL 4QRPB 4I3SH 2C3GA 2V5TA 3ZKMD 3U83A 3VD7A 4PJ9C 4OTXL 1YEEL 2BY2A 5JORB 4XHJC 4DVRL 5HI3C 3AS3A 5EFIB 2VQUA 3T2NH 2Z92B 3TA3D 3VWKA 4LASL 4PJAF 1S7WA 1JF1B 2R1XB 3VRJA 3I3BA 1ES0B 1TCMA 3RVTC 5C7XH 4QHLB 2NXYD 4MQ7B 1MEXH 4NYLA 4RIRB 4RIRA 3WDJA 3K46A 4O51A 4M00A 2A74B 3L7EB 3HE6C 2NY6B 2UWEE 5DZNA 3TPUA 4BSJA 1EMTL 3MMEA 4WFEE 3U0PB 2BNUB 3TBSB 4GXUM 2FBJL 4V1DA 5JW4R 3T0DA 3ULSB 1S9WA 4H5SA 1G7MB 3VXUA 2AK4A 4I77H 4M6NH 4JPWL 3HNTL 4FQPA 1YY8A 1G7LB 3CXDL 4FQCL 1DSFL 4QHNA 5I76B 5HDBE 3K8LA 3V7AE 2IH1B 4OSUL 3HC0B 1I7UA 1DUYA 3GRWL 3MXWL 4M7LT 3CPLB 3TZVD 1B0GA 4HUKB 3UEZA 5MERB 4X7DC 5MERA 1MFBH 2SEBB 5ESVB 4GT7A 3EO0A 2EXWC 2F53A 1VADB 2OXHA 3OPZL 1JRHI 4JFQA 3ZE1F 6FABH 2IMNA 2YKLH 3EYOA 2GTWA 3SGKC 4GLRI 4RGNE 5CIPH 3TN0B 4F7EA 1Q0YH 3AROA 3HS0B 2PR4H 5CILL 2X4QB 4LHUG 3KLHD 1SEQL 2JE8A 2VDNL 4YHYC 2H32B 4MZ2A 1IBGL 3OAYH 4HUUB 1F3JA 3OQ3B 3BRDA 3ARBB 1KJ2B 5F88A 2CLRB 3F12B 4HDIB 4TVPE 4NNXA 3OAYK 5AYUL 1QHPA 3U82B 2AJSH 4UTBL 2BY1A 3BW9A 4JPKH 1ADQL 4HPOL 5E4EB 3D18B 2VNCA 4LLYA 4XWGH 4YHOL 3PNWA 1MIEL 2EKSB 4X5WA 1KCVH 5E4EC 2JLLA 1NDGB 3P9MB 1IEBB 2JF1A 3RVXC 5H2BA 5J6HB 3I50H 1K8DB 4OM0H 4QRRA 5DEGB 3NFNA 3HHRB 2BVOB 4L8DA 1FQ9C 2NYYC 3BZ4A 2HYMA 5EIVA 2ADGB 2DYPB 3TO2B 1U3ZA 3HZVB 4JFYB 4LAQL 4CN6A 4Q9QL 5D2NC 3O4LB 3FRPG 4BH7A 5EOCL 1KPUB 4GMSH 5HJ3B 5HJ3A 4YGVA 2V5YA 4OLZH 1GJIA 3AU1B 3HKFA 5L2KB 3KWWB 3SCMD 3LN4A 5C09B 4KI5C 4KQ3H 3WKML 4YHML 1C1EH 2YR3A 3OJMB 5GIRA 4ODXA 4Y16C 4HFWA 4JJ5A 2WK2A 4JZJA 4PD4K 3M17A 4NCC2 4WGWB 1XF3A 1CFTB 2E7HA 3GK8H 1EXUB 5DYOA 2GCYB 4CVXA 4PTUB 3S97C 4Q9RH 2CLZB 1FCGA 3MLUL 3NCBB 1EA9C 2Q7YB 4AEEA 1RZKL 3GHBH 4ETQB 1LP9A 1T5WA 4NT6B 5B4MC 3GRWA 4MA3A 4MVBC 1RZ8B 1LD9A 4K3EH 1YPZE 4CMMA 1L0XA 5EUOE 1FNAA 5GRXG 3RJDA 2R8SL 4UOW1 4EI5A 2VKXA 3KYNA 3ARED 2OQJB 3TCLB 1DVFC 3I75A 5KSBA 4NO5A 2VITB 3UJTL 5BZWB 3VFOA 2EIEA 3BSZH 1FL3B 3NIDE 1UEMA 4J4PD 1RZFL 5DUBA 5B22A 3MJ8B 4U3XA 1RULH 2EYTB 4BK4A 5DD6B 1A7BA 1MIEH 2Q3ZA 4PG9B 1IFHH 4PRIB 5D70L 3TEUA 3V0WL 4N8VB 1CLYH 5T5NF 1T0NA 2FIKA 4RGNC 2ZUSA 4X8XA 5HHMD 3ILPB 3L5IA 5EO1B 5CP7A 4RA3A 3BPLB 5DQJA 1OP3H 5HY9A 4Z7UE 4XVTL 1U8PA 4K7FB 2GYSA 4TULL 1Q38A 4KFZC 5DJ2B 5E8PA 1T2JA 4M4PA 2AS5M 1MRCL 4HWBA 1C08B 5JOEA 5E9DE 3VMNA 4EN3A 4HQQH 3QNYB 3O9WA 2ARJQ 3GSNA 5E2UH 1SEBB 2V7NA 3CZJA 3CFDA 1CU4H 3IJSA 4PJDB 2PXYA 1INDH 3VCLB 3PUCA 4JB9H 4NPYA 3Q3GA 3F5WA 3QRGL 4TNWK 5JR1H 5SX4I 3UZQA 1H3PH 4UT7L 4KUCD 2QQNH 4OZFA 4ORGB 3ZE2E 4X6FB 4PRHD 2JB6B 3GB7B 3D85D 4LRNH 1TDQA 4PGZA 3AY4C 2P8MB 1DEDA 1I85A 2RFXA 1FNEB 3CZFA 4R4FL 5JW3L 1QLEL 2KQNA 3CVHB 3KPNB 1ONQB 4NC2B 3RGHA 3V5HA 5I1KH 1RJZA 5GJTL 1U3HA 2GTZA 5KJRL 4XNUH 2YXMA 3KLSA 1B0RB 4PREA 4C54A 4C55A 4DJMA 4F15B 3BRGC 1I8MB 1A6TB 1J05B 3PP3K 5BVJA 2BVOA 4ZUWB 2QHRL 3IFPA 4QO1A 1Q1JH 3V6FA 1ZXQA 1NCAL 2P44B 1IE5A 3MUHL 5KG9A 1FVCB 3SDAD 3SQOH 2Z35B 4BZ1H 3BIAX 2QL1A 4X5LA 5J3HC 3UYOD 4BKLA 3FN0L 3IRPX 3KLDA 3UCRA 5IIEA 4IOIB 1OHQA 2OR9H 3S5LB 3PHQA 3DI3B 5TQ2H 3DETD 3MCKB 3RVXD 2GK0B 4WTWA 1J0JA 2BRRL 3B2UD 3QDJD 4PJ8A 4YXHH 4KKAD 4J8RB 1BX2B 3RWDB 4QOKD 2YC1B 1ZLSH 2VDLL 1HIML 3IU4L 4P2OA 3UMTA 1X3DA 3I9GH 5TE7L 5B21A 1Q0XL 1EAPB 4I3SL 5ILTH 3DX8A 4NWTL 5C07D 3BGMB 2Q20A 4YHKH 4G5ZH 1FZKB 2FATL 1JV5B 4J6RL 3S37X 1PSKL 1LEKA 1O7SA 3TJHC 1X5HA 3OKMA 4KJQD 2VMFA 4M7KL 4N0FB 3U36A 4OIIL 2E5EA 5EA0L 2EYRB 5DJ2A 4JKPL 1FN4B 4F7TA 3FQNA 4TVPL 2KQMA 3ZE0F 1BJ8A 4JM2F 3EJZC 2OJZL 3S35H 3QWQB 2G5BA 5GRJH 5BVPL 4Q97A 2R1YB 4JZNA 2AJXH 1EAJA 4HHAB 3K2UL 4PJ9A 1NC2A 4XPTL 3UJJL 1N64L 3RNQB 2VQ1B 2XY1A 5LGJB 1UXSA 5EU7C 3HPJB 3THMH 5IFAL 3O11B 2CR6A 5J6GB 5EU3B 3FFDA 1U8QB 3TBWB 3MV9D 4PJXF 2WLZA 1TPXC 4GG8B 1M1SA 3LQZB 4QHUB 5IFJA 3SCMA 4NIKB 3MV7B 1SY6L 4P5TC 2PTTB 2HJKB 3HB3C 4OKVA 4YK4B 5T33L 1RUAH 4YHPA 5D1XC 1PG7X 3NZHL 2X1XR 1OTUD 3TT3L 1GCFA 1H8OA 1U8KA 2Y1VA 3VXNA 1YEFL 4L5FL 1TMCB 3HI1A 2JB6A 3MA7B 4R7NB 1B0GB 1XR9A 4JFFB 4QRUB 1A7RL 5GS1C 3TVMA 3VA6A 4B5EA 1QKZH 3GNML 4G8GB 4IDLA 4YE4H 3BN3B 3UXFA 3VFMB 2G9HB 1VERA 3TV3H 2UY7A 1QRNB 3EDJA 2MCPH 2C7UA 4O2CB 4OF7A 5HHOA 1KC5L 3WJJA 5GRUL 4OFYD 1OWRM 5GXBB 3NMEA 2BHUA 4R7DB 3MOAH 2NY0B 3SKJH 2XWBB 4I1NB 1G9ML 4X4ZA 3OKOA 5C07B 2FD6H 4PUBL 4V1DE 4RMQA 1Q9KA 5KS9F 1NCBL 3QH3A 3BMVA 3V95A 1TCRA 3K8KA 5ID1B 4I18C 2NY4B 3VFSB 1GOHA 2AEPL 3OKEA 5B39B 1FZMB 3NABH 3IETB 5FYLE 4NRZA 4Y4FC 5KN5B 4OLUL 3GSNH 2ATPA 4GLRH 4MXVF 3VFTB 3LQAL 2EYSA 4UTAL 4EEEA 4D0CB 1KB5B 2OS7A 2BHYA 1CN4A 3OJ2C 3RDTA 1A5FL 5SWQA 1NH6A 4G9FA 2HTKD 4PRHB 2RGSA 3ULVH 1H8NA 3LKOA 3PWUA 5FYKD 2D31B 2UVFA 1JHKH 2QEJA 3N85L 5C0CD 2FJGB 3D2UB 3LAFA 4U4BA 4ZPTB 2NX5A 2CLRA 3BXNA 4P23C 4XBGB 3P4OA 3ARUA 5GGTH 3F7YB 4NZUH 1PG7L 1BJ1J 2D7NA 4W4OA 4C58B 5I1HH 4ELME 4F58L 1EV2E 3FTGB 2EO1A 4KVNH 5E7BA 3I6KB 3MV7D 4OKDA 1CDJA 3NFPB 5T3ZL 2OTPA 3OMZA 3SY0B 4PJ5D 3VWKB 5IV2A 4Z7OE 4JFZH 4Z7UF 2GW5A 2CSPA 4KKLD 2WV3A 4M7KH 2J6EL 1OAZL 5IGXH 3N85H 5FFLA 4AQ1B 1WC7B 3P4MA 3QIWC 2VLJB 3BN9C 7FABH 4MNQA 1F90L 1A7PL 4W68A 2V2TA 5SX4H 2EDXA 3BPNB 4MJ2A 1ZHKA 5FOJA 4M62L 1MH5B 1WBXA 1NC4A 2AABH