4RQQB

Crystal structure of human fab pgdm1400, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
239
Chain Sequence
QLVQSGPEVRKPGTSVKVSCKAPGNTLKTYDLHWVRSVPGQGLQWMGWISHEGDKKVIVERFKAKVTIDWDRSTNTAYLQLSGLTSGDTAVYYCAKGSKHRLRDYALDDDGALNWAVDVDYLSNLEFWGQGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human anti-HIV-1 antibody PGDM1400 light chain
publication title Recombinant HIV envelope trimer selects for quaternary-dependent antibodies targeting the trimer apex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 239
sequence length 240
chains with identical sequence D, H
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rqqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rqqB01
3KLHD 3BHBB 2A73A 1CBVL 5ETUA 5ID0A 2NY3D 1CVSC 2FBJH 3IB4A 4PTUA 3DUHA 2ZSWB 5DLMH 1A4JB 4S1SH 3P0VL 3RWFA 1C5DB 1TPXC 3HE7A 4HKXB 3SCMC 1ETZA 4ZYKA 1NANI 3Q6GL 3O0RH 5IB1A 1HHKB 2VDKH 4KK8C 4L3ED 3WDJA 3B9KD 4RAVA 5IJVA 3SDXA 4QXUL 5ANME 5E8DL 4NBZB 4UB0H 1JK8A 5B4MD 4CMMA 4OM0L 3ZL4L 2X5PA 3TT1L 2IAMB 1EEUA 4IIQC 3WUWG 2OTPA 1KSRA 4BUHA 1TJIH 4NO5A 4JGMA 2WK2A 4U0RB 4NQDB 2ZG3A 3DSNA 3RZCB 2W0FB 5J56B 1QFWL 4Z7VA 5KAQG 1A5FH 5JOFB 4XAWL 1JBJA 2LV4A 4XBGB 1J9CT 1P5UA 2HT2C 4POUB 4P5TC 3QWRD 2VIRA 4AEIL 1PFCA 2XZAH 2APXA 2Z9TA 4P9HL 2DKUA 5LAXA 1F3RB 5CBAB 3D3VD 3MZTA 2YN5A 4IMLB 3U0TA 4YDKH 2A83B 4G3YH 5CEZL 3OGCB 3BGFC 5I1GL 3QJHA 1X7QA 2WBKA 1EEYA 4DGVL 3CFDB 2CR6A 4NFCA 2DL2A 2V2XA 4JREC 5T3ZD 2FD6H 4HLJA 1A6AB 4WO4A 3QDGE 4LSUH 4GAYB 4LCWE 2EXYD 2LTQC 3O2DL 1U0QA 5FA4B 3N9GL 1MREL 1QSEB 4YNYB 5DD5L 2OBGA 1G9MC 4L29A 1AP2A 2Q8BL 1C16B 4B0MM 2F58H 3MLRL 1OAXL 3L9RB 4GKNA 3UO1H 4X80H 1DEDA 3DO3A 4UOW1 3SGKA 5KTEL 5IB2B 3JBG7 4NJAL 1IGYB 1MI5B 2BX5A 5CAYB 5IKCA 3KLAA 1UM6L 1HSBB 1KB9J 5C0AB 3CFJB 4NZTL 4JQXA 4PGJA 2MSPA 4WTXA 1FJ1B 4P3DB 2VZVA 4JFEB 4I5BA 3G5XA 3RY4A 1X5YA 3B2UC 2ZWLT 3WUWB 3GIVA 1UT9A 4NO3B 3IKCA 1Z9MA 5I2IB 3LIZH 4EQ3A 2P8PA 4G6FB 1H3GA 2N7AA 5E2VL 4JRXD 2LU3A 3TBTB 3TT3H 1TDQA 4Q2ZA 1QRNA 4H25A 5DXWA 2AJZB 4Y19E 3RVUC 2ZCLH 3B5HA 5KG9B 4R0LB 4U4BA 2Y6SC 2BC4A 5C0GA 5F88B 1JPGB 1U8LA 1HHIA 1I7UB 3HMXA 4PG9A 4QGTA 5EFIA 3T65B 4EI5C 4YK4B 1I1AC 1Q94A 3OR7A 1JHTB 1HHGA 5DVMA 2EYRA 4I3SH 2DICA 2PN5A 1QEWA 2FO1A 3MXWL 1NCTA 2WP3O 3IJSA 3PHOB 3SGEI 4BQCA 4XH2A 3OAYH 3CXHJ 1NSNH 2GJZA 1YJDH 4O02L 1OTTC 1RK0A 5E4EC 1CLOH 4U7KA 2ZCHH 5HI3C 4K94C 5C0JB 4U6HB 4BFBD 4EXPX 4G42A 1TTUA 5IB4A 4BFIB 3GSXB 5DJ6B 3E6HA 4M3JA 4NPYB 4BQ6A 1UGNA 4K2UL 4GSDH 1AHWC 2UWEF 4JPIA 4XNZB 1VEPA 2HH0L 1SEBA 4IRJD 4NSKA 1MFBH 4WTZG 4O4YH 1MVUA 1S7RA 2YOCA 5ERWA 3SE4A 4QYOB 1TJGH 3HRPA 3VGFA 3HUJF 4JVPA 4PJHB 3UYPA 5BV7C 2P48B 4OV5B 4N5UA 3C60D 3AC0A 3RFZC 2GAZA 1KFAL 2OQJB 1ZS8B 2IQ9H 4F9PC 3ILQC 3IXTA 4PJCA 3TZVD 4Y2OA 1LO0H 3F7VB 1O7VA 1KBGH 1P6AB 4NJ9L 1M71B 5IM7B 1ITCA 2IBZX 2H1PH 3GBLA 3GK8L 4JFXA 1MJ8H 1ZT1A 3ZE1F 4M6AA 1VGEH 3QNZB 4Z9KB 3WJLC 3L3IB 4XPTL 1ZGLP 2C5DC 3QIWA 4PJBA 4JM2D 3KLHC 3B6SB 2WWKO 2ZZUT 4J3VA 5L0QC 3IFLL 1ZAGA 3VMNA 3TBWB 1A6VL 5GGRA 4DZBA 3Q1SH 1IM9A 3MXVL 4Q9RH 3HE6C 4NGHL 1IC7H 1VERA 5D8JL 3GSUB 4UUJA 1XH3A 1RFDH 1WIUA 1HDMA 1YEHL 2VLJD 2AJVL 1FGNH 4D9QE 2F5BH 3EYUL 2IH3B 4UOW0 2GFBB 3ARYA 4FOMA 4NRYA 1HOCB 2BERA 2JCCA 2YD9A 3RL2A 2NLJA 1A64A 1NBQA 2RIKA 1V7ML 2AABH 4G8EA 1I3VA 5EU3B 5F1OB 12E8L 2BNQB 2E7MA 5DYOB 2YUZA 1ZLSH 4WI3A 15C8H 4HIHB 1A4KB 3UAJD 2VISA 5D96B 5E7BA 2XKUA 3H3KA 1NCBL 1A7NL 4LVEA 3UBXG 3BKJL 2Q20A 1WWCA 5JW3H 4PY8J 5F96H 1TTGA 1CU4L 5I16A 5HPOA 1QSFA 3IDNA 5E6IB 1BF2A 4MNHB 5JR1H 2RB8A 4XVJH 1JYNA 2XT1B 3MRJA 1EXUB 1PQZB 2BOCA 5HDBE 5D2LF 3STLB 4PRHA 4Z7NF 4CADA 3VG0L 1BIIA 3U6RA 1A6WH 1OPGH 2Y5TA 4PREB 5HHQB 2EXYC 3G6JE 3I02A 2BNRA 2DLTA 4F2MA 1EX0A 1CCZA 4R4NC 3EW3B 1QACA 4ZDHB 3UJJH 2AK4E 3O45B 1YNLH 3QEGH 4BH7B 3NOIA 2IANE 2WUBH 2X1WL 1B9ZA 4KK9C 4L8SB 4F57L 1K8IA 1QFPA 1D5BA 3ISWA 3VFMB 1FFRA 5JHDA 1G9MH 2CLZB 4YGVA 5I8KL 1IZKA 4OGAD 1A9EB 4AIZA 3U83A 1YDPA 4PV9A 5C0IB 4HWBH 1DE4B 3F7RA 3TPUB 4IDJH 5FYKE 3VFTA 4J6RH 3MV7E 43C9B 4NZRL 2CGRL 4X7TA 2UY7A 4J2XA 5I1EH 5I1HH 3W0WA 1KCKA 2XZCL 4N5EC 5H94B 4ZUVA 3W39B 3O41B 5EU7E 1U8OB 1QBMH 4Z76B 2J6EH 3MV8D 3L5IA 4AENB 3UBXB 4QWWD 4Z7QF 5HVHC 4XNYH 3E6FB 3PIQB 1EGJA 4QOKD 3BO8B 5DVLA 3VDBA 5F6HJ 4F33A 3HB3C 4OZGF 5MEND 2FJGA 2IC2A 3KPMA 3D2UD 4IIQA 3CH1A 1KACB 1S9XB 1GZQA 4PG2A 1VHPA 3VXOA 3BDYH 1NFDE 2UWEB 4HWEH 1PG7H 3OAYK 5KVFH 3ARDB 4PJAE 4QHMA 1M6OA 1GH7A 3VWJB 3OXRB 4ODHL 5IMLA 3V6OE 1AD0A 1G7LA 4P5TA 3C8DA 1BFOB 5D7IF 2PCPB 4ZPTB 5F1NB 5CSGA 3FB7B 4JY6B 3M1BA 3HUJB 1BVLA 4O2CB 1RQ5A 4WEBL 4XMLL 5CIPH 5D72H 3T0AA 5EBMB 1NC4A 4YEFA 1FHGA 1FIGH 2QKIA 2W60B 5JIHA 3BX7C 3S96A 2VDOH 5AG9A 1BGXH 2MQ3A 2VXVH 4K94H 3GMNB 3V5HB 1JPTL 2AJUL 1UB6B 2J7LA 5FHAH 4ZAKC 4R90L 1KJVA 2VL4A 4RAHA 1FYTD 2Z31D 3RWGB 1GGYA 1P84J 2AXFB 4XWGH 4OZIF 5D6CB 1TVBA 3GUTB 3UJIL 4KKAD 3DUUA 1J11A 2XA8H 2CXKA 3VMPA 1XGRB 1J5OH 5BV7H 2WBJB 3PL6D 4HJGA 3J7HA 4BSWA 4HF5H 4I1NB 3T08A 1X5AA 4YHPB 1Y6KR 3REVA 4TTDD 4M7ZC 2JJSC 4NO0B 3FN0H 1JGDB 5FEBA 2BVOB 5SWSD 1S9KC 5GSRA 5GSVA 1CLYL 5C6TH 2FYYA 2J8UF 3BISA 1MCJA 2WINA 3RZCD 4RRPA 4OUOA 3VWKC 2DM2A 5DSCA 5ADPL 2NCMA 1UKTA 1FP5A 3SDDB 5AG8A 1G9NC 4JG0L 2H9GA 2Z4QA 1ODAA 3LN9A 4JPVL 3TBVA 3MRKA 4XBPA 5LXGL 5TQ2H 1W0YT 4ZS7L 3IDIB 1TQCB 3MQIA 2XXMB 3QQNA 3OZ9H 3LHPL 1A7BA 1I8IA 3RNKB 1FRGL 1KULA 4U7SA 1EJ6A 3M07A 4MJIA 4XMKL 5KJRL 2AI0L 5EUOA 3RTQC 4EI5A 4KK6D 2V5SA 1S5IH 3QPQC 1I7TA 4E0RB 4HFUH 1TVDA 4YZFE 3V4UL 3V6FA 6FABL 4TUKH 4IEFB 2CIKA 2VDQH 1NL0H 5FM8A 2DI7A 1SY6A 1H3PL 2LU4A 2R4RL 2Y5EA 1NGWA 4OT1H 2P7TA 4R6UA 3IU4H 4NN6C 5D2LB 2PNDA 3FHQA 3Q0HA 3MJ6A 3LEYH 4PRPE 1FVCB 1Y18A 1BZ7B 4CN6A 4LEOA 1T89C 1NMBL 3ARPA 4KC3B 4NIKB 1YYLL 3HTLX 3UPCA 4GKSA 4KMLB 5FCUL 1KJ2A 4FTVB 3B9VA 4PJ5E 5DMGC 5I76A 1CXIA 1OL0A 4XPBH 2G60H 3NVQA 1DFBL 3QHFH 5HYJA 1YNKL 2E9JA 1CQYA 3Q6FA 3RDTB 4XAKD 1TZGH 3RNQA 4WUUE 1HZHL 4LHQB 4XP1H 5C0AD 3QO1B 5I1DA 4U31A 1K3ZA 1HHJB 4OIBA 4QHUB 4IS6B 1R3HA 3EDEA 5KSUB 1G7QB 4LEXH 5DA4A 4PJ7A 3WIHL 3LKQA 4M43L 4EVNB 1XAUA 1MNUH 2ZUUA 4JHAH 1FNLA 3OQ3B 1OF2B 3LVEA 5FUZL 2ZUQB 5FO7A 5HHMB 1JE6A 1S3KL 5D1QB 2V5TA 4F9PA 2MJWA 2L7JA 4EOWH 1FVDA 3BAEH 1FZKA 1U8QB 4R96B 3H9SE 3QDJB 5DF0A 3CU1A 1R5WA 1MRDH 2EDEA 4HCRA 3G9VA 1XCTA 1F3DJ 2M1KA 1MJUL 3SDYH 35C8H 1INQB 5T5FH 2ILLA 2R8SL 4YBQC 3DYOA 1EJOL 1XGUA 1U6AL 2HKFH 4ZUSB 2UUDH 3FRUB 5GRYA 2I9TB 2VXSH 3L6FA 4OZGB 3P73A 2OTWA 1NANH 1G6RH 1RPQA 1KYOJ 3ZHKA 3QWOB 3GJEB 5TF1H 4HIEA 2A2QT 1B4RA 4FQIL 2Y25A 2CMRH 4FQLL 4PRIA 1MFEH 1JMZA 1FO0H 4MA8L 3VXSE 1QR4A 4O00A 5FYKL 1U95B 3C6LA 1A3LL 1DANU 5D7SH 1VFMA 4YUEH 5D7IB 1A21A 1TQBC 5L2KD 3MLWH 3UMTA 2A1WL 3BEVB 2YRLA 1SJHB 2CRMA 2B0SH 2G75A 1ZTXH 1Q38A 3BN9D 3WXWH 3QCTH 1E4XL 4YH6A 4O2FB 4U1SA 4Z7UF 2A9NL 2DQJH 1KCVL 2OYPA 5L2JB 4JO4L 4KZEH 1QO3B 2YPLE 3HPLA 3OMZA 5FYLD 1P4IH 5J6GB 5CINL 4S2SA 1A7PH 2VAAA 3CPLB 3CVHH 4W4OA 3VCLB 3GSNL 4N0FB 2ADGA 5DZNA 2VLKB 3KGRA 1NGYB 1PZUB 4OZIB 1T1ZB 3GBMH 4QY8A 5IB5A 3HCVB 5EU4A 4K7PY 1XGTA 5E8PB 3CFEB 4LBEA 4PB0H 1U9KA 1XF3B 2VZUA 4MA3B 3T3MF 2DI9A 3GJFA 3CZFA 3F5WB 3QH3B 4HPYL 4LSTH 5F7YC 3MO1A 3KPRB 2ERJC 4PGCA 3WBDA 1BREA 1K6QL 4LLQB 3X3FH 4PJFF 3DO7B 3VFUA 1NFKA 5F3BA 4XVSH 4XPGL 2R1XB 2H2PD 2OZ4A 3GI9H 4KKAC 3QFJE 2I07A 3NZ8B 4ZPVA 3DUSB 5DFVD 4ZFZA 1JUFA 2J8UB 4PGDB 4S1QH 1T04A 5I1AB 2WV3A 4NQEA 2FO4B 3O2WH 3OSKA 4PJEF 4X6CA 2OXHA 4XB7A 3F7YA 1WVZA 3O0RL 2R0KH 3ARBC 3OKOB 4NZJA 5E6YA 1C12A 5IIEB 3KYMB 5DJXB 4EN3A 1N64H 3NMEA 2XICA 3ARRA 1SYVB 3LKRA 2AEQH 3EO1A 4LLYB 2IAMC 4RFOH 1T6VN 1IAOA 4PIRF 1J18A 1PEZA 5EO9B 3OV6A 4U0RC 4Z0BH 2BNQD 5EBWA 1NEZA 1VFBA 4X4MA 4EI6B 2F19H 4TPRL 3O3UN 1AGFB 4PJ9C 4J4PD 1PLGH 4MJ6A 1EPFA 4LDEB 1OD9A 4X7SL 4OUUB 2FWOA 4IRZH 1YPZA 3MRCB 5EOCL 4X6BA 5TGBB 3PWVB 4K8RD 4HKJB 4YAQB 3MNZA 2D7QA 5D5MA 4P5KA 4Y5XB 4XGZA 1T5WB 4TUOB 1MIML 4UINH 2F74B 5SX4I 4HV8B 4RNRB 3TJEH 4F37F 2EYTB 3WEXA 4J3WA 2E3VA 2X4NB 3QUML 4BQ9A 4GRWF 4G7YL 5E6ID 1CFBA 1IM3A 4NKDA 5HGDB 1AD9B 3T1FB 1AKJB 4I2XA 1FNGB 2NPLX 5DI8A 3ZLQC 3MA7B 4ZXBC 4HWNA 4MQXD 2FD6L 1JNJA 3HC4H 2FL5A 1DQLL 1OP3H 3MLTB 3RA7L 3THMH 2OL3H 3PWLB 4YHIA 5GZOC 1DVFA 3CFCL 1WWBX 4YFLI 3PQYA 4APQB 3PP3H 4PJDE 2NQCA 4XPAL 3H7BA 4N9OB 4UV4L 3X3GL 3H9HA 3RVWD 2FIRT 2OTUA 4LFHD 4FQCL 4M7LH 4F7PB 3VXPA 1U8PB 3W2DH 4FFVD 1CF8L 2PXYB 2B8OT 4UT7H 4YEEA 5D7LB 1GIGH 3SQBA 3KHQA 4K3GA 5EIIB 1GHFL 3MRPA 2E9BA 4R26L 5GZND 4GH7B 1Z2KA 3WNPA 4DTGL 2XRAH 1AY1H 4XXDB 3H3BC 5KVGH 3P4LA 5FAAA 3SDAC 4K7FB 25C8L 5F7EH 4I48B 1AFVH 4F7MB 3QFDA 1LO4H 2JB5L 4K9EL 4PR5A 1AJ7H 2HT4D 5D7JB 4RX4A 3LKNA 2YEZB 3BN3B 3RWCB 3T0BA 4XB8A 2AV7B 5ILTL 3LS4L 4AH2A 2EKJA 1VB9A 1FFNB 1KXVC 3UX9B 3WNKA 2IPKB 5EH1A 2JJSA 4YK4C 4HIXH 4OFVA 2B1AH 2R0ZL 5A2FA 2GIYA 3LN5B 4F9LC 5E2WL 3WHXB 4OGXH 2VB5A 2UUDK 3IXAA 3WD5H 4L5FH 4KI5E 1CD8A 1I85C 1RUKL 1ZLWH 1P53A 3ARDD 3BGMA 4GW1B 4M1DH 1QLRB 1CVRA 5CKAA 3VWJD 4GRMB 4X5XB 1PKQA 3D39E 4POZD 4Z7UB 1LGVA 4TYUA 3DECA 2A77L 3BFOA 4QXGL 1T1YA 1BMGA 1NLBH 4QXTA 1CZ8H 5TDNB 3ZKMC 1PY9A 2FZ3B 2DKSA 1AO7B 4NUGH 5EWIH 5A16B 4XNZC 1F4XH 3ALWA 1QVOA 1NGXB 5CP3H 2VDML 4Z18A 3IJYB 1UFUA 2DQDH 4OLZH 2J4WH 3RJQB 3PHQA 3AY4A 4UMGA 1FNEA 1WAAE 4RISH 3VU2A 3GSRB 4G80A 2PYFB 5ADOL 3MGOB 1EFXA 3BZ4B 3CX2A 1LEGA 3FONB 1B2WH 4MCZA 4HKZA 3Q48A 5FECA 2HMID 1CE6A 1ES0B 5TJWK 3QO0A 3BVNB 1KJMA 3V79C 2VLLA 4I77L 4NKIH 3BZEA 5MP6L 4O58L 1NC4D 2DJUA 4XCCH 4JFQB 4OZHF 3E2HB 4J8RA 5DJAB 2IEPA 2VC2H 1MJ7L 4NO0D 2YS4A 1WITA 4PJEB 1IILE 1DZBA 3ZTJG 4MNGB 2VYRE 3VGBA 2H1PL 4QRRE 3CUPB 5GGSY 4RGNB 3NBNA 4XP4L 1OT2A 4KTYA 1NLDL 1FG2B 3SDDD 4ETQA 4JM4H 3SE9H 3N85L 1SJEA 4WFFD 5I73B 4L3EE 2XG5A 3KJ6L 1UEMA 2CKBB 4ZSOE 4DK3A 3I3DA 3Q1SL 1C08A 4RDQG 5HGGS 1PEWA 3QQ4A 2EEBA 3K1DA 1YY9D 1JNLL 4K7PX 5B39A 3ELAT 4FS0A 4N90D 32C2A 1RZ8B 4HUXB 4PD4J 2F54B 5BS0A 2XWJA 2NW2A 1YEKH 1R3LB 3HA0A 2P5WB 5M95B 5GJSH 3VH8G 3FQTA 4RIRA 2MFNA 5KSVB 2NY2D 2RHEA 1XFPA 1IC4L 2X4PA 4OZFG 1T7YA 1WWAX 2DDQL 1OAZH 4P2OC 3ESVF 3CLFL 4GRWB 3SEPA 4AEFA 4JHWL 1WBZB 7FABH 1F2XK 3QUXC 2VMFA 2X4SA 5D96C 4U6VL 15C8L 3L7EB 3LSOA 2R9HD 1MSPA 1N59B 4I4WA 5EO1B 4XNUL 4HJ0D 5D1ZA 3FT2A 3LKSA 1DTUA 2EDOA 3GB7A 3IS0X 3D0VB 3VRJB 1E4KA 4MA7L 4P23B 4MJID 2F9BT 5E6IC 1CDYA 3KS0H 3RDTD 5GGTH 5H35B 4V1DA 1BAFH 3K1KC 1B4JH 4I8DA 4TSAL 2JK5B 4XVJL 3KHOA 2CLRA 4XPFL 1A2YA 1U8IA 3V5DA 4LPXA 2X2YA 4IOIA 1UXSA 2VH5L 2VN7A 5FA3A 5KSBA 4JHBA 1OP3K 4OGYH 4AK1A 4HEME 5BRZB 1B0WA 3WLWC 5FM5M 3VXUB 3U46B 5GISH 1UENA 3PP3K 4MDJB 3BKYL 5L9DH 4FMFA 1NBZA 1W72A 4DKFH 4LNVA 2DLHA 4NWUL 4BJLA 2GCYA 4HULB 5TFSL 4ACPA 1DLHB 5C86A 1NGQH 4PGBA 4FFVC 3BUYA 5ESQB 5JZ7D 3NABL 2BDNL 2YRPA 1E27A 2L4OA 4KY1L 1X3DA 1ZHKB 5EOTB 5C9JB 1R3KA 3OKKB 3NCCB 2X4RA 4JN1L 4M00A 4ZFOA 1NCAH 4WI7A 3VH8B 1PW3A 3DX9A 2LQRA 5ICYB 1LDPH 2R2CA 2Z91B 2ZSWA 3OKNB 5EPMA 5ICXA 1OP9A 2X1OA 3QNXA 3GHEH 1F3JB 1EZVY 2DIBA 5CWSA 1JI2A 5DMKB 5F9OH 2O61B 4FNLL 1Y6MR 5E2UH 3ARBA 3ZKXC 3QG6B 2Y72A 2GKIA 1CXHA 1ONQB 1QZ1A 1Q9KA 2YSSB 3NACH 4Y4FA 4JB9H 3NCBB 3TNMA 3GRWH 4HKBB 4JQIL 4Q6IB 2DM7A 2Q1EA 5DURB 1G0YR 2CK0L 1CR9L 4NBYB 3QQ3A 1ZLWK 1T1WA 4PJ9A 1KPUA 2V2WA 4LSPL 1JHKL 3S8WA 1Y6NR 3VWJC 2D31A 4POZC 2I26N 3I2CL 4HS3B 1KC5L 4X9GA 1N6VA 2QADB 2DD8H 4IHOA 2MCPL 2VQUA 5GS1A 3U36A 2HJFB 4WFGE 3WHE1 5F89A 1FIEA 1AR1C 4XHQA 4HGKC 5EZLA 3V95A 2DLFL 4L4TE 5DJCB 2BOBB 4XZUB 5ISZA 1ULVA 2VXVL 3BD5A 2L0DA 3INUH 2EDLA 3BH9A 4OZHB 4ZXBA 1INEH 3FN9A 1HKLH 1P7QA 4JR9L 1YY8B 2J88L 4D94A 5MEQB 4HDIB 2EIZA 1KLUA 3H0TA 5K93A 4D0BB 1G7IB 1QSEA 1U8NA 2AP2A 1RVFH 3N1PC 4XWGL 4YIQB 3S36X 4DGYL 1UXWB 3KJ4C 1QLEH 2XFXB 3BYTA 3UTSD 1I75A 3DXAE 1OAYH 1TZIB 2WBJC 3T09A 4X0KB 3I50H 4I9WE 4TUJB 4UIMB 5IB2A 1OW0C 1OGAB 5IR1A 3DRQA 2OJEB 5EZIL 2P5EB 1JYWA 2DWEB 4HF5L 4U05A 4P2QB 4JFFE 1RJZB 1P1ZB 3SJVB 3KLDA 1OB1B 1T21B 4QRPD 3IDGA 4P59H 5C0BA 4MAYA 1FJ1A 2G5BB 3UTTA 1Q9LA 2ZOLB 3Q5OA 4C59B 2HG5B 5IFAL 4OQTL 4WV1A 4CDGC 5CJXA 4G5ZH 2QL1A 3WUWA 5M7QA 3SDAA 5IHLB 5DUBA 2LAAA 4OLVL 4RBPH 2IPUK 1U3ZA 4HPOL 4N8CL 2A9ML 1E4WH 1IQWH 1MQKH 5MERB 3DLQR 3AMLA 4U1JB 1TQCC 3WS3B 1LNUB 4NQED 3QIBB 2VLJE 1Q1JH 3BMVA 3QQ9D 4OLYL 4KUCF 3QG7L 1U42A 1RZJC 5EOQL 1C8PA 5D2NB 5CSBA 2ARJA 4Q9CA 5JHLL 1A6ZA 4IOFC 1YUHB 1MELA 4F9LA 4U1GC 1KIPA 1AKJD 3QUYA 5FKPB 3RY6A 3PHOA 1TVHA 5C08B 1I85A 1YQ2A 1HIMH 4MAUH 3CNKA 3AB0B 3EJZD 5C07B 3CLEH 2V7HB 2E6PA 2OM5A 1EO8H 1W0WB 4DKAA 3MLZL 2BRRL 4LPVA 3NIDF 1AIFA 1M05A 3LKOB 4NQCA 2GEEA 4XP9L 2CJUL 5ITBL 5C0JA 3EYQD 4K8RH 5CSZB 3LS5L 2X7LA 1KELH 5HHVL 1JPFB 5I1KL 2IH1B 4LOUC 1FLRH 3U48A 3KAAA 5DD0H 5DQDL 2CUMA 5F7KC 4M8QB 3ZDZE 2N7BA 4DN4H 4C56A 1XZ0A 3L3KA 3X13B 1A02N 2R1YB 3DV4B 2R0LH 4KGJA 1Q0XL 3RX7A 1A7OH 1IGTA 4D0CB 3HFMH 3VDCA 3O6KH 1FFPB 3MRHB 1KPVA 4PJIF 5A2IH 3D87B 1AGEA 5BJTB 2EC9T 2C26A 1UM4L 4LSSL 2UZYB 3EOAB 3LV3B 5E7FA 2VO5A 3RHWK 5T3ZL 1UVQA 3S35L 5C6WH 2ZPKH 1XGYL 3G5ZB 4FQJH 5BOPA 3U9UA 4FQ1L 3ULSB 1I7RB 5D1QC 5F9AC 3DETC 3F7VA 1FL6B 3AREC 5IG7B 4ISVA 5BZWA 3UTQA 3SKJH 1YZZA 4ZO7A 1Z5LB 1M71A 1NGPH 5IM7A 3BXNA 3LQZA 4JANB 1HXMA 1EEZA 1WJ3A 2Q3AA 4ZUWB 2XOTA 4MX7B 1KB9K 2YKLH 2C1PB 2UV3A 2A6KA 4RFEA 4CNIA 3C08H 2AXGB 2WBWB 3DX6A 2VXSL 2VDLL 5C0FB 3K3QA 3KXFB 5IFJB 4TTGA 3FHAA 1A1OB 1DN0A 3M45A 3FJTA 3MV8E 5EU6B 5HGAB 4GG8B 3IDMA 1H15A 1WZKA 4OD3H 3MOBL 1FVEA 3DURA 3P40A 4NUJA 5SWZB 3G6AA 2Z0BA 3MCLL 5T1LD 5KZCD 5MENE 4LCIL 1K4CA 2ZKHH 3P4MA 3V0VA 3MOAH 2ZCKH 1LE9A 4LKXB 4DK6A 3RWIA 5DEZA 2ZOKA 6CGTA 4RMUA 5IESH 4OFPA 3KYAA 1D5MB 4JVUA 4P2OA 1AI1H 5DRWB 2DQFB 5HYSG 2CRYA 5INCB 2D4DA 1M7DB 1KTLB 3HR5B 4OCRH 4WTZA 2X70B 4UILL 1A4KA 5SX4H 3QUXA 2WIMA 5IB3B 3EO0B 1B0RB 3O4LA 1X5KA 3LB6D 3ARQA 3WCYA 4BQ8A 4LK4A 4ODUA 5CGMA 1QLFB 3FAWA 5EORH 2WWMC 3RKDC 4N0RA 4XI5D 3EYVB 4G6KH 2R4SH 1UB5A 1H3UA 1MIEL 1A1NA 3L3OA 4WTWA 4FN0A 1FYTE 3REWA 3DPBA 4Z77A 4WHDA 5LGHL 1HI6B 2GK0A 5F3HA 1E6JH 4KQ4H 4LLUB 4RGND 4R8WH 1DL7L 5E24E 1J1OL 4R2GD 2K7QA 5T3XD 1IC1A 3V5KA 4P5MB 4NQUA 3ARWA 1N8ZB 4PRBA 4EIGB 1DBJH 1MRFL 1ACYL 4N8VG 1A14H 5E08H 1VDGA 2FJFA 3S5LG 1EBAA 4ZO8A 3OJDB 2ZNXA 1MCKA 2FSEB 1FDLH 1ZHLA 4LKCA 1VSCA 5CJ5A 1S9WA 2EZ0C 3SQOL 4ELMA 4F7CB 1R0AH 1IEBA 5IFHH 1T2QL 2ICES 1TNMA 5CUSL 5GRJH 2HFEA 3HZKB 1KIRA 3BH8B 2HJKB 4U1IA 1FBIH 2A38A 5TPWL 2FGWH 4NQDE 2P5WD 3VXMA 3MACH 1RZFH 2YN3A 1T03L 1KCUH 2VLRA 1UC6A 4ODWA 3DMMB 3CDCA 4MMZC 4RBPK 1FG9C 1HH9A 5ESVB 1OLLA 5TDPB 1X4XA 1EMTH 1I1YA 3W9DB 1YNTB 5HYSB 3O2VH 3MBEA 3DOSA 1H3TA 3X14B 2ENSA 4JFYB 3W39A 4OF8A 3F58H 3F7PC 1KGCE 3QQ9C 5DHYB 1L7IL 4S1RH 5IW1A 3PIQA 3DV6B 4DUVA 5KOMC 1T22A 1QTYT 1CLZL 2D7PA 3VFNB 3ARGB 5BS0D 1Z6JT 1XGPB 1FGVL 3QHZH 3VGEA 1NGZA 5C09B 2CDGB 5CP7B 2PYEA 2YUVA 4GS7B 4ZQKA 1IJ9A 2XKNB 3U7WH 3BRFA 1IAMA 2UWEA 4PYGA 5J13B 1MY7A 2AEPL 3MRLB 2BVYA 5IVXE 4MS8D 5BRZD 1CN4A 1LHZA 1T0NB 2H8PA 3DX7B 3OXRA 1BFVL 4JJ5B 1NC2A 4APQC 5F6IB 4YWGH 1Q9OA 1YN7B 4H1LB 3MV9B 5FO9B 4N8VB 5FYJU 4PJIB 5D1ZD 3T2PA 4YFEA 1MI5E 2QQNH 3IFOB 1I7ZA 1C5CH 3JV4A 4XAKE 3K8LA 2YD2A 1ZEAH 1J1PL 5C0AE 3T2NH 1D5IH 3EAKA 2PXYC 2O5YL 1I9RL 4HEPG 4Y88A 5IW6B 3GKZA 3D48R 3HZVB 4JFEE 4V1DD 3MLSH 4HT1L 3U30B 4DKEH 2FB4L 3I75B 2AKRA 4U1HA 2DMCA 1VGKA 5CGTA 1AY1L 3ZE2E 1BQLL 5I17A 1NFIB 2VR5A 5IT2L 5HDBF 2NR6D 3AAZA 5JXAH 3WKMH 5F7MC 4OCWL 2KH2B 1MJJB 5DUPH 1T66D 1XGRA 3QULA 4Y7MA 1IKFH 4KKNA 5D7JC 4D9RE 4MCYA 4LVNB 5EZOL 1OW0A 1K8DB 1NBVL 3SKNA 5DMJB 1MF2L 4TULH 3ZMRA 3RPIA 1AE6H 3O8XB 5ID1B 4OCXH 4KMTH 5DS8B 1VKXA 2FH6A 5GHWH 4MWFB 4X6DA 1UCBH 3HNVL 3LKPA 3OWEA 4CVUA 3IF1B 5TDOA 1DBBH 3GMPB 4KXZI 1BZQK 3BPLB 2LU7A 1A47A 2DQCH 4K7PH 4Y1AB 3WL9A 1SBBA 1P9MC 4PJGA 4JO2H 4OCSL 2Q76A 1X5HA 2OK0H 3WNOA 2W65B 1DLFH 2MHAA 1RIVL 3KYKH 3GI8H 4HZLA 2XZQH 1I9JH 1R5IA 5IMKB 2Q3ZA 2CPCA 5IJKC 4M7JL 5C0EA 1QNZL 2BJMH 5L2KE 4NKMB 3VW3L 4G9FB 1D5ZA 4G9DA 2CRZA 4JQVA 4YDIH 1HH6B 4Y5YB 4Y4FD 4Q74A 1INDH 3BE1L 1WLHA 1DQMH 4YX2L 4XP5L 3MJ9L 4X7EC 2GYSA 3LN4A 4I0PB 4KKBD 4PJHE 1IE5A 2A0LC 3KYNA 1HWHB 1N5AB 2MWCA 1E28A 4DW2H 1JWMB 1RJYB 2DJSA 4M48H 4ERSL 1IGIH 1XIWB 4A2LA 3GBNL 5IHZB 1CIUA 3FB8B 4GQPH 4HG4J 2FATH 2BVTA 4OIIH 1ND0B 5DJDB 5LQBH 1I9IL 1OGAD 3HAEG 3MBXL 1BLNA 3ES6A 3DX8B 2P5ED 4G6JL 3E2HC 3MC0A 4ZFFA 1NCCH 2VQ1B 4QTIL 4K07A 3SJVD 2DQIL 2VC2L 4ZD3L 2FEDD 3TV3H 3TWCH 5ISZD 4P4RA 2XWTA 3E8UL 3M8OH 1EDQA 3HNTL 5E99H 4CU6A 1G7QA 4NT6A 1F4WH 3C2AL 1UM5L 1NKRA 2C3HA 5DR5H 1NCNA 3FO1B 3P4OB 4LHJB 4MQ7A 1P84K 3IU3A 3SPVA 5I73C 4JM4L 3SE9L 3DI2B 3CC5B 1N4XL 2HWZL 1DSFL 3QIBD 3A6CL 4HFWA 1T3FA 3QEUB 4EUPG 2H32B 2GTWA 3V9FA 3AREA 3PGCB 5T1KB 3QDJA 2DBLH 2ZUYA 5F7NC 1VADA 3ULVD 3TEUA 2PO6C 4O5LH 3WE6A 4NC1C 2HKHH 1T20A 4UT6H 1PX4A 4XNXL 1WFUA 3UTPD 4CMHC 4NQTA 2BNQE 4MAYD 5TQ0H 1A7QL 4LIQH 3UTTD 1ZT7A 5KN5A 3FT3A 4WCYL 1IGFH 3LRSA 1AC0A 4K23H 4O51A 3B2VH 3CSYA 2DTMH 2X4QA 4TOYH 4PJ8B 4HC1H 5M94B 4KROD 1NEUA 3OB8A 3MR9B 1AC6A 3ZYZA 1KPRA 1SJXA 5F7DA 1FNSH 3A67H 3K4ZA 3FRPA 3LOWA 3BDXA 1QR1A 3T77A 4OZ4A 2NY7L 3EHBC 1R24B 4P23C 3TIEB 4NO2B 2VXUH 3JXAA 3BEVA 1MRCH 1MHEA 3GKWL 3HAEB 3BP7B 4JPWL 2NX5B 5CLWA 5DJ2B 2PTTB 3IGAB 3QUYD 5DUML 4Z78B 4JAMB 4WW1A 3TO4C 4ONFH 3VA6A 5I1JH 3P30H 4HUVB 4HIIB 4K3DL 5BO1H 3MJ7A 3KYOA 1QO3A 2H3NB 3MLUH 3RUGA 4XVTH 3FQXB 4QTHB 2EDQA 3N0PB 4X6FA 2UYLA 2HLFD 2Y36L 3T4AB 4KKLC 3HMWH 4D2NA 5L9DL 2VLKA 3QJFA 2NY1C 4DKFL 4QHLB 5E8PA 5JDSB 3RWHB 4EUPB 5BVPL 3S36H 3HI1A 3T0EA 5GGVH 5I8CA 3DBXB 3KPSA 3F5WA 4C56D 1C5BH 3B3IA 4ZNCD 2K3TA 1DDHA 2EYSA 2GITB 2VDRL 3K81A 1DBMH 4CRPA 4KDWA 1BBDL 3PABB 3CD4A 1QYGL 4KJQC 3QA3A 1R3JB 1CGSH 1K2DB 4JKKA 1PAMA 2CLVA 3GHBL 1J0YA 1GVIA 5BXFA 4DVBB 2NR6C 3B8YA 7CGTA 5MEOB 4JRYA 3DUSA 3HKFA 3KXFD 4N0YH 1TCMA 1ADQH 5EU6D 1I3RA 3QUZB 3T2QA 3NN8A 2EIDA 2VL5A 3KR3H 5TH2B 1ZT4B 1RV6X 1UJ3B 2V5RA 5FXCH 5L8LB 2DQUH 5DJXA 4L8BA 4YHYB 4R7NA 1MLBB 4AIOA 5HYQB 3BZFB 2XXCB 1KCSH 1YEIL 1GXEA 1U58B 3EYSL 5D71H 3EYFA 5FO8B 1FV1B 2Y07L 4Q6IC 2Z92B 2IADB 5EO9A 2MKLC 3HG1A 2NY6B 2JB6B 4U1NA 3CSBA 5CZXD 4JKPL 2MNUA 5HY9A 4BA8A 5MI0C 3MRCA 3PG2A 4JVWA 3PWVA 3HUJE 1KYOK 2YC1A 4YAQA 4JZJA 4JGJA 4HS6B 2FRGP 4UU9B 2QADC 1NCDL 1WFTA 5EC1A 2FX7L 1HSAA 3OHXA 3OGOE 3GSNB 4U6YB 4FQHB 4YHZH 5HGBB 3CMOH 3IFPB 3LQAL 5FUOL 5DHVB 2X9WA 1DCLA 4QRTB 2UZIL 1AQKL 3MA7A 1RZKC 2ICWB 2APVA 2HT3C 3HMXL 5FDWB 4YGAB 3LMJH 3ULUL 4JG1H 3IDYB 2IWGA 3MREB 2P45B 4LVOB 4LPUA 4P3CH 4IM8A 3B83A 4D8PB 3O4LD 1KTDA 2HJLB 2E6JA 4GAJH 1SM3H 4J12A 4YHNA 3PDGA 1FQ9C 1GPOH 1P2CB 1S9VB 2EDRA 1J8HA 5FYLL 4M5ZL 3L3DA 43CAB 4YO0B 5GRUH 3RWEA 3KLSA 3DGGA 1NDMA 3NZHL 1LD9A 5J06A 1N5YH 3H42H 2ITCB 2OJZL 5L6YL 1MCBA 5DVKA 4UNTA 1HQ4A 1IL1B 1FZOB 3P11H 3DMMD 4WFFE 3BPNB 4GXUM 1XR9B 2MOVA 2H26B 5FYJD 1PYWA 1Q0YL 1P4LA 2FIKA 3N1QC 4E5XB 5T3XH 4JY5L 4NNPL 5F9WC 1RIUH 4ZUTB 1R3IH 1A6TB 3NFNB 1F58H 3PGFH 2I60H 3VD4A 5D7JA 5IBLC 4P9HC 4N90E 3CDGA 2AV7A 1JV5B 3IFNH 4MD0B 2CKBH 5D2NC 4NRXA 2VLME 3FOMB 3D9AH 2V9QA 5DRZB 5B8CC 1WV7T 4U6XB 3T8XB 2BCKB 4U3XA 3ARGD 2Z35A 1MCCA 3QUMB 3WHXA 3VXMD 3L3GB 3GMLA 3PJSB 5A3ID 1ZVSB 4X8JA 5D2LE 5JLZA 4AT6B 5IEKA 4NHUA 1KN4H 4RMSA 1ZKAA 1CXKA 5GGSA 2BSTA 3AB0C 1ZANL 4MSWB 3GEWB 3UCRA 4GRMA 5MHSE 1I8LC 1NMAH 4KRPD 3MBED 4AIXA 2B2XH 2YBRA 4GRWH 1OSZA 1TZHB 4GKOA 4FTVE 5FCSH 4MJ5B 1S7TB 2NW3B 3MV9D 2R39A 3B5GA 4OAWB 3UC0L 4N0UA 3U0WL 1AH1A 5EO0B 3CK0H 5KS9A 2FZ3A 4YXKL 4NQXB 1T83A 1AO7A 5F93C 4MDIB 2IFFH 2GTZA 3MNVA 4KAQH 1MPAH 4PRDB 4PRPB 1CFTB 5HHOB 2AGJH 1C1EH 2PYED 1IAII 1CFSB 3PDOA 2EDTA 3EJYD 1I4FB 3RGVB 5J9PB 1EEQA 3JVGC 4PJ5B 1W0VA 1R5VA 1FH5L 1AGDB 4CW1B 1NC2D 3ZTJH 3F6IA 4PJFA 1EHLH 1SBSH 4P2CG 3RX8A 3JSSA 2XIDA 1LO2L 1Y0LA 1N6QL 1U3HB 4JFQA 3FZUD 2J12B 3TN0B 5B21A 1BF8A 3KDMB 5LGJA 4P2RA 4C57C 1BP3B 1ZA3A 4Z7QE 1FL5A 3GNMH 5LJYH 3CVIL 3QI9A 1JTOA 4H5SA 2A6JB 3RWJB 3QDMB 4OZGE 1S8DA 3MA9L 4GBXB 3KNBA 2JJTC 1PY4A 2WP3T 1XF4A 5DEGA 3C08L 2Y06L 5IF0B 4Y1AD 4RA3A 4Y4KD 1J7VR 1KJ3H 1LK2B 4U2ZA 4XVUD 5I1CL 1OAUL 5T5NF 4JFDB 4U1MA 4S10A 4GQ9H 4IRSD 5D7IE 4L3CB 3FQWB 3GMRB 4DFIA 4MXWL 4ONGH 4G9FD 4Z8FL 5EBGA 4GG6A 2ESVA 2PO6A 1YC8A 2DAVA 5E2TL 4KZDL 1N2RB 1T0MB 3MNWA 3H3PH 5D6DA 2EH8H 4HXBL 1T0PB 1WTGT 2NY4B 4N0CD 4I0PD 2EC9U 4Z0XB 4L9LC 5DO2C 3U0PB 5DRXB 1UJTA 4AYFA 1KENL 3G04A 2R2HA 1SQ2N 3I6KA 1XIWD 3C9NB 4BYHA 4KI5F 4OZIE 5AUMA 2ORBL 1E6OH 3VRIB 1A1MA 2ZG1A 4Y5VA 3K8KA 3FB5B 1ZHNA 3QIUB 3VRJA 3HC3H 1LK3H 5SX5H 3ZKNC 1F11B 5FKAB 1I8MB 3KPRE 4ZTPH 1WT5C 5IEHB 3QEHB 4X7FC 2HRPH 4R7DB 2DYPA 3MPCA 4HK0A 2IBBA 4F3FB 3VXQA 3O6FC 3H6JA 1RULL 1EERB 3TO4A 1EGJL 3FFCA 5E00B 4G7VH 2D7NA 4GLRH 4RFNB 1LEKB 4Y0GA 1B6UA 2J8UE 4YPGB 5IW3A 3RAJH 3ROOA 3UTSE 4EJ1C 2WWKT 3PGDA 3VXUA 1LO5A 5GRVK 2XNAA 2HLAA 4R9HA 4W4NA 3SGJC 1FCCA 2Y7QA 4OJFH 3N1MC 4LIQE 1JN6A 4DFHA 5J6HA 3LEVL 3K4AA 3TO2B 4CVWA 1CBVH 5K9QI 3W82A 1CGYA 4QRPE 3ILPA 1LP9F 5ESQA 1MWAA 3VFWB 1W8OA 4LCUA 4Z5RB 2XWBB 4M03A 1QG3A 4HGWB 3BWUC 3MJGX 4I18A 3Q6GH 2XA3A 2YA2A 3V7AE 5SWQB 2X4UB 3H9YA 5GJTL 4QRQA 1ZHKA 5EOTA 4WI6A 2CKNA 2G9HB 4QXUH 3F12B 1OM3L 3DMMC 3VH8A 5E8DH 3QR2A 3RVTC 4PJ8D 4OZFA 3RL1A 2A6IB 1JGVL 4OM0H 3ZL4H 3TT1H 3O9WA 4LF3A 5K9OB 2H45A 1HYSD 3MCKA 1UZ6E 3VFPB 4KGLA 4UDTB 5GGQL 2BY0A 3QG6A 4XAWH 4WVRA 5INDA 2A74B 1OOAA 4KXZH 1N3NB 1E4XI 4AEIH 3ARGC 3LY6A 3JWOL 4FMKA 4P9HH 3HS0A 4X4YB 2CO6B 3U7YL 2NX5D 1A6UL 5C7XH 4X9FA 3L7FB 2IBGA 4GS7C 4MNQB 5CEZH 5F70A 1LWRA 1IT9L 5J13C 5I1GH 5JQHC 5AEAA 4DGVH 2YPKA 5DK0B 4F37K 1NJ9B 3K2UL 1OCWL 1JF6A 1IGCL 4AL8L 2P8LB 4P46B 4L1DA 3GGWA 4QGYA 5E94B 1Q8MA 2O5XH 4OKVA 3CU7A 4E9LA 3O2DH 5D7LE 2ICWI 5EU5A 3WFHB 1NDGA 3N9GH 1F6LL 1MREH 5DD5H 3BPOB 1WUNT 2VN4A 3VXRD 8FABA 3EGSA 2Q8BH 3GMQA 4ZOBA 1DQTA 3MLRH 3U30C 1OAXH 1WFOA 4WU5B 4YR6B 5C71A 1JGEA 5KTEH 3C6SB 1CDBA 4NJAH 3UDWC 5I19L 3PHSA 1J05B 1JZ7A 1KV3A 2P8MA 1UM6H 3SKMA 1IGML 2ZNWA 3RRQA 2R29L 4NZTH 3OKDA 3VGAB 3TBSB 3WSQL 1SY6L 3TVMB 1YMMA 4WNQB 3V2AR 1WBYB 4LVNC 3ME0A 4EBQL 3MRQB 2DM4A 4TVPL 3DVNA 4OCMC 3BSZL 5FV1L 3O8XC 5E2VH 5DD3L 1RZGB 3EDFA 4D0DB 4M8VA 3KPSD 1D6VL 2G5BA 1JTTA 1DQQB 5C9KA 1OTSD 2NY6D 4DZ8A 3C5ZC 4PLJC 5J1SC 2X9XA 3BPLC 4O2EA 5HGHB 3OAUL 1YEGL 2HYMA 4XTRC 1S7UB 4Z7UE 3WFBL 4AEEA 4ORGB 4JRYD 5TE7L 1OTUD 2R2EA 2K7PA 3MXWH 5FK9B 3U9PL 3O6ML 5D1XB 1XR8B 1PKOA 2XZQL 4R3SB 3DHJA 2ATKA 2BJML 5CEYB 4XRCA 4HUNB 1CGVA 2GJ6A 4O02H 4C4KO 4Y5YC 5B8CA 1UQSB 2APFA 2OR9L 3WLBB 1WBXA 3AXLA 1JL8A 3T3ME 1UZ8A 3CFIC 2JJVA 2D3VA 4HS8L 4I0PC 5C08A 3HG1D 5F9JA 3DVIA 1IEAA 5J12C 5FF6B 1KTRL 4HCRL 1U36A 3OKEB 4K2UH 1MCOL 3DVFA 3VFVA 4UV7L 2HH0H 5C07A 5JXED 4DW2L 4Z7WA 1YC7A 4M48L 1ZK9A 5MEPB 3MRFB 1FNHA 2W07A 4MQTB 5CSZA 1S78C 3MMEB 3BP4B 5E9DB 4PJEE 5SX5K 1ZXQA 2BSSA 3O3EA 3QXTA 3VXTA 4MNGE 1A22B 4OBSA 2W9DL 4WJ5A 4KI1A 4RGNE 5KSAA 2CRIA 5T3XE 1KFAH 4MB3A 3TV3L 1B6DA 1LP9B 3NPSC 3PF2A 3D6GA 3G08A 3P4NA 1AXSB 1JNHA 4NJ9H 1HEZB 1CICA 3WYRA 3JVGA 3WS6C 3GK8H 4EEEA 4N68A 2C7UB 2D9CA 2C3VB 4YBHA 3CH8A 2NXYD 4XPTH 4WRLA 4X5WB 4Y4HB 1D9KB 2GSIB 3FFDB 3M17A 3PWJA 5ICZB 1D6EB 4XCEA 3OKLB 5C0DA 4L8CA 4RA0C 2NY3B 2P5WE 1CE1L 2GT9B 3QXDB 1A6VH 4OD1L 4XCNB 3ARFD 3MXVH 3U1SL 4MX7A 4NGHH 4M1CC 1RUQL 5D8JH 4GRWE 3PV7A 5DA0B 1YMHA 1J0ZA 2C1PA 3VDAA 2W9EL 3B9KB 3W5NA 2JJTA 3GMMA 3P9LB 2AJVH 3EYUH 3OKYA 3B2VL 3ZYIA 1XF2B 1ZA6A 2YMXL 1LILA 4X9BA 2ZUXA 4JM2F 3BESR 1RHHB 2VDPL 1V7MH 1BOGA 2XTJD 12E8H 4ELKA 4NM4L 1II4E 1TCRA 3A67L 1K5NB 5SWZA 4OCYL 1JRHL 5GRWA 2OZ4L 4BKLA 1BECA 1NCBH 1ORQB 1RUAL 2XZZA 3FAXA 1A7NH 2FR4A 3CCHB 1MRCL 3ECBB 3BKJH 1BZ9A 2BVPB 5GS2D 4ENEC 3D3VB 2IMMA 5CZVL 1CU4H 1TFHA 1S7SA 2HA1A 4L9LA 5BRZE 1WZMA 2FDBP 3HR5A 1ZVHA 1T80A 4FXGA 4ONFL 2CUHA 4LLVB 1I1FB 5E70A 1AR2A 5DDHA 2M26A 2GUOA 5AZ2H 2CDEB 4QO1A 1EIBA 3CFKB 4HXAL 4KRLB 3EYVA 1EAPA 3W11D 4NQSB 4H1LH 3V6ZA 4WGVB 1BQUA 2CUIA 3TN0D 4CL7A 4Y8DC 3BEWB 3GDBA 4M5YL 4M61B 5EUKA 4F57H 3TA3A 3DROB 3O6FA 4GBXD 4LDOB 4QRSB 3MRGA 3Q5TA 4LCYA 2Q6WA 3BI9X 4HW6A 5I8KH 4E41A 4PJXA 2HVJB 4N8PA 5AD0B 5IMMA 5DJ0B 5K9KA 2XN9B 4P3WA 5DWUL 5EBLA 2BXZA 3QUZC 3FMGL 2GQHA 4JFDD 4QCIB 1K3IA 1M1SA 1UJ3C 1HN1A 5FGRA 2R2BB 1XGQA 4R97B 1Q9WB 4NZRH 1BX2B 1U8KB 1WFNA 3KVQA 4UQ2A 2CGRH 4MLSA 2YRZA 2XZCH 1ED3A 4G8IA 4JRXB 1X6NA 4CJ0A 4ZUUA 5EC2A 3FTGA 5DJYA 4PLKD 1CD0A 5D71L 1VFOA 1OTSC 3KPPA 3DYMA 1DUZB 2GSGB 5DVOA 5T1DL 5EU7C 3UZEA 2H6PB 2Z8SA 5TDPA 3BPCB 4LQFL 4X6EB 5ANMA 4AM0B 5DQJB 3B43A 4JFYA 1G7HA 1G7PA 3BW9A 5FOBB 1GGUA 4G8GB 3FB6A 3O3DB 5DHYA 4P4KB 2AJYL 4JY4B 2XKSA 5IK3A 3O11A 3QIUD 3MLXL 4YXHL 4ODHH 2PTVA 1OAKL 5JPMA 1VESA 4NDMA 3X12A 1H9VA 4HHAA 4F7EB 2OSLA 2CDGA 3RVVD 1RJLB 3ARXA 3V6OC 2J2ZA 4WEBH 3D69B 4XMLH 5LCVL 2XKNA 4LAJH 4X99A 1BD2B 3KPNB 1DR9A 5JXEC 1QBLL 3IDYC 1JPTH 2AJUH 4NKQB 1RUPL 3OKMB 4R90H 1OGAE 3MZGB 3S5LA 1TITA 2NNAA 2P5EE 4KHXL 1G9NL 4P2QE 2OCFD 3SJVE 1IAIH 3QDGA 3NGBB 3UJIH 3JZ7A 4JN2A 5ISZE 4LCWA 4C55A 4JLRB 4GW5B 1MHCA 4JZNB 3C60B 5C8JB 3I75A 5J8OA 3FOLB 1YEDB 3UDWA 4WI4A 5C0CB 5CJQL 2PR4L 3R4DA 3BPNC 1VACA 3VFRB 1QHOA 4FG6C 4PGZA 2O93L 3UYRL 4NCC1 4MD5A 1GGIH 1CLYH 3DIFB 2NTSP 2B4CL 3LDBB 4A6YA 5T3XL 2HFTA 2YPVL 4FFWD 3T1WA 5ADPH 1L4IA 3ULVE 2BY1A 5D2NE 3IAPA 4JG0H 4JM2B 5JNYA 5CEZE 2FECI 4JPVH 4PBVC 3UTPE 1UYWH 5LXGH 1ORSB 2EEAA 3STZA 3RVXC 4ZS7H 1U8JB 1QP1A 2H32H 3VXNA 3GSWA 3OJMB 4OI7A 2BSRA 2VAJA 1PDKA 3LHPH 1FRGH 1FYHB 3VA2C 1G1CA 2E8YA 3C5ZA 4Y19A 5KJRH 2AI0H 4XWOC 4K71B 1T1XA 2VLJB 4J23A 4OLUL 2ZUTA 5TE4L 3IYLW 1A3RL 3QXWA 3O9WD 2QQQA 4FZEL 3V4UH 6FABH 2GK2A 4P46D 1JI1A 1HXYA 3RZWA 2DWDB 1FZJA 3HZYB 3KWWB 1H3PH 1EA9C 4DAGL 4DCQA 1G84A 5HDLA 3L5XL 1AGCA 4BFGA 1HH6A 4U0QB 5HYEA 1NMBH 5HHPB 3SDXF 1YYLH 4U1KB 5JW4N 2X9YA 1QFWM 5FCUH 3V0AC 4WDIB 3UPRB 4DQOL 1NAMA 5CBEA 4J1UA 3QNYA 2R23B 1DFBH 3B4NA 5HHNA 3RGVC 3HAEH 4JFPB 1CG9B 4KJPD 5DEFA 3TGXA 4M62L 4Z7VF 1S9YA 2JIXA 3T0WA 4NOBA 2LVCA 4LSDA 1SMOA 3QEQB 2X44D 1F90L 2KZWA 5IVXF 4DKDC 1U91A 4K9EC 3HZMA 1U3HC 3EO9L 4HK3N 3BD4A 4C83A 4LLMB 4C56E 3TN0C 5I8EA 4M43H 3ZTNL 3BQUB 5ACZB 3W81A 5GIRA 1URLA 5FUZH 4DGIL 1S3KH 3RWDA 3SDCC 4WENB 4EUPH 5B22A 2BNUA 2BVQB 1WICA 1CT8A 2YA1A 4Y2DC 4KJYA 3KXFE 2IPUG 2I9LA 5EU6E 4NFBA 1MJUH 3EFFB 3WS6A 1XCQB 4FQQB 4BZ2L 1IEHA 2R8SH 3SY0A 1EJOH 3B9DA 3QEUA 5E8NB 2H32A 4XNMB 1YJDC 5IBUG 5F97E 1KB5A 1BIHA 4BELD 4JZOB 2PW2B 3MRIB 4LNRB 3WJJC 4FQIH 4FQLH 1CXLA 1ZV5A 3V4VL 2C1OA 1W72L 4MD4A 1HQRB 2HFFA 4PLKC 2WLYA 3MRMB 4MA8H 5IV2B 2ADFL 5FYKH 4K3JL 1A3LH 4LLWB 5I66A 3MV8B 2NY4C 2VKWA 4M1GL 3L1OL 1GZPB 2SEBB 4P57A 4QOKB 3G5VB 3U4AA 2IBZY 2A1WH 2AERT 4OB5L 5MENB 1JYXA 4GRLA 1IQDA 4PY7B 4LLDA 1BQHA 1E4XH 3MGTA 3NTCH 2A9NH 4ZFOL 1GYAA 3L3JA 5HD8D 3TH2T 4CGTA 1CD9B 1KCVH 4XCYB 1R24A 4JO4H 2W1NA 1MFNA 4QF1B 5E9DD 3PWPB 4X8XA 1LK3L 2GJJA 5CINH 2C3XA 3GSNH 5DJ2A 4PP1D 3ULUF 4JDVB 5I8OL 4PV8B 5GGUB 5DHVH 3LQMA 1BBJB 1MH5A 1U92B 4HPYH 3WIHA 3S35X 1PX3A 3MROB 4QHNB 1K6QH 4M3KB 1QKZL 4Y4HD 1FYTB 5JORB 1JHLL 1QQDA 1XF1A 2Z31B 3F65A 4OLXL 4KQ3L 4YHKH 4XPGH 4HG4K 1RJCA 1H0DB 4GW4A 3P9MB 2MKWA 2W59A 3BGAA 4WW2A 1MEXL 4LCCC 5IBUB 3G6JA 4MGXA 3VRLE 3ZT6A 5JMOC 4PTTB 2FX9L 3FO9B 4YDJB 5KSAD 4E42B 4LSVL 3VFGL 2AK4A 5E5RB 3PL6B 3C8KA 1WK0A 1ZSDB 3NAAL 3X11B 2CQVA 2IANA 4L8DA 2NY5L 1CICD 3VE0A 3FQRB 3KPOA 3VGGA 5KANI 3HPJB 5K59F 4P9ML 5IVZB 5SWSB 1OLZA 2YD4A 5IHBA 5I18L 1DQJA 1JFQH 4TPRH 2ITDA 3NIDE 3E3QC 4X7SH 1U8MA 2F53B 1KT2A 4MXQD 5ENWA 2A73B 5ETUB 5EOCH 4XC3L 5ID0B 3MRBA 4PJCF 5C09E 3MV7A 1U58A 3RWFB 1U8HA 4MVBC 3JTTA 3HE7B 4DN3L 1U2HA 4ODTL 1ETZB 1MIMH 3P0YL 4ZYKB 4WFHD 5DD1L 5IB1B 1I9EA 4ZMAT 3SO3B 3ULVL 5C7XL 3OF6A 4RAVB 5IJVB 3KS0J 5H8DA 3SDXB 1PBYA 5L8KB 3QUMH 1JWSA 2IQAA 4G7YH 4KVCL 5JIIA 1E4JA 1JK8B 3MV9E 4CMMB 4PJBF 4PJIE 2RJMA 4NQVA 1FAKT 5C0ND 1EVUA 4NO5B 4XX1E 4YHOL 5H37G 3QB7C 1DQLH 2O5XL 4U6YA 5CHNA 2Y23A 4FP8L 4Z7VB 4XP6L 3RA7H 1T7ZA 1NFDA 3CFCH 3BPOC 1Z9OA 4PJAA 5E1AA 3WMSA 2PYEE 4XPAH 5E6ZA 4C58B 2HN7B 1MQ8A 5IVXB 2VIRB 5ACLA 2JE8A 4UV4H 3X3GH 3CGTA 3V6OA 5LAXB 1TLKA 3FQNA 4FQCH 3VFOA 3MLPA 3U0TB 3ROLA 4OM1H 1CF8H 2CH8A 3QJHB 1X7QB 1EEYB 5CGYD 3VGAC 1GHFH 5IOPA 4R26H 4KJWC 1RI8A 1UACL 2V2XB 4ZFGL 2XN9D 4DTGH 3HI6L 3TFKD 3TVMC 1MCSA 1LEIA 2NTFA 3BIBX 25C8H 2NZ9D 1DEEA 3O3BA 3IDJB 1BVKA 2QQLL 2JB5H 3PNWA 2W0PA 4K9EH 4ZODA 1VFAA 1AP2B 5FYKU 2C4FT 3PWUA 3TA3D 1VFUA 4Y1AE 4GKNB 5ILTH 3LS4H 4B41A 2RFXA 5IKCB 3KLAB 1F4YL 1CK0L 4E41D 3RKPA 2R0ZH 5E2WH 4K3HA 4AEHH 4ZUTA 1A6TA 2EDWA 4WU7A 5D1XC 1B88A 4G9FE 4G8GD 4I5BB 3G5XB 3OX8A 5JA9A 4P4KD 1RUKH 3B8SA 3LH2L 3GIVB 3IKCB 3BP5A 4KI5C 1N0LA 4KK5D 3FOMA 2BCKA 3WXVL 2A77H 4Q2ZB 4UBDC 4QXGH 1QRNB 3UTZA 4JEGB 2WMPA 1GL4B 5T1MA 4PJGE 1BD2D 3OG4B 2BC4B 1GC1L 1U8LB 3ZYJA 1HHIB 4JGUA 5BVJA 4PG9B 5EFIB 3V4PL 3RQ3A 5L2KB 2XPGA 1Q94B 3WN5A 3WIFA 2VDMH 3OR7B 1TETL 1HHGB 5I30L 1TZHA 2EYRB 4MJ5A 1QEWB 1R6VA 1S7WB 5EO0A 3IJSB 5J1TC 5DMIH 1MCEA 1ZWIA 4U1LA 1MUJB 4LGRB 4LDLB 5ADOH 4KTEL 2KQMA 2R0WH 4FQXC 3F6LA 4Q97A 3MLYL 1MCLA 2GJZB 1REIA 1OQOA 4YFLF 1QPPA 1RK0B 4OF6A 4PP1C 4HH9A 2D03L 5HI4C 4HWUA 4I77H 5MP6H 4O58H 1RIHL 3BMWA 5EA0L 3R1GL 4G42B 5IB4B 5C0CD 2YD7A 4G8FA 3F8UB 1MJ7H 3E6HB 4TNWF 2ATPA 4PJ5A 1OARL 1LE5A 4XNQA 4JPIB 4M7LT 5DJZA 1SEBB 2Q7NA 4WUUA 4Y4HC 3ALPA 4NSKB 4XP4H 1D9KC 3BIKA 1MVUB 1S7RB 5ERWB 1NLDH 4M4PA 4YC2B 3D25A 3BKML 4FFZH 3N85H 2NY3C 5J4MA 4LCWD 4WWKA 3N06B 1CGWA 3N50A 1MAJA 3KJ6H 2A6JA 2EIEA 3RWJA 4LFHG 3SDCA 5LVEA 2VOTA 2GAZB 3B9KC 1AGBA 1H3XA 3ZE0F 2VZ1A 3IXTB 4PJCB 1DBKL 1IMHC 2BSED 4Y2DA 5CJBA 2E9IA 3I3BA 1JNLH 2NXZD 5B4MC 4G43A 5AYQA 1CYGA 3U2SB 3OPZL 4U3HA 3H9SA 4JFXB 1CI5A 1ZT1B 1IC4H 3AU1A 3C5SA 1OGTA 2DDQH 2Q86A 4X4XA 2F8OA 3CLFH 3D85A 4JHWH 3FQWA 2EKSA 3QIWB 5FYJL 4PJBB 1B0GA 4U6VH 1KXTB 5HPMA 2NX5E 1Z0NA 1YEEL 4F7TA 4XNUH 3ZSTA 5GGRB 1T0MA 4DZBB 4LVHB 1IM9B 4ORZC 1F2QA 1OSPL 4MA7H 1XH3B 4UUJB 4CVZA 4Y19D 3ZT5A 1HDMB 4BSVA 3SBWC 3VXSA 1MFDL 3EYOA 4N1EA 5KBNC 3ZT7A 4NRYB 4TSAH 1P4BL 5DTFA 4XPFH 3RL2B 3BD3A 1H8NA 4URTB 2QR0A 5AZ2L 4X98A 3QEQD 2VH5H 1FFOA 3OG6B 1DBAL 2EO9A 3VXRE 3DYPA 2R69L 4L4VA 2VISB 3BQUD 3ESUF 1J86A 2YZ8A 3BKYH 2YPLA 2VUYA 2DLGA 5EUOF 3IJHA 1EVTC 4NWUH 5TFSH 4BZ1L 1OVZA 1SHMA 5E00A 2VQTA 3IS1X 3HR6A 2B5IC 3TBYB 3TC9A 3RUGE 5D7KD 5I16B 2E5EA 3NABH 2BDNH 1QSFB 3IDNB 2UVEA 5E8OA 4KY1H 2BOCB 4PRHB 2X89A 4YLQT 4CADB 1YN6A 2O26U 4JN1H 3U6RB 1U93A 2N56A 2APTA 4KPHL 1MLCA 4L9DA 1S5HB 2R1WA 2R15A 3I02B 3S4SA 4F2MB 3PE9A 4LCCA 2EC8A 4LHUD 5JOEA 1X44A 3AFLA 3SCMA 3QFJA 4FNLH 3O3AA 4KHTL 2G9HA 3S34L 1K8IB 2DS4A 3VMOA 1MHHA 4Z95L 5JHDB 4S1DD 1L0XA 4ZNEE 4YGVB 4PJ7F 2B1HL 4JQIH 4NNXA 3DSFL 4AIZB 1YDPB 2VITA 4PV9B 5AWNL 3ORJA 5ESAB 2CK0H 5CD5D 1CR9H 4NCC2 2BZDA 4LSPH 1JHKH 3CSPA 4ZS6D 1DN2A 4ODSL 3W5MA 3S37L 4JFOA 3PWPD 4HUUA 3I2CH 4P48A 4X7TB 4ALAL 2G2RA 1IARB 3W0WB 1KC5H 1UH3A 1UWEL 4ZUVB 2MCPH 3C09B 2FLRT 5JQ6L 2Z8WC 5FV2A 4AMKL 1MCIA 4Z7OE 2OS7A 5E8EA 5T33L 2DLFH 5I9QB 4F33B 4H88L 2FJGB 4Y16D 4IRJC 3MCG1 3NCJL 3KPMB 4EDXA 4D9QD 4IIQB 2HTKD 4OD2A 3CH1B 3U4BL 1GZQB 4RRPG 2X10A 3VXOB 1BQSA 5EN2A 3EBAA 3NA4A 4JR9H 2J88H 3BOVA 1BPVA 5C6PB 1IAIL 4QHMB 1M6OB 1JGUL 3QXAA 4DGYH 3MYZA 5IMLB 1AD0B 1G7LB 3C60C 4P5TB 2YR3A 1GGCL 3M1BB 4RCAA 1BVLB 4OBRA 3PXJA 4PJDA 3EDDA 1RZJL 2AEIT 3TM6A 2ED7A 5EZIH 3TZVC 1NC4B 3I6GA 1KCLA 4HWBA 2F5AH 2QKIB 3S96B 3UPAA 2PUQT 3FN3A 3MUGB 3TBSA 3LDBC 5IFAH 1GGIL 3ABZA 4OQTH 1UKSA 1KJVB 1WBYA 5H2BA 4YHLL 3MRQA 3RBGA 4OLVH 1EO7A 2PW1A 3W9EA 4JM2C 2AK1L 4JDTL 2F53D 4HPOH 1CD1A 4N8CH 2A9MH 1JF1A 2J6EA 1UYWL 3QHTC 4LASL 3DUUB 2YUXA 1CDGA 4HUWA 3HE7D 4OKDA 5FGSA 1GSMA 3MV01 4OLYH 1DQQA 4HWZA 5B38A 2AK4D 1JCKA 3ARTA 3QG7H 4LU5L 1ACZA 4BSWB 2IAND 5EOQH 5AZEL 5FB8A 2WUCL 5GS0D 5JHLH 3REVB 2RAMA 3LPFA 1I1AA 4XCFL 1RUML 3T3PE 5HBBA 3R0NA 5D1XA 5GSVB 1QA9B 2NY2B 4PUBL 1WEJH 3V52L 4XXCC 4YE4L 2FYYB 3MGAA 1QRKA 2CIIA 2VXQL 3PP4L 5DSCB 1G7MA 3T0DA 3G5YA 2H9GB 2BY2A 2Z4QB 3MLZH 4HUKB 2BRRH 3UAJC 1UZ6F 2V7NA 1AXTL 3TBVB 1UQSA 3IRZA 5CIPA 3MRKB 4XBPB 3TYGL 5HHOE 1SMAA 4XP9H 4P99A 1G7JA 2CJUH 5ITBH 2AEWA 3D39A 3H7LA 3ZYOA 3LS5H 1I8IB 5HHVH 5GXBB 3OF6D 1V3JA 5FF6A 5I1KH 5DRNA 3OKEA 4MJIB 4BK4A 5DQDH 3OBAA 5EUOB 1AHWA 3U4EA 1PG7W 1I7TB 4U3CA 4YQXL 3V6FB 2EE3A 1EBPA 1Q0XH 4KKCD 2DQTL 2CIKB 2CO7B 9CGTA 1YPZF 2W38A 3PV6A 4WO4D 5D5MF 5HJ3A 1NGWB 2P7TB 3PXHA 4FQXA 1UM4H 4LSSH 2A6DA 4CVXA 4XMPL 3BQUC 1WAAA 1LO3L 3QDME 5T3ZH 3S35H 4ZO6A 1Y18B 5BZDA 4JO1L 1XGYH 5HI5D 4FQ1H 1YECL 4GKSB 5DQ9A 1UWGL 1AXSA 5I76B 3LD8C 5DJ8A 2DQGL 1RZIA 3Q6FB 5J89A 4OGAC 4JFDE 4DVRL 5I1DB 2Q87A 2OXGA 1D9KA 3WJLA 1LMKA 1R3HB 4UT9L 4TSBL 4QRRA 4U49A 3TJHD 2VDLH 4PJ7B 1BFSA 2NY0D 5D9SA 3LKQB 3QXDA 3IAQA 3GSVB 3T2OA 5DZLA 1KNOA 1QRND 3MOBH 3MJ8A 3HE6A 4L3EA 5FO7B 2Z8RA 3B9KA 3MCLH 3SOBL 4LCIH 4FXKB 4ZSOA 4QWWC 1NBYB 2RCSL 1FVDB 1XF2A 3GMOA 3KPQA 4EDWL 1HHHA 2P47B 3PWNA 1R5WB 3ULUD 1XCTB 2D0GA 5KVDL 3V7AG 2BHUA 2OLDA 2JTDA 2KBGA 4Q0XL 4Y8AA 1XGUB 3NTCL 4LPTA 2EXWD 3L6FB 4ZS6C 3P73B 4J3SA 4UILH 4UQ3A 2APWA 1F00I 3IVKA 1KLFA 1IGJA 2D7TL 3IKKA 4HIEB 5C2BL 5CLTA 3QWRA 4PRIB 3SKOB 2H2SD 2JF1A 4NN7B 5F1SA 3B9AA 5E1HB 5IWLC 3C6LB 4WUKL 3ZHLA 3FCTA 5A2KH 2ADJA 1MIEH 1O5DT 3HNSL 2YD5A 2Z93A 3B9EA 1CGUA 1J1XL 5TE6L 4WHTA 1P7KA 1X4ZA 5LGHH 1WC7A 1DL7H 2YXFA 1EH9A 1N0XL 1J1OH 3FT4A 3FO2A 2Z31C 5IQ9A 3ZZ1A 4U1SB 1F8TL 2KQNA 2Q7YA 1P6FA 2HRLA 1EHXA 4FZ8L 1MRFH 2WM0A 1ACYH 4YHKL 3MX0A 1QHPA 3BEWA 3HPLB 5HHXL 4K3EL 4LARL 3UTSB 1JZ8A 1FSKB 4S2SB 2VAAB 3SQOH 2ADGB 3PL6C 2XQYK 1T2QH 5CUSH 4H0HB 4KTDH 1KG0A 4QY8B 3VI4E 2VNCA 2ICEA 5IB5B 5EU4B 3LPGA 1XGTB 4TTDC 2EIBA 4LBEB 3VJ6A 5TPWH 3O6LL 1QBBA 4QRPB 3GJFB 3CZFB 1G6RA 3S9DB 3E3QE 3MO1B 4N1CA 1T03H 4WUUD 1FZMA 4PGCB 4JFHE 1HILA 3RZCC 2HTLD 1JFQL 5E56A 2EDHA 3QIWD 5DFWH 2FJHA 2NYYD 3VFUB 5F3BB 2YD1A 1FO0A 4F15B 3DRTA 4DOHB 4ZPVB 2I07B 4WWKD 5F1IA 1JUFB 4MNQE 4UTBL 1T04B 3SO5A 4NQEB 1L7IH 1IM9D 2PKDA 3SO3C 4M7KH 3F7YB 3UTOA 1RURL 1C12B 2DQEL 3K4DA 3FO0L 4RQQA 4EN3B 1CLZH 4HIJA 3OJVC 4UNVA 3SGEH 4KK6C 5I1LA 5IQ7L 4R4FL 1FGVH 3EO1B 5CD3A 1IAOB 2JELL 3VD5A 3JUZA 5EBWB 1NEZB 3MLVL 4DJMA 1VFBB 2AEPH 2CD0A 1F6FB 5IROC 3CVHA 1IFHH 4GMTH 4GMSL 4KUZH 1BFVH 4MJ6B 2P24A 5J3HD 2FWOB 3D0LA 4KMQA 1YPZB 2AJ3A 4GAGL 2BFVL 3MNZB 5D5MB 1CQKA 2ZSVB 1RJLA 4P5KB 1U3JA 5JPNA 3IETA 3Q3GA 1J1PH 3L3HA 3WEXB 2O5YH 1I9RH 1OT1A 4OM1L 1QSFD 4GKZA 4IRJA 1CFNA 4HT1H 1IM3B 4J3UA 4NKDB 2FB4H 1VEOA 4I2XB 4L4TA 4PRHD 4ZAKA 4YHML 2MMXA 1BQLH 5DI8B 2ENYA 1CLCA 1UADC 5IT2H 1ITBB 2EE6A 2FL5B 3K7UA 2AV1A 4M93B 1TMCB 2BNRD 4OCWH 2VABA 2FGZA 4L4VD 4YHIB 1DVFB 3DGCR 4GW5A 3PQYB 1F02I 2DLEA 2YPLD 2N1KA 4XC1L 3H7BB 3D18A 5EZOH 3H9HB 3QXVA 1NBVH 3DXAA 1WISA 4R0LC 3TZVA 4PRAA 3P77A 2OTUB 2IMNA 1MF2H 5JHDD 1PVHA 5KSBF 3B5TA 4JQXC 3MRPB 4KH2A 4JFFA 1UA6L 3HNVH 3MFGB 1GAFL 4AEHL 3HC0A 1WSST 2ZUSA 3MFFA 3VWKA 3CFBA 4OCSH 1A9BA 3KPLA 1F6AA 4AJ0A 3TCXA 5GGVY 1RIVH 3LQAC 3W0WD 3SCMD 3QFDB 1W8NA 4M7JH 5I74B 2X4TA 2PF6A 4S0TD 1QNZH 4PR5B 5KVEL 1S7QA 3LKNB 4KK8D 3A6BL 3VW3H 4TQEL 5T1LB 5KZCB 5AAWA 4AH2B 4TSCL 2JLLA 3RTQA 4M7ZB 4GUPA 3BE1H 1DJSA 4YX2H 5E4IA 3LZFL 2EO1A 2EEDA 4P49A 2HVKB 4XP5H 3MJ9H 3BN9C 2OL3A 4XXCA 1BM3H 3IXAB 5E9DE 1WIPA 2IG2L 2FNBA 4M9OA 5DMIL 5AAMA 2F8XC 1FORL 3BGMB 3F62A 4WFED 4ERSH 3GBNH 2D0FA 2R0WL 1IAKA 4EXKA 1GGBL 1PKQB 1FL3A 1T89A 3MRNA 1LP9E 4P5TD 2AQ1A 5C70A 3MRRA 5F7LB 3QUKB 5DFTA 2BHZA 4RMQA 1I9IH 1WCBA 3MBXH 4QXTB 4G6JH 1SVZA 4Z7WE 3DWTA 4QTIH 2DQIH 4FXLA 1T5XA 4ZD3H 1QVOB 3H8NA 3K80A 3E8UH 4U33A 1CFQA 3HNTH 4MYWB 2D7MA 2E7BA 3C2AH 1UM5H 3SE4C 4R2GB 3L5WA 3PHQB 1GJIA 5A1AA 1FNEB 1KCRL 2H2PC 3V8OA 4JDZA 1JP5A 4FFZL 5DFVC 1LEGB 1X5FA 1N4XH 3GSOA 4MCZB 4HKZB 4R4BA 2HWZH 4H8WL 1DSFH 5FECB 3JV6B 3A6CH 3FQUA 1CE6B 2HAZA 3QO0B 4RAUA 1KJMB 3HI5L 2P4AB 3LCYA 2VLLB 4QHKI 2VDNL 3BZEB 1S7VA 5E5MA 4MHHI 3UROR 3EFFA 1ZE3C 4J8RB 4XNXH 1G0DA 4KDTC 2XYCA 3QZWA 1A7QH 2XY2A 5BMFL 4ONHB 5IMOA 4WCYH 3HRZA 3JTSB 3MUZ1 3B2UD 1PZ5A 4QRUA 4J4PC 4QNPF 4RMVA 4ETQB 4WFHE 1SJEB 4K8RC 3A0OA 3D3VE 1WIOA 1L0QA 3ULVF 4S11A 4HLZG 5ELIA 4LVHC 5EZJA 3RVUD 3S98A 1AQDA 3I85A 2NY7H 3MV8A 5BCAA 5CP3A 1C08B 1GZPA 1MWAL 3QQ4B 3BUTA 4WIQA 5MENA 1I3UA 1MFAL 4TRPL 3GKWH 4EI5D 5B39B 4JPWH 32C2B 1I1AD 4LRNL 3D2UA 5BS0B 3BWAA 5J57B 2XWJB 4P0DA 4HZAA 5T3ZE 4BH8A 3EZ8A 3SE8L 5BQ7A 2D4FA 5GS0H 5DUMH 3FQTB 4RIRB 5KAQF 5J1AA 4K3DH 1BFTA 4MQXC 2V17L 2ZJSH 2V5MA 3DTXA 4V2BA 3CJJA 2X4SB 3OL2A 1IC5L 4TVPD 1JGLL 3LSOB 2AVGA 4RWYL 2E7CA 4KVNL 4XBEL 1M7IA 4I4WB 1SYSA 2Y36H 2YA0A 1TJHL 3STBA 5D1ZB 3FT2B 3LKSB 5DD6A 3WDHA 1J0IA 4JDVA 4L8SC 4J3TA 5HI3D 4CN1A 3GB7B 3RVWC 3TNNA 1I8KB 4PRNB 5BVPH 1I1RA 2XN9E 5HYJD 4QT5A 1TENA 1K4DA 2VDRH 4V1DB 2WNGA 1BBDH 2FHBA 5GZNC 5CEXA 1QYGH 2CLRB 2HP4A 1A2YB 1FYTA 1JWUA 1U8IB 2EDNA 4JCMA 3V5DB 3GHBH 2QLVB 1UXSB 5FA3B 5KSBB 1MHPH 3BHBA 4JRXE 4LP4A 1T4KB 1A4JA 1X6LA 4PTTA 1C5DA 4HKXA 4E42A 1NBZB 1HHKA 1W72B 2HT4C 3LRHA 3MODL 4E41E 2GCYB 3ILQD 1YEIH 4PGBB 2DIJA 5L88L 2APBA 3EYSH 3BUYB 1FAIL 1MOEA 2IAMA 2Y07H 4G8GE 4CKVX 1E27B 1JRHI 1RZKL 2FECL 2QJDA 4XPHL 5D70L 1JIBA 2EECA 5CJOH 1BJ8A 4NM8L 4NQDA 1R3KB 1NUDA 3RZCA 4JKPH 2W0FA 2X4RB 1SEQH 4QRRD 4ZFOB 5JOFA 3DX9B 3ARDC 4XBGA 4PGEB 5EPMB 4PS4L 4H20L 5ICXB 2E8ZA 5FGCB 4PRID 3QNXB 1BD2E 1HNGA 5CWSB 3C09C 1NCDH 5CBAA 2FX7H 3HE6D 5H37H 5GGTA 1I3GL 3ARBB 4IMLA 4O9HL 3C6LD 1T7XA 2A83A 3LQAH 3OGCA 5FUOH 5I9QC 2WW8A 1Q9KB 4Y4FB 3CFDA 1N7ML 3TNMB 1T2XA 2UZIH 1AQKH 4PG2C 1NCWL 3HMXH 1BHGA 1KLGB 3R8QA 1A6AA 5CILL 4FABL 5JMRA 3ULUH 2YUWA 2I25N 3L5JA 1YQVL 4GAYA 5IROA 3QQ3B 4J7RA 1T1WB 4PJ9B 1KPUB 4GT7A 4UAOB 2V2WB 1MAKA 4GFTB 4WI2A 4NBXB 5FA4A 4HUMB 2D31B 5L7XH 4YNYA 2HN7A 5IVXA 2QQKL 2HMIC 4FFYL 1K85A 1C16A 2QEJA 4UIKH 5C0CE 4IHOB 3L9RA 1Q72L 5GS1B 5FYLH 4M5ZH 3U36B 3WFCL 5F89B 1IGYA 1MI5A 2WQRA 1HSBA 1KN2L 5DZOA 3NZHH 2F5AL 5EZLB 5C0AA 3CFJA 2OJZH 4OTXH 5L6YH 5ISZB 5F9DC 1M4KA 3BH9B 4P3DA 4JFEA 4ZXBB 1OHQA 5CZKA 4HQQL 4NO3A 5TF0A 1A3QA 1P7QB 5I2IA 2V2TB 3SDDC 2EIZB 1Q0YH 1X5XA 1KLUB 3H0TB 4JY5H 4NNPH 4R4ND 3IDJA 3NH7L 5BW7C 1U8NB 3NIFF 3TBTA 3IRPX 1QFOA 4I3RL 2AJZA 3ZHDA 1RSFA 2EE9A 3JWOC 3QT2A 4KK9D 3OJ2C 2OX5A 3GRWA 5KG9A 4R0LA 3UJTL 4OI8A 3WIIL 1F45A 5F88A 3VRLF 2V5YA 5IR1B 1JPGA 3DRQB 4EN3D 1I7UA 1YY9C 2Q8AL 3T65A 1M7XA 1JHTA 3IDGB 3IDXL 4NWTL 5C0BB 4MAYB 2NY2C 1JPSL 3UTTB 1Q9LB 3SGDI 4WV1B 2DBJA 1WEJL 1Z3GL 3SDAB 5DUBB 2DQHL 4KROB 1ZANH 4ELMF 2R9HC 4HAFA 4N5ED 5C3TA 2VXTL 4HJ0C 3UC0H 3U0WH 4YXKH 3TF7C 3T04D 4U6HA 4BFIA 3GSXA 5DJ6A 2WQ8A 5I1IL 1MCPL 1Z0MA 4NPYA 1JZ4A 5L2KA 3RDTC 3HB3D 2ARJB 1DQDL 1A6ZB 5C0RL 3CXDL 3QEQE 1L9NA 1OWRM 1KIPB 1S7WA 3QUYB 3DHMA 1TVHB 4QYOA 4GOSA 1MUJA 1QSVA 2F15A 3SN6N 4PJHA 5HVGB 4OV5A 5F7UA 1FH5H 4NHCL 1SJVA 1DVFD 4S0SD 4B50A 4LAQL 4MXVF 3PQYD 1AIFB 1M05B 4NQCB 1LO2H 2ZUQC 5D7KE 1N6QH 2D0HA 3RIAK 1QOKA 2OQJA 4MZ2A 1ZS8A 3QCVH 3NCMA 2X7LB 4D3CL 4LMQI 5JZ7C 3CVIH 4WFGD 3WHE0 5E95B 4C56B 1XZ0B 3L3KB 5ACMA 3MA9H 5ITFB 3OB0H 3QNZA 4L4TD 4ZAKD 3L3IA 5HVFB 1IGTB 2Y06H 3EFDL 3B6SA 1KPVB 1AGEB 5I1CH 1OAUH 4XHJD 4C4KT 3TBWA 1UVQB 4PPTA 4JO3L 1P7HL 2IGFL 3U9UB 4LL9A 4QOKE 4EIZC 3GSUA 4RX4D 4MXWH 3DXAD 4Z8FH 5BZWB 4ISVB 3UTQB 2IH3A 4I9WD 3BXNB 3U2SA 2GFBA 4KDTA 5E2TH 3RU8L 3LQZB 1HOCA 4KZDH 1YEJL 5ALBL 4W68A 1HXMB 4HXBH 1EEZB 1JNNL 4JE4B 4JFFD 5DGQA 5F44A 5FUCE 4WI8A 5EU3A 2BNQA 2A6KB 4RFEB 1BEYL 5DYOA 4CNIB 1QFUL 3PWPE 3DX6B 4WY7L 1KENH 4J4PA 3VWKD 5JIPA 4HIHA 3MUY1 4FQPA 1XEDA 2ORBH 1DN0B 4NN7C 2QHRL 4PB9L 2UVFA 2BP3A 3IDMB 1H15B 4WI5A 2R56L 1FVEB 3DURB 3C6LC 4NUJB 1RY7B 2BXYA 4X6DF 3G6AB 4HJJL 5AYUL 5HYIA 2XACC 1K4CB 1D5XB 3RTQD 1PD6A 5E6IA 3P4MB 3V0VB 4MNHA 1LE9B 3QPQD 3OR6B 4RSVA 3RWIB 1EXUA 1PQZA 3STLA 4PJGF 1RULH 2ZOKB 1EGJH 1WF5A 4P2OB 4PREA 5HHQA 2O5ZL 2YK1L 4JKMA 2E7HA 3QUXB 4H1LG 3QRGL 1EFXD 1MAML 4ZDHA 3O45A 1FSKC 3O4LB 4UI2A 4BH7A 5KVMC 3RGHA 1EFQA 4XX1G 4W4OC 4ODUB 1L9MA 2P42B 4JPKL 3LEVH 4L8SA 3TBYA 2AQ3A 3VFMA 3EOTL 5DMGD 4QEGA 1UB5B 2IPTL 4KTDL 5SWSE 1PSKL 2CLZA 1A1NB 5ALCL 4KWUA 3L3OB 1A9EA 3REWB 5GJTH 5GRZA 4Z77B 2OP4H 5C0IA 4RGMB 1DE4A 1JZ5A 2GK0B 5F3HB 2F53E 1OM3H 3TPUA 1OAQL 4ODVL 1S5HA 3V5KB 5JO5B 1JGVH 5J0BA 5LWYL 43C9A 4UNUA 1MFCL 3QDAA 4PRBB 4F15C 2FJFB 5CCKL 4F58L 5GRXG 5H94A 1ZHLB 3O41A 4LKCB 4Y5XC 5GGQH 3U79A 4YPJA 3SDXE 3K74B 1U8OA 4Z76A 1S9WB 4ELMB 4AENA 1QUNA 1IEBB 3UBXA 4M7KL 5ECJE 4EN3C 2NMSA 3E6FA 2ADIB 2HFEB 3BO8A 1KIRB 2Y4SA 3V7MA 3JWOH 1PGRB 4U1IB 5J7CC 4NZUL 1V3KA 3X17A 3U7YH 1T7WA 1S9XA 1A6UH 3VXMB 5ESAA 1FPTL 5IBTL 4YBQD 4Z7VE 1IT9H 3NPZB 2VLRB 4ODWB 5FOJA 3C8HA 3ARDA 1HH9B 1OCWH 3K2UH 1CFVL 1IGCH 4AL8H 4F8QA 1I1YB 1IFHL 4BSJA 3EJZC 4GMTL 4KUZL 4LSRL 3VWJA 4A6YL 4KRPB 3MBEB 4ZTOL 1BFOA 4ZPTA 2PCPA 5F1NA 3FB7A 4JY6A 2QSCH 3HUJA 1RZ7L 4O2CA 2AXHA 3EYQC 3ZKXB 3TYFB 1ROWA 5EBMA 5IW1B 1QBAA 2W60A 1T22B 1TTFA 2YXMA 4LGPB 5HDQL 4HBCL 3GMNA 3V5HA 1RU9L 1UB6A 1NGZB 4NYLB 4OF3A 1P69B 2PYEB 2QSVA 1N26A 5I19H 3WFEL 5DMYA 4ZQKB 3RWGA 2LABA 5KW9L 1IGMH 2AXFA 2R29H 4M93C 1MCNA 5D6CA 3GUTA 2H8PB 5JTWA 1DVFC 3WSQH 1RD6A 1SY6H 1NC2B 3S97C 4NP4L 1Q9OB 4EBQH 1KEGL 2WBJA 4TVPH 1WTLA 4FHBD 3JV4B 1I7ZB 1IBGL 3BSZH 2BK8A 4YHPA 5DD3H 2EDBA 3MUGA 4NO0A 5I15L 1D6VH 1KJ2H 1JGDA 2BVOA 4ODBD 1MCDA 1NAML 3OB0K 3GIZL 3RUGF 2AKRB 4U1HB 1CL7L 1VGKB 1X4YA 5I17B 3OAUH 1YEGH 1A0QL 2AAVA 2AJX