4RRPM

Crystal structure of the fab complexed with antigen asf1p, northeast structural genomics consortium (nesg) target pdr16
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
153
Chain Sequence
GSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics Consortium (NESG) Target PdR16
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab antibody, light chain
total genus 27
structure length 153
sequence length 158
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4rrpM00
5EIIG 2I32A 2DZEA 5BNXD 4EO5A 2IIJA 2Z3FA 5C3IA 1TEYA 2Z34A 4ZBJA 2HUEA 1ROCA 2IO5A 2YGVA 5BO0D 3AADB 4RRPM 2IDCA 1WG3A 2CU9A
chains in the Genus database with same CATH superfamily
5F7UA 3HZKA 5F8QC 4Z7VA 5IQMA 4Y4FC 4Z7QF 3BFWA 2HTLD 5E5LA 2FBRA 1FNAA 5DK2B 1NAMB 4XNXL 5GJSL 5EG6C 3VXMD 4JN2B 3JTTB 1LMKA 1U2CA 2VDMB 2Y06L 4HZLB 2ESVA 2GBVA 1KGCE 5HVFB 1IAIL 4LSVL 4DP0X 4U1JA 3P69A 3POCA 3INUL 2AXHA 3P30L 2MRYA 3HS9A 3K0YA 4XVJL 1E50A 1QSZA 1MFNA 4B97A 1JFHA 2NY6C 2FBOJ 1XMEB 5E8NB 4Y8DC 5EDSA 3TU6A 3PNWA 4LLVA 3BSZL 5AFAA 4MJIA 4LRNL 5HHQA 3UGXA 1AAJA 1UD2A 2H0FA 1FNEB 3B3IA 1H5BA 2DYPB 3GZQA 3SE4A 3SE8H 4NQXB 2AXJA 4PJHA 5F1IA 3RDTD 3Q1SH 3F7VB 1LNUA 3BC9A 4XOEA 4ALAL 4E41E 5EOCJ 3LKQA 1E2ZA 3MUGA 5AB2A 1ZXQA 1NAMA 1XBDA 1UOLA 1T03L 5E6IC 4NHCH 2PW2B 4KFMA 4G1MB 4L8SC 5T1LD 1QMUA 4Z7VB 3DDGA 4OFYA 3IFNH 5JO5A 2Y69B 3HRZB 4MTMA 1JMZA 4ODTL 1NBZA 1WBZA 3QG7L 5DWUH 4DN3H 4GSUA 4DKAA 3R8BB 1ZEAL 3DGDA 4ZMWA 4O5LH 2BO0A 4YX2H 3H7BB 4OQTA 1CWVA 1JTPA 4NKIL 4WFHE 3WNMA 4DCQB 4Z7OF 2J8UF 4QIRA 2WLLB 1UUSA 4G5ZL 1CB4A 2R1XA 3B3IB 5EOTB 1NFDA 1HIMH 4LEOB 4N2EA 4B9IA 3HG1B 3LIZH 2Z7YA 3FCSA 3TT3L 1OY3B 3NZ8A 2F53D 3M1CA 3DNKA 3ZE0E 3QXWA 3CNKA 1NKGA 1TNMA 1NDTA 2DH3A 1TQUA 3SDYL 4HOXA 4HIIB 4RMSA 3TFBA 1BF5A 4Z78B 4MNGB 1MW3A 3ZGHA 2NZIA 3MBEC 3EH5B 1Z66A 4IRSD 2X3BA 3HG4A 3ZUCA 5LXGH 2C9RA 4ZAKA 5I17B 2YPLB 3G7TA 4IRZL 5F93C 5IEKA 3D05A 3LXBA 3SKUD 3SQBB 4XPBL 3TYFA 4XP1L 1OAKH 2X88A 2GITB 4PM1A 1XDTT 4DUXA 3JZ7A 2JKSA 3I6SA 3B9DA 3L5XL 4O58L 4ZTPL 4EMZA 2NY2D 4NQSB 4LLQB 5IBUB 4DCQA 3L95A 4MB3A 3M7OA 2KYIA 2ICEC 3VB9A 5LHDA 3ROLA 5DVLA 4OCYL 1YEKH 2UZPA 4UDTA 4CW1A 4EQ3A 1U0QA 1D6EB 2BSDA 2C3HA 4K3EL 1BF8A 2W07A 2YPKA 2VLKE 2ALAA 5CJBA 1JIBA 3FQXA 4NGHL 1VLXA 1A1MA 5BW7C 3LD8B 1NBQA 4BFIB 4LLMA 3VXPA 1V3JA 4RH4A 4OW6A 3D2UD 1DJYA 2IAMB 3LHAA 1KB5H 5F7LB 3U9UA 3ZL4H 4PJHE 4N4YB 2OL3B 1D5MA 1W2KT 3ARDA 4NQDE 3DPDA 4OM1L 2IAND 2A2QT 4RGOH 5BRZD 1GZPA 2P5EE 2QPFA 4PJDF 1IM9D 2FWUA 4GW1B 4PLOB 4WWKC 5B3NA 2CG9X 5MEQA 1IC7L 3U0WL 3BIAX 2QGBA 4DZBB 3DXAE 2FJHA 1IV8A 1WH0A 3FYEB 2VN5A 3Q5TA 3TBVA 2D03L 5LQBL 1AC0A 1DANU 4Y5YB 2HG5A 4Y5XA 3ZYZA 1KELH 4X7SL 2DQCH 1IAMA 1VPOH 1L0XA 4PCYA 4JM2F 1WA0X 1IQWL 3TO4D 1WFTA 1SLVA 3FBQA 4LCYB 5AL0A 5LBGA 2IQ9L 3T08A 3QZLA 3US1A 3GQFA 5IESH 5AVXB 4UQ9A 2BW4A 3FCBA 3HI6L 4O2EB 1U8IA 2E27H 3T0EB 2VN3A 2B5IB 4ZO8A 3N91A 5J56B 5DGQA 2X4OB 1S5IH 1XGYH 5T3ZL 4L29B 2WD0A 2GAZB 4G7VL 1I4FB 2ZKWA 1E9PB 1EJOL 2YAFA 4QRRE 3O9WA 4ODHL 4FP8H 4N2FA 4L3CB 5IEHA 4ZK8A 3VFWB 2WP3T 3VD5A 2VLRE 3IMRA 4ZNEE 4G9FD 3RIFF 3IF1B 1BLNB 1HZHL 4OU3A 3A22A 3HNSH 1D9KD 1PDKA 4G8GA 4E41A 2YEZB 3BWZA 3TIDA 3O8XC 2NR6A 2PWEA 2P44B 4LIQL 3N9GH 2RD0A 5I8OH 1LGVA 4URTB 3MXWH 1Q72L 3ESMA 5CSGA 5CZXD 3NDZE 3WN6A 2XRAL 5HDQH 2UXGA 2ZXDA 3IDYB 5HYQB 5HGBB 5T33L 2VKWA 1DQQA 4EN3D 1BOYA 3DSFH 5E4EB 4HISA 5T3XD 4MB4A 1T89C 1P1VA 3DYPA 3E2HC 1KTBA 1TVBA 3WDIA 3GINA 4IIQC 2NR6D 1YNTB 4GUPA 3BWAB 1BMGA 4GXFA 4JM4L 1MCKA 2ALWA 3BZFB 3ULUD 3E8VA 5IFHL 2I9TB 1IGIH 5DK3A 5C3TA 4RZKA 3NZ8B 1CL7L 4XC3L 2WLMA 3SDDD 5ESVA 1KBPA 3UZEC 4P2RD 3WE6A 4DQAA 4HIIA 2DQ6A 2CGYA 1QRNE 3TONA 1FAIL 1M1XA 3NABL 3I3EA 1LEKB 4NO0B 4Y1SA 2YGPA 3CVIH 4LCUA 4OZGA 2DZEA 4AEHH 1MCWM 2CXKA 3Q8EA 5EU7E 3WNJA 3IGLA 3ARGC 2H3NB 1IBHA 1DBMH 1NEPA 1A1NA 4LNRB 4R4FL 1QBMH 1KJ2H 5CN2A 5DQJA 3VXSA 3VXMB 4JJHA 1L0PA 4QRUA 3KYOB 4QRSB 1O9VA 5JDSB 4JRYE 3FB8B 4OSUL 4OTXH 4AYBA 3I6GB 3WTSA 1R3KB 1G4MA 2APWA 2HMID 4AJVA 1WIUA 4PJCF 4PJIB 4KNUA 1DJSA 4JFZL 4UQAA 4XNYH 4XPHH 2CO2A 4N1CA 1HWGB 4N0UE 5D4JA 4P06A 4OLWH 3D4YA 1CR9H 1P7BA 3Q05A 3FO0H 4YXKL 1B9ZA 3RX5A 12E8H 3VNYA 3Q2WA 1T1WA 1W91A 5DS8B 1DBJH 1AZCA 4UM8A 1MCQA 3TO2B 1J5HA 4M61A 3DHMA 1I7UA 1KB9J 5DQJB 4AG4H 2BNRD 4WVRA 4EDXB 3HZYB 4PJCA 5ALCH 1AQ8A 1MH5A 3QQNA 3CJJA 3W57A 2IGFL 1I7TA 3OKDA 4QRTB 3KBFA 4HS3B 3UERA 1Q9KB 3EOBA 5FK9B 4UV7L 3BLBA 3TESA 5I30L 4FQHB 2HFTA 4P3CH 5KVGL 1IM9B 3IAPA 1P6AB 5HVWA 2PO6B 3H9YA 2ARJQ 2G0KA 2OMXB 3M17B 4R2GB 5IB1B 4RGMC 1U8OA 2OMWB 4N28A 1D5XA 3RHWF 3S3BB 2WVVB 4AW4A 3QORA 1EIBA 2ENYA 2W65B 4M1GL 4N2GA 3U1SH 5BW7A 3GI9H 5JZ7D 1C12A 2DYSB 4M5TA 1O7SA 4M61B 2ATPA 3FCGA 2X1WL 4NZRH 4F2ME 1GGUA 4P3DA 4ZYKB 5I1DA 2UZYB 5KVDE 1M2VB 1DDTA 5LXGL 4FNPA 1Z3GH 1QHPA 5FO9B 1AQKH 2ERJC 5E00B 1ZT4A 4G1EA 5ESQB 4CC1A 4LK4A 4LIQE 2FLRT 3U25A 5FKAB 4NNYB 5HHVL 2HSIA 2XQBH 5HYSA 1SXSA 3QEQE 3RKDD 3U2JA 2OX5B 4BH8B 4H8PA 4K71B 5E8OB 1KGWA 4LEXH 4R26L 2BOBA 5B38A 2WN3A 1UH2A 1JYWA 4OY9A 2JQMA 4MNHA 3FQNB 2AP2A 4DGIH 2V0AA 3FXIC 4KY1H 1GL4B 3DIFB 2XWTB 5D1XA 2FX8L 1ODUA 1CBVH 4LPTA 2LFEA 4BFNA 2K45A 1QLFA 1KJ2A 3FSAA 2NX5B 3NCWA 1OCOB 3OAYH 4M1CD 2HUHA 5I1DB 1TPXB 1EVUA 2HJFA 3PP4H 1RUQH 2GBAA 4XNMA 3D48R 2B9AA 2F18A 4H8UA 4MX7A 3FRPA 3L1OL 1M7DB 1XVSA 5JHLH 3ULUH 4E9SA 3NRPA 2AJXH 1RJLA 3VWJA 1T0OA 5I1IL 1FPTL 2ENPA 3MUUA 2VRKA 5AUMB 4GBXA 2V7NA 5B38G 1G5GA 3AQXA 1F97A 4UIMA 4CKQA 5TGBB 1NLBH 4BH8A 5C0DB 1K9TA 3FUNA 1FL6B 4ELKA 2P8PB 2Y7NA 2J71A 3GKWL 1FFNB 3RNKB 4H1LB 4U1NB 1NOLA 2JCWA 4K3GA 4N1HB 1K4CA 3PL6C 3V5DB 4L4VA 3GZKA 2CR3A 4ONOA 2E86A 5KS9B 3NJLA 1ZMYA 1B2WL 1PKOA 3DPBA 2IAMC 3BZ4A 1QATA 1AYOA 1IC1A 1VPOL 4H8WH 4OLVL 2Z6FA 2BS71 4FGMA 4JKPH 4ZOEA 2FO1A 3SOTA 2WKOA 1J1PL 4HKJB 1QTYT 4XNZC 3L3OA 1BPLB 2NX5A 3ENEA 4A55A 4UIKL 2AK4D 5BUAA 4MZ3A 1DLHA 2IQ9H 3VXTB 3DOIA 1G1CA 1S7TB 4XPAH 4UBDC 1F00I 1JK8B 1L5GB 2V7NB 4JPWL 1I1AA 1U6AL 3BWSA 5I24A 1LXMA 1KXQA 3U82B 2BVQA 3VWJB 2TRHA 4HMCA 4X4MA 1X5ZA 1IEBA 3GHPA 1JNJA 4XZUB 3EGXA 4PJ7E 4RGNB 2B1HL 3HJ0A 4U31A 4B50A 4AMWA 4L4TD 2V5RA 3MYJB 5DEGA 1OP5H 2VWEE 3WOVA 1EZUA 3AY4A 3VD0A 3OR6B 5CN3A 3TIEB 4QOKD 4U6XA 4ZFOL 1J8HB 4FLQA 3U4BL 2YZ1A 2OI9C 3EJJX 3QDGE 2EDXA 2R0ZL 43CAA 2WQXA 4W1TA 3CFNA 1F42A 4NERA 2QLYA 5LJYH 3KGTA 3UPCA 3Q1SL 3U30C 4FERA 4ALAH 5DRXA 4LIQH 2HZHA 2FHCA 1M71A 1S7QA 2B3IA 4X6EB 1ZLVK 3WSQL 3F12A 5DQDH 1MF2L 2P24B 4DQOL 4OCWH 4QRBA 5T1KA 5JPNC 5KJRH 2NRDA 5FHAH 4LMQI 1J5OH 3WHXB 4U3XA 4FTVD 1ASOA 3IK2A 1LE5B 1QSFE 3KGSA 5FAAA 3QDMB 4DN3L 5JHDD 4P5KA 3FQWB 4HS3A 4HGMA 5CP7B 4A7TA 3K5RA 4JM4H 1MFEL 1BBJB 2JQAA 3BP7A 3DMMD 3O8XB 4M3HA 3TIEA 5JIPA 2AJZA 3SYAA 1YO4A 2PW2A 3LH2L 1EV2E 3GMQB 5GGUB 2OMXA 1R3HB 4MXVF 4XPTL 1NGXB 1FVCA 4J6IA 3U30B 3ZR6A 5BJTB 4N9GB 1A8ZA 3CCHA 3UTZA 3LXUX 4G8EA 2HJKA 3KJ4C 3SDYH 2EYTB 1FSKB 2A6JB 2R15A 4CVXA 1XGPB 1TLKA 3B7YA 2UZYA 3II3A 3QXAB 4BK5C 1IKFL 4FTVE 2PWFA 4NO3A 4U3CA 4YDJB 5J6GB 4BWUA 3ZTNL 4YDVB 5K9JL 4QHLA 3EKCA 4HUUB 1P2CA 4KKNA 1JV2B 4F57H 4ZW5A 3MA9L 5D8JL 2HT3D 4BSJA 1AZRA 3NDYE 5DC4B 4ESKA 2NY0D 3QEQA 3RYMA 3FJTA 1UUNA 5F3BB 2VMJA 4JRYB 2LT9A 2FT6A 1GSKA 5BOJA 4TNWF 3MGOB 4TUJB 1MVUA 3ZKMD 3P4NA 1M56B 1XSKA 1SUHA 4JDVA 2ZCKL 1GS8A 4QUOA 3LKNA 1LQSR 1THCA 3N50A 2XPYA 1FWXA 1YVLA 1WVZA 5FUCC 4FNRA 3GO1L 2CO7B 5HHME 1UB6A 5I6LA 1CDCA 3QXAA 1DANT 4XN8A 2OJ1A 2A9CA 5C08D 2R29L 3MNWB 1BYNA 1M7DA 4KUZL 1TVDA 3DVNA 2EJ1A 3OKOB 3QUMB 2CALA 5SX4I 2EDFA 1BVNT 1AXSA 1TETL 2P43B 3X2QB 3ZQWA 4XAKE 4XCEB 2EQDA 4A6YB 4Z3HA 1BIIB 4JBSA 4OM1H 3VXME 2H2SD 4CGUB 5FW8A 1S7UA 2CKBH 4BQ8A 3S96B 2CLVB 1TJMA 3B8SA 2EILB 2AANA 1ZHKA 4KVCL 4NPJA 3N41B 1NIEA 3GSUA 5INDB 1AMYA 3GT6A 2B9BA 4QCIA 1KEML 2J6EL 3EBGA 3FTGB 3V6FA 3VFVA 5KEZA 1VFAB 2H1XA 3HRZA 4MXWH 2CHXA 2WYIA 4WF7A 2IBZY 3ARDB 3JTTA 3LQAH 4QAWA 4P2AA 2DH2A 3GI9L 2B1OA 1TOXA 4HUKB 4CKVX 4XN9A 4M43H 5CZVH 3KPQB 3HS8A 3AS1A 3EYVA 4K3JL 3DK0A 1D3CA 3HG1A 3WUWG 1IGJB 1PKQE 2G4GA 1HHJA 4GKNB 4Y4HB 5I1KL 3BKMH 3LTVA 4RWYL 2YD4A 4YSDA 4YIQB 4AX3A 4JFYA 1GAFL 2MH4A 4DEUA 2XQBL 1PMYA 4L18A 4P4KD 1IBGH 4QCIB 5F1IB 5BZWA 3EYUL 4UTBL 1X7TA 2DWYA 5ADOL 1NCBH 3GWJA 3TWCH 1EFQA 1G6RH 2BVUA 4ABQA 1UYWH 4RIRA 5CM1A 3ESPA 5GPRA 1QTSA 2FJUB 4JPVL 5F88A 2K6WA 5A40E 2BSCA 2EADA 3JXAA 3UAFA 3U46A 4Z8FH 5DJYA 1RUQL 4I18A 5IBLC 2ZKXA 4P9HH 4MJID 1JNNL 3ZE1F 1UQSA 4I0PA 4IK7A 3DOHA 3LKSA 5B7FA 2NY2C 2IG2L 2B59B 1B0IA 3BSGA 3RTQA 2WO4A 3X3GL 1BGXH 3FCSB 3TJEH 3SE3A 2HTLC 4C56A 1CFSA 5CEYB 1HEHC 4Q97A 3GMPB 3QUML 4Q52A 2PF6A 3QI9A 3IJEB 4MAZA 1NC2D 1RJZA 2E7DA 1FHGA 4QYOA 3IMVA 1A2YA 1R4XA 4QHUB 2R69A 5F7WC 3VRLE 2DS4A 1EHNA 4Y1AD 5C6WH 2JJTC 2GK0B 2ZUUA 1MOEA 1GZHA 4UT9A 4UF7C 3TO4A 2PP7A 4I18C 2TSBA 5HI5D 1WFOA 3T77A 1DUYA 1QR1A 1KGYE 2VLJE 3OL2A 1YAZA 1DEEA 2E8ZA 1CICB 1CO1A 2NYYD 1K6QL 5AD0B 4HIJA 1MLCA 3H1ZA 2KH2B 1KN2H 4JY6B 5BRZB 4N0FA 2EDOA 3RIKA 2LU7A 1BOGB 1NCAL 4NZJA 4YE0A 3IJEA 2I9LA 2W0FA 5SWSE 1K8IB 4HAKA 2GEQA 4PRIE 1JVKA 3KWUA 2PO6D 4FI6A 4AQAB 1UWEH 2EICA 2W07B 2YPKB 4HSCX 4XNAA 4DGVL 3F62A 1O7DC 5AZEH 2X6MA 4YXHH 2BP5M 4Y5XC 1OM9A 3IKKA 4TOYL 2YD6A 3L2NA 2W60A 4XN1A 1A9EA 3OMAB 4LSSL 3F83A 4HX1B 3DHUA 4QRPA 1I1CA 35C8H 4DESA 3FQTA 4IIQB 2OL3A 1CICA 3NGBB 5HHOE 1ZV9A 1N5AA 5IBTH 3HE6A 3UZQB 3GHEH 5DZVA 5J4MA 1QACA 4NUPA 1U3HA 1LL1A 4OCWL 3EYSL 1JGEB 3S5ZA 2WXPA 3LZPA 1BZ7A 2FJHB 2ZX5A 3TNNA 3ETSA 4MJ6A 4F3FB 1NBVL 3EJSA 3LHPL 4G6MH 3STLB 4G8GB 4MDIB 3WCYA 1E5YA 4NKOA 1XAKA 3HHRB 2Y7LA 2H1PH 1YY8B 3G5YB 4TLSA 4GQPH 1PEWA 1L3NA 5F71A 5AALA 2JCCE 3BH8A 5E24E 2VJXA 1U91B 5F6IC 3KWXA 4BGDA 5IHZA 2F8IA 4P9MH 5DYOA 5TFSH 1R3JB 3LQZA 1TEYA 3CFDB 5H2BA 3RKDC 3T0XA 5H35A 3Q5OA 5AYQA 1E27A 3KS0H 3PAUA 2FO4B 2Y5TB 2WXJA 3VGAB 1ULVA 2VCOA 2FX7H 1YMHB 2A4CA 5FYKH 1BQ5A 1A9VA 3FO2B 3B83A 4OJYA 5ITFB 1U9KA 4X4ZA 4B7LA 5CO1A 4F8TA 1QSEE 3IJYB 5DS2A 1QG3A 2ZXAA 1IBDA 2GJ6A 2NY1C 5K9JH 4OT1H 3RAJL 4NUJB 1JGEA 4JMXA 1NBCA 1TTCA 5C0JA 4ZW8A 3LV3A 1T1XB 2P7TA 1XX9C 4ALAC 3PV7A 1ZT1B 1G7JA 1S7SA 4GRLD 4DGIL 1C08A 3SJVA 4GXVL 2CO6B 4WI2A 4IQHA 1YN7B 2FX8H 5IQ9A 1ZTXL 3ZKND 5JA9A 3Q2CA 4TN9A 1CF8L 3GO1H 4XMZA 3A6BH 3BN9C 3ECQA 4M1CC 3KBEA 1I7ZA 5E8PB 1NIFA 1P53A 1GYCA 1QFWL 1OWRM 1XB8A 2MHAB 3DTXB 3P77B 5BUPA 1EZSA 3EGSA 5DMJB 5AOIA 2HAZA 3WKMH 3RZCA 1RIHH 2VMDA 4GMTL 4H20L 3APFA 5HVHB 5C70A 4J5VA 3L7FA 2EO7A 1E4JA 3MRPA 4ZS6D 4DPAX 3SE9L 3BGMB 5EUOB 3VAEA 2JCCF 1NLBL 2GJ6B 3PFQA 2VDLB 3DVGA 4C56B 1SJHB 2YUWA 1J48A 1RZJH 2TAAA 1BFVH 5E0QA 1G9NH 3SE4C 1D7BA 2K8MA 1V3LA 3CMGA 3E9UA 4PG2A 4AYEC 3LPWA 2DIEA 1U8NB 1GYWA 2VDNB 4RMBA 5CSBA 3UTPE 2C9VA 3ZL1A 5EWIH 4KUCD 3DGCR 1KF9B 4P2OA 3MRLB 4ACTA 3H55A 3AITA 1RUPL 1KLFB 3U2IA 3PIQB 4K7PL 1BVLA 5LDUA 5ESAB 1DQJA 3QHZL 5I71C 2FGZA 1JPTL 5DUBA 1Q9KA 5SX5K 2YGOA 2H6PA 3KWVA 3W0WA 1TO5A 3NTCL 2NY2B 2BNRB 1N0XH 5EBWB 3GXNA 3QUYA 3GXTA 5IMMB 1R34A 2F53A 1SOSA 1K5WA 4OLEA 1PZ3A 3SPGA 1S5HB 4KRPB 1SEQL 1HH6B 4OGAD 1IC0A 5IWLC 4PB0H 4UAHA 5DA4A 2DLFL 2I9LB 3DX4A 3RL2B 1MHCA 4PHXA 3BGMA 4BZ2H 1CUOA 1EJ8A 2XTJC 4WY7H 5D7EA 4L1SA 2CD0A 5AWNL 1Y6MR 5LAXB 4IIZA 1PYWB 5FCUL 4DO4A 3PGDB 4PJ9B 1XBRA 5LCVH 5HXMA 1XL4A 1BECA 2H1LM 4IBLT 3QG6A 5IB5B 3D4CA 4RFOL 3S0PA 5C0CB 4CMMA 3CHXA 2R0ZH 5D7IF 4PJHF 5AKRA 1BAFL 2Z4QA 3V6OC 4RGMB 5E51A 2VMCA 5D7LA 4G8FB 3WHE1 4DEWA 4XB7A 3SCMA 2YD8A 3RVWC 2JKTM 5KSBE 3QP3A 2Z3FA 2VC2H 4P9HL 4LLYA 5DQDL 5KJRL 4PGDA 1DBAL 4U6XB 4PY7B 2HMIC 3BZFA 3QUXD 4DGYL 1VFBA 3FU0A 5KTEL 4WUKL 5MEPB 1LE9A 2G60H 4M02A 1KJ2B 3ARYA 1NLDL 3QSKB 1FF5A 2XG5B 3KCPA 1FA4A 2OCJA 4L48A 3BH8B 3K2MC 1HHKA 2YRZA 3HE7B 3O2DL 2YK1H 4XVTL 4GSQA 3HN5A 3IDJA 1SN5A 1NC2B 1M05A 5GS3A 1VADB 2JK5B 4U4IA 1D5BA 3RUGB 5ICXB 4AWJC 2P3YA 1LE5A 5BV7H 2QADC 3JWOH 2Y5TA 1MJ8H 1A9BB 4F15C 3T4AA 5FO9A 3MLWL 5F9JB 4APQA 1NDMA 1BAGA 4ORGA 5HGHB 5A2IH 4AKOA 1F3DJ 2YSSA 4ZZKA 4R7XA 1XXDC 4X8JB 4NN6C 4AVHA 5DYFA 3ZIMA 1FUNA 2F1BA 4IOFC 5GGVH 5FECA 2O72A 4MD4B 3T8MA 2NY1D 4LPXA 4YZFE 1TIUA 3HOGA 3TN0B 5LVEA 2W80C 4NRXB 4P23A 3Q6FB 1JNHB 4NNPL 2WINB 3HAEB 4AC2A 1DLFH 1IKNA 1AFVH 2AV1B 3VWKD 2IADA 4KKPA 1SN2A 4YEFA 3CSTA 2QKSA 1JPSH 4NKMA 3ZMEA 3D4GA 3FRPB 2R59A 4ZZFA 1QUNA 3R1GL 1FO0L 1RSFA 5J1AB 5JHDE 4Y16A 2BVQB 5CJXC 3LY6A 1CU4L 4AQZA 1QFPA 4I3SH 5TE7L 4EDXA 4KTEH 3DK2A 5IT2L 5E99L 1QI5A 3Q3GA 2OKMA 4WO0A 5LWYL 2OK0L 4HW6A 3TN0C 1QBLH 1TZHA 2CDGB 4QRPD 1P1ZB 2MQGA 2X0WA 1YQVH 1WJ3A 3WS3B 2Q6WB 5I6MA 4PEEA 1CC3A 2VLRB 2NNAB 1TSHA 4H2AA 4UAOB 3VWJC 2BNQD 4S1SH 1DFBL 4I0CC 1F18A 2ZSWB 1EEQA 4A2HA 3ARGB 4ZUTB 2IFGA 3QIBC 4BRVA 3B8YA 1WAAE 3LRSB 3N1PC 5MERA 4UT6A 2V37A 5D2NC 4L4TE 1T0MA 1CGSH 2R83A 3KMDA 4MA8L 5JW4M 1RUKH 3QHTC 2LU5A 3LNEA 4K9EL 2VXUL 1X5LA 1DSYA 1CLVA 3LQAL 3QUGA 2QFRA 4L1BA 2YAQA 3IFLH 3RFRA 3LEVH 4NQDD 1ZIBA 1KTLA 3RIFK 3REVA 3ZO9A 5HYSB 2V7HB 5EO9A 4V2CB 2R69L 1EEZA 3I9AA 5LO7A 4GSDL 4UM9B 5F72S 2PPDA 3VG0H 2CCWA 4D9QE 5JQ6H 1J8HE 5EN3A 3V0FA 3DYMA 2Q8BH 2F5AH 3HHMA 5ALBH 4P5MB 5JW5A 3L08A 1AQMA 1D2OA 3V4VB 5IEKB 4PHZA 4JRXA 1I9IH 3ARFA 3O6MH 4GRLA 5DDHA 4NO3B 1RXLA 3K3QA 3VG9B 1KIRB 2EDYA 4WFFE 4MDJA 4AK2A 1BQUA 2YXWA 3M1BA 5AOLA 5DJDA 1KLUA 5LBSL 2ED9A 3IS0X 2PPFA 5I2IB 2ZWZA 5FO7A 3GTNA 3BP6B 5LGHL 3BZDA 3GZOA 2OMYB 1FRGH 2DQUH 3VYOA 1DTUA 4OCNC 3PQYE 5AKSA 1RIHL 2WCSA 2I69A 3QJZA 1J8HD 2FR4B 2YWZA 3MV8B 2LTQC 5LKNA 4JJ5B 3EJTA 2OW6A 4WQOA 3ZU8A 3ULVF 4W9ZA 4I4WA 3RWIB 1H3PH 4JDEB 2YBRA 1E8ZA 1Z5YD 4WGVB 1D5MB 3QUMH 5TTRA 4WWNA 4RMUA 4JQIA 3ISRA 1CYWA 3RWFA 1ET8A 3AGVA 1D7FA 2WBKA 2YOAA 3CDCA 5EUOE 1XCTB 3RWHB 4ODVL 4BQ6A 3MRRA 1EMTL 4XNBA 3MI6A 3IXAA 2QGEA 4FZEL 2X4QB 4GQZA 1KGIA 2H8PB 1A9BA 1LK2A 5EZJA 4PJEB 3QHZH 4ORGB 5IQLA 4PWKA 3ZKQD 4F7CB 3V95A 5ISZE 1K6QH 2FEEL 1WAEA 3MBED 4X0NA 1HHGA 4PB0L 4MRCA 3MTRA 4Z7UA 5D5MA 4AENA 2J44A 2YN3A 1A3QA 1KC5L 4O02A 2AKRA 3OBAA 2I26N 4MJIE 1RZKH 2F54B 1AG6A 4NO5A 1OWWA 3WJJA 1BVNP 5IMOA 5IV2B 5I1HL 2IXQA 5FCUH 4BSVA 2HYMA 1IC4H 2DM3A 3RWFB 1MIMH 4TOYH 2NQCA 3LQAC 4ANVA 4I3RH 4KJPC 4AQ1C 1W72A 1EO7A 2YKLL 5HYFA 1RU9L 2R2HB 1NAKH 1PW3A 1EAQA 3QCVL 4ZQTA 3FHAA 2XTJE 3C75A 1N12A 1FNFA 1NGZB 4WUUD 1HZKA 4R5TA 3NA9H 1PIGA 4XP6H 4B9PA 2XU9A 4EI5C 1G6RB 1Z6JT 4Q6IA 2YXVA 1B0GB 3WEXB 2MCMA 2V3DA 3VXUB 1NEZA 4MZRA 3VSUA 4R84A 3RFZB 2FATH 3W9DB 1LILA 1YEIH 3OKMB 4LGSB 3DI2B 3ARSA 3TM6A 3HE7C 3F65A 1RJYB 3MMEB 4LPYA 3U7WH 1BJMA 3WIIH 1CXLA 3G6JE 3N55A 2P26A 1R3HA 3O2WH 2EUWA 3FCUB 2XTLA 1IUZA 4AYSA 3NCMA 3GDBA 3HPLB 4NQEE 3S5LG 1NJ9B 1ADQA 1F3JA 4PJGB 5E6RB 3RGHA 2MKWA 2BC4A 4HIEB 4LASL 4PJFF 4QDGA 1CBVL 1AIFA 4PJIF 4XHJC 2YK1L 2I27N 4OGYL 4A2LA 3D9AL 1DCLA 3CBJB 3GMMA 1XR9A 4NO5B 5IQ7H 3SE3C 3BKYL 1KJ3L 1T4KB 4YE4L 4RAVA 1T3FB 1R9FA 5AAMA 2W5PA 2AJYH 3MJ7B 4JL1A 1WEJL 3MLUH 3GJFH 4CJ1A 4TNFA 5GRJH 2HT4C 5IGXL 5JNYA 3OB8A 3QR0A 3LZLA 1J05A 1FNLA 1B0GA 2I07A 3GMLA 4GH7B 4I0PC 4NPKA 2LV4A 3FTSA 4J3UA 5F3BA 2JJUA 2JB6A 4CGTA 1OB0A 1BJ1H 3BXNA 3WV0A 1TUPA 5E03A 4Z7WE 4YO0A 1WLHA 3NSFA 2XA3A 5ICYA 4TTDC 4YVNA 3VM7A 1RHHB 1CD0A 3CTTA 4FYSA 1FZOA 4AQ1A 1DVSA 3QCUL 3QUZB 4P5MA 3MUHL 5I6OA 3PL6B 1FVEB 3S36H 4GQ9L 3UAAA 1S7RB 1TJXA 1A1NB 3CUPB 3HLAA 2E6JA 4MQXD 2GT9A 3FU6A 3GNMH 4EI6A 5GS1C 1JPSL 1HCFX 3KYMA 3MV9E 3NJHA 2NY4D 2ZG3A 3EJRA 1LWHA 3CVHB 3II1A 3NCYS 5HYSG 1WDAA 1R3KA 1JAEA 4XN2A 1A6VH 2Z9TA 4MMXA 4PJBA 4AQEA 1TQCB 5I2IA 5EU6D 2XDHA 5FGSA 2D9QB 2YC1A 1HHIB 2JV6A 2D7PA 4X5XB 1ADWA 3TZVC 3PHQA 4WW2F 2IWGA 2VXQH 1ZOXA 1F4XL 3QXDB 3TPUA 1A3LL 2CA4A 3KD4A 1U3NA 3LKRB 4BWWA 4N90D 2ZXBA 5IHUL 3GJFB 5KBKA 1MEXL 3UTTE 3KE0A 2EACA 1JF6A 1RSYA 3H9SA 2OJZH 2VUOA 3V5KB 3DX2A 5HDLA 1JNLL 3BVNB 4OFVA 4S1SL 3D25B 5CWSA 5F7EL 2YPLE 4CC0A 3BKJL 5I17A 2NT0A 3OJ2C 4QXUL 4HOMA 1LD9B 4Z23A 1KTKE 1M57B 3RI5F 5B3JF 5L88L 4F8LA 4KKAC 1R19A 5E2WL 1EGJA 1N67A 4YK4B 4M6OH 3ZIYA 3CDGB 2BHYA 3D12B 4PJEF 4JHWL 3WTXA 2PXYB 4K9EH 1IAOB 4W4OA 3ZTJG 2DI7A 3IFLL 3L9RB 5DT1H 3OKNB 2NX5D 1SJHA 3GBNL 4JM2D 5TD4A 5E8EB 3DV6B 4S11A 1KGJA 2FWLB 4HS8H 5F7MC 2B2XH 3O6KL 2JXMB 5C9JB 5J11B 1T1YB 1WAAA 1E2VA 1T6WA 3VM5A 3BT0A 4IM8A 2O93L 2JELH 4PG2C 2G75B 1E4WL 5JDJA 2OZ4L 5DGRA 1A9EB 1JXGA 2MWCA 1CBJA 1OF0A 2XZQH 2WLIB 1NPNA 2ZOLB 4FRWA 5E95B 1UFGA 2J3SA 5GRYA 3WEAA 3AZUA 4JZOB 4HBCL 4OCSH 1L9RA 3SZ6A 1AGFA 2PYEB 1HNFA 4BUQA 3HB3D 5IHLB 3FB7B 4RVBA 4PH8A 2X10A 2A6KB 2BSSA 3MLPA 2J72A 2GTWA 4F2EA 1YCSA 4PU2A 4TSAL 3RTQB 3W3BA 4ZPVB 5DI8B 2EIBA 3I2CH 1HQ4B 2ADJB 4K3DL 2KT6A 3O6FC 2NTSP 4JANB 3ULUE 1OP3H 3SGKC 1EK3A 3C2AL 4GIOA 3PWVA 4G7SB 5FUZL 1JZJA 1C08B 5I6XC 5D96C 4Y16C 5I5MA 2BNUB 2QKIB 3MKKA 5KTEH 1TZOA 4I77H 1L6ZA 3OHXC 6TAAA 5DYOB 2Z4QB 3G6AB 5T5FA 3AU0A 4FKKA 1H3PL 1D5ZB 3PWLA 1OAXL 1HU8A 1A4JA 4LO9A 1O9WA 3OLGA 5CNHA 1YPZA 1P4IH 3B1TA 3VFWA 1DFXA 2P8PA 1AANA 4OFQA 3ULUF 3PF2A 3PS6A 5ECGA 3W9EA 5DMKA 4J7RA 1E9PA 3DLQR 3C6SA 3EJYC 3VTTA 1HSAB 1LEIB 3CVDA 3LS5L 3P4OB 1FLTX 1MFAH 1MCJA 2BHUA 4X98A 4LDLB 2IEPA 2VDOB 1EJ6A 1KACB 3COOA 3JV0A 4OZFG 3U2SB 1MHPL 3UZEA 2UYLA 3MLXH 1G9MC 2RMNA 3PQYB 4U1LB 4DW2L 1XCXA 2P4AB 2R9HC 3NCJH 4Y4KD 2ZKHH 1BD2D 2AMGA 5IR1A 2Q7YA 5HGBA 1A5FL 3P9LB 4MMZB 1IBZA 1ZGLB 1DQVA 3GMNB 1FVEA 5C07B 3WN5B 4F7KA 2ZAIA 2DI9A 1EO8L 4ELMF 3TA3B 1PEZA 3QDJA 3G6AA 1JUFB 4ZTEA 4XN4A 4IIQA 4NFDA 1TTBA 2LLGA 3VI3E 1NTDA 1IC4L 3B7SA 3MOBL 3SCMC 5ITBH 2V3EA 3UCQA 2AQ3A 3I75B 1TVBB 4Z7OB 5IFAH 5KYXB 2CSPA 1P4BL 4OUOA 2ZQKA 4NLHA 2IFFL 3WMSA 4GP4B 4PJEE 4PJXE 3NA9L 4FXLA 4PRDA 1PZ5B 3DX7B 5CLWA 4PSRA 3FU5A 3ZZQA 3IKCB 5AW0B 1GPOL 3CFJB 2P80D 1USZA 4A1RA 1QYGH 3PGDA 4PJ9A 4D3CH 3DRTB 1M71B 5C0EA 1PNCA 3QUXC 4BH7A 5ISZD 1KFGA 3Q01A 3FULA 3HAEH 3RTLA 2X40A 2FEDD 4WW1A 4ZYKA 2EDRA 1ZGLM 3FQ2A 4I88A 5F3HA 1ZLUK 3ZKXB 2ZWKA 2PMZA 1CXKA 1CLYL 4FL4B 2IDTA 4HXAL 4N6QA 4FFVD 1LD9A 1LO0H 1RI8A 1INDH 4ZMQA 5CIPB 2BOCB 4WI6A 4KQ4H 5E1HB 2WTPA 3HPJA 3GRWH 4NHCL 4MNQA 3T0DA 1E5ZA 3NCFB 3O4OB 3KBPA 3DX7A 1EHLL 1UCBL 4KVNH 1BZOA 2AQRA 2R8SH 1YDPB 1AGBA 1U2HA 3QJRB 3OV6A 1OTSC 4ODSL 1XEDA 3JWNG 4GG6A 4JK0D 3BO8B 3AT8A 4QNPE 3UJIH 2A6JA 2QL1A 4LPCA 5I5IA 3SDAC 1XD0A 4N2DA 2DJMA 2XKNA 3Q2VA 3S35H 4J3OF 5GSVB 2Y6SD 1FC1A 1UEMA 4WCYL 3CC1A 2VDNL 3LNHA 4ZS7H 2J43A 5B39G 5DEZA 1KTDA 4MJ5B 1FNSL 4QR7A 5CINL 4YSSA 5JHDB 2VSMB 4M4PA 3K6DA 2WB7A 3M45A 3ZRFC 1Q1PA 2GJ6E 3GXMA 1PLGL 3KEDA 4PRAB 2Q10A 5CP3A 1AZZC 2V8MA 3VGGA 5B1JA 4TQEH 1ZV2A 1OAJA 3VE0B 4U7SA 4ENED 1Q0EA 2WKGA 2EE0A 5I23A 4OLYL 1GA2A 2G30A 5GIRA 5CCKL 1EAOA 1NSNL 2BIIA 3CC5B 1JWUB 1PDKB 4ELDA 4XP1H 3DPBB 1U8OB 1F4WH 3EOTH 4PGEB 1HYSC 1PIFA 1VEOA 3WJMA 2UVEA 1F4XH 3TN0D 1JGVL 4XCYB 1ZS8A 2DOCA 2R0LL 4Q0XL 4C4KO 3VWKC 3RA7H 2XPGA 1A1OA 3CN3A 1AYRA 4LVNB 1KTDB 1X5JA 2W9LA 4XNZB 4HEMA 3X1GA 4FA7B 3PWLB 3ASOB 2AEPL 4FXGA 2WUCL 4KI5D 2PUQT 2FT7A 1T1ZB 4GUPB 5K1JA 4IGBB 4AYGA 1E2WA 3ALXA 2V9RA 2N59A 3W0WB 1NZRA 5DMKB 3F7KA 1J87A 5DJXA 4GRWE 1LDPL 2CRZA 3FN9A 4KO9A 4LKXA 4ZAKC 4GAGH 4ZD3H 5K59E 1E28A 4X6FB 4XX1G 1V7NH 5IIEB 1W6LA 1CGWA 1N0LA 1PX8A 2R4RH 1FZJB 2NY4C 2FJSA 3GBNH 1PY0A 3N3EA 3TBSA 5I1CL 4D9RE 4PD4K 2ZUYA 3CSYB 1RZQA 2C8NA 2KKQA 3KPOA 3JT2A 4G70B 2R9HD 4QRRD 3SYQA 3POHA 3QFJA 2XWJB 5KSBB 3OHXB 1BVZA 2ZSVA 3T2NH 1II4E 5GRUH 4ODWB 2ICCA 5FA4B 3OJMB 2NYKA 4K8RL 1AQHA 4K07A 4S1RH 1JWMB 2XZQL 3GGWA 4IRZA 3TEZA 3L45A 1QNZL 4OCSL 4L4VB 4AIZA 5BRQA 2KQNA 4HKXA 1V10A 4FQ2H 3V6OE 2C7FA 3HZKB 5IVOA 3K80A 4AZUA 3GXFA 4M7JL 4P23C 1F3RB 1RU9H 3WNPA 4CU6A 1JJUA 1XF1A 3FU3A 5HHPB 5DD1L 3F04A 3FT3B 3RPIB 4X5PA 4ADGA 5T1MA 3QEHA 4KXDA 2R29A 3RU8H 5B1BB 1TZIB 4K3HA 4JNXA 4XVJH 1ZRUA 4PP2A 3WTUA 1S9VB 2FATL 3LRSA 1LLAA 1YEGH 1JMXA 1Z3RA 4LSPL 4BH7B 1A6PA 1GGYA 3WIIL 4ZW7A 1QO3B 4G11A 3WTWA 1Q1JL 5D1QB 3V0VB 2F2HA 3DECA 4U6VH 4XH2A 4CVWA 1OAXH 4OD1L 4IEFA 4QOKE 2FDBP 2X2JA 3T4AB 1P4IL 1EAPB 2YJQA 4A2FA 3GGWB 3C8HA 1CDYA 3ARQA 3BKYH 4PJ7B 3MBXH 1T6BX 4PVLA 5FYJD 4MGXA 5JHLA 4GUQA 3ATDA 1F8TH 5GRVK 1YPZF 1DSWA 4QAMB 4LSRL 3DBXB 1TYRA 2EDBA 3CFIC 1FIGH 4FFZH 5DEFB 1CTMA 2FQFA 2Z31A 3X13A 4NZTH 1I1YA 4OZIE 5GRVL 1VIWA 4NFBA 1WAPA 3QG7H 4AGOA 4JL2A 2ATPB 3CGTA 1SMOA 2WO2B 2IV9A 1F11B 3BSHA 3Q7JA 1Q9LB 4G5ZH 4DO6A 3PCYA 2ITEA 4PMFA 5IFHH 4RMWA 4DK6A 4JO2H 1J1OL 2LVEA 3PQYD 4PRHB 3LPPA 2JLPA 4LLWB 3OKKA 4YHZL 4UNIA 4R0LC 2X4TB 3HJEA 1HJBC 2AQ2A 2NQDA 2FBJH 1MFCL 2B3RA 3IMTA 1MHEB 4NN7C 5F0PB 1FYTB 1JZFA 1CE1H 4N0YL 1XFPA 4OV6F 3PXLA 2Y7OA 4N2OA 3QNXA 4JAMA 2CNZA 2VMEA 5IG7B 3R8QA 3T4YA 4YHYB 1QP1A 5KOVC 5JIIA 3O45B 3MV8E 1RD6A 4UQ2B 5GGSA 3Q1EA 5JPNA 1BVOA 3B2MA 2HJKB 3U6RA 1OL0A 4XPBH 2JWYA 2BVPA 1NGXA 5BJTA 3N04A 5DD0L 1H8OA 1A3LH 3HC4L 5I19H 2Q87A 2Y9RT 3R19A 4YDVA 4BFBD 1YMMA 2IOMA 1VAHA 4GBXC 2XV0A 1I85A 4L1HA 4MMXB 1OCRB 4XNYL 1T5KA 1CMOA 1VZGA 2FQDA 3BP5A 4XO3A 1F4AA 4HD9A 5DZOA 2BWIA 1VRSA 2Q20A 3H9SE 4QEGA 3EYOB 3V0EA 2O5XL 1GZQB 4LAQH 5C0GA 4BYHA 1HHJB 3NJGA 4PJEA 3ILPB 4PJHB 1FFNA 2WSKA 4MXQC 2ZXGA 1JHKL 4KO6A 5LGJA 1DP0A 1RMFH 1NEZB 1SVZA 4IU2A 4PW3A 3G5VA 4Z7NF 1SFDA 5KS9A 1C7SA 4MQSB 3QNXB 3DUUA 4NJ9L 4XO9A 1VESA 4HZ1A 4KDTA 3ML9A 4QO1A 3GKZA 4PR5A 1ID2A 2OR7A 3V79C 1E9OA 3G6DL 4UZSA 5EO0B 3MUZ1 2IDFA 3IS1X 5TE4L 3ZN6A 3KPOB 4HFUL 2J8HA 1JHTB 5CD3B 1UXMA 4Y19D 3KWWB 3QQ9D 3IGKA 4TPRH 1G6VK 4R96B 3FUHA 3M1OA 2XV6B 3BIBX 3CHSA 2B5IC 2E6QA 3ME0A 3K2UH 3PXHA 4UDUB 4Y5XB 4Y5YA 1P7QA 1FNSH 3AGWA 5LGJB 1U8KA 2FLMA 2ED6A 4QRAA 1ZHKB 5KN5B 3WNKA 4BUHA 2BXYA 2ID5A 1H3TA 1AO7D 3IMBA 2AQNA 1YNLH 3VI4B 4M3KB 3WL9A 2BWDA 1QSEB 5CBEB 1N2RA 4P07A 3VH8B 3NJJA 2FIKA 3B9KD 5LAPA 5CLYA 4IOSD 4WHTB 3FU7A 4J3VA 1BJ1J 1BQHB 3FT3A 4QTHA 3KLDA 2J1ZA 1DBKL 3VWKB 2OL3L 1A7QL 3TWYA 2CM5A 3MGTB 4AYID 2V4LA 1JI2A 3NK4A 4GRMA 3TYFB 3LRHA 1KIQA 5DJAB 5EUOF 2CLRA 2O26U 3E8UH 4HUCA 4KJQC 1S7QB 1S9VA 3MXVH 4ZTOH 4QHKI 5FYKU 4NS0A 1WBXB 1NUGA 4PTUB 1NBYA 2R1WB 3RA7L 3WKNA 5C09D 3SDXA 2XWBA 4EUPG 4P5TA 3WGUB 1U4EA 2AXFB 4BZ1H 2RGSA 3SBQA 2AEPH 2ZKMX 4WKZB 1QEWA 2ICWI 1CDGA 3MN8A 5AW9B 3VGFA 5C0IA 4YIQA 5ADPH 3NZHL 2AI0H 3FC8A 4NQCB 1L7TL 1ZE3C 1MQKL 5TDPB 4PJFA 2XRAH 3A6CL 2EYRB 4PV8B 3QUZD 2X3AA 8FABB 4JMNA 3T9WA 5E08L 1QUPA 3U48A 4WHTA 2JKRM 1NFAA 4G3YH 4QPEA 5FM8A 3HNTL 1S7RA 4W6XB 4GAAA 2I32A 2VDPL 4CU8A 1PFCA 1R47A 1YRKA 3QR1A 3BJ91 1OE1A 5HD8D 2ZCLL 4KNTA 2C4XA 3PXJA 3GMRB 3CXHJ 1ZGLP 1HSAA 1CDJA 3OAZK 3RVTC 2ZP0T 4A7SA 3MKGA 1CL7H 1MFUA 3GTVA 4YDKH 3R06B 2GHZA 3BHBB 2WZ6A 3VCLB 3H2WA 4NI6A 4A2MA 3BVWA 4TQPA 3WE6B 4OI9A 1BXUA 4LP8A 4O00A 4YDIH 4JPIB 5EORH 8CGTA 2WXRA 5EU7C 2IDQA 1ZPLA 3MV7B 2PWHA 3K72B 4Z5RA 4W4OC 2A7BA 1ZD6A 4DEPC 3PHOA 4MWFB 3MRKB 3T0EA 5H94B 5I8KL 2KI6A 4TVPL 5C0CA 1FE8H 2C3GA 4K2UL 3LYRA 5I1AB 4FTVB 2I85A 3CFDA 3GUTB 3NQIA 3VXMA 4X80H 5KG9A 4ANWA 2CHNA 5GJTH 3KM1A 2N1KA 2MCPH 2XWZA 1MI5A 1MLCB 3B5TA 2E7LC 3PWUB 3MODL 5J11C 2N3JA 3QZWG 2MMXA 2YLKA 4IMLB 1U4FA 3X12A 4PYGA 1QLRB 3VMNA 2EVIA 1AXIB 1EX0A 2WMPA 3WUWB 4AIEA 4C4BA 5D93B 1N4XL 2B7DT 4ZDHA 2YEZA 3TIDB 3CMOL 1WITA 2R51A 4Z0BH 4ZFZA 3EG9B 4XB8A 2QFPA 4OFDA 2V2WB 4MD0B 3VX1A 2W0KA 4AGMA 4DQOH 3UBXG 1O6SB 3LS4L 4LESA 2VRQA 3DV4A 3IBOA 3TVMB 4Q8BA 1UGKA 4M5YH 3GZPA 3L6FB 4GAYA 4NIKB 3GLDA 1AGCA 1I7TB 3IDXH 3QC5X 1EHAA 1L9SA 4KZEL 3VA6A 1G0XA 1MFEH 1UVQA 4LLUB 5AOMA 1SEBA 2XXFA 1MNUH 5EU5B 1A7PL 4UUJB 1YJDL 4P3CL 6PCYA 1EHKB 4YNYA 3OQ3B 4NSKA 2VDNH 2O6FA 2WGNB 5FGCE 4JM2A 1OQXA 4L9DA 4NKOB 2QMJA 1FO0B 4FLOA 3TH3T 3QUYD 3NACL 3L95B 3L3KA 4FCAA 2GFBA 2FH6A 1U8JA 5TDOA 1KB5B 4IDJH 1UA7A 3PU7A 3X1BA 2ZYSA 1UZ6F 5C7XL 5FW6A 3TS8A 3WFCL 3PQYA 3VXUD 3QPXH 3DV4B 4R3SB 2APSA 3RPBA 4LOEA 2H2SC 3TYGH 1P4UA 1YECL 2BY2A 1A1MB 5MP6H 1AD9A 3KGRA 2XQYK 5AOZA 4Q2ZA 2C9AA 3VMOA 4P2RE 4NEHB 1J18A 5HHVH 4JFTA 1KZYA 1M3JA 3FH8A 5D2NE 2J2ZA 3FFCE 3QFDA 3U7YL 1R6VA 5I19L 4LEXL 1UD3A 4PJ5A 2A9ML 4N8VG 1XF3B 4LKCB 3EH4B 4XXWA 4NX0A 5C0AA 2DQIL 3ZE1B 3RWJB 5I71B 5DWPA 3CN1A 5EBWA 3MNMA 5B21A 3WEOA 2OS7A 4K71C 4ATWA 4YDNA 5JUEH 4LAQL 3SGKA 2QZ5A 1Y07A 3BPLB 3S37H 3L3KB 3OG6B 1FNHA 5E94B 2UUDK 4YFLI 4MA3A 4YGVA 1CI5A 2VC2B 1FBIH 3RL2A 1KPRA 4KUZH 3L1OH 3SKNB 1YN7A 3L5HA 5IQ9B 1FZMA 3BVXA 4WJ5B 5IK3A 4LGRB 4LCYA 4DGWC 4IU3A 1FPTH 2EYRA 4OJEH 3ARZA 4BKLA 4C8XA 3IVKA 4GKZB 4XP5L 5GGRB 2PPAA 1TNNA 4P46C 3VGHA 3VXRA 2GK0A 3CPLA 2OTPA 2X0UA 4IBTA 1E6JL 3OSKA 2HJLA 1JPFA 1A6ZB 1XR8A 2OMNA 1IBYA 3T77B 1QR1B 5IQOA 2ICEB 2DV6A 2ETWA 2EIMB 1AHWA 2V5SA 3L7FB 3G9VA 2L8AA 2QV4A 1QKZH 4JFEB 4DKTA 3BESR 2APTA 2QVTA 3FTVA 1EEZB 5KANG 1MG3C 4I0KA 3M17A 5IB1A 2MOQA 3K2UL 5TQ0L 2CCVA 4I3GA 3MQIA 1YDPA 1P7KA 4B5EA 4JKPL 4R8WL 5BVPL 5DFVC 3CFUA 1XH2A 4OD3L 3AG3B 4UQEA 3GK8L 3W2DH 3F85A 2DL9A 3DVGB 3JUYA 4JANA 1YNLL 1U3YA 5CU5A 3HR6A 4ELMA 1LMIA 4DNLA 4YGAB 1OQOA 4LZKA 4IRJC 1U6AH 3P3UA 3LRMA 1UXSB 1WA1X 3EF4A 4HD5A 1F58H 3IPEA 1KBGL 3ZDZB 4XMLH 4U1KB 3QYNA 3D50A 1VADA 3HVDA 4RNRB 2NZ9C 3ETBJ 3K74B 2I5YH 1N18A 3DTUB 2HJLB 2EDTA 4XMPL 2ZJSL 2A9BA 4WAFA 2E76C 1KYAA 2IBBA 4IS6A 2V8LA 5MEQB 2VQ1B 2YMXL 1R5WA 4Q89A 4L8SA 3PAVA 1NUDA 3BCDA 3LEXA 4XPGH 5F89A 3DO7A 2BSTA 4OF5A 4NN6B 1FL5A 5HJ3B 1NICA 5F7BA 5DD3H 1UC6A 1N6QL 1TDQA 5ETUA 1CDBA 2NSQA 1WFMA 3QIUC 2YAEA 1UXSA 1GYUA 1H5BC 2BNRE 4FXGC 4HIHB 3GSNL 3OLIA 1IZJA 2Y36H 1JFQH 3OGCA 5GS2H 5DSCB 4GNKB 4Z77A 4MD5A 5FM4A 5IROC 1SY6A 4NZTL 5DVOA 2FT8A 3HC2A 5E08H 4KHXH 1U8IB 3CN0A 5C97A 1M7IB 4P5KB 4G3YL 2G5BB 2X38A 3ZRSA 2HFFB 4A39A 1OAYL 3MV9D 2C3VB 4MLIA 3VJ6B 2WVSA 3FB6B 4OAWB 4DTGL 1ACZA 4OFIA 1Q90A 2DQHH 1QABA 3WO3B 2PTTA 2JIXB 2WOYA 3IDNA 4HHGA 4L2LA 2B1AH 4WWID 3NJXA 1MDTA 2XVKA 4AUUA 4HWEL 2UVFA 5I16A 1FVCB 2FZ3B 1NDGB 5JIDA 5C0JB 4ODXA 2VO5A 3QIWA 4IJ3B 3T65B 2XKSA 3TF7C 1S4IA 1SDAB 2YD3A 2BP8A 5C6PB 3LNIA 4P5RA 3KLQA 1YMMD 4EN3C 1OOWA 5ICXA 4BSVB 5DR5H 3NIGF 1H6FA 1UZ8A 5DO2C 3ZTNH 2ZICA 2X1OA 2H2PC 1PL3A 2X42A 1AOHA 4PW4A 4W9CC 4ONGL 4AI7A 2WIIA 3D0LB 2YKKA 2YGQA 2YXFA 3N85L 4GB9A 4W9FC 3TBBA 1P4LB 3QNYA 1W72L 3ZT5A 4JPKL 5C09B 3UAJA 4O51B 5CGBA 5F8RC 2WBWB 3TOPA 2X7LB 4QWWD 1YEDA 4KVPA 1A3RL 5KYWB 3QS3A 2IH1A 1T21B 3BSZH 5AG8A 1XGQA 3Q6FA 5JYLA 1T66D 5K1NA 1N7MH 3C9NA 1F56A 1I3GL 3MCYA 5LCVA 1RJYA 2H3KA 4ZXBC 3A23A 4HV8A 2WUBH 3FT4B 5IREA 4XWOC 1WBYB 4W68A 5LNEA 4Z0BL 1AG0A 4U1HB 4ZMOA 3QEGL 4KZDH 4FADA 1BA9A 5G5DB 4P49A 3Q48A 4EIBA 2FEJA 1HZLA 4CAGA 4B60A 5D1ZD 3EO0A 1FG9C 3APNA 3ML8A 5DRWB 4C4KT 2XX0A 3AQZA 1OAUH 2J5WA 3CFTA 5FA4A 3VMPA 1QZNA 2GG1A 3MLZH 4QYAA 3JVGA 2J7LA 5TE4H 1VCAA 4HFUH 2DM2A 3UAJC 5I6XB 3UYPB 5EC2A 2A38A 4NCDA 3P4LA 4NKIH 5LDSA 3HUJE 1IKNC 2P5PA 4XPFL 1TXKA 3PLYA 1IC5L 5I0VA 2BOLA 4N9OB 4G6AD 4P9ML 3RVUC 1ODAA 3S2AA 5KW9L 3VU1A 1HTYA 3UX9B 3IDGA 3NACH 3T0WA 4ORZC 2QADD 4WU7B 5EZOH 3GSXB 5CSZA 5A7EA 3RVXC 3BAJA 3VI3A 2FGWH 1IARB 1QLFB 5DS1A 2PPCA 3O3DB 4PGEA 2IPKB 3NFPB 2YMOA 4L1DA 4PRPB 4C54A 4U1HA 3D8MA 1CLOL 4Z7WB 3ZYIA 1AR1B 4B5ZA 5CEZL 4OT1L 4QHLB 3SPHA 1QFUH 2WNWA 1BLIA 1UG9A 4JFDA 2EDQA 5DLMH 3T5WA 5HYIA 4MXVE 3UO1L 1VJSA 4Z3GA 1RZFH 5C07E 4XH2B 1DZBA 4M93B 2VQTA 4JB9L 2CE6A 3LN5B 4NN5B 3L5XH 3WKPA 1FFRA 3QDGD 5D70L 4WW2B 1QRNB 1S3KL 4U1NA 3DURB 3QWQB 4XP9L 1MUJB 3DO7B 5BCAA 4JW3A 4OIIL 4LLMB 4FA8A 4X5WA 3U4EB 2J20A 4DSYA 4MYPA 2EECA 1CT8A 2YAHA 3TL5A 2ZWLT 2I7OA 4PRPA 4U3SB 3QDJE 4EPSA 3SKMB 2BZDA 3LZFL 1CFVH 3ULVH 4HIHA 1X5KA 4C56E 4L0ZA 3BSZA 4GW5B 1UQSB 4I0PB 2IG2H 1XSOA 4LCIL 4P46A 1NINA 4U1GB 4HOZA 1CFTA 5AQ0A 1LM8V 2IPTL 5I0WA 2DLTA 1W0WB 1A25A 1I1AB 1WG3A 1BGXL 4X6CF 2HKFH 4A2DA 4GAFB 5D4QA 4Y9BA 1EUTA 3GM0A 1BM3H 4O9HH 5CKAA 1H15A 3HHSB 3L9RA 3NJNA 3QDAA 1GHFH 1HKLL 2DL2A 2D7TH 4H40A 1H3GA 2R0WL 1IEBB 3LNDA 5DU7A 3E38A 3LVTA 5L4FA 1JF1B 5HI3D 4HULB 3BN3B 4G83A 2BIQA 3L5IA 1NL0L 5F96H 3RWIA 5DLLA 1G1YA 1NCUA 2GW5A 3RWCA 3RFZA 3ARVA 2G3XA 2OMUB 4XR8C 1IQWH 4NB7A 3W2DL 5CD3A 2Z8SA 3IRPX 3A67L 5DZPA 3N43F 5CJ5A 5IESL 4MBOA 1G5AA 1L7IH 4XNMB 3SO5A 3QH3A 5I1JH 2P9RA 5DZJA 5C0RL 1F58L 4O2FA 3MRBA 1OAQH 4M7LT 1NCCH 4Q58C 1XGYL 3EJPA 3V4PH 3T1FA 4WTWA 1IO4C 2HH0H 1Q9WA 3G6JA 4UDTB 3VFMB 1JVOA 1IAKA 3MV11 4J8QA 2H41A 1RULL 3NFNB 2MCPL 1U8QB 4GPVA 3WY2A 1V3MA 4KMTH 4IJTA 5B8CB 2IH1B 1V3KA 3T0VA 4AQOA 4HLZG 2VDLL 1RHFA 4X6CE 3HE7D 3IDUA 4AENB 2JB6B 4JPQA 4BEIA 5DHYB 2VLRA 5D4IA 3B2UD 3JWNC 3EOAA 3MGTA 4WGWB 4P8QA 5CJ8A 4CMHC 1WZLA 3D30A 1EUUA 3DVFA 3SKOA 5M7QA 2YPLA 1KBKA 3I02A 5E4EC 4HUVA 1K2DB 1MCOL 4W9GC 3RVVC 4X6CA 2JJSC 2ORBL 1ZDQA 1BG9A 3P40A 1FH5L 3MNVB 2HX9A 2P5EB 4QHMA 2DDQH 3CXFA 2IXQB 3SGEI 1PD0A 3X14B 4QJ4B 4BCYA 4YDJA 2R2EB 4PYHA 1GJUA 1JPEA 5E8DH 1QVOB 4LHUG 3OKKB 3UO8B 2X2UA 3T3PB 1IVLA 1SFHA 2CGZA 5KSVB 1FN4A 2BVTA 1S9XB 1Z9NA 1A21A 4KOBA 4G9FB 4B0MB 4QRQB 5IW6A 4PGJA 1H5BB 1X5MA 4I1RA 4PJFB 4ODBD 2F6AA 2AXGA 4TUJA 2HVKB 1FFPA 4P2RB 4PJGF 1QSEA 5CBEA 5E9DA 1YN6A 5DJCA 1ZHNA 4JQXA 5K9QG 4U49A 2WY3B 2Y25A 3R18A 4EZLA 3V4VA 3NABH 3TA3A 2X28A 1URZA 4FQ1H 3A5VA 2A6DB 4JVWA 4W6YB 3FPXA 1T7WA 1ZKAA 5DC9B 4KKZA 5MP6L 4HUNB 1P6WA 1NBYB 2R1WA 4ZFFA 3GJEA 2D3JA 5DJDB 2ZUTA 5I0ZA 2QPDB 5KYXA 5E2TH 4ACPA 1IGCL 1WFJA 4JX0A 4R4FH 3BHBA 3N6YA 1B88A 1S9XA 1VZHA 3B5GA 3CDGA 3HIZA 4JFVA 2P7TB 2IWFA 3QQXA 3NJIA 4MJ2A 3KS0J 3ZYOA 5EFIB 4KX8A 5D4HA 1T2JA 4BSWA 4B0MM 4ZUWA 2HFGL 3RWGA 2CLVA 4L4TB 5E5RB 4JFZH 4MCYA 3R1GH 2WM0A 5J7CC 4W70A 2IF7A 1YEKL 4Z78A 1FAKT 5AZUA 3GLZA 2FK9A 3RL1A 4QT5B 1ZA6A 2WYZA 4IRSC 4KTEL 3FQTB 1PCXA 4MDRA 3O4LB 4OQTH 12E8L 3P9WB 5I82A 2ZYIA 2AF2A 3TH4T 1ECZA 3ARDC 3MC0A 2E75C 4NZFA 4S1DC 3SGJC 3QJVB 4F7TB 1X5HA 5BVJB 3GSNA 2PYED 4CVUA 2E4FA 5AW7B 2PKDA 1N8OE 3D0AA 4AQ8C 4RRPG 1RIUH 3F8UB 5DTFB 3NOIA 1BWMA 1CCZA 3JV6B 4M93C 3UOAB 4D9QD 1PSKL 3G5XA 5D6DA 2GJRA 3C09B 4KH2A 5I30H 4ZPVA 3ZDZE 2QGCA 3W37A 3VXPB 1A47A 3WTYA 5CKGA 3KLHC 3STBA 1CGSL 1J1XH 1SJMA 3HC0A 3T3MB 2DWTA 2CRIA 1C9SA 4LDEB 3EHBD 2VR6A 4F8NA 2CRYA 4R8WH 3GJFA 4F1SA 5FYJL 5H94A 2FGWL 4R83A 1IAIM 3U6XS 2IWEA 3GK8H 4ZMVA 2PN5A 4WI7A 2AK1H 1YAIA 3MOAL 2CNYA 1KXTB 1D5ZA 3PAYA 3IPFA 4PIRF 2VDPB 2R69H 4F5CE 4O2FB 5CZRA 4HGWA 4Q9RH 5AOJA 1K4DB 4G6JH 5JQ6L 1XT5A 3UO1H 5E6SB 3VX0A 1KGUA 2F5AL 1FG2A 5ALBL 5IKCA 1QNIA 2WWOA 3QI9C 3G5WA 2OSLB 3O41B 4N2MA 4YPGA 4FP8L 2DBLL 5DFAA 5AWNH 3N0PB 3RPKA 4A6YA 3O6FA 3CFKA 3US9A 5D70H 1AP2B 2BFGA 3P3TA 4KY1L 4HU2A 3GRBA 1PS3A 2EO1A 3PHSA 1ERNA 4HJ0D 2EAEA 1AR1C 3JWNE 4FD0A 1O6SA 2DEYX 3AG1B 3QXUA 3H6JA 4MRBA 4P05A 1NFDE 2X4OA 1O5DT 5T3ZD 1GY2A 2X4RA 8FABA 2AEWA 4LSTH 3U0TA 1JCKA 5LN8A 5I8OL 3WN5A 1ZT7A 3W82A 2MHAA 1ET5A 3U79A 4DAGH 2Z31D 1QPPA 5EBMB 4TQHA 2GIMA 5CHNB 3TBWB 4Z3IA 5EEYA 4GI6A 1DVXA 3ATFA 1SLUA 4LAJH 3Q13A 3GIZH 1E8XA 1ZV5A 3B37A 3JWDC 1L9PA 4WUKH 1AD0A 1MJUH 3BAEH 1RZ8B 2ZUQB 3DSFL 1F41A 1UASA 3N06B 4FNUA 4R4BB 5IEHB 3II2A 2HKFL 1NLDH 4KKBD 4I48A 2BPBA 3QO0A 2VDKB 4HZAA 4JFPB 1GHFL 3PABA 1F90L 4FABH 3VXSD 4HUMB 2X1PA 1ZLWK 5I9QB 4AMXA 3AWGA 4TTGA 4AQAA 3KCWA 2PWGA 1I9JL 1FFPB 1DBBH 1Z9OA 2JI2A 4GRWB 5DJZA 2FJFB 3EGDB 5HHNB 4PLNC 4HKZB 1MCIA 3SPIA 1MJ8L 4PJDB 3T1WA 3ETTA 1IJ9A 2WTRB 3DUSA 4APQB 1JZIA 1AZBA 3CUPA 1AR1D 3HLAB 4UIKH 3V10A 4WUUE 2GK2A 4ODUA 5H4ZA 4W9IC 2LR4A 1JHLL 2WKLA 2WNKA 1BFTA 3NJMA 3HRPA 5HDBB 2GJPA 4RETB 4I48B 5IW3A 3RY5A 1A7NH 1NDGA 1BZ7B 2NXYD 5HJGA 2HH0L 5KSUB 4BBWA 1LEIA 1XCQB 4OLXH 1C5BL 3IAQA 3EYFA 2CGRH 2C26A 3MBWB 4OSUH 4E42A 4A7GA 4KMTL 4LXFA 4JFHD 2BDNH 4ZUVB 4AOFA 3QNFA 5FHBH 3AWFA 4UU9A 3EGDA 5KS9E 4FQXA 3D52A 1GMIA 1QUNB 3QUXA 2YQGA 1PZSA 4OCRH 3FZUC 3UBXA 1X4XA 2WHVA 3UYOD 2P24A 1CURA 4I3SL 2RQ8A 1G9ML 3FAWA 5PCYA 2WUBL 3VXRB 4G8FA 4RCAA 4C4UA 5IT2H 3WTVA 5L8KB 4D8PA 4ZT1A 3IDMA 2RR3A 4Y0GA 1SJXA 5B39A 2IDUA 2LQRA 4NAQA 3FO2A 3KLAA 4FFYL 2AQ1A 4M4RA 2HT4D 2XG4A 4WHYG 3FF7A 1NPUA 1XGQB 1AGEB 4UUJA 2BRRH 4M8VA 1GIGL 4RAHA 3IGUA 5FB8A 3I3BA 5D7SH 3UTQB 3OKNA 3RJDA 3CFJA 3AM8A 1OW0C 1N6VA 4JFHE 3HN3A 3QJXA 2VDQB 3A4FA 4ZXBA 3ABKB 5DJ2B 1F0LA 3BUYA 3CFCL 5L7XH 1J0ZA 3E3QC 1S7WB 2AV7A 7CGTA 1JOIA 3MTXA 2CO6A 4G82A 4Y7MA 4UOJA 2P8MB 1H3UA 1AQDB 2BIMA 1N70A 1Z0MA 1PKQB 1Z32X 2DEXX 3MJ9A 3OR7B 2GI0A 1CD8A 4Q56A 3PDGA 3RGVB 4U1SB 3REVB 2DB8A 1I7ZB 2H9GB 1NMBH 2ARWA 1CLOH 5ILTL 4L37A 3VNZA 3IJHB 1H6UA 4JQXC 4JY4B 4N8VA 1Z3GL 3RX9A 1K4DA 2EVHA 4HEPA 4M56A 5DZ9A 4IBVA 3V0DA 3E0GA 5IB4A 4ZUSA 5IMLB 4L8SB 1C5DB 3SPJA 5DURB 4A7VA 4YBQC 3OMNB 2X1XR 3CK0L 2PO6A 3ZDZF 4E9TA 3OMZA 3D51A 5J5EA 4YHIA 4BFOA 3KPLB 2ZNWA 4IRSB 3P11H 3PWVB 1TTGA 4XMWA 3FU8A 1UH3A 4OZFB 5FKPB 3T4AC 3FFOA 3O3AA 2CPUA 1W9XA 4X6EA 1VKXA 2AK4E 3TEYA 4O2CB 4KI5F 1IX2A 2P49B 4AL8H 3LXCA 3MJ8B 3UTTB 2BERA 2G3ZA 5FWRA 1NH6A 3JTBA 2W88A 3APDA 4X9BA 4D2NA 4M6NL 3EZJB 1OW0A 1CTOA 1YMHA 3WFBL 2V5TA 4LCIH 2E46A 3KW8A 2D3VA 5IROA 3F58L 4Z7QB 5IB4B 2ADGB 1ECYA 1X9LA 2CQVA 4KHTL 2IPTH 2FR4A 1MY5A 2X4PA 2IDCA 3QUYB 2B20A 4XO5A 5H8DA 3STZB 4L37B 1MCNA 3NCXA 4RFEA 4ZMLA 3TT1L 2ISDA 2DQGH 3VQ2C 2HG0A 3ES6B 2FZ3A 2CKBL 3UJTH 4H88H 4ANXA 1B3JA 2R0WH 4NQVB 4OZIA 1EWHA 1JV5B 4QXUH 4GUOA 1TCRA 4HG4K 1PQZA 3Q43A 3ZVVA 5HHOD 5A2KH 3FL7A 5D93C 3V7MA 4FFWC 1BQSA 1UWYA 5JA8B 2JCCB 2VDQL 3MYZA 2J5LC 4CUCA 1VFUA 4YH6A 4EN3A 1LO3H 5EO1A 1JZ8A 1OGPA 3UYPA 3QDJB 1UACL 4GKOA 3A67H 3W39A 4RNRA 4LGPB 5I74B 4AV0A 4AYMC 3E6HB 2CBQA 1OP4A 3RURA 1ZHLA 1QSFA 1BX2B 1EAPA 3MGOA 3V9CA 3TBYB 3MUJA 5B7EA 1AY1H 3CQFA 3H9HB 1IJNA 4JKLA 2JELL 4LHQB 3MO1B 5IM7B 3IAGC 4NQVA 4NQTA 4OZIB 3CH8A 4O02B 3OM3B 3STZA 4JQVA 4EZKA 2VE6B 5A16B 3JTSA 4P4KA 4QLRA 4ABWA 3AJ7A 3O2DA 3BT2L 3WIFA 4H0HB 1RFDL 1YLBB 1QSVA 1UATA 3K6FA 4RRPA 4X5RA 5DK0B 1RY7B 1ZLUH 2LE9A 4AMKH 4K5LA 2EKSA 4OI7A 2ODIA 2YKLH 4WI0A 3LKSB 3F7YA 4R4NC 3SDXB 4JCWA 5DD6B 4N2KA 3MX0A 3QQ9C 1G7LA 4QHNA 5CFAA 1YA5A 5I8CA 4TNVF 4PI2A 2F19H 1G9HA 2WBXA 5B39B 1MCOH 1NGPL 4KRPC 3T2LA 2EXWD 5EO1B 5B8CA 4DH2A 4DVRL 4TUOA 4IKIA 2Y0SA 1UM5L 4P5TD 2FL5A 5A2AA 1MI5E 2BNQE 1EXUA 2XTJB 1AKPA 1ONQA 4OCMC 3U7WL 3JTSB 3L5JA 4J28A 3V6FB 1UWGL 4JEGB 3C6LA 3IFOB 1AE6L 3MO1A 5E2JA 2FHFA 3SKOB 1UKQA 2BVOB 4XBEH 1J88A 2UWEA 4NKDA 1T20A 5DMGD 1MRCL 1KCKA 1JXKA 3A3YB 1E9QB 1DBBL 3PV6A 4WW2C 5D1QA 1DEEB 1HWHB 1W0WA 3V4VH 3R4RA 4P59H 2P8MA 3R4DA 1UKTA 3LS5H 1KZQA 3OKEA 4RGNC 1PKQA 4HPYH 5IOPB 3DJSA 3QHFL 3C87A 4W9LC 1QA9A 2Q76B 1Z9PA 3BP7B 3O8XA 4PJ7A 5C6TH 3BP5B 1S78C 4FAAB 2CM6A 1S2EA 4WFED 5I73C 4N2AA 3UACA 2H6OA 2VKXA 1KCWA 4DFIA 2X7LA 5IZ7A 4JQIH 4UNUA 4TM9A 3RRQA 4GFXA 1WT5C 2WC7A 3QIUD 2ARJB 5GGVY 4X9HA 3SN6N 4JO4L 5D2LB 3T8VA 5C1MB 2P5WA 4DPRA 1NM4A 1NCWH 3BFQG 5HVGB 4N8CH 4LSQL 4JKMA 5DEFA 3X13B 1WBYA 3G5ZA 1J5IA 1BCIA 2OBGA 4OCLC 3MOBH 4UCFA 3ZE2B 2GSMB 5JOFB 1XSJA 5IY5B 4GT0A 5C0FB 1A4BA 4OLUH 3WXWH 3BZEA 35C8L 4IBWA 4G7YH 5DRWA 3UTTA 2VLLA 1HHIA 1QTPA 3S8GB 2BVEA 4TVPE 2R29H 3EJCA 3GS0A 1G1KA 4J3SA 2WLHA 3RVTD 1H9VA 3IU3A 5TK2A 1CXFA 4JFYB 4YOKA 3MLVL 2VXSL 4N2CA 1M42A 4UQ2A 2HT2D 3ZT6A 1RJZB 2EO9A 1CFBA 4PRHE 4NQXA 1MVUB 2Z8RA 1BYOA 3AREB 3V0WH 1N2RB 1FFQA 3QGVA 1JGDB 1A6TB 4JREC 4KU1A 4AYFA 3F6IA 2BY3A 4WSGA 4XAKD 5DZLA 4HOWA 1TR7A 4G8IA 1LO0L 3QCTH 3CAFA 4MSWA 4RMQA 3ZGIA 3F5WA 4XGZA 4G1MA 3VRIB 5BVJA 3OD3A 4JRXB 3F6LA 5TFSL 1TJGL 1FYTD 3MLYH 5IFJB 1AXSB 4HG4J 4WI4A 3WEMA 4KNSA 2X4SA 3TV3L 3UYRH 4Q9CA 3CZUB 5SWZA 1J11A 4LDOB 3QUMA 4DEPB 3QJTB 2VR7A 4CN6A 4WTZA 4OCXL 3C12A 4BQ9A 5H4YA 3MOAH 3HCVB 3TZVB 2R56H 5SWSA 3N1QC 1QRND 3DROA 4K3JH 1YHPA 4KK8C 4XCEA 1ILUA 3T6WA 4PWGA 4ANUA 1U8LB 2GY5A 2X3CA 5FFOA 2CJ3A 4D7BA 3BKML 3IBEA 1UGNA 5FW7A 3BE1H 5EOCL 3UMNA 4A6YH 4UMGA 4Y5VB 5MENE 5FCSH 3OPUA 2W9DL 5EUKA 4ZW6A 1MWAB 3SYCA 2DBLH 3AM8C 1E5AA 7FABL 3WD5H 5ID0B 3BPCB 3U0PB 3DXAD 3ZE2E 5K9OB 1IE5A 1OSPL 2RH0A 4N2HA 2NUTA 4YLBA 3A6OA 3O6LL 3CG8A 4I2XB 3EGSB 2R27A 1I1AD 1XF2A 1HL8A 4UYPA 5D2LF 1NSNH 3PWPD 4XBGB 3ULVE 3H3KA 4L3EB 3VYPA 1JPST 5L2KE 5K33A 2PCFA 4AGLA 1R5IB 3VFNB 3C2AH 5JXED 4EVNB 3O3BA 4YXLH 4YGVB 2MIZA 4JGJA 2P45B 1XH3B 4X6DB 5D1XC 2Z35A 3DGGB 3SQOH 4CVZA 4Z95L 4K94L 1C16A 3KW7A 1HHGB 5C9KA 1I1YB 2L3BA 4LNVA 2WUCH 2HVJB 3E80A 4WEEA 1ACCA 1TZGL 4HK0A 3UAEA 5ESAA 1EFXA 5D72H 1GZPB 2P47B 2MNWA 2NY0C 3RLSA 3UDWA 3WU1A 2EH8H 1JZHA 2BNRA 1MCWW 2VXQA 4OB5L 3EXJA 3BUQA 1EZLA 3O4LD 3CD4A 4L3EA 4P46D 4ZRGA 3TA4D 1WBXA 3CHPA 4M9OA 4I1NB 3RX7A 2NTFB 5L2KD 2G3MA 1JPTH 1OO2A 1WUZA 3OX8A 2QQNL 4JG5A 4LQFH 3QRBA 4NQCA 1N0XL 3HLKA 2N1TE 3OWEA 3DV6A 3MLXL 4BK4A 4X6BB 2O61A 3L4WA 1WE5A 4MMXC 1CTNA 3TZVD 9CGTA 3FOMA 3RVWD 5HBBA 5JPMA 2QQLL 1F4YL 2YEQA 1E90A 1I3RA 3WUZA 4PBDA 4R5VA 4LOVA 3MJ9L 1JZ4A 2A83A 4S1RL 2H3NA 4Y19A 4KGLA 2E74C 4X4XB 2XHNA 3VA2C 1JUFA 2YBGA 3MRCA 3K46A 4YXHL 1BFSA 2F61A 5LCVL 2EVGA 1ZVNA 3RY6A 1KJMA 4R6UA 4FNLH 4XVSH 5MENA 3P77A 3GSNB 4M7JH 2ZD0A 3IYLW 5FFGA 1MWAL 1G9MH 4X9IA 3WS6A 4B9ZA 3X14A 1YYCA 2GJJA 1KCBA 5K59F 1DUZA 5SWSD 3O9WB 3LEXB 3APMA 3U7AA 2EDHA 3BJLA 5TF1H 1BZDA 2ZOKB 4QXGH 3G5XB 1TU2A 5KYUA 4U4BA 4P57B 1HL4A 1R3LB 2HUEA 2B0SH 1Y18B 2B8OT 4U05A 1UM5H 3PHOB 2AERT 1YEGL 1HHKB 2B16A 1K5NB 3BQUD 1KCSH 4G6ML 3K1KC 3Q2LA 2WZPA 5AYUH 1D5IL 1Q0YH 1L6XA 4N90E 1DQQB 4F2MB 1T7XA 2OMVA 3O0LA 1JXDA 3FUIA 5JPMB 2VLRD 5F0JB 3T71A 3VFTA 1YPZB 1CICC 1P5VA 1U93B 3ZK0A 3PWUA 3SGDH 2HFFA 4TNGA 3CFCH 1F5WA 5L7XL 1E0OB 3KLAB 4KQ4L 4Y2LA 4KK9C 5DJ0A 4QRRB 5HPOA 3Q44A 3T2PA 5I6NA 5D1ZC 1HEZA 1OGAA 3NIFE 4FL4C 1MZZA 5AVTB 4A66A 3IMSA 3HMXH 3UMTA 1T5WB 3C5JA 1FIGL 1KCLA 3CXDL 5FYKL 3QO0B 4BCZA 1IIKA 1R3LA 1U36A 3QHFH 4ZS6C 5BO1H 2WVVA 4HF5L 5GZNC 5DHEA 1COBA 5GZOA 1NGWA 5T5FH 1U42A 1BMWA 1ZHBA 1NMBL 4H1LG 5DUPL 3HZVA 4MDIA 2PYFA 3ABLB 3HBQA 2BJML 1PU0A 2RTTA 3CFKB 3S35L 5LN4A 1RZGB 4PJ5E 3QFGA 3VGBA 4J4PD 2WLKA 2X6BA 2Y07H 3BISA 4LP5A 3ARDD 4HKZA 5IJKC 4Y5VA 3GEWB 1OARL 3BVVA 3H9SB 2EE2A 4GKSB 3B2VL 2WIIB 1E4KC 1BVKB 3D39D 5FYLE 3SDCB 2NY3C 4N0YH 5E8OA 3P11L 3NCCB 3ABZA 2C9SA 3ULSA 3CFEB 1A0QH 2VZUA 5DO2D 3FRUB 2Y1VA 4LNRA 4LVOB 3SODB 2DJ4A 4HT1L 1R5VB 4JG1L 1CF8H 4MZIA 4HXBL 4G7YL 3FTYA 4K7FA 4AL8L 2JF1A 2V2TB 1ACYH 1T22A 1S9YB 1LWRA 1R5IA 4HEME 1CFSB 3VFNA 4ABVA 4GQRA 3WJMB 4YHIB 4FYQA 2F54E 4AVIA 3VD3A 2EIKB 5IHHA 1YQVL 4PJ5D 1GC1L 1F45A 3V9FA 4UB0H 2FJGA 2K7QA 4UI2A 2DWDB 1HHHB 4KI1A 2P1YA 2ZOUA 15C8H 1NGQH 4EQ2A 2NYYC 3UJTL 4M7KL 4HFWB 1HH9B 1QWHA 5K9QI 1RZJL 2P42B 3QJHB 3A4DA 5KS9F 1KEGH 3VRJB 3X17A 1CD1B 1UD5A 4UYQA 1B3IA 1BJ8A 2K7PA 3HMWL 1DQIA 1UXLA 4K7PY 2CIIA 4TNEA 1PAZA 4KK9D 4M6AA 5EWIL 1I9EA 4H8WC 3MFGB 1RUKL 2X4PB 4WI5A 1CGVA 1ROCA 1IT9L 2L7EA 3NEOA 4F33B 5I66B 4C56D 2VDQH 5JW4R 3OX8B 2WXMA 3SY6A 5FA3B 1IQDA 4CSPA 5EEZA 1G7IA 2YRPA 4JDTH 5CMAB 2WINA 3HAEA 4XI5D 2VDKL 5IMKB 2HRPH 2FJGB 5DUJA 1KYDA 3QDHA 4CL7A 1KV3A 1S7WA 3O6FB 1OB1A 1KB9K 2CRMA 1TT6A 3OHXA 4BE5A 4W9DC 2A0LD 3GSQA 3CZKA 1N59B 4ZO9A 5A1AA 4BZ2L 5HYJA 5DFWH 4X4YA 1WGOA 2XQ0A 4NWTL 1JZEA 1OAZL 1UM4L 3QWOA 1CYGA 1JXJA 1ZJBA 4ZOBA 3OF6D 1VGEL 3NEEA 4M29A 1KULA 3D2UB 3IDMB 3PIQA 3UEZA 4AEFA 4GBXD 4RFOH 5MENB 1DJXA 2EDKA 1BIHA 1P9MC 4IBUA 4IRJD 2OTUB 1MJJA 1UWXH 2BY0A 4FC3E 1JZ6A 5CLZA 3ALWA 1R3IH 4P2YA 2NXYB 2EC9T 1KV7A 1KIPB 1AS6A 1WZ1H 1MCPL 1BBDH 1YJDC 3L5WB 3QEQD 5DVMA 3UDWC 2W92A 4OJFH 4F27A 3MV8A 2OX5A 3U9PH 1CDUA 5IMMA 4HUXB 5F6HJ 3FK3A 3G04A 3V0JA 3LH9A 4ZFOA 5IB3B 5FB8B 4UM9D 2WQSA 4N26A 1Z5LA 2NMSA 5SWQA 4OZFA 1RLBA 3AVEA 5C2BH 1BHGA 3WMPA 2VIRA 2DLEA 4U1LA 1A1OB 4IKJA 4Z0XB 4AEIL 4E9RA 2EE9A 5TPWH 1HXYA 2MTPA 5LAXA 5E9AA 1UKSA 4LSUH 2ZPKH 4KKLC 3MRFB 4NNXB 4OD1H 1Z0NA 3VQLA 1IFGA 5C09E 4O4YL 5DJ8B 4IBZA 4XBEL 5HHMB 2C7UA 1CICD 2WTOA 2Y5QA 2O4EA 1E4HA 4QRRA 2EH8L 3MBXL 3CLWA 2H9GA 5F21B 1KY6A 1Q4NX 4MMYB 4OB5H 4YDMA 4HKBB 5F1OB 4ES9A 3HEIB 3LMJL 3UP1A 4N68A 3CZSA 5EEVA 4YR6B 3HFFA 1U8JB 3OAWA 4V1DD 1KPUB 5J57B 3D69B 1ZHBB 1HILB 3BRFA 3K6OA 3RFZC 1GGIL 3L3OB 1U8HA 3L4TA 5F9AC 4WHDA 1DVFA 3TEXA 4EBQL 4FHKA 1J10A 1QWUA 3KJ6L 5E2VH 4WTQA 5HPMB 1T1WB 3P0YH 5GGTL 2H0PA 3SHSA 5DJ6A 2H32A 3L7EB 4BK5A 3K71A 1U8MA 3NJFA 1L3WA 1MFCH 4N2BA 3SOBH 2CCLA 3H3BC 2X6UA 4NZ8A 4PRBB 5ENWA 2HN7A 2YFOA 2EXSA 4QRFA 1QLEL 3AS2A 4NC1E 3WIHL 1L9OA 4NHUA 2XNAB 4J6RH 2G5BA 4KRLB 1J0KA 4DKFL 3IXTA 2GJ6D 2AJ3A 1I8MA 1DQMH 2UUDH 1IGFL 3L4ZA 1ZANH 4WENB 2Y06H 1DQTA 1B6UA 2DYPD 4QXGL 2CWRA 2W8CA 4LHJB 4X80L 3OR6A 5D7HA 2E7CA 5FYKD 3H4FA 1D7CA 1M6OA 2EEFA 3HC4H 2F7OA 4PRPE 4APQC 1J8HA 4YWGL 3ESVF 4YHML 2ATKB 3CX5J 3ELQA 4PREB 3B2XA 1ORSB 3QUZC 2Z0BA 3PE9A 3JWDH 1LEKA 2CAKA 3D0LA 2QR0B 1NOFA 2VAAB 3NFPA 4M03A 3MROA 1NCTA 2GTZA 4E9WA 3CPLB 4WFFD 1LJMA 3N42F 5EOTA 2NXZD 2D7NA 1FVDA 5CGTA 1DQJB 5EHFA 5JIQA 5I73B 3T3MF 4J3WA 1RURL 5GS2D 2CH8A 4KFZC 1TZHB 1UURA 1KJ3H 3FCTB 3FFCA 4U6HB 5JQIB 4QRUB 3C9NB 3ZTDC 1VDGA 3Q3GB 3HMXL 4AJYV 2HLAA 1V7ML 4UINL 3BI9X 4WKXA 2EYSA 4D9RD 1DVZA 2D2OA 5FA3A 2XZCL 1BBJA 3IETB 3TURA 3MJWA 1YYLH 1J5DA 2YAMA 2BIHA 2KZWA 3TO4C 1MUJA 3BCFA 1Z9SB 2VE6A 5IHBA 5GGUA 2M8XA 4HV8B 2HRLA 3FFCD 2F7QA 5GHWH 4GSDH 4OFPA 1J9TA 1K72A 4WHCA 2FB4L 1WS7A 4PJAE 2F54D 1ZS8B 4MXQD 2KL6A 4YSEA 3CSPA 3QCUH 4NQEA 4LLWA 4APQD 4L5FL 2XT1B 3P73A 1T0MB 4OM0H 4R5XA 3VXRE 4LFHG 1I9IL 1KTLB 1QZ1A 2HLEB 3WD5L 2A74C 2FH8A 4FXGB 2GUOA 4FFZA 3PP3H 3WFCH 2H8PA 5I1GL 5LGYA 1KTJA 1NA8A 2VL5B 1A6AA 2HP4A 3F7VA 2DIBA 1S78D 3UXFA 3RWEA 2AXWA 2Y72A 5JPNB 3VI3B 1KXVC 4IRZH 4UTBA 1MN4A 1ZJAA 4JFDD 4JRYA 4N2NA 2X12A 5KVFL </