4RQVA

Crystal structure of pdk1 in complex with atp and the pif-pocket ligand rs2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
289
structure length
288
Chain Sequence
b'PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title A small-molecule mimic of a peptide docking motif inhibits the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rqvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rqvA01
3CPBA 5AX9A 3L8SA 3SGCA 2PVNA 5CF5A 3A7FA 3RWPA 3QRUA 5L6OA 4NIFB 3ZC6A 4ALVA 4WT6A 3WF5A 4F9AA 3PIZA 1BMKA 4DLJA 1OM1A 2R64A 4FK3A 2Z7QA 4OBOA 4ANOA 1YKRA 3HAMA 3LKMA 1R0PA 3WF6A 3DBDA 2X7FA 3BHYA 4FK6A 4XOYA 1GZ8A 4QTDA 2C3KA 2UZLA 4BKJA 2OXXA 3A7JA 3VS2A 4A07A 5TR6A 5CQWA 3MA6A 1QMZA 4FGBA 1YDSE 5CSXA 3Q96A 4DEBA 2GQGA 4WO5A 4BR3A 4FNXA 2CNQA 4OW8A 3TTJA 4S32A 4V0GB 1LR4A 4S30A 2YHVA 3II5A 4GS6A 4QMWA 3W18A 3BV2A 2VTSA 1H4LA 3NNXA 3D14A 5FD2A 4G3GA 3GU6A 5BMMA 2LAVA 4C33A 4WIHA 5IH5A 4U42A 2G2IA 2QG5A 3OWLA 4IVBA 1CTPE 2QNJA 3P7BA 4PL4A 4FZ6A 3ZRMA 4RVKA 3ORKA 3QC4A 4BDIA 1ZOEA 2P2IA 4YZNA 4PX6A 1UWJA 1ZYSA 5F1ZA 4BN1A 4Y8DA 1H1QA 3FLYA 5HBJA 4J7BA 2IN6A 2AUHA 4FIGA 4F70A 1H27A 2E9UA 3C1XA 2YDJA 3D2IA 4K0YA 2WAJA 5H3QA 2I0VA 3HVCA 2UZBA 3MVHA 2SRCA 3G51A 4IAAA 3QD4A 4U0IA 3KRWA 2PE0A 3E8CA 5HO7A 3DY7A 3FE3A 5KMJA 4X2NA 3GU4A 4U9AA 3RVGA 2W17A 3UC4A 4E8AA 4EHGA 5IA1A 3QHWA 5AP0A 3F66A 4UYAA 4D9UA 2OH4A 3BPRA 3GCSA 5H8GA 3ZYAA 1TQIA 4XEYA 2GQRA 4IZ5A 4C4EA 4FSWA 4UWYA 4MQ2A 4EK5A 5CAVA 2O3PA 4ERWA 4IW0A 3T9IA 4YMJA 3EQGA 5L8KA 1YHWA 4I4EA 3SLSA 3C50A 3QCXA 5A4TA 5E8ZA 5HCZA 3UDBA 4DGMA 3BRBA 3DA6A 3DQXA 3PXQA 5HO8A 3ZEPA 3O7LD 1Z57A 2C4GA 3ACJA 3P0MA 3VBVA 2G9XA 4CV9A 4QQTA 2W5BA 4ZTSA 1QCFA 4QP3A 3VF9A 2WNTA 3COHA 2C69A 3VF8A 2CLQA 4LMUA 4ZLZA 3SXSA 2R3NA 3Q32A 4FKLA 4NL0A 3VQHA 4YTCA 4JNWA 3FY2A 3QTQA 3VS3A 4R77A 1CKPA 2QI8A 4O86A 3CTJA 4C2VA 4AS0A 2BHHA 5LMBA 2C5XA 2EXEA 2PVMA 2HXQA 4XX9A 3V5PA 1ZMUA 3GCPA 2ZB0A 2X9EA 3ORZA 3ZRKA 3U8WA 3PFQA 3E87A 3M1SA 5EQYA 4L01A 2C6KA 5I9XA 4I0TA 1WCCA 3BHVA 1L8TA 4FEWA 4R78A 4RFYA 4I22A 4UZHA 4GT5A 4E4MA 5LWMA 3SW7A 4LV5A 3L9LA 4FVQA 4NM3A 4QYFA 4EOPA 5CF4A 3DJ5A 4I5CA 5M08A 3FAAA 4E6CA 1WFCA 2CJMA 4IFGA 5KMOA 4DGLC 3DBEA 4LGDA 5C01A 1KE8A 2QHNA 3EQCA 4YJPA 3W16A 3FJQE 3ITZA 4BCPA 5KX8A 3EMGA 4M3QA 5I3OA 4PV0A 1NT2A 2YCRA 3DS6A 2J7TA 4OTWA 3U4UA 3CKWA 4IX6A 5TF9A 4L68A 2V22A 1I09A 4HVHA 4HGTA 4K33A 3KVXA 4M66A 4OR5A 4MHAA 4O2PA 4EZ3A 3I1AA 5M4CA 3CY2A 5L2SA 2F7XE 3NPCA 3HV6A 5A4CA 3NW5A 3MJ1A 2X39A 3I6UA 3TNQB 3ATSA 3R1NA 2J0MB 3DBFA 5HOAA 1OGUA 5EOBA 4HVIA 4CCBA 4F9CA 2WMAA 3R1YA 3BLQA 2ONLC 3QZHA 1W82A 4FTOA 1RDQE 5AMNA 4ZS4A 1E9HA 5L8JA 3U9CA 3W8LA 4AZSA 1GY3A 5KHWA 4PTEA 5DNRA 4NW5A 5CEMA 4WSYA 3R8VA 1UKHA 4PTCA 3OBGA 4KA3A 3CQEA 1PKDA 3GBZA 3E88A 3PY0A 4AOIA 2C47A 1OBDA 4AE6A 5IEXA 1KE7A 1OPLA 4HYIA 2GNJA 3QYZA 2W1GA 4OTHA 4QP4A 5A9UA 5L2WA 3OHTA 4CLJA 4TYJA 3UP7A 2R3MA 3QX2A 5CQUA 3S95A 3PP0A 2Z2WA 2IVTA 2GMXA 4BDDA 4C2WA 5JSMA 1AD5A 1R39A 4MAOA 3JVSA 4QPAA 5IH6A 1Q8ZA 1OITA 4XG6A 2W1CA 3G6GA 3S00A 3N4UA 3ENHA 3AC2A 3M11A 4DEGA 2EXMA 4ID7A 4ONAA 5JQ8A 4WNPA 5CYIA 5AP5A 2GSFA 3Q9XA 4CKRA 3U55A 4FX3A 2QR7A 4PL3A 3OY3A 1HCLA 5F94A 4J95A 4DG2E 1Q97A 2UZNA 4EUTA 4FTUA 5KKRC 3JY0A 5FP5A 3NVKI 2XBJA 5BYYA 4I0SA 3DU8A 5FGKA 3EQRA 4MWHA 4YJSA 3HX4A 3PSBA 2NRYA 4F7LA 3QBNA 3OROA 3D5XA 1OKYA 3TEIA 5D1JA 3WZJA 5TE0A 1YHVA 4QTAA 1JSTA 4MXAA 3CCNA 4R3PA 5JFSA 4RJ3A 2RFNA 4UB7A 3KU2A 1JWHA 2BHEA 4FSZA 1IAJA 5TO8A 1Q41A 3D15A 1DS5A 2FUMA 3FBVA 3KB7A 4JQ7A 4RVTA 3GFWA 1H1SA 1YDRE 4QT1A 5J95A 2GQSA 2B53A 3GC7A 2WTCA 4OTDA 4DEDA 4F6SA 5BMSA 4OT6A 5I0BA 3V04A 2C6EA 2VTJA 2R3QA 3P7CA 5G1XA 3W10A 4AT4A 4KIKB 1PXLA 4EWQA 1PYEA 2UZVA 3B8QA 3AOXA 3H9FA 2F2UA 3QTIA 5EM8A 5EW8A 4K11A 4JIKA 2EWAA 5CAOA 3VBWA 2O63A 3UMWA 1OIRA 4WRSA 2VWBA 2HZIA 5FP6A 2J0LA 5LOHA 4EQMA 4FIJA 4XLVA 3M42A 4U3YA 4MCVA 3UG2A 2HY0A 4TYIA 3CJGA 4ITIA 1VYZA 2O8YA 4P5ZA 5C1QB 1KE5A 4O0RA 5AJQA 1Q4LA 5K9IA 3TNHA 1GAGA 1J1BA 5HBHA 4JBOA 4O0SA 1XBCA 2QG7A 4RWKA 3HLLA 3G9NA 4IZYA 3LFEA 2BFYA 4BIDA 2W1HA 3NR9A 2FO0A 2VWXA 4NIFA 2OF2A 4I5MA 3FMJA 4BDBA 5F9EA 3EN4A 4FG9A 3TZ9A 5GZ8A 5EYKA 3UZRA 1IASA 3G9LX 5HLWA 5CEQA 2YM4A 4QP2A 3K5UA 1OB3A 5M55A 3TUBA 3MVJA 5CZHA 5HE2A 4LOOA 1FGKA 4DG3E 2XK9A 3DGKA 3FZOA 4U97A 4RVLA 5E8TA 4XNEA 2C6OA 1VYWA 4P90A 3LFAA 3PZEA 4NKAA 4XUFA 3QRJA 2VWUA 5FLFA 3PDTA 4BZDA 4D0XA 5EDPA 4V0GA 3PUPA 3S3IA 1H08A 5KO1A 3C4EA 4M69B 1M17A 4TN6A 3BEAA 5LARA 2UW3A 4H3QA 4FL2A 3A7GA 3FLQA 3I60A 3UMXA 3VUTA 3RCDA 1JLUE 3EN6A 2HCKA 4IFCA 4BICA 1J7UA 3C4XA 3NLBA 2KULA 2OF4A 4IC7A 1PKGA 4HCUA 4FZDB 4J8MA 3RCJA 5EH0A 4QMQA 4F63A 2HXLA 1YXXA 4Y5HA 4KS7A 2IPXA 2C5OA 3ZONA 3ZXTA 2VWZA 3MIAA 3QL8A 3QWKA 4DFNA 2WHBA 3QUPA 4N6ZA 4RIOA 3SHEA 4EH6A 2GS6A 4I21A 2PPQA 3FY0A 3LOKA 3D7TA 3OF0A 4QYEA 2F57A 3CD3A 3VBQA 4GKHA 2XM9A 4Y95A 2Y4IC 2QQ7A 3PY3A 4R1YA 5CEPA 4D2RA 4E1ZA 4R8QA 1PMEA 4G17A 2IVUA 5IQGA 1P4OA 3O96A 3QQJA 3S1HA 4F1TA 1JSUA 2F2CB 3TKIA 5I3RA 3HMOA 3KCKA 2JD5A 5EFQA 3NVMB 3R30A 4EOSA 4WG4A 3QKMA 2ZAZA 3OWJA 4FV4A 3R9NA 4BB4A 3DLZA 5CALA 5GINE 3PP1A 4JDJA 4EWHA 1DM2A 4BYIA 4M68A 4AN9A 4AN3A 4IDTA 4JI9A 4YPSA 3TZMA 4E4XA 3NWWA 2XKDA 2PZRA 3DBQA 3HL7A 4MXCA 3PE2A 4C58A 5KMIA 3UVQA 1Y8GA 3SG8A 3DNEA 3OT3A 4FV0A 4IHPA 4IQ6A 3LE6A 3DNDA 4Y72A 4UMQA 4ASXA 3ENMA 4DH3A 4JQEA 3PA4A 4CTBA 4J97A 1OBGA 3MDYA 4JX7A 3RM7A 3EFLA 4B0GA 3QZIA 4CCUA 3MY1A 1JBPE 3GP0A 5DBXA 3ID6C 3BV3A 2HAKA 2R7BA 3ANRA 2R5TA 2P55A 4D2VA 5BUIA 2VZ6A 4O38A 1ZOGA 1WBVA 2X2KA 4GG5A 3PE1A 1M52A 1OL1A 4X2GA 3WOWA 3D5WA 4FKGA 3UQFA 3DBCA 4LMNA 4O0TA 2ZJWA 5CI6A 4ZSGA 2OZAB 5E1EA 3E63A 2BFXA 4EK4A 5CSPA 2CN8A 4RVMA 2I6LA 4QP7A 5L2QA 3VUKA 5AR8A 2IW6A 2X2MA 3D0EA 3KFAA 3O71A 3D4QA 1M2PA 5LWNA 4PNKA 2GHGA 2WOUA 2JIVA 2Y0AA 3CJFA 3GU8A 4YUQA 4I5PA 1H0VA 3PLSA 3MWUA 1FINA 1FMKA 3KVWA 5FXSA 1R1WA 4CT2A 4AGDA 2B55A 4RX5A 2XUUA 4FKJA 4QP8A 3KXNA 4JR3A 2OJ9A 4L45A 5D7AA 2OSCA 4J96A 1KV1A 3JPVA 3Q5IA 5FXQA 3ZO2A 4ANQA 1GJOA 5IA5A 5KBRA 5BPYA 2F9GA 2H6DA 2X4FA 5K4JA 5M4IA 1ZLTA 3AXWA 2CKQA 2PUPA 3RPOA 3M2WA 3AC5A 5DA3A 4DLIA 1V0OA 4HPTE 4QMYA 2B54A 4C02A 1TKIA 2HK5A 5E1SA 2BDFA 5JRQA 3PPZA 4IX5A 4P5QA 2BZJA 2ERKA 3IOPA 2WQOA 3CD8A 1T45A 3KXZA 3VW8A 1MRUA 3E8EA 2JC6A 3KN5A 2IJMA 1YRPA 3Q9YA 4C4GA 3CBLA 3H30A 4F64A 4DBNA 3BBWA 1P5EA 3E3BX 4FL3A 1Z9XA 3OOGA 4IWPA 5KHXA 4CG8A 2FA2A 3NSZA 4BYJA 3ZUTA 4TYGA 5KUPA 4KB8A 5CS6A 2X0GA 4FKSA 3OXTA 3KL8A 4TY1A 3ZO4A 5J8IA 3HMMA 4PDYA 2CMWA 5T68A 1GIHA 2R3PA 4BDHA 2YFXA 3F6XA 5E8XA 5EDQA 5BUEA 3GC8A 3NW6A 1W7HA 4M84A 4RJ8A 3P1AA 4X7QA 5ANEA 4A06A 2OU7A 3NRMA 2HW7A 3GXLA 2GTMA 4U5JA 3NS9A 4D2PA 4DGNA 3O50A 2B9HA 1H00A 3UOKA 4E26A 4EBWA 1A06A 3FLWA 2VX0A 4FYNA 5EM5A 3AGMA 1JSVA 1RW8A 4FIHA 4E3CA 5GIPE 4X21A 3GENA 3R7EA 3OWKA 3PXZA 2FH9A 3MGYA 5M07A 4C4FA 4G31A 4MVFA 5FWKK 3LLAA 4JJRA 1OIUA 2VNWA 4KIQA 4EQUA 3MIYA 4FKRA 3CE3A 4UWBA 2WPAA 3E5AA 3K2LA 3OW3A 2YERA 4WOVA 3IDBA 4I24A 3WZDA 4EKKA 3KRRA 4TWCA 1Q8YA 3MVLA 4AACA 1JKLA 3LFBA 4KIKA 2JDOA 5LMKC 1XKKA 4Y5QA 3UBDA 1Z5MA 2XEYA 2VUWA 1Q61A 2PE2A 1OUKA 1R0EA 2BIKB 4Q5EA 4RIYB 3NYOA 3RAWA 5AUUA 3GFEA 2FSLX 2CGWA 4FTQA 2ACXA 4I0RA 1GIJA 5FTOA 5JH6A 2IVVA 4GJ3A 4ZP5A 1UNGA 2BMCA 3RHKA 2NP8A 4ENXA 1KSWA 4IE9A 4FTKA 1GZKA 3SAYA 5EDRA 4H3PA 1DI8A 5G6VA 5K0XA 5EHLA 3OXZA 4D2WA 5LQFA 3RP9A 3DOGA 5CNOA 4Z3VA 5EI6A 4XYFA 4ASEA 4F7NA 4A9YA 4O0XA 2WQNA 3R63A 3V5QA 4JLCA 4X2FA 4BHNA 1K9AA 4FVPA 4CYJA 4RA4A 2VWVA 3R28A 2PVFA 2BZKB 3CC6A 3WF7A 5LCJA 4DITA 2F49A 5IA2A 5IQAA 3DKOA 3UODA 1FBNA 4DTBA 3T8OA 3G0FA 2F7ZE 2WTVA 3Q52A 4X3JA 5HGIA 4ZZMA 4CXAA 4E6DA 4JT3A 4FTJA 4KS8A 4DG0E 4IAZA 1NXKA 3IG7A 3QLFA 3TACA 3UP2A 3CTHA 2JFMA 2X6DA 3DK3A 3BE9A 4M69A 3G0EA 5LVOA 1HCKA 3W2CA 2VTOA 2YM6A 4PUZA 4AZWA 4YC6A 3NYVA 3VRYA 4IB5A 2C30A 2HOGA 4K6ZA 2C6DA 5HG9A 5AAFA 2IW8A 3VULA 3FC2A 3S2PA 4WRGA 4W4XA 3U87A 4FKPA 2LGCA 1ZRZA 4HZSA 5HICA 5A4QA 4IIRA 5L4QA 1X8BA 2XNNA 1W83A 3OTVA 4DH7A 3RWQA 4YSJA 4GFMA 4GW8A 3E7OA 1M2RA 1STCE 4D55A 2J2IB 3W32A 4FYOA 4KAOA 1JKTA 4AF3A 4EQCA 5AUYA 4M67A 5FTGA 2DUVA 4IXPA 4FGRA 2VTQA 5JN2A 1RQQA 3I6WA 3QTXA 2GHMA 3PIYA 4C3PA 2PVLA 2VWYA 3PLAE 3PA3A 4IMYA 3AD4A 3IKAA 3MS9A 4I1ZA 4G1WA 2JLDA 4K77A 3FLZA 1TQMA 2XJ2A 4E4LA 3CPCA 4XG4A 1O6YA 4DF3A 5C8KA 3AC3A 4LFIA 1XH4A 3UTOA 4AOTA 3VBXA 3QCQA 2RFSA 4W9WA 4D1ZA 4I5HA 3F5PA 1O9UA 3LJ1A 2RFDA 4MNEB 1PW2A 3UNKA 4HNIA 3ZFMA 4ANNA 4XH6A 3R7UA 3RPVA 4C3RA 4FSMA 3DLSA 3CGFA 2X8EA 5E7RA 3IDCA 5CAPA 3IO7A 4FV7A 1YVJA 4FODA 5AIKA 2RSVA 2XK7A 4GFOA 3SC1A 1V0PA 5AA9A 4W9XA 3ZM9A 2QOOA 4JG8A 2R7IA 4N0SA 2X9FA 4ACGA 4LL0A 4NK9A 1AGWA 4DEEA 4HJOA 4FI1A 4IAFA 4CMOA 4KINA 3HAVA 3U9NA 3FZSA 3EHAA 3KMMA 3KRJA 4C57A 1Y6BA 4O7SA 3ROCA 4M0ZA 1MQBA 2YZAA 5AUVA 4B9DA 1A9UA 5A6NA 2ITPA 3FLNC 3EQHA 2XJ1A 1UA2A 3EH9A 5E8VA 2OZAA 2HIWA 4M14A 3FKNA 4PPBA 2UZDA 1PXOA 4FTNA 4XP2A 4AT5A 3QQUA 4ANMA 4ZZOA 3FMEA 3H3CA 4Q2AA 3UZPA 4DFYA 2DQ7X 4EJ7A 1APME 2I1MA 4JAJA 4A9RA 3F2AA 4ZZNA 4FKQA 3FPMA 4O7RA 5ETAA 5E4HA 1TQPA 3PVUA 4W4WA 5K3YA 4M7IA 4LOPA 2CPKE 3R0TA 4IX3A 4PL5A 3OXIA 1P4FA 2Z7SA 5CLPA 4ZY6A 1FVVA 4QMTA 1O6LA 4ZTRA 4HVSA 3QCSA 5B2LA 2ZOQA 1U59A 2ITWA 1G8AA 3K5VA 4B7TA 2YLEA 4EHEA 2UW4A 3B2TA 4GUBA 4M12A 4FKOA 4MX9A 4YC8A 5CU4A 4UMPA 1KE9A 2HY81 3ZHPC 5L2TA 4D9TA 5KMNA 4A7CA 5JRSA 3ZDUA 4U43A 4KSPA 5FXRA 4TNBA 1Y57A 3ZFXA 3U6JA 3R9DA 4CRLA 3EJ1A 3DT1A 3HRBA 3OMVA 4ANSA 3KEXA 5JQ5A 2ZDTA 4MD9E 1YDTE 3OC1A 4IVDA 2XIXA 2JKQA 2W1DA 4QOXA 5M06A 4MK0A 4M15A 3E62A 2QR8A 5CEIA 1UU8A 3O2MA 2BILB 2OICA 4MD7E 5H2UA 5DMZA 2ITOA 3BYVA 4TPTA 3HMPA 2IZSA 5EW9A 4USEA 3DZOA 1R3CA 3DPKA 2REIA 2YJRA 3QQGA 4O0VA 5J5SA 1OIYA 3JYAA 3B2WA 5FEDA 3LXKA 5FM3A 1Q8TA 4HNFA 3TV7A 4U44A 4R7BA 3P9JA 1FOTA 2ONLA 2XNGA 3WE4A 5EK7A 1WAKA 4MEDA 5AAGA 4CGAA 3F69A 2ITVA 4LYNA 4YPDA 2QOBA 5CAUA 3NUXA 3SKCA 4FV8A 4R5SA 4CQGA 3FXWA 3H9OA 2RIOA 4DEHA 1XBBA 5M53A 2JITA 1ZXEA 4TWPA 5CVHA 3LCDA 1SVHA 1VZOA 4DH5A 4I20A 2F4JA 4ZXTA 4BBFA 5KCVA 4F0GA 5DG5A 1ZYCA 5HNGA 1U54B 3OFMA 1G8SA 2UW6A 1YHSA 3RJCA 4D2TA 3TJCA 5A46A 2CKOA 3PXKA 5T3QA 3TZ7A 4YZ9A 4YURA 1J91A 3KGAA 4AZVA 4EHZA 3JR1A 3LVPA 2HYYA 3BYUA 2JFLA 4J98A 2V62A 2FVDA 1XO2B 3D7TB 4MBJA 2BAQA 4FT9A 4X2KA 1PF8A 4CYIA 5AUTA 3UZTA 3ERKA 4M13A 3PIXA 5DI1A 5I9VA 2JGZA 2P0CA 2XH5A 4N6YA 4KRCA 4Y83A 4H39A 2VD5A 3DAKA 4E4NA 4XBUA 3FKLA 5AP1A 4O7NA 2OIBA 3VUGA 4RIYA 4BTMA 3VW6A 2E2BA 4U40A 4E7WA 2Y6OA 4CKJA 4S2ZA 2XVDA 5AIRA 3WZKA 4FSYA 3JVRA 4R3RA 5J79A 4HGEA 4MNFA 3ORMA 1OPJA 4NTTA 5ETCA 2X7GA 4JBQA 3RK5A 2ZM1A 5AEPA 4RJ6A 1H25A 3VNTA 2WEVA 4RJ4A 1Q62A 4HYUA 4YO6A 3SV0A 5ACBC 3A8WA 3FQSA 4CFMA 3D9VA 2BR1A 4DFZE 1MP8A 2QC6A 3CR0A 4MH7A 5ANOA 5D12A 4DT8A 5IF1A 2PMOX 3TIYA 5EI2A 3DDQA 1BL7A 2E9PA 2XNMA 3RNYA 2GNFA 2R9SA 3TWJA 3S0OA 4RMZA 1YXTA 2C6TA 4GH2A 3PPKA 5D9HA 5IG1A 3ORPA 4CD0A 3AC4A 4JXFA 4ARKA 4XV1A 3NMUF 3BCEA 1W0XC 4L8MA 1H0WA 3UG1A 2RG6A 1CKJA 1NVQA 3VHKA 2OFVA 4K8AA 3ZOSA 2GPHA 3BQRA 3SX9A 3P79A 4YZCA 5A4LA 2G2FA 2PTKA 4RWJA 4GFGA 2W1ZA 4HCVA 3AGLA 5IUIA 4BZNA 4QQCA 5K5XA 3R00A 4FEVA 3UIXA 3OCTA 3VS7A 2PWLA 3EYHA 4G6OA 3DKFA 5AM6A 1U5QA 3HP2A 4FEUA 2YA9A 2QKRA 3MY5A 3RZBA 3R7OA 2YLFA 4BCGA 4D58A 3ZBFA 3ZZEA 1BI7A 3FZTA 3TUDA 1Q3DA 5AR7A 3FV8A 1KV2A 3V5WA 4ZLOA 4YLLA 2C1BA 3NUSA 4A9TA 5LXMA 1KWPA 3WYXA 3OCBA 4BDEA 2VTHA 4CQEA 2EB2A 4GCJA 4J71A 5EM6A 2ETRA 4GRBA 5GNKA 4FNWA 5AUWA 4DINA 4XG9A 5CT0A 4BBMA 4OTPA 3R01A 4C36A 4BC6A 3MESA 5HZNA 3W8QA 4R7IA 3LM0A 2BUJA 3VUMA 4ITHA 5L3AA 3DTCA 3LCSA 3EIDA 3AMAA 3MH0A 3QAME 3OP5A 3PSDA 3IW8A 4ZY4A 4LGGA 3PG3A 4ALWA 1H8FA 2QCSA 5DRBA 3WZEA 1H28A 2B1PA 3BWJA 1OKVA 5CSWA 5BYZA 2CNVA 4DT9A 2J0KA 4U6RA 2GNIA 2NNWB 4Q9ZA 1E1VA 1OPKA 4BDAA 3LJ0A 4XBRA 4QMSA 2JEDA 2WMBA 2PY3A 2XS0A 1QPEA 3P4KA 4FUYA 5DE2A 3QKKA 1CMKE 2BIYA 4MNEA 2UW0A 4TRLA 4OAVB 3OT8A 3WIKA 3KC3A 3RINA 3PJ1A 4CKIA 2C5VA 1ZY5A 2VGOA 2X4ZA 3NUYA 3R21A 2XRUA 4P2KA 3A62A 4UMUA 1V0BA 4G9RA 3FMLA 2VGPA 3R8MA 4F99A 5AV3A 2V0DA 4GIIA 3MW1A 5LMAA 1E1XA 4FA2A 3QD2B 3DB8A 3HNGA 3FZRA 3PSCA 3FHRA 4BCKA 4O0YA 3A4OX 3QWJA 4A4OA 2ZV9A 5DLSA 4XV2A 2X81A 3FI3A 2QLUA 4I92A 5CXZA 3OUNB 3TG1A 5LVPA 3ZLWA 4GJ2A 3R8LA 3QYWA 4U81A 4MXXA 2OK1A 2UZEA 3A7IA 4F1OA 4YSMA 4O82A 5GZAA 5ANKA 5C26A 4XG7A 4WUAA 3VO3A 2PK9A 4JVGA 3QZGA 4IZAA 5BVNA 3R6XA 3NYXA 4R7HA 2HELA 4XP3A 3ZSGA 5CASA 2VU3A 3SOAA 4ENYA 2ITQA 3PG1A 1P14A 4XOZA 3D5VA 4HYSA 4TKSA 4D4RA 1UKIA 2ETMA 5AV4A 4L53A 3R02A 4BDJA 1KUTA 1Q99A 3R04A 4RBLA 4WHZA 3W1FA 3WE8A 3FSKA 2YZLA 3QQKA 2C6LA 4RRVA 4MD8E 1YOLA 3L8VA 3P78A 4LUEA 1S9IA 4EOOA 5B7VA 5HTCA 3LXLA 3ORIA 4KBAA 3WYYA 4KBKA 5E90A 1WVYA 3IQ7A 3GB2A 2JDSA 1UNLA 3OS3A 5BVKA 2R3JA 4D4VA 4O21A 4PMTA 3WZUA 4FSRA 3ZLSA 2A1AB 4AA4A 4FG8A 5DGZA 4YHFA 1TVOA 4U41A 2O5KA 3UVRA 2P4IA 4KWPA 3VS0A 4UXLA 4J1RA 4NUSA 5BUJA 4QYGA 3ET7A 1OKZA 3LJ2A 4OTQA 3K3IA 3PRIA 3R2YA 2WZJA 2ITYA 2VX1A 1YW2A 2PHKA 2QO9A 2WELA 4LGHA 2WTJA 4YJUA 3THBA 4O7LA 1YXSA 5EQPA 2QODA 4JAIA 2YM8A 1KOBA 1WBWA 2H8HA 3CLYA 4WNMA 3HDNA 4XLIA 3LQ8A 2B9IA 4PWNA 1PY5A 3O51A 2CN5A 2YISA 2W5HA 4FT3A 2W96B 4I6QA 3CXWA 5E8SA 3VJOA 2V7OA 4E6QA 4Z55A 5E8UA 1RE8A 2A2AA 3I0OA 4CMTA 1ZYJA 2WO6A 4NM5A 2OIDA 1JKSA 2C5YA 4N4SA 3O17A 5HLNA 2OJIA 3KXMA 4BGGA 2V55A 4GU9A 4G3DA 3PWYA 3OVVA 2UW7A 1U46A 3QTSA 2CKEA 3U6HA 3CIKA 4YO4A 5CEKA 5CU0A 1VR2A 4FV9A 3DDPA 3T9TA 2XP2A 1U54A 5K5NA 4L3PA 5EHYA 5HIBA 5TOZA 4ANLA 4J8NA 5E92A 3UYTA 5B0XA 3A2CA 1ZMWA 2WXVA 3QTRA 2XYUA 3KF4A 4FKWA 5B2MA 5ANGA 2GTNA 3BU3A 3WF8A 4K18A 1URWA 3K54A 3ULZA 4O2ZA 4EOKA 4ZSAA 5M56A 3ATTA 2YAKA 2CCIA 5EG3A 4A4LA 5DWRA 1PHKA 3ZBXA 3WARA 2PVHA 2XNBA 3SD0A 3V8WA 2X8IA 3LFCA 1YOJA 3QQFA 4PMMA 2J9MA 1BI8A 1SVEA 1XJDA 2C0IA 2OKRA 1G5SA 2WTKC 3TNWA 2Q0NA 2FSTX 2IZRA 4LOQA 3FSFA 5GZ9A 5I4NA 4L7FA 4XMOA 3DJ6A 1JKKA 4EOQA 2J6MA 2BALA 4E20A 4QPSA 2R3LA 5DFPA 4MKCA 2J0JA 4X2JA 2BRMA 4UMTA 3BHUA 2BZHB 5HIDA 4IANA 5CU3A 4JIAA 2R0UA 3ODYX 4F09A 2WU7A 4YTIA 3QTWA 4RX7A 2YCQA 3QQLA 4Y73A 4QP1A 5LMKA 3OEZA 3O0GA 3KK9A 3ALOA 4F7SA 2OWBA 2ZV2A 3DQWA 4HW7A 3O8PA 4C59A 3SXFA 5DOSA 4BWKA 4YJQA 3KK8A 5DRDA 2UW9A 3KXXA 4O96A 2P3GX 5J1WA 3C5IA 1B38A 3QUDA 3EKNA 4NFNA 3TXOA 3MJ2A 1IA8A 3UJGA 3MSSA 1ZZ2A 2XMYA 1O6KA 4MWIA 2OZOA 3ELJA 4EH9A 1BL6A 4PMPA 5M4UA 4JOAA 4OTRA 2PMLX 4C4IA 4Q9SA 2X6EA 2YIRA 3C9WA 5EKOA 3VJNA 4RC4A 4E5WA 3R9RA 4DE4A 4EC9A 4L52A 3QTZA 1NVSA 3VS5A 3C4CA 3NCGA 5EYMA 3TV6A 4QYHA 4E6AA 4ZSEA 3FQHA 4BCFA 4GYGA 4ALUA 2PMNX 3VN9A 2V7AA 1FPUA 4YTHA 4AW0A 1REJA 2R3GA 3NYNA 2YJSA 4MBIA 3ZO1A 3F9NA 1H1PA 3QFVA 4CMUA 1IRKA 5CY3A 4D4YA 3HZTA 4JX3A 2E9OA 3TKHA 3IGOA 4UYNA 4TT7A 5DVRA 5JFWA 3FZPA 5HO6A 3MFUA 3OW4A 4ZTMA 4TL0A 1J3HA 4BRXA 5CTPA 3ZH8A 4QNYA 1I44A 3RAHA 3G6HA 4AGWA 4AXAA 4E93A 2PVYA 4BCOA 5A6OA 4NM0A 3MFRA 1H07A 4LV8A 1MQ4A 3NNVA 4HPUE 3C4FA 3QX4A 2WTWA 3SG9A 1WVWA 1Q8UA 4FTMA 4C7TA 1T46A 3IK3A 4C61A 4FSUA 3NW7A 2XZSA 4DEIA 4CG9A 2QOIA 3EYGA 2OG8A 3E93A 4GU6A 1PXKA 1XH5A 2C3IB 2GFCA 5AR4A 4C4JA 4AW1A 4O22A 4EOJA 2ZB1A 4IVAA 3NEWA 3TDWA 3EFKA 2XRWA 4IAYA 3R71A 4UV0A 5JGBA 4I41A 5ACKA 1GZNA 2WTDA 3A4PA 4FL1A 4FMQA 4C8BA 3VS4A 3DK7A 5CX9A 1Y8YA 3FQEA 3PVWA 3Q53A 5IDNA 3I81A 3UQGA 5IQIA 1REKA 4H05A 4S33A 4BI2A 4EK3A 2R3RA 5FRIA 2JBPA 4NH1A 3HGKA 4ZTQA 4ERKA 4ZLYA 4ZJJA 2ETKA 2V5QA 3GU5A 4V01A 3G15A 3MPAA 4F6WA 4DBXA 4DCEA 5M44A 2W1FA 4G6LA 4OGRA 4AE9A 4FR4A 4B8LA 4BY9E 1S9JA 1SYKA 5CI7A 3GCQA 4X6RA 2YWPA 3N4TA 1QPJA 4UX9A 3ZDIA 2BKZA 3F3WA 2W4KA 4IH8A 1OI9A 3ORNA 3VS6A 3ZUUA 3RALA 5BQ0A 4ZJVA 4QMVA 3COKA 3ROYA 3BWFA 3PRFA 4FV5A 5LVMA 2ZV8A 3GI3A 2PUIA 1IR3A 4JDKA 3Q4UA 2YWVA 3AG9A 3VC4A 2VTTA 3QF9A 2QOKA 4XRJA 2W9FB 3R7IA 4IX4A 1SMHA 2YACA 3C0GA 3OCGA 3OEFX 1XQZA 1KOAA 2IVSA 4MYGA 4QTBA 5KKRB 5B2KA 5CSVA 5GJGA 4AWIA 3MA3A 4RQVA 3CP9A 1F5QA 1KE6A 3HUBA 5HE1A 4CFWA 2YN8A 3IGGA 4D2SA 3MTFA 1QL6A 3VRZA 2OLCA 4ZTNA 3V5LA 4F65A 2DWBA 3C4WA 4S34A 4BDCA 1NA7A 3LFQA 4YHJA 3PYYA 3BE2A 5IKWA 4O91A 5F20A 3NIEA 1SVGA 3HP5A 4ASDA 3PXFA 5AM7A 4BVUA 4FV3A 4BIEA 5FEQA 5K4IA 3P5KA 5IEVA 2KTYA 2PZYA 4BGHA 1WZYA 1WBOA 2R3IA 3NIZA 4TNDA 4D5HA 3RGFA 2Z02A 1SZMA 2B9JA 2ZV7A 5CVFA 2QVSE 3TCPA 2I7QA 1BLXA 4ITJA 2CGUA 4IC8A 4JG6A 4XP0A 5CZIA 2R4BA 2PE1A 2Z7RA 2GDOA 3BELA 1M7QA 2BRBA 2QURA 3HMIA 4CZUA 2W1EA 2XNPA 4PP7A 4EHVA 4ACCA 5FUTA 4RLLA 4AOJA 3CKXA 3EQPA 5AUXA 3QLGA 3BHHA 3QD0A 5AFVA 4NCTC 5HLPA 1OZ1A 4FUXA 4YNEA 5BVDA 3N51A 3OY1A 4ZY5A 1JQHA 3R7YA 3KY2A 2PU8A 4IJ9A 3VBTA 3FC1X 4YJRA 4D28A 2XBAA 2XNOA 4IZ7A 2WQBA 4U7ZA 4XJ0A 4L3LA 2PL0A 3LZBA 5AA8A 2PULA 3A99A 1UU7A 4B6LA 3G5DA 1JVPP 3FMMA 2QOLA 2ITZA 3DKCA 5IQCA 2HWOA 5AP7A 1Q24A 4BDGA 3GC0A 3G2FA 3AQVA 3C7QA 2R3KA 4F9BA 2Q0BA 4IAKA 4G3FA 3UYSA 4TXCA 1YI6A 5HU9A 1PXMA 4RZVA 3COIA 4EL9A 5TT7A 3V3VA 3VUIA 2G2HA 4H3BA 4C62A 5AAEA 1MRYA 4RX9A 4B4LA 1J7IA 5AUZA 4FZ7A 3LFSA 4AW2A 4O1OA 1ZMVA 2UVXA 3ZM4A 4WSQA 3UPXA 4YP8A 4EOIA 2OI4X 4NJ3A 2I40A 2YITA 5HX6A 4F9WA 2WU6A 2BTSA 4LQMA 2B0QA 2OJFE 5HBEA 5DIAA 4W4YA 1QPCA 4FF8A 5LJJA 3FMNA 4J53A 4PNIA 1L3RE 3F5XA 2VTAA 4ORKA 2YIYA 5IEYA 4ZEGA 5AP4A 2VAGA 2EB3A 3HV3A 3LW0A 5DT3A 4O84A 2VTMA 1IEPA 2NPQA 3HECA 2JAVA 2WMUA 4EOLA 1NVRA 2O64A 4IVCA 2ITXA 4TYHB 3TNIA 3RAIA 3LMHA 1UV5A 2ITTA 2ITNA 4FTRA 4CFXA 2VTLA 2Y4IB 4MTAA 3ZTXA 5J7BA 2C6MA 3LMIA 3OTUA 3AMYA 4EH2A 5JKGA 3MH1A 4X3FC 4C37A 5IQHA 2J51A 4CT1A 3LCKA 3H4JA 4RIXA 3NNWA 5HORA 4MXYA 4DFBA 4M0YA 4C4HA 1Q3WA 2GCDA 2WTKB 4WBBB 3P86A 1XH7A 3D94A 3FYJX 2VO3A 4IB1A 5DYJA 2AC5A 3DB6A 4U80A 3AC1A 3A61A 4FNYA 4D1XA 5IZFA 2VN9A 3W33A 2C1AA 3KMWA 4CTCA 4RJ7A 4DEAA 4GK2A 1ZYDA 2VWIA 4L7SA 1JPAA 5IMEA 4O1PA 2ERZE 4NW6A 4I6HA 4QMZA 1BKXA 3U6IA 3EKKA 3LXNA 4NZWB 4ZK5A 3DXPA 4ZMFA 4R3CA 5A3XA 4ZAUA 4EZ7A 2VO0A 3FI4A 4L9IA 1PRYA 2JAMA 4ASZA 2O65A 3DXQA 1F3MC 4JRVA 5AR5A 2H9VA 4RX8A 2PMIA 3GT8A 4WA9A 5HD4A 2H34A 2R3FA 3L9MA 4D5KA 4DTAA 3DXNA 3W2RA 2B7AA 2XYNA 2JDTA 1LUFA 5D7VA 5E8WA 3QZFA 1UVRA 4FTIA 2JIIA 3EN9A 4KIOA 5A4EA 4YJVA 5HESA 4HVDA 2OJGA 2G1TA 2GS7A 2NO3A 3DK6A 3DV3A 3FKOA 3OOMA 4GL9A 4PMSA 4BZOA 3BI6A 5IA4A 4AW5A 3EQIA 3I5ZA 4JBPA 2B52A 3B8RA 5GHVA 3FEGA 5I9ZA 4FICA 1XH8A 2GNGA 3NUAA 4L6QA 4WBOA 3HV7A 2VTPA 3HRFA 3ZEWA 1IAHA 4HVGA 5BVEA 4GUEA 4BHZA 3PZHA 5HCYA 4V04A 2W7XA 4NTSA 4BKZA 3UPZA 4BCHA 5AP2A 3COMA 5M57A 4QP9A 4QRCA 3KRLA 1XHAA 5FDXA 3UO4A 5HE0A 4ACHA 2UV2A 3F3TA 4O6EA 4PDSA 4X0MA 4EONA 4IJPA 4Z7HA 4FBXA 2WEIA 5DT4A 2PSQA 3AT2A 4UALA 4N57A 3E92A 4BTKA 2RKUA 4FSTA 2I0HA 3F5UA 3D5UA 2PZPA 1WBTA 5A14A 2RFEA 1B6CB 3PWDA 3WILA 4BL1A 3BHTA 3BU5A 1J7LA 3A60A 3LXPA 4GSBA 5I9WA 3AT4A 3QD3A 3MPMA 4GVAA 3HA8A 3UNZA 5LVNA 4D0WA 1XBAA 4WG3A 4WNKA 4BKYA 3R83A 4A4XA 3W2OA 4P4CA 2B9FA 2IWIA 4O7VA 5HTBA 3U4WA 4F9YA 5EKNA 2QKWB 3POOA 5GJDA 2QO7A 4PPCA 3F2RA 3C5UA 2Z8CA 3IOKA 5AV0A 2YM7A 3QA0A 4RIWB 2OO8X 2W0JA 3QRIA 3VVHA 4QQ5A 3UGCA 3ZO3A 4JR7A 2R2PA 2WMQA 3DCVA 4FZFB 4XRLA 1QPDA 1JNKA 2PZIA 5H9BA 3OCSA 2WOTA 3V5TA 3ORXA 2UZUE 3F2NA 3F61A 4FT5A 2XCKA 2XM8A 1PYXA 3Q9WA 3GQLA 3RZFA 4DGGA 2CCHA 3TN8A 1GIIA 4NT4A 4UEUA 1M2QA 3RK7A 4QP6A 1K2PA 4L00A 4BI0A 3JXWA 3V8SA 3IDPA 5C27A 4EBVA 3EL7A 4RWIA 3WIGA 5IPJA 1ND4A 4UMRA 1ZZLA 2QONA 2ZMDA 3CQUA 3Q04A 4DYMA 4KKHA 2XF0A 3KCFA 3Q6WA 4FIIA 1P2AA 3A8XA 3VUHA 4GG7A 2X7OA 5HX8A 2CGVA 3E8NA 3R2BA 3AC8A 2PYWA 3CEKA 1UWHA 2WIHA 4KKGA 2OFUA 1OL2A 1R78A 5EI8A 3HUCA 2WQEA 4YJNA 3VWAA 4CV8A 3C0IA 5HD7A 3LPBA 1OL5A 4IBMA 4EH8A 1OIQA 5KMMA 1OKWA 3O7LB 4YBJA 3QTUA 3LMGA 4FSQA 4I6BA 3IW6A 2HZ4A 4FC0A 4PDOA 2CLXA 4TZRA 1OUYA 4L3JA 4H1MA 5CANA 4EK8A 3TDVA 5KE0A 4PQNA 4FTAA 4JRNA 3QQHA 1BYGA 5E91A 4KKEA 5TKDA 5HNIX 3BQCA 3GQIA 3NZ0A 4KBCA 4S31A 2P2HA 2PVJA 3R8ZA 3ZSIA 4EH3A 2EU9A 4K1BA 3F5GA 3DFCB 4KUJA 3OG7A 5FTQA 4PPAA 3UE4A 4NYEA 1XH6A 1H1WA 2A27A 4D4SA 4AN2A 2JDRA 4HGSA 3RMFA 3H10A 2HZNA 3Q3BA 5EHOA 3SRVB 2PVKA 2BVAA 5JGDA 2UW5A 1WBSA 2VRXA 2W9ZB 1PXJA 2PZ5A 3H0ZA 4FG7A 3F7ZA 4USFA 3EZVA 4KRDA 4RA5A 2YAAA 2JDVA 2Y4PA 2QOHA 4JQ8A 4C34A 2W99B 3F82A 2XKCA 3SQQA 4U79A 5D41A 5CF6A 3BYMA 2IG7A 1DI9A 5FEEA 4HOKA 3UO6A 3QKLA 1PXIA 1WVXA 3DZQA 2BRGA 5HHWA 2CGXA 4YBKA 1W98A 4CSVA 4EORA 4KNBA 2J4ZA 3QGYA 3N4VA 2RG5A 4O0WA 3AD6A 4G34A 4XCUA 3BLRA 3RPRA 4CLIA 2YIXA 2J0IA 2W06A 4YJTA 5JFVA 3LIJA 5HE3A 3TL8A 4ANBA 4PY1A 1YI3A 4RZWA 5HVJA 4C35A 2HZ0A 4DN5A 4FZAB 1LEWA 3H0YA 4EOMA 4F7JA 3MY0A 1YXVA 3NUNA 5J1VA 4E73A 4LRKA 4YNOA 3C0HA 4B8MA 1GZOA 4AT3A 2XIRA 1VEBA 4YJOA 3E64A 4GV1A 5EW3A 4EC8A 1M14A 4QNAA 5C4LA 3FYKX 3GCUA 3I7BA 4FEXA 2P33A 3ZSHA 4DC2A 3LQ3A 2ZYBA 4JG7A 5KMKA 4TYHA 3ZXZA 1LEZA 1CKIA 4EH5A 1Y91A 3QXOA 5IQBA 4DFUA 4QMOA 3HRCA 4Z9LA 5FQDC 4I93A 2OH0E 4QMLA 5IISA 5HU3A 2WMSA 4KIPA 5HVYA 4XG2A 3RPYA 1K3AA 4OTFA 2R3OA 4DH1A 4FV2A 5ANJA 5IMXA 5CNNA 2IZUA 3MH3A 2UZOA 4BCMA 5E9EA 2AC3A 3QC9A 4AA0A 1H01A 5J5TA 2Y6MA 3IECA 2CDZA 3GOKA 3IW5A 2OXYA 3VAPA 4FE2A 4E5BA 4RC2A 4Y85A 4RGJA 3K3JA 5DR9A 3UOJA 2CNUA 2FSMX 3T3UA 3BGPA 3MYGA 5BVOA 3MB6A 4R6VA 4XS2A 4ACDA 3VBYA 5H8BA 4P7EA 3W2SA 5CEOA 3R73A 3DAEA 4UXQA 2XIKA 3V6SA 2UZTA 4NKSA 1UU9A 3P7AA 4AG8A 5M51A 4DCAA 3HV4A 3L9NA 3Q2MA 3QCYA 3EN7A 4BCQA 5F95A 4RT7A 3FXZA 2F7EE 3PTGA 4JDHA 2R3HA 3QRTA 4AQCA 3KN6A 5HG8A 3OBJA 4X3FB 3TM0A 3R7VA 3VIDA 2WMVA 4NWMA 2B4SB 3MV5A 1WBPA 2H96A 2R0IA 3KMUA 4IM3A 4IAIA 5JEBA 4CRSA 4WUNA 3I4BA 2IW9A 3SVVA 2UUEA 4ZOGA 5IQEA 5CWZA 3FL5A 3IONA 4G5JA 4LI5A 2BZIB 2DYLA 4MXZA 2GS2A 4BGQA 1LP4A 2BAJA 4PDPA 2XK6A 3HA6A 4U3ZA 1F0QA 3OD6X 4KD1A 4Y46A 4F0FA 3LFFA 1OMWA 4L44A 5KNJA 4JS8A 3FLSA 5JZJA 2VO7A 2C0OA 3D83A 4IWDA 1CM8A 4W4VA 3KULB 3V01A 5J9YA 1AQ1A 5DEWA 3DFAA 4BCNA 2XK3A 3MTLA 1H26A 4GYIA 4DFXE 2OBJA 4DHFA 5C9CA 2WMWA 3BZ3A 4IDVA 1XR1A 4YC3A 2OW3A 4FSNA 3UOHA 3QU0A 4YGAA 4G16A 3PJ8A 3OUKA 2DS1A 2HWPA 3TZ8A 2X8DA 4QMUA 5FM2A 5EYDA 3UOLA 3R22A 1PMNA 4F6UA 4C38A 4ACMA 3CTQA 4DGOA 3NUPA 5IUGA 5ICPA 2BDWA 5AR3A 2XIZA 1W84A 3WF9A 2IO6A 1XH9A 4OLIA 4N70A 4PP9A 4RIWA 1JAMA 2VV9A 3RNIA 3ZCLA 3ZC5A 3ZRLA 3CY3A 4DA5A 2I0YA 2WTIA 4FVRA 4W8DA 1OECA 4QO9A 5IA3A 3L9PA 4IWQA 1M7NA 1V1KA 1WMKA 4GEOA 3PVBA 4EKLA 4EYJA 2O0UA 3W2QA 5GJFA 2A4LA 5BVFA 3MI9A 5IDPA 3GOPA 2XNEA 4EEVA 1ZY4A 4G3EA 5JZNA 3VUDA 5DHJA 5HEZA 5C8NA 4FEQA 3U54A 4ZMEA 3N9XA 3HDMA 2XKFA 1NY3A 1YXUA 5ANIA 5EYCA 2PVRA 2QHMA 2QU5A 2UZWE 3LCTA 4BDKA 3MVMA 3ZZWA 4AP7A 4LUDA 5J9ZA 2PUUA 4QPMA 3W2PA 3FMDA 3PJ3A 4IM0A 1EH4A 1PJKA 4ZS0A 1GNGA 3RAKA 4AX8A 1YWVA 5AV1A 2W4JA 4CZYB 3UQCA 4EJNA 2BCJA 3KXGA 3R8UA 4KSQA 3EZRA 4OT5A 1IG1A 3LFNA 1OL6A 2WB8A 2YIWA 2Z60A 1VJYA 2VX3A 3JS2A 3BIZA 4OAUC 5DEYA 3RK9A 3FI8A 3C51A 2ESMA 3UIMA 3GC9A 3DJ7A 1PXPA 2WMTA 4KABA 4O0UA 4USDA 4G9CA 3EQFA 2W5AA 2Y8OA 2ZVAA 4AZTA 3TT0A 5ETFA 5JK3A 5M4FA 3BKBA 3TKUA 3BBTB 4RIXB 4ZSLA 3Q5ZA 5KMLA 3CQWA 1W8CA 3G90X 4RFZA 3EOCA 3GGFA 4LRJA 5ETIA 1ZWSA 5HG7A 4BIBA 1UU3A 2GHLA 2J5FA 2BDJA 3RI1A 3OWPA 3KQ7A 3BX5A 4IB3A 3P08A 3UIBA 3E7VA 4JBVA 2X2LA 5HQ0A 4NFMA 3EFJA 3QA8A 1FQ1B 4F08A 3SRVA 3ULIA 2JBOA 4U45A 1YWNA 1ZOHA 4GK3A 4WKQA 4AZEA 4LL5A 3V51A 4DAWA 2C0TA 4RWLA 3VS1A 4C3FA 4LRMA 5KZ0A 1XWSA 2XCHA 2RF9A 3BU6A 5HNBA 2G15A 5BX0A 3PJ2A 2XKEA 3PJCA 1YWRA 3QGWA 4FT7A 3V5JA 2WMRA 4EI4A 1ATPE 4K9YA 3L8PA 4C0TA 1H1RA 3GUBA 4NM7A 5LVLA 4H36A 2W1IA 4RC3A 2QOQA 4HGLA 5DN3A 3IPHA 1Q8WA 5D11A 4O81A 3POZA 4TWOA 4U8ZA 3ODZX 3Q6UA 4GIHA 4W8EA 4O7ZA 3LCOA 5KBQA 2ITUA 2JIUA 4NCTA 3BEGA 3P23A 3GVUA 3ETAA 2QO2A 3F3UA 4JDIA 4Z7GA 5I5ZA 3HYHA 4BI1A 2HENA 2OXDA 2VTRA 2EUFB 4PTGA 1UNHA 3F7WA 4IWOA 3TI1A 5EOLA 3UO5A 3E8DA 3W55A 4O27B 3D7ZA 3SXRA 2XK4A 2I0EA 4MF1A 5FBOA 4V05A 4II5A 2HW6A 5H8EA 4QTEA 1GOLA 4AGUA 3EWHA 2J50A 5HG5A 2VTIA 3ZUVA 3Q2JA 5CU2A 5AP6A 4J52A 4QMPA 3QUEA 4XV9A 2VWWA 2X1NA 4EZ5A 1YQJA 3V6RA 2VO6A 4G6NA 4O83A 3GEQA 1BUHA 4HCTA 5DR6A 1PMUA 4O7WA 4OUCA 2AYPA 3MH2A 4FIFA 3RM6A 4CFUA 4FIEA 1A48A 1PXNA 3MB7A 2WMXA 3Q4ZA 4MXOA 5C03A 4GT3A 4BBEA 4EK6A 3QRKA 4O6LA 5A54A 1IA9A 2FGIA 1OL7A 2CKPA 4OBQA 1CDKA 4L67A 2J90A 2WIPA 4XG3A 3GCVA 4GVJA 3MPTA 2GU8A 4UWCA 3AD5A 4RPVA 4R1VA 5AR2A 4I23A 4MF0A 4YZMA 3FI2A 3BGQA 3RBWA 1FVTA 3BYOA 4ZSJA 2W05A 3Q4TA 3R7GA 4L42A 2ZDUA 4FT0A 2FYSA 3NGAA 4AFJA 4L43A 2QLQA 3TIZA 4WG5A 3A7HA 4FTLA 4PF4A 5FG8A 2ZM3A 2E9VA 3UC3A 2XK8A 3ZFYA 3KREA 1DAWA 4UZDA 1FVRA 3O8TA 4X3FA 4OBPA 3FMKA 3IS5A 5FDPA 5EQEA 4OTIA 2C6IA 4FKTA 4DTKA 4TW9A 4BDFA 4GT4A 4UY9A 2OJJA 3KA0A 2ZMCA 4ZTHA 3R9OA 4AA5A 4FV1A 3FWQA 4D1SA 4QQJA 3Q60A 3L1SA 4G3CA 1YI4A 3EL8A 1J1CA 3FXXA 3PPJA 3PY1A 5AV2A 2YM5A 4FOBA 5E8YA 4YHTA 3R1QA 4WNOA 3LFDA 4I4FA 3OZ6A 4NU1A 4RSSA 4UBAA 5JGAA 5GIOE 4LG4A 1LPUA 4NJDA 5IQFA 4IEBA 4M8TA 4AU8A 2WGJA 4MBLA 2GNLA 4G5PA 4RQKA 4AGCA 4FKUA 4Q5HA 3CSVA 4YTFA 3CGOA 4TYEA 2CSNA 4DFLA 5DR2A 3HEGA 5BYLA 4IM2A 3NUUA 3KULA 5CVGA 5EM7A 1G3NA 3MBLA 5JT2A 4WD5A 3TNPC 3ZLXA 5IU2A 2GNHA 4CZTA 1SM2A 2YEXA 3SA0A 4A9SA 5AADA 3FZ1A 3ZLYA 2Z7LA 4BTFA 3BLHA 4NEUA 2UVZA 1URCA 3R8PA 5I9UA 4YR8A 3LAUA 4BFMA 3DAJA 3F3ZA 3QHRA 1ZAOA 4H58A 4RG0A 3UIUA 5HTIA 4BTJA 3L8XA 2JKMA 3LM5A 2RGPA 3DKGA 4O7YA 1FMOE 1Y6AA 4YZBA 4J99A 5FBNC 4RFMA 4AZFA 5CU6A 4B99A 4CEGA 4F1MA 5IUHA 4FOCA 4G2FA 5L2IA 4XG8A 3RTPA 4RLKA 4AUAA 4IADA 4ZTLA 4EYMA 4TTHB 5DH3A 3REPA 4F0IA 4PRJA 1RJBA 3KF7A 3IW4A 3ORTA 3EB0A 3QALE 4GMYA 4FTCA 4E5AX 4K2RA 1JOWB 5JFXA 4I94A 2Y9QA 3R1SA 3MN3A 5CENA 1PMVA 2OGVA 3Q4CA 5CXHA 5J9LA 2Q83A 4I3ZA 1OVEA 3F3VA 3O23A 1WBNA 2PUNA 5F4NA 1FGIA 2A0CX 2BRHA 2ZM4A 3ALNA 4O7TA 3EN5A 3JY9A 4EUUA 3GNIB 3MFTA 3JUHA 5JMSA 1ERKA 3WBLA 2WQMA 2UW8A 4ZJIA 3ZMMA 5CT7A 4QMXA 3FDNA 3I79A 3TJDA 3SOCA 3CS9A 4APCA 5HI2A 3FL4A 4I6FA 4IACA 1MRVA 5CSHA 3U51A 2A19B 3ZU7A 2BRNA 4JL9A 1H24A 3EQDA 4FV6A 3SW4A 2FB8A 5AP3A 5IQDA 5DPVA 4EH7A 2C3JA 3FMHA 1MUOA 5KZIA 2BAKA 5J87A 3D2KA 3FPQA 3V8TA 2XB7A 5CF8A 1Q5KA 4DH8A 4NSTA 2EVAA 3I0QA 4QD6A 2BROA 2BTRA 3UNJA 2FSOX 4FTTA 1SNXA 3HV5A 3HMNA 3PXRA 2QOFA 2NRUA 2C5NA 3ORLA 5J7HA 1HOWA 4IB0A 5D10A 4BCJA 5HIEA 5IA0A 2YDIA 2CHLA 2UVYA 4L46A 4CFNA 4FNZA 5DT0A 5ITAA 2QOCA 2VTNA 2WKMA 4CNHA 1B39A 3AMBA 2GFSA 4H1JA 4AFEA 3NCZA 3G33A 3KXHA 4YZDA 5IH4A 3KRXA 2C68A 3ACKA 4RJ5A 5HVKA 4YU2A 1SNUA 3VHEA 3QXPA 2WFYA 4QTCA 4A9UA 5BVWA 3C13A 5T6KA 1CSNA 2C3LA 2JKOA 2OIQA 2YCSA 3GU7A 2YIQA 3KKVA 4YLKA 2YABA 3RKBA 4R5YA 3LLTA 3MFSA 4GK4A 4F4PA 5L6PA 2J5EA 2WD1A 5LCKA 4YLJA 1YOMA 4QMNA 3LHJA 3IW7A 3RPSA 2BPMA 3AT3A 5HKMA 5HCXA 3O8UA 3TUCA 2EXCX 2QU6A 3NNUA 4QYYA 4HYHA 3I5NA 3PVGA 4FKVA 3H9RA 3SDJA 3EQBA 4CFVA 4LM5A 4Z16A 4BWPA 4CVAA 1DAYA 2XA4A 4OTGA 3WI6A 3NDMA 3TTIA 4BCIA 3FUPA 1ZARA 2XEZA 3DTWA 5K0KA 4XHKB 4AAAA 4MQ1A 2W4OA 3TV4A 3Q9ZA 4ZIMA 2YCFA 1U4DA 5AWMA 5L6WL 4EH4A 3FHIA 2QD9A 2BKKA 5C8MA 3NAXA 3RHXA 4GKIA 3R9HA 5C4KA 3NX8A 4XV3A 5I9YA 4FKIA 3ZS5A 5M09A 3E3PA 5CAQA 5BNJA 4M97A 3ANQA 3NAYA 1ZYLA 2YM3A 3I7CA 3PXYA 4TWNA 4X6QC 4BWXA 2IZTA 3BYSA 3T3VA 3UVPA 3LQ5A 4QMMA 5L8LA 3HKOA 4HZRA 2XJ0A 3PA5A 4CFFA 4APPA 2G01A 5AX3A 4UN0C 2XIYA 3S4QA 3EFWA 4BF2A 2O2UA 2RL5A 3F88A 2YDKA 2Y7JA 2VNYA 3VQUA 2JKKA 3BGZA 1U5RA 2E9NA 5ANDA 1NW1A 3C4ZA 1BX6A
chains in the Genus database with same CATH superfamily
3CPBA 5AX9A 3L8SA 3SGCA 2PVNA 5CF5A 3A7FA 3RWPA 3QRUA 5L6OA 4NIFB 3ZC6A 4ALVA 4WT6A 3WF5A 4F9AA 3PIZA 1BMKA 4DLJA 1OM1A 2R64A 4FK3A 2Z7QA 4OBOA 4ANOA 1YKRA 3HAMA 3LKMA 1R0PA 3WF6A 3DBDA 2X7FA 3BHYA 4FK6A 4XOYA 1GZ8A 4QTDA 2C3KA 2UZLA 4BKJA 2OXXA 3A7JA 3VS2A 4A07A 5TR6A 5CQWA 3MA6A 1QMZA 4FGBA 1YDSE 5CSXA 3Q96A 4DEBA 2GQGA 4WO5A 4BR3A 4FNXA 2CNQA 4OW8A 3TTJA 4S32A 4V0GB 1LR4A 4S30A 2YHVA 3II5A 4GS6A 4QMWA 3W18A 3BV2A 2VTSA 1H4LA 2ZFYA 3NNXA 3D14A 5FD2A 4G3GA 3GU6A 5BMMA 2LAVA 4C33A 4WIHA 5IH5A 4U42A 4DDGA 2G2IA 2QG5A 3OWLA 4IVBA 1CTPE 2QNJA 3P7BA 4PL4A 4FZ6A 3ZRMA 4RVKA 3ORKA 3QC4A 4BDIA 1ZOEA 2P2IA 4YZNA 4PX6A 1UWJA 1ZYSA 5F1ZA 4BN1A 4Y8DA 1XMLA 1H1QA 3FLYA 5HBJA 4J7BA 2IN6A 2AUHA 4FIGA 4F70A 3W0RA 1H27A 2E9UA 3C1XA 2YDJA 3D2IA 4K0YA 2WAJA 5H3QA 2I0VA 3HVCA 2UZBA 3MVHA 2SRCA 3G51A 4IAAA 3QD4A 4U0IA 3KRWA 2PE0A 3E8CA 5HO7A 3DY7A 3FE3A 5KMJA 4X2NA 3GU4A 4U9AA 3RVGA 2W17A 3UC4A 4E8AA 4EHGA 5IA1A 3QHWA 5AP0A 3F66A 4UYAA 4D9UA 2OH4A 3BPRA 3GCSA 5H8GA 3ZYAA 1TQIA 4XEYA 2GQRA 4IZ5A 4C4EA 4FSWA 4UWYA 4MQ2A 4EK5A 5CAVA 2O3PA 4ERWA 4IW0A 3T9IA 4YMJA 3EQGA 5L8KA 1YHWA 4I4EA 3SLSA 3C50A 3QCXA 5A4TA 5E8ZA 5HCZA 3UDBA 4DGMA 3BRBA 3DA6A 3DQXA 3PXQA 5HO8A 3ZEPA 3O7LD 1Z57A 2C4GA 3ACJA 3P0MA 3VBVA 2G9XA 4CV9A 4QQTA 2W5BA 2NYAA 4ZTSA 1QCFA 4QP3A 3VF9A 2WNTA 3COHA 2C69A 3VF8A 2CLQA 4LMUA 4ZLZA 3SXSA 2R3NA 3Q32A 4FKLA 4NL0A 3VQHA 4YTCA 4JNWA 3FY2A 3QTQA 3VS3A 4R77A 1CKPA 2QI8A 4O86A 3CTJA 4C2VA 4AS0A 2BHHA 5LMBA 2C5XA 2EXEA 2PVMA 2HXQA 4XX9A 3V5PA 1ZMUA 3GCPA 2ZB0A 2X9EA 3ORZA 3ZRKA 3U8WA 3PFQA 3E87A 3M1SA 5EQYA 4L01A 2C6KA 5I9XA 4I0TA 1WCCA 3BHVA 1L8TA 4FEWA 4R78A 4RFYA 4I22A 4UZHA 4GT5A 4E4MA 5LWMA 3SW7A 4LV5A 3L9LA 4FVQA 4NM3A 4QYFA 4EOPA 5CF4A 3DJ5A 4I5CA 5M08A 3FAAA 4E6CA 1WFCA 2CJMA 4IFGA 5KMOA 4DGLC 3DBEA 4LGDA 5C01A 1KE8A 2QHNA 3EQCA 4YJPA 3W16A 3FJQE 3ITZA 4BCPA 5KX8A 3EMGA 4M3QA 5I3OA 4PV0A 1NT2A 2YCRA 3DS6A 2J7TA 4OTWA 3U4UA 3CKWA 4IX6A 3W0NA 5TF9A 2IF8A 4L68A 2V22A 1I09A 4HVHA 4HGTA 4K33A 3KVXA 4M66A 4OR5A 4MHAA 4O2PA 4EZ3A 3I1AA 5M4CA 3CY2A 5L2SA 2F7XE 3NPCA 3HV6A 5A4CA 3NW5A 3MJ1A 2X39A 3I6UA 3TNQB 3ATSA 3R1NA 2J0MB 3DBFA 5HOAA 1OGUA 5EOBA 4HVIA 4CCBA 4F9CA 2WMAA 3R1YA 3BLQA 2ONLC 3QZHA 1W82A 4FTOA 1RDQE 5AMNA 4ZS4A 1E9HA 5L8JA 3U9CA 3W8LA 4AZSA 1GY3A 5KHWA 4PTEA 5DNRA 4NW5A 5CEMA 4WSYA 3R8VA 1UKHA 4PTCA 3OBGA 4KA3A 3CQEA 1PKDA 3GBZA 3E88A 3PY0A 4AOIA 2C47A 1OBDA 4AE6A 5IEXA 1KE7A 1OPLA 4HYIA 2GNJA 3QYZA 2W1GA 4OTHA 4QP4A 5A9UA 5L2WA 3OHTA 4CLJA 4TYJA 3UP7A 2R3MA 3QX2A 5CQUA 3S95A 3PP0A 2Z2WA 2IVTA 2GMXA 4BDDA 4C2WA 5JSMA 1AD5A 1R39A 4MAOA 3JVSA 4QPAA 5IH6A 1Q8ZA 1OITA 4XG6A 2W1CA 3G6GA 3S00A 3N4UA 3ENHA 3AC2A 3M11A 3UDSA 4DEGA 2EXMA 4ID7A 4ONAA 5JQ8A 4WNPA 1G8JA 5CYIA 5AP5A 2GSFA 3Q9XA 4CKRA 3U55A 4FX3A 2QR7A 4PL3A 3OY3A 1HCLA 5F94A 4J95A 4DG2E 1Q97A 2UZNA 4EUTA 4FTUA 5KKRC 3JY0A 5FP5A 3NVKI 2XBJA 5BYYA 4I0SA 3DU8A 5FGKA 3EQRA 4MWHA 4YJSA 3HX4A 3PSBA 2NRYA 4F7LA 3QBNA 3OROA 3D5XA 1OKYA 3TEIA 2XANA 3UDZA 5D1JA 3WZJA 5TE0A 1YHVA 4QTAA 1JSTA 4MXAA 3CCNA 4R3PA 5JFSA 4RJ3A 2RFNA 4UB7A 3KU2A 1JWHA 2BHEA 4FSZA 1IAJA 5TO8A 1Q41A 3D15A 1DS5A 2FUMA 3FBVA 3KB7A 4JQ7A 4RVTA 3GFWA 1H1SA 1YDRE 4QT1A 5J95A 2GQSA 2B53A 3GC7A 2WTCA 4OTDA 4DEDA 4F6SA 5BMSA 4OT6A 5I0BA 3V04A 2C6EA 2VTJA 2R3QA 3P7CA 5G1XA 3W10A 4AT4A 4KIKB 1PXLA 4EWQA 1PYEA 2UZVA 3B8QA 3AOXA 3H9FA 2F2UA 3QTIA 5EM8A 5EW8A 4K11A 4JIKA 2EWAA 5CAOA 3VBWA 2O63A 3UMWA 1OIRA 4WRSA 2VWBA 4QDEA 2HZIA 5FP6A 2J0LA 5LOHA 4EQMA 4FIJA 4XLVA 3M42A 4U3YA 4MCVA 3UG2A 2HY0A 4TYIA 3CJGA 4ITIA 1VYZA 2O8YA 4P5ZA 5C1QB 1KE5A 4O0RA 5AJQA 1Q4LA 5K9IA 3TNHA 1GAGA 1J1BA 5HBHA 4JBOA 4O0SA 1XBCA 2QG7A 4RWKA 3HLLA 3G9NA 4IZYA 3LFEA 2BFYA 4BIDA 2W1HA 3NR9A 2FO0A 2VWXA 4NIFA 2OF2A 4I5MA 3FMJA 4BDBA 5F9EA 3EN4A 4FG9A 3TZ9A 5GZ8A 5EYKA 3UZRA 1IASA 3G9LX 5HLWA 5CEQA 2YM4A 4QP2A 3K5UA 1OB3A 5M55A 3TUBA 3MVJA 5CZHA 5HE2A 4LOOA 1FGKA 4DG3E 2XK9A 3DGKA 3FZOA 4U97A 4RVLA 5E8TA 4XNEA 2C6OA 1VYWA 4P90A 3LFAA 3PZEA 4NKAA 4XUFA 3QRJA 2VWUA 5FLFA 3PDTA 4BZDA 4AXFA 4D0XA 5EDPA 4V0GA 3PUPA 3S3IA 2AEGA 1H08A 5KO1A 3C4EA 4M69B 1M17A 4TN6A 3BEAA 5LARA 2UW3A 4H3QA 4FL2A 3A7GA 3FLQA 3I60A 3UMXA 3VUTA 3RCDA 1JLUE 3EN6A 2HCKA 4IFCA 4BICA 1J7UA 3C4XA 3NLBA 2KULA 2OF4A 4IC7A 1PKGA 4HCUA 4FZDB 4J8MA 3RCJA 5EH0A 4QMQA 4F63A 2HXLA 1YXXA 4Y5HA 4KS7A 2IPXA 2C5OA 3ZONA 3ZXTA 2VWZA 3MIAA 3QL8A 3QWKA 4DFNA 2WHBA 3QUPA 4N6ZA 4RIOA 3SHEA 4EH6A 2GS6A 4I21A 2PPQA 3FY0A 3LOKA 3D7TA 3OF0A 4QYEA 2F57A 3CD3A 3VBQA 4GKHA 2XM9A 4Y95A 2Y4IC 2QQ7A 3PY3A 4R1YA 5CEPA 4D2RA 4E1ZA 4R8QA 3PUFC 1PMEA 4G17A 2IVUA 5IQGA 1P4OA 3O96A 3QQJA 3S1HA 4F1TA 1JSUA 2F2CB 3TKIA 5I3RA 3HMOA 3KCKA 2JD5A 5EFQA 3NVMB 3R30A 4EOSA 4WG4A 3QKMA 2ZAZA 3OWJA 4FV4A 4O4BB 3R9NA 3DLZA 4BB4A 5CALA 5GINE 3PP1A 4JDJA 4EWHA 1DM2A 4BYIA 4M68A 4AN9A 4AN3A 4IDTA 4JI9A 4YPSA 3TZMA 4E4XA 3NWWA 2XKDA 2PZRA 3DBQA 3HL7A 4MXCA 3PE2A 4C58A 5KMIA 3UVQA 1Y8GA 3SG8A 3DNEA 3OT3A 4FV0A 4IHPA 4IQ6A 3LE6A 3DNDA 4Y72A 4UMQA 4ASXA 3ENMA 4DH3A 4JQEA 3PA4A 4CTBA 4J97A 1OBGA 3MDYA 4JX7A 3RM7A 3EFLA 4B0GA 3QZIA 4CCUA 3MY1A 1JBPE 3GP0A 5DBXA 3ID6C 3BV3A 1W2DA 2HAKA 2R7BA 3ANRA 2R5TA 2P55A 4D2VA 3BLAA 5BUIA 2VZ6A 4O38A 1ZOGA 1WBVA 2X2KA 4GG5A 3PE1A 1M52A 1OL1A 4X2GA 3WOWA 3D5WA 4FKGA 3UQFA 3DBCA 4LMNA 4O0TA 2ZJWA 5CI6A 4ZSGA 2OZAB 5E1EA 3E63A 2BFXA 4EK4A 5CSPA 2CN8A 4RVMA 2I6LA 4QP7A 5L2QA 3VUKA 3ML1A 5AR8A 2IW6A 2X2MA 3D0EA 3KFAA 3O71A 3D4QA 1M2PA 5LWNA 4PNKA 2GHGA 2WOUA 2JIVA 2Y0AA 3CJFA 3GU8A 4YUQA 4I5PA 1H0VA 3PLSA 3MWUA 1FINA 1FMKA 3KVWA 5FXSA 1R1WA 4CT2A 4AGDA 2B55A 4RX5A 2XUUA 4FKJA 3NFGB 4QP8A 3KXNA 4JR3A 2OJ9A 4L45A 5D7AA 2OSCA 4J96A 1KV1A 3JPVA 3Q5IA 5FXQA 3ZO2A 4ANQA 1GJOA 5IA5A 5KBRA 5BPYA 2F9GA 2H6DA 2X4FA 5K4JA 5M4IA 1ZLTA 3AXWA 2CKQA 2PUPA 3RPOA 3M2WA 3AC5A 5DA3A 4DLIA 1V0OA 4HPTE 4QMYA 2B54A 4C02A 1TKIA 2HK5A 5E1SA 2BDFA 5JRQA 3PPZA 4IX5A 4P5QA 2BZJA 2ERKA 3IOPA 2WQOA 3CD8A 4DDIA 1T45A 3KXZA 3VW8A 1MRUA 3E8EA 2JC6A 3KN5A 2IJMA 1YRPA 3Q9YA 4C4GA 3CBLA 3H30A 4F64A 4AXEA 4DBNA 3BBWA 1P5EA 3E3BX 4FL3A 1Z9XA 3OOGA 4IWPA 5KHXA 4CG8A 2FA2A 3NSZA 4BYJA 3ZUTA 4TYGA 5KUPA 4KB8A 5CS6A 2X0GA 4FKSA 3OXTA 3KL8A 4TY1A 3ZO4A 5J8IA 3HMMA 4PDYA 2CMWA 5T68A 1GIHA 2R3PA 4BDHA 2YFXA 3F6XA 5E8XA 5EDQA 5BUEA 3GC8A 3NW6A 1W7HA 4M84A 4RJ8A 3P1AA 4X7QA 5ANEA 4A06A 2OU7A 3NRMA 2HW7A 3GXLA 2GTMA 4U5JA 3NS9A 4D2PA 4DGNA 3O50A 2B9HA 1H00A 3UOKA 4E26A 4EBWA 1A06A 3FLWA 2VX0A 4FYNA 5EM5A 3AGMA 1JSVA 1RW8A 4FIHA 4E3CA 5GIPE 4X21A 3GENA 3R7EA 3OWKA 3PXZA 2FH9A 3MGYA 5M07A 4C4FA 4G31A 4MVFA 5FWKK 3LLAA 4JJRA 1OIUA 2VNWA 4KIQA 4EQUA 3MIYA 4FKRA 3W0PA 3CE3A 4UWBA 2WPAA 3E5AA 3K2LA 3OW3A 2YERA 4WOVA 3IDBA 4I24A 3WZDA 4EKKA 3KRRA 4TWCA 1Q8YA 3MVLA 4AACA 1JKLA 3LFBA 4KIKA 2JDOA 5LMKC 1XKKA 4Y5QA 3UBDA 1Z5MA 2XEYA 2VUWA 1Q61A 2PE2A 1OUKA 1R0EA 2BIKB 4Q5EA 4RIYB 3NYOA 3RAWA 5AUUA 3GFEA 2FSLX 2CGWA 4FTQA 2ACXA 4I0RA 1GIJA 5FTOA 5JH6A 2IVVA 4GJ3A 4ZP5A 1UNGA 2BMCA 3RHKA 2NP8A 4ENXA 1KSWA 4IE9A 4FTKA 1GZKA 3SAYA 5EDRA 4H3PA 1DI8A 5G6VA 5K0XA 5EHLA 3OXZA 4D2WA 5LQFA 3RP9A 3DOGA 5CNOA 4Z3VA 5EI6A 4XYFA 4ASEA 4F7NA 4A9YA 4O0XA 2WQNA 3R63A 3V5QA 4JLCA 4X2FA 4BHNA 1K9AA 4FVPA 4CYJA 4RA4A 2VWVA 3R28A 2PVFA 2BZKB 3CC6A 3WF7A 5LCJA 4DITA 2F49A 5IA2A 5IQAA 3DKOA 3UODA 1FBNA 4DTBA 3T8OA 3G0FA 2F7ZE 2WTVA 3Q52A 4X3JA 5HGIA 4ZZMA 4CXAA 4E6DA 4JT3A 4FTJA 4KS8A 4DG0E 4IAZA 1NXKA 3IG7A 3QLFA 3TACA 3UP2A 3CTHA 2JFMA 2X6DA 3DK3A 3BE9A 4M69A 3G0EA 5LVOA 1HCKA 3W2CA 2VTOA 2YM6A 4PUZA 4AZWA 4YC6A 3NYVA 3VRYA 4IB5A 2C30A 2HOGA 4K6ZA 2C6DA 5HG9A 5AAFA 2IW8A 3VULA 3FC2A 3S2PA 4WRGA 4W4XA 3U87A 4FKPA 2LGCA 1ZRZA 4HZSA 5HICA 5A4QA 4IIRA 5L4QA 1X8BA 2XNNA 1W83A 3OTVA 4DH7A 3RWQA 4YSJA 4GFMA 4GW8A 3E7OA 1M2RA 1STCE 4D55A 2J2IB 3W32A 4FYOA 4KAOA 1JKTA 4AF3A 4EQCA 5AUYA 4M67A 5FTGA 2DUVA 4IXPA 4FGRA 2VTQA 5JN2A 1RQQA 3I6WA 3QTXA 2GHMA 3PIYA 4C3PA 2PVLA 2VWYA 3PLAE 3PA3A 4IMYA 3AD4A 3IKAA 3MS9A 4I1ZA 4G1WA 2JLDA 4K77A 3FLZA 1TQMA 2XJ2A 4E4LA 3CPCA 4XG4A 1O6YA 4DF3A 5C8KA 3AC3A 4LFIA 1XH4A 3UTOA 4AOTA 3VBXA 3QCQA 2RFSA 4W9WA 4D1ZA 4I5HA 3F5PA 1O9UA 3LJ1A 2RFDA 4MNEB 1PW2A 3UNKA 4HNIA 3ZFMA 4ANNA 4XH6A 3R7UA 3RPVA 4C3RA 4FSMA 3DLSA 3CGFA 2X8EA 5E7RA 3IDCA 5CAPA 3IO7A 4FV7A 1YVJA 4FODA 5AIKA 2RSVA 2XK7A 4GFOA 3SC1A 1V0PA 5AA9A 4W9XA 3ZM9A 2QOOA 4JG8A 2R7IA 4N0SA 2X9FA 4ACGA 4LL0A 4NK9A 1AGWA 4DEEA 4HJOA 4FI1A 4IAFA 4CMOA 4KINA 3HAVA 3U9NA 3FZSA 3EHAA 3KMMA 3KRJA 4C57A 1Y6BA 4O7SA 3ROCA 4M0ZA 1MQBA 2YZAA 5AUVA 4B9DA 1A9UA 5A6NA 2ITPA 3FLNC 3EQHA 2XJ1A 1UA2A 3EH9A 5E8VA 2OZAA 2HIWA 4M14A 3FKNA 4PPBA 2UZDA 1PXOA 4FTNA 4XP2A 4AT5A 3QQUA 4ANMA 4ZZOA 3FMEA 3H3CA 4Q2AA 3UZPA 4DFYA 2DQ7X 4EJ7A 1APME 2I1MA 4JAJA 4A9RA 3F2AA 4ZZNA 4FKQA 3FPMA 4O7RA 5ETAA 5E4HA 1TQPA 3PVUA 4W4WA 5K3YA 4M7IA 4LOPA 2CPKE 3R0TA 4IX3A 4PL5A 3OXIA 1P4FA 2Z7SA 5CLPA 4ZY6A 1FVVA 4QMTA 1O6LA 4ZTRA 4HVSA 3QCSA 5B2LA 2ZOQA 1U59A 2ITWA 1G8AA 3K5VA 4B7TA 2YLEA 3W0MA 4EHEA 2UW4A 3B2TA 4GUBA 4M12A 4FKOA 4MX9A 4YC8A 5CU4A 4UMPA 1KE9A 2HY81 3ZHPC 5L2TA 4D9TA 5KMNA 4A7CA 5JRSA 2A98A 3ZDUA 4U43A 4KSPA 5FXRA 4TNBA 1Y57A 3ZFXA 3U6JA 3R9DA 4CRLA 3EJ1A 3DT1A 3HRBA 3OMVA 4ANSA 3KEXA 5JQ5A 2ZDTA 4MD9E 1YDTE 3OC1A 4O4FA 3O5AA 4IVDA 2XIXA 2JKQA 2W1DA 4QOXA 4F78A 5M06A 4MK0A 4M15A 3E62A 2QR8A 5CEIA 1UU8A 3O2MA 2BILB 2OICA 4MD7E 5H2UA 5DMZA 2ITOA 3BYVA 4TPTA 3HMPA 2IZSA 5EW9A 4USEA 3DZOA 1R3CA 3DPKA 2REIA 2YJRA 3QQGA 4O0VA 5J5SA 1OIYA 3JYAA 3B2WA 5FEDA 3LXKA 5FM3A 1Q8TA 4HNFA 3TV7A 4U44A 4R7BA 3P9JA 1FOTA 2ONLA 2XNGA 3WE4A 5EK7A 1WAKA 4MEDA 5AAGA 4CGAA 3F69A 2ITVA 4LYNA 4YPDA 2QOBA 5CAUA 3NUXA 3SKCA 4FV8A 4R5SA 4CQGA 3FXWA 3W0SA 3H9OA 2RIOA 4DEHA 1XBBA 5M53A 2JITA 1ZXEA 4TWPA 5CVHA 3LCDA 1SVHA 1VZOA 4DH5A 4I20A 2F4JA 4ZXTA 4BBFA 5KCVA 4F0GA 5DG5A 1ZYCA 5HNGA 1U54B 3OFMA 1G8SA 2UW6A 1YHSA 3RJCA 4D2TA 3TJCA 5A46A 2CKOA 3PXKA 5T3QA 3TZ7A 4YZ9A 4YURA 1J91A 3KGAA 4AZVA 4EHZA 3JR1A 3LVPA 2HYYA 3BYUA 2JFLA 4J98A 2V62A 2FVDA 1XO2B 3D7TB 4MBJA 2BAQA 4FT9A 4X2KA 1PF8A 4CYIA 5AUTA 3UZTA 3ERKA 4M13A 3PIXA 5DI1A 5I9VA 2JGZA 2P0CA 2XH5A 4N6YA 4KRCA 4FJVA 4Y83A 4H39A 2VD5A 2X0QA 3DAKA 4E4NA 4XBUA 3FKLA 5AP1A 4O7NA 2OIBA 3VUGA 4RIYA 4BTMA 3VW6A 2E2BA 4U40A 4E7WA 2Y6OA 4CKJA 4S2ZA 2XVDA 5AIRA 3WZKA 4FSYA 3JVRA 4R3RA 5J79A 4HGEA 4MNFA 3ORMA 1OPJA 4NTTA 5ETCA 2X7GA 4JBQA 3RK5A 2ZM1A 5AEPA 4RJ6A 1H25A 3VNTA 2WEVA 4RJ4A 1Q62A 4HYUA 4YO6A 3SV0A 5ACBC 3A8WA 3FQSA 4CFMA 3D9VA 2BR1A 4DFZE 1MP8A 2QC6A 3CR0A 4MH7A 5ANOA 5D12A 4DT8A 5IF1A 2PMOX 3TIYA 5EI2A 3DDQA 1BL7A 2E9PA 2XNMA 3RNYA 2GNFA 2R9SA 3TWJA 3S0OA 4RMZA 1YXTA 2C6TA 4GH2A 3PPKA 5D9HA 5IG1A 3ORPA 4CD0A 3AC4A 4JXFA 4ARKA 4XV1A 3NMUF 3BCEA 1W0XC 4L8MA 1H0WA 3UG1A 2RG6A 1CKJA 1NVQA 3VHKA 2OFVA 4K8AA 3ZOSA 2GPHA 1VLRA 3BQRA 3SX9A 3P79A 4YZCA 5A4LA 2G2FA 2PTKA 4RWJA 4GFGA 2W1ZA 4HCVA 3AGLA 5IUIA 4BZNA 4QQCA 5K5XA 3R00A 4FEVA 3UIXA 3OCTA 3VS7A 2XAOA 2PWLA 3EYHA 4G6OA 3DKFA 5AM6A 1U5QA 3HP2A 4FEUA 2YA9A 2QKRA 3MY5A 3RZBA 3R7OA 2YLFA 4BCGA 4D58A 3ZBFA 3ZZEA 1BI7A 3FZTA 3TUDA 1Q3DA 5AR7A 3FV8A 1KV2A 3V5WA 4ZLOA 4YLLA 2C1BA 3NUSA 4A9TA 5LXMA 3NFFB 1KWPA 3WYXA 3OCBA 4BDEA 2VTHA 4CQEA 2EB2A 4GCJA 4J71A 5EM6A 2ETRA 4GRBA 5GNKA 4FNWA 5AUWA 4DINA 4XG9A 5CT0A 4BBMA 4OTPA 3R01A 4C36A 4BC6A 3MESA 5HZNA 3W8QA 4R7IA 3LM0A 2BUJA 3VUMA 4ITHA 5L3AA 3DTCA 3LCSA 3EIDA 3AMAA 3MH0A 3QAME 3OP5A 3PSDA 3IW8A 4ZY4A 4LGGA 3PG3A 4ALWA 1H8FA 2QCSA 5DRBA 3WZEA 1H28A 2B1PA 3BWJA 1OKVA 5CSWA 5BYZA 2CNVA 4QEBA 2J0KA 4U6RA 2GNIA 2NNWB 4Q9ZA 4DT9A 1E1VA 1OPKA 4BDAA 3LJ0A 4XBRA 4QMSA 2JEDA 2WMBA 2PY3A 2XS0A 1QPEA 3P4KA 4FUYA 5DE2A 3QKKA 1CMKE 2BIYA 4MNEA 2UW0A 4TRLA 4OAVB 3OT8A 3WIKA 3KC3A 1W2FA 3RINA 3PJ1A 4CKIA 2C5VA 1ZY5A 2VGOA 2X4ZA 3NUYA 3R21A 2XRUA 4P2KA 3A62A 4UMUA 1V0BA 4G9RA 3FMLA 2VGPA 3R8MA 4F99A 5AV3A 2V0DA 4GIIA 3MW1A 5LMAA 1E1XA 4FA2A 3QD2B 3DB8A 3HNGA 3FZRA 3PSCA 3FHRA 4BCKA 4O0YA 3A4OX 3QWJA 4A4OA 2ZV9A 5DLSA 4XV2A 2X81A 3FI3A 2QLUA 4I92A 5CXZA 3OUNB 3TG1A 5LVPA 3ZLWA 4GJ2A 3R8LA 3QYWA 4U81A 4MXXA 2OK1A 2UZEA 3A7IA 4F1OA 4LV7A 4YSMA 4O82A 5GZAA 5ANKA 5C26A 4XG7A 4WUAA 3VO3A 2PK9A 4JVGA 3QZGA 4IZAA 5BVNA 3R6XA 3NYXA 4R7HA 2HELA 4XP3A 3ZSGA 5CASA 2VU3A 3SOAA 4ENYA 2ITQA 3PG1A 1P14A 4XOZA 3D5VA 4HYSA 4TKSA 4D4RA 1UKIA 2ETMA 5AV4A 4L53A 3R02A 4BDJA 1KUTA 1ST0A 1Q99A 3R04A 4RBLA 4WHZA 3W1FA 3WE8A 3FSKA 2YZLA 3QQKA 2C6LA 4RRVA 4MD8E 1YOLA 3L8VA 3P78A 4LUEA 1S9IA 4EOOA 5B7VA 5HTCA 3LXLA 3ORIA 4KBAA 3WYYA 4KBKA 5E90A 1WVYA 3IQ7A 3GB2A 2JDSA 1UNLA 3OS3A 5BVKA 2R3JA 4D4VA 4O21A 4PMTA 3WZUA 4LDTA 4FSRA 3ZLSA 2A1AB 4AA4A 4FG8A 5DGZA 4YHFA 1TVOA 4U41A 2O5KA 3UVRA 2P4IA 4KWPA 3VS0A 4UXLA 4J1RA 4NUSA 5BUJA 4QYGA 3UDTA 3ET7A 1OKZA 3LJ2A 4OTQA 3K3IA 3PRIA 3R2YA 2WZJA 2ITYA 2VX1A 1YW2A 2PHKA 2QO9A 2WELA 4LGHA 2WTJA 4YJUA 3THBA 4O7LA 1YXSA 5EQPA 2QODA 4JAIA 2YM8A 1KOBA 1WBWA 2H8HA 3CLYA 4WNMA 3HDNA 4XLIA 3LQ8A 2B9IA 4PWNA 1PY5A 3O51A 2CN5A 2YISA 2W5HA 4FT3A 2W96B 4I6QA 3CXWA 5E8SA 3VJOA 2V7OA 4E6QA 4Z55A 1TFFA 5E8UA 1RE8A 2A2AA 3I0OA 4CMTA 1ZYJA 2WO6A 4NM5A 2OIDA 1JKSA 2C5YA 4N4SA 3O17A 5HLNA 2OJIA 3KXMA 4BGGA 2V55A 4GU9A 4G3DA 3PWYA 3OVVA 2UW7A 1U46A 3QTSA 2CKEA 3U6HA 3CIKA 4YO4A 5CEKA 5CU0A 1VR2A 4FV9A 3DDPA 3T9TA 2XP2A 1U54A 3AKLA 5K5NA 4L3PA 5EHYA 5HIBA 5TOZA 4ANLA 4J8NA 5E92A 3UYTA 5B0XA 3A2CA 1ZMWA 2WXVA 3QTRA 2XYUA 3KF4A 4FKWA 5B2MA 5ANGA 2GTNA 3BU3A 3WF8A 4K18A 1URWA 3K54A 3ULZA 4O2ZA 4EOKA 4ZSAA 5M56A 3ATTA 2YAKA 2CCIA 5EG3A 4A4LA 5DWRA 1PHKA 3ZBXA 3WARA 2PVHA 2XNBA 3SD0A 3V8WA 2X8IA 3LFCA 1YOJA 3QQFA 4PMMA 2J9MA 1BI8A 1SVEA 1XJDA 2C0IA 2OKRA 1G5SA 2WTKC 3TNWA 2Q0NA 2FSTX 2IZRA 4LOQA 3FSFA 5GZ9A 5I4NA 4L7FA 4XMOA 3DJ6A 1JKKA 4EOQA 2J6MA 2BALA 4E20A 4QPSA 2R3LA 5DFPA 4MKCA 2J0JA 4X2JA 2BRMA 4UMTA 3BHUA 2BZHB 5HIDA