4RRPM

Crystal structure of the fab complexed with antigen asf1p, northeast structural genomics consortium (nesg) target pdr16
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
153
Chain Sequence
GSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics Consortium (NESG) Target PdR16
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab antibody, light chain
total genus 27
structure length 153
sequence length 158
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4rrpM00
3AADB 2Z34A 2CU9A 5BNXD 2IDCA 5EIIG 1TEYA 5BO0D 2Z3FA 2HUEA 2IIJA 2DZEA 4RRPM 2IO5A 5C3IA 4EO5A 2YGVA 2I32A 1ROCA 1WG3A 4ZBJA
chains in the Genus database with same CATH superfamily
2Z35A 5F3FA 1CQKA 4YHLL 4DO5A 3KYOB 3KYKH 1A4CA 5DJXA 1FAKT 2HP4A 3CSFA 4G43A 4JZJC 1E4HA 5TGBB 4HDIA 3Q8CA 1LDPL 2YA2A 4Q9QH 3QJFB 3ZK0A 3ENEA 2IIJA 2WXIA 3SBWA 1VADB 5I19H 1AIFB 5FHBH 2IANE 2UV3A 2D2CC 4F7CA 3KLAA 1MI5E 1RKRA 4UDUA 4BH8A 4AZUA 3B56A 3SE8H 4RVBA 1I7ZA 1RHFA 5AB1A 2P3YA 4OB5L 1O7SA 3I9IA 2P26A 4MAYD 3B2MA 3OGCB 4MJ5A 2YRBA 5AW8B 2VLLA 1PDKA 1JMZA 4P8QA 1GYAA 5FYJL 4BHUI 5IHLB 5CEZE 3EJYD 1HOCA 1VF5C 2DQ6A 1CK0L 3GSQA 5F0JB 4X7TA 3LXAA 4QGYA 2W65B 1P5VA 1W8NA 4PR5A 1KOAA 1HH9B 5MEOA 3VG0H 1P6WA 4GW5A 3RU8L 1NDGA 1VADA 3UTZB 4WK4B 1MF2H 3KPRA 4X50A 5MHSE 5E8OA 3U46B 1IT9H 3ZZQA 1MIEH 5I1DB 3IJEB 3DURA 4F8QA 4Z95L 5KSUB 1OM3L 1F3RB 2WXKA 4LEXH 5DI8B 5HJDA 3WEOA 3IJYB 1QO3A 2DWSA 2WSKA 3X1BA 1BQLL 3T4YB 4QXUH 4EIUA 1X5JA 3BPLB 1I3RA 1PSKL 1ITCA 2DLHA 2Y2YA 4DIXA 3MOBL 3RBSA 4BH7B 4N0YL 3MLWL 1C5CL 2PKDA 3DPBA 3JWNC 3KM1A 3VMNA 2HRLA 2OMTA 1JHKH 5DRXA 3US0A 4HQQH 2H32B 4A68A 5I0DA 3T3MB 3GBML 2ZKMX 3KLDA 2FO1A 4IBYA 3UYRL 2NY7H 4OF8A 4V1DD 2XN2A 5FKAA 4APQB 1X5KA 3L3HA 3KJ6H 1PLCA 5EOCJ 1AP2A 4FI7A 3UACA 5L4JA 4D3CH 4DFIA 4HBCL 3BUQA 1HIML 4I9WE 1HESA 4ZUUB 2O5YH 2R0LH 3LOWA 1CDJA 3MREA 4U1LB 3A3YB 4CADA 1FAIL 3JUZA 5I1EH 2PNDA 5KYUA 1F97A 3BIKA 3LSOB 5EEUA 1ZLWK 5K93A 3O4OC 1YVLA 3BAYA 5TF1L 1YAZA 3O3DB 5EPMB 1YEFL 1KGIA 4MWFA 1HILA 4WUKL 1VERA 4TUOB 2VW6A 3F6LA 4OZIB 3L5WA 5FM8A 3VGDA 5K9OA 1G6VK 1HHKA 4R5TA 5C0BE 3WYRA 2XXGA 3C5ZA 3MRHB 2VSDA 3HE6C 3IMBA 3P30L 3PF2A 2BNUA 3QORD 1Q9WA 5G4MA 4FG4A 2OMNA 3QUKA 3ZR6A 2AJZB 5DD5H 4H1LH 1VFUA 1I8LA 4HCRH 1D5BA 3G6DH 4J8RB 2IANB 4MNQD 2MCG1 1CL7H 5FYJE 2A99A 5SX5H 4XXDA 4N9GB 3ARGA 3NZSA 2FL5A 3AUVA 5DA0B 4AYDC 4ODTL 4OZFH 2CJSA 1F02I 2OW6A 3ECWA 2CJTA 4X4KA 4C58B 1E5YA 3CFKA 4X0NA 1O6VA 4L3EA 4WWKB 2VSKB 2W9EL 1ZE3H 3LKNA 4GAGH 5D7IA 1FZMB 4I8DA 5FS5A 4N2CA 2F19L 4HJGB 1S7VB 2VQUA 1RZJC 4RDBA 4GQPH 1W0WB 4HAFA 3A21A 4AZ8A 5DVOA 5KBPA 1JNNL 1U3HD 4XMTA 3RVUC 3NK3A 3TBSB 3X13B 4Q6IB 1J87A 2BSDA 3HTLX 1ZHLA 4KKAC 1GHFL 2NUPB 5H2BB 3T2NL 1M6OA 3D4YA 3U0PA 2FJGB 1G1YA 1A64A 4FX5A 2XG5A 4HS3A 4QKTA 5I8OL 2HJFB 2MRYA 4KMTL 2Z4TA 1SOKA 5EF0A 5B3SB 3KGRA 2DPKA 4U1IB 1C7TA 5DC4B 1I8MB 3I6SA 2X4SA 4H0LC 4ENZA 4TNEA 1PG7H 3S3DB 1JWUA 1FBIL 5B1BB 3OBAA 5JIQA 1F58H 1OSEA 1XEUA 3D0VB 3ROOA 3WI9A 4P2YA 4EI5A 1IGYA 5MENA 2OMYB 1T4KB 2FD6L 1J0KA 4E42A 4MXQC 1AZNA 3A6OA 2P5EA 2O61A 3VRLE 3LD8C 1J9SA 1QZNA 1CICA 1JAEA 4M7JH 1ZGLP 4JZNA 4WTWA 3VD5A 4UQIM 5ANME 5HI5D 5D6DC 2JKXA 5EUOA 4YXHL 5C07D 5JR1L 1A3RL 3MLVH 2VDOL 3VQ2C 3WDHA 2EKSA 1UB6A 2M2DA 2XETA 3HR5A 1T7WA 4JM2B 4Z18A 4F58H 5JHAA 1O9VA 1SY6A 2YMOA 3B9AA 2P5WA 1OCOB 1TVBB 2BSEA 3CVIL 4RNRB 1I8KA 1OP9A 3LNFA 4GP8B 2YPLD 3TN0A 3V5DB 2XFXB 5KYYB 2I32A 4K8RH 2F7QA 1LXMA 1AE6L 4PY8J 2AJYH 3QO1A 5I5MA 4XWOD 1AZCA 1RSYA 1QP1A 3CC1A 2IWFA 3J27A 4R0LB 1COBA 1QMUA 4G1MA 1TO4A 4ZUTA 3N41F 1G7HA 2EEAA 2QPFA 3W0WB 3MRRA 4GQ9L 1QBAA 4AIXA 4Y88A 2X9XA 3JWNE 4RAHA 2VERA 3TT1L 2VDNL 1EAPA 2BZDA 4AYSA 1JERA 3FT4A 1IBFA 1TDQA 1LEGB 3MTXA 4KNUA 4QOKB 2AQSA 5D6CA 4EVNB 3GSNA 4NKDA 5GGTA 4F27A 3G5WA 4F7TA 3KNBB 3TVMD 5HYQB 1OK8A 3UZVA 5IV2A 2PP9A 4FTVA 4JPVH 5T1MA 1IE4A 2ATKB 3MGOA 5E00B 3BFOA 1SJMA 2ADFH 3ARBB 2VXVH 1D7DA 4U6HB 3RTQA 4K55A 5CUSH 1THCA 4OAWA 3WEXA 3FTSA 1M71B 1U33A 3NIDF 2DQFA 2MTPA 4S2SA 4AEEA 2IFFL 3PL6D 5F6HJ 4Z77B 3BVNA 3SY0B 1NAMB 1XF3A 5D55A 1YNTB 4BV1A 3QUYB 4NP4H 1P6AB 4HZLA 3B7SA 2G2RB 4KUCD 3AACA 3S2CA 2D7MA 1U92A 1LL1A 3L45A 2W9DL 3KL3A 4LCCB 4YDJB 4X4YB 4O2FB 4NO2B 5C09D 4E9QA 4WLCA 2OZNA 1NFKA 2E7DA 3O81A 4DP8X 3P3UA 2EDFA 4U6XA 5GZOC 4E68A 1N9PA 1NGYB 4HETA 4D0BA 3ZTNH 5TQ2L 3FU7B 3Q44A 3DHPA 3GI8L 2VXSL 3RVWC 4YHNB 3BAEH 4LBEB 5D6DA 3MJ9A 1GSMA 1U36A 5DYFA 4YL9A 1HHGB 1SYVA 3QHFH 1ZE3C 1KGCD 1CLCA 3GSWB 4Z7UE 1LE5B 3BLKA 1ZHKA 4UQ2A 1NC4A 3HRZB 4EI5C 3TA3A 3GTNA 4KKQA 3WTWA 4ZTOH 4KVNH 1E42A 4KKPA 4KRLB 4PRDB 3WKQA 1MIEL 3VD3A 1JTOA 3QO0A 1ITBB 3OKDB 5LVEA 1KGYE 2WZ0A 2CDFB 5IJDC 4G72B 4DPRA 5L9DH 1JYWA 5I6MA 2D31A 3QGVA 1DQQB 2OYLA 1FVDA 2WZPA 5GGSB 4XNUL 2B1AL 4GJTB 2H0JA 3FONA 4M6NL 2B59B 2X1OA 2V5SA 2P48B 3MRKB 1LM8V 1E2VA 4IBUA 4J3WA 5FCUH 3SDCA 2CIKB 1Z9NA 3ZT6A 1SJHB 3I9GH 5FYKE 4AVKA 4Q2ZB 4Y0GA 5BZWA 3IKCA 4EZLA 3VA2C 4TQIA 1IKNC 1QW9A 5C09B 4POYA 1YN7A 2DZEA 1E6OL 4KKNA 1N6QH 5IQNA 4MD5B 3WO4B 1QLEH 2QLYA 3GSXB 3IGLA 3RNKA 1U4FA 2DLGA 3WUWG 2X4SB 3RFZC 3GKWH 2OLDA 4XO4A 3RL2A 4LOVA 5BV7B 3SYOA 3IMSA 4KI5C 3NAAH 4ZUWA 5I1HH 3MBWA 2VQTA 3HG1D 4FNSA 4MLSA 4OFIA 3S3JA 3CZUB 4LKCB 4OLYH 4OLEA 1J8KA 5CILL 1GAFL 3MV01 1EXHA 3DROA 2ARJB 5DFAA 5GISH 5DR5H 3DNKA 3HG3A 1N19A 4Y16D 2WXMA 4F3FA 4H25A 1MJ7L 5B4MC 1KJ2L 4UOW1 3VFUB 5J12B 5I16A 1R1CA 3QXDB 5F9WB 2VT0A 1BFSA 1DBMH 4XVTH 2C26A 3QJQB 1WISA 4C56E 2NT1A 3HS8A 2EIBA 2IC2A 1I1RA 2E75C 3DIDA 4PRID 4Z0XA 4ERSH 1NUNB 5IFJA 4ICWA 5HHPB 3V4PA 1WZ1H 3O9WD 3VNYA 1FN4B 1WH0A 1DE4B 3BD5A 4MS8C 1HDMB 4F57L 1NM4A 3SPVA 4BZ1L 4FL4C 1WFOA 1NGQL 1M1SA 3CXDH 5HJ3A 1BXVA 3QUZD 1GZQB 4Z7VA 4FQXB 4J2XA 5IUCA 4DP9X 1E4XL 3ZE2E 2NR6D 5I1AA 4PJIE 1U8MB 4GUPA 3VFVA 3TF4A 4IGBA 5D7HA 3T1FB 5BQ7A 2CDFA 1A4BA 2WTOA 3QO0B 1P84K 5LAXA 1O6TA 4DN3H 4JFFE 4O5LL 3WUWA 2AP2A 3I6GB 3L48A 5BO1L 5BRZD 2WXLA 4XPHL 1WC7A 2A1WH 4O02A 4XNMA 4WFHE 3UPRB 3E6HB 2Q1EA 3HI1B 1FDLL 5EORL 3SY6A 1ERNA 3VRIA 4B6ZA 3KXFA 3ARDD 5T1DL 3AXLB 4XPBL 4QRQB 1OALA 2VXQL 1C5DB 3II1A 4YSRA 3ZYOA 2B39A 3ZQ9A 4FXKA 3EZJB 4OV5B 3NCEB 3QDJA 4OCXH 3PFQA 4KROC 3WY2A 3P0VH 3R4DA 4FGMA 5ISZE 3FCUB 2JELH 4J27A 3DSNB 4OZHE 3AG3B 3FU5A 4ZMVA 4Q8BA 1DL7H 4TVPH 4AYEC 4DWHA 1NBYA 5E2UH 1OE2A 1XGQA 1TQBC 5JR1H 4LSTH 1B6DA 2EE0A 1JGIA 1XCTB 2BY3A 3AM8A 4NO2A 4IOFD 4K7FA 1OZTG 2Y5TA 4A38A 1A7BA 5D1ZC 4W4OC 3TCLA 2BIPA 4ODSL 1R3KB 4NLAA 1BD2A 4XXCA 3D0LB 3OPZH 4K23H 3DJSA 1A7OL 4PVMA 2IG2L 3FT1A 3G5YA 4ZPTA 3S96A 5CCKH 5L2KE 2ENJA 1UXWB 3DGDA 3DARA 1MELA 5E9DB 5I0WA 3QP3A 3DMMC 1QQDB 1Z6JT 2NNCA 4KRPD 2I07A 8CGTA 3W37A 3HJEA 1WGOA 4MB5A 1MI5B 1A6UH 3ZOAA 5C1MB 5F1OB 5MEPB 2FT8A 4ZUVB 2IGFL 4L4VB 5CLZA 4C4KT 1NGPL 1PZCA 4N6RA 3JYCA 2Y1YA 3FT9A 2FE0A 1FZOB 4APXA 1LP9A 2ZYHA 4DP4X 2FB4H 4KJYA 1F56A 4NNPH 1LHZA 3EKCA 4O9HH 3MC0A 1OWRM 2DAVA 2DQIH 4HH9B 1MY7A 1B0RA 2IH3B 4NQSB 1B6UA 4GRWH 5DWPA 5E5MA 1FO0B 2HFGH 2QSCH 1EDHA 3CDYA 4YLCA 2O4EA 3BAWA 4PRIA 2XPGB 5JHDB 2FIKB 4F9LC 1CT8B 1O9WA 1YNLH 3ARSA 3DGGA 3QJTB 4MQTB 3KPOA 4GMTL 1KPUA 1PF3A 3MJWA 3FQRA 4G6KL 3HE7A 3ERXA 3QORB 1LO3L 2AABH 2ZOLB 2HLAB 1PTZA 4JL2A 5AW4B 3I6LE 4IIQB 4UV7H 3S36X 4K9EL 5E2WL 3DIVA 1MFEH 4JAMB 4TMPA 5HYEA 3FHAA 3OC8A 2P8LB 2VDLL 2Z64C 4R4FH 2XX1A 5BOPA 5BUPA 4URKA 3L4CA 2QR0B 5CZRA 2XN0A 4IKIA 2BWIA 1VAHA 1T83A 2YJLA 4YH6A 3UP6A 4IKKA 2VZVA 5JDJA 1ZLUH 2PUQT 3PWVB 2VDKL 5TF0A 4XCNB 2WXNA 4Z7IA 5FYJH 1KY6A 4WKXA 1ES0B 3TEZA 4WF7A 2C1OA 3MRPA 3FXIC 5C0GB 4P2OC 3RGVC 3DPDA 1CFMA 2JE8A 1QPXA 2BERA 4JFFB 4J4PD 2NDFA 3APNA 5KSBA 4PWFA 4PW9A 3IDJA 4DNLA 4NCDA 3BP7A 2GJ6E 4OFVA 5FB8A 1FZJA 1RU9L 3ULUF 4ONFH 1RMFH 5I30H 3EFDL 4F8PA 3PXHA 4PWIA 1HE7A 2F18A 4QAMB 4K3EH 3TFKD 1EEYB 1QR4A 4PJHB 3NTCH 3V4PB 1G4MA 3DVGB 4MD0B 2QR0A 4XC1H 1C1EH 3MOBH 3HFML 4M7ZC 4YHLH 4OT1L 4A7GF 5AVVB 4HUXA 4FP8L 1OY3B 2XZQL 3ESUF 1CFQB 3LN5A 1BD2D 4I2XE 2FECL 4U3XA 5CFHA 1RP9A 5AKSA 1NANI 3RIAK 4L5FE 1OW0A 1BZDA 3LHAA 4YDVA 3SPCA 4OCMC 2J5LB 1ZEAH 4U1HB 2W60B 4UT9L 2JKIS 2P7TB 3GMNB 3H4FA 5GIRB 1I1CA 2GB2A 2OCFD 2AEWA 5D1ZD 3DROB 3F85A 4H8WC 4MDRA 5DMGC 4WTZG 5LNEA 3NACL 1IV8A 3HLAB 4L29A 4RSYA 4H13C 4GBXC 1U3ZA 3BZ4A 4L8SB 3KYMB 3RWFA 2VR4A 2FLRT 3EOTL 1JTPA 3Q2VA 1JV5A 4PJEA 3WDIA 2EE9A 4XI5D 3PNRB 2XV3A 4W9HC 3OXRB 4OKDA 4CW1B 43C9B 1BFVL 3A5VA 4OD1L 2IOMA 4RGNC 4CUCA 5E70A 1LP9B 5GRZA 1MHCB 3B1UA 5FKPB 4FFYL 4DP7X 2VDPH 3WE6A 2ZXAA 1TENA 3K91A 3Q5TA 4H2AA 1PGRB 1OM9A 1K6QH 2WLLA 4JE0A 1GZHA 4LEOA 4QXGL 5IB2B 4ODBD 2JNZA 4JRYD 1NL0L 3WFDL 1LE9A 1SQMA 5J6HB 4W68A 4AX3A 4OCYL 4ZMYA 1NMBL 3RHWK 5IHWA 3SKOA 4CJ1A 1JZ8A 2D0GA 5JA9A 1GGUA 4AQ1A 3OKLA 2OTUB 3BFWA 1VA9A 5HHMD 4I88A 5GISL 4PGEA 4BZYA 4E9SA 4EO5A 1S5HA 3TCLB 1HYRC 1K4DB 4KDTC 3A4AA 3V9EA 2FSEB 1BCIA 3RPKA 2RALA 4BHUA 3KDMA 3P0YL 3HMXH 3QG7H 4MASA 3PHSA 4Y9EA 4G8GD 4D0CB 2CGRH 3NG5A 4OV6F 1GJUA 3BKML 3DRTA 3MXVH 4KTGA 4TLUA 2UZYA 3EYQD 4QF1A 4P46B 2Z8VC 4LLQB 3ZBMA 1IC5L 1OGTA 1RI8A 4HIXL 4Q9CA 4ANXA 25C8L 2HFEA 3JVGA 2VR5A 1IGFH 4UBDD 2NY3C 1SYVB 3EYFA 4CILA 3RA7L 1E4XH 35C8H 2WTPA 3NT0A 4QRQA 3LQZB 2NQDA 2B7DT 2B0SL 3J8F7 2HMID 3RKDD 4PTUA 4Z95H 2R2HA 2A38A 4XPFH 4FKKA 5EB9A 1T7VA 3KW7A 4MMXC 1KCRL 3PPSA 5I1DA 1OGAB 4HEPA 3S5YA 3CLFH 5C6TH 1EGJA 3NCCB 3VRJA 1BZOA 3UJTL 1OB1B 3NQIA 4BSVB 1HKLH 2IWEA 3JXAA 1EXGA 2ESVA 1G9NL 2HT3D 2NYZA 2Y22A 1NDGB 5BQ7B 4KI5E 3BAKA 3EJTA 5D2LF 2A9NL 3FCBA 3VXSB 1IQDB 3H9SE 2CG9X 5CCHE 5T1KD 1X5GA 2O72A 2FEDC 2RB8A 3W9DB 5J13C 4S1QL 3UABA 2YUWA 4KZCA 4XOAA 4AV4A 3TYGL 1GAFH 2AQQA 5FYJD 2E9BA 2YXVA 4WY7L 1A6VL 4XCCL 3VXTA 2G2NA 1EA9C 5FGCE 5F44A 5KJRL 2VC2L 3L3KA 4JFDE 4F92B 2VLKA 5IQ9A 5IB1A 1G9NH 1Z5LB 3ZIMA 4WJ5B 5ICZA 5IVXA 1AXTH 1D6EA 3B2XA 4JJ5B 4X6CF 2MNJB 5GGQL 3MGOB 5E00A 1GGIH 3RY4A 3OMAB 3LD8B 2L4OA 3VX1A 3DOIA 3QXDA 3O4OB 3GSNB 2AS5M 2ESVE 1FL5A 3S48A 4JJOA 3FS9A 1PYWB 3VXQA 4PJ8C 4PW4A 4XWOC 4HPYL 2DIEA 3D6GA 1TJXA 1NLBH 4KTEL 4WTQA 1W9XA 3THML 4HK0A 5AAMA 5T8IA 3UGUA 5L2KD 3HS0A 1EERB 2DLTA 3BMVA 1HXYB 4NWTH 4NXKA 4WAFA 2XA8L 4PU2A 2HUHA 3P2BA 4G8AC 4Q6KA 5CZXD 3ILQC 1EDQA 3PWNA 5T5NF 1XB3A 1BQHG 3D30A 5DJCB 1QBBA 3EYSL 3G6JA 2Q3AA 2B5IC 4HD9A 4GOSA 4KJPC 2EDYA 1D2OA 3QEUB 4AGPA 2WBJB 2Y1AA 1NIEA 5HHQA 1W8EA 1RPUA 2X9WA 1YN7B 4M6AA 3UYPB 2Y07H 2EUXA 4C83A 5DQJA 2ADFL 1XFPA 3OG4B 2FJHA 3L2MA 1NPUA 2BS8A 4JCMA 1ZA3B 4ADGA 3QCTH 3OHXB 1W72L 3VWJB 4JZNB 1BJMA 4OBRA 1MW1A 2BIIA 4OUUA 4GMTH 5SWQB 1J5IA 1CGSL 4TULH 3MJ7B 5FW6A 1T5WA 2IQ9L 2WWOA 2ERJC 4JY5L 1ADQA 3IMWA 3L3JA 1YNKL 2IV8A 1H15A 3O6KH 4P9ML 1A7NL 5E8PA 2IWKA 2K0RA 3FQ2A 4GT7A 2NZ9C 3T09A 1A4AA 1W72H 2NZ9D 4NNXA 4G59C 2X89D 2X09A 1F4WL 5ECGA 4HS3B 1MCRA 4HK0B 3NCYS 2H6OA 1M6OB 3U0PB 4LSPL 1LD9B 3NJVA 3TZVD 4TPRL 2OZ4A 4FNRA 4Q6IA 2Y36L 3AMKA 2VQ4A 4ZPVA 1IGML 3D06A 2AHIA 2WB7A 3I6KB 3DDFA 3VM5A 1W0WA 2VDOH 2X4RA 3FHQA 3FT2B 1YC8A 4AT6A 2JXMA 5FK9A 1RZPA 3ZIYA 3QIUD 3CFBA 4W6XB 5EBGA 4FZEL 5TQ0H 4Y1SA 5C6WH 2CK0H 3QJHB 4R97C 4BZ2A 2QV2A 4FNLL 2XTJB 1ZV5A 4K8RL 4EN2A 4LDOB 4IMLA 3TBTB 1DLFH 1WSST 1UD8A 2PYEA 3FT2A 4G1EB 1LO5B 1ZPLA 2IAND 4MNQB 4R0LC 2WLZA 5ELIA 5TDNA 1QBLL 5BMFH 3QDGD 2H6PB 2PYFA 3PJSB 5J9PB 3GK8L 2VE6A 2Y7QB 2P24A 2Q2EB 2C9QA 5EU7E 4KTDH 2BNRA 5CMAB 3V5KB 4XN4A 3CX5J 1P2CA 2FWOA 1S3KH 2ZAIA 1JXKA 5B1JC 4F37F 4BFEA 1BPVA 1QFWH 2DYRB 1ZT1A 3TJHD 4M7KH 3STLA 3V10A 1NKRA 1NCBL 5E6IC 2W9DH 2VABB 4OLUH 3D34A 2DKMA 1U3HC 1IKOP 1NCHA 1AI1L 5HYQA 3LEYH 1KB5H 1JHKL 2UVFA 4TNVK 3ARBC 5D6CB 3L3JB 3TTSA 3OKNA 3SDYH 2HFTA 5E8DL 3BDYH 3E8UH 4CDGC 2QKIB 2HFEB 3IPBA 4DHLA 3WTVA 3L5JA 1HC1A 2QT6A 3AW5A 4P46A 4A7UA 4P5KA 3GZOA 4WI6A 2NY0C 1PZBA 3E3QE 2F0CA 3MFGB 4M43H 4AL8H 1DZBA 4LSRL 3RZCA 3WUZA 2AV1A 3UOAB 5BW7C 1ZA3A 2X6MA 1HHHB 2FVNA 3QUMA 2YXWA 2Z6FA 4M7LH 1QX1A 1OPGH 2X6AA 3QWRD 4LCCC 1BIIA 2O5YL 3S6CA 4ZXBA 4JFDA 1QLEB 1OV8A 4NQXB 5JW4N 3HG5A 3QFGA 1TPXB 2D9CA 2WINB 5ENWA 3JWDH 3SDYL 2IPTH 3X3GH 1CDBA 1RUAL 2R0ZH 4QRUA 4NHCH 4DVRL 3GGWB 5CJQH 2NCMA 4QRPA 5C9KA 2A0LD 4XO9A 1LEIA 3O11A 4LSRH 5I28A 1B4JH 2P42B 2WQ8A 3VE0B 1OT4A 4CA4A 1QRND 5E1GA 2FATL 1JZJA 3PIQA 5FUOH 5KOMC 4FP8H 2F08A 5IJKC 2IPUK 2IQAA 5JPNA 3P0YH 1A9BA 3QG7L 4P49A 4DK6A 4ZK8A 5I18L 4Z0BL 3JV4A 3PG2A 5HGBB 4GNKB 3GRBA 1PAZA 3UTZA 2EIKB 2FBOJ 3OZLA 1QOKA 4CRPA 3BVDB 2NUTA 1BQLH 3WMPA 5AB0A 2O93L 3I3DA 3U4KA 6PCYA 2OL3A 2OSXA 4U1GC 5JORA 4GYBA 3ISWA 4YHKH 5E5UB 4DH2A 3WLBA 4IBWA 4PWEA 1JCVA 3H7BA 3GSQB 5FGSA 4PV9B 5DURD 4FQXC 5F9AC 2HVKA 4QOKD 2XG5B 4YK4C 3HC2A 3TWCH 1B9ZA 4IMKA 4L8SA 5EH1A 2OMBA 3V52L 4BSJA 5DTFB 2ZYRA 2FX8H 2EUVA 1PZDA 1KFGA 5F3HA 4OLXH 4F2MB 1AGDB 3BE1H 2CCLA 2WGNB 3QDGB 4HBCH 1CJYA 5LGJA 3EHBC 2ZX7A 4I3GA 1IFRA 3F65A 1NCTA 2NY1C 3KJ6L 4CMHB 5D71L 1RUKL 3O8XA 4N5EC 3P0VL 5F89A 4PJGA 1IAOB 4HWBH 1PW3A 2BRQA 1U8LA 5I1EL 3V52H 4Z3FA 2MNWA 4PJXF 1NFIB 4TVPL 1HWGB 4HD5A 1PG7L 4FZ8L 1TR7A 5HDBE 4OZHA 3DXAA 1VRSA 2CLVA 5T3XH 3WFHB 3QDMB 4Y1AE 3IKKA 1F4XL 2CHXA 3TGXA 3QEGL 4WHCA 3RVTC 2BINA 4ODWB 4QHLA 1WZ1L 4K9JA 2ADIA 2JCCA 3I9AA 3U83A 2EXYD 3NAAL 1DVFA 4XVUC 2CUHA 3DHJA 2R27A 4E5XG 1A7QH 2QZ5A 4UT7H 5JIIA 4JKPH 1XXFC 2COVD 3UBXG 4CU7A 3MBED 1AQHA 1BQ5A 3QAQA 3Q6GH 5J3HC 1UWXH 1GKOA 3QS2A 5F8RC 5K1JA 5L4MA 2BP5M 2UZYB 4LCWD 1C9SA 5E94B 3RWEB 5IGXL 1W8OA 4Z23A 3NESA 2DQTL 1MNUL 1CURA 4ZFQA 2XRAL 1G9HA 4P4KA 1KJMB 1NGPH 2X4PA 2DQCL 3TL5A 2KS0A 3MYZA 4O5LH 1J1PL 4ORGA 2RAMA 1JGUL 1NCOA 5AW3B 2WN2A 3MUZ1 2HX9A 5T33H 4Y1AA 3PDGA 1SXSA 1O5DT 2P8LA 4Y1TA 2EDBA 5AAPA 2R2EA 4JB9L 3DV6B 5C6TL 2ZCKL 3EOBB 1ET5A 1AP2B 4Y16A 5C07E 4BM7A 2X4PB 3HBZA 1L9RA 4OFPA 1AH1A 4KVPA 3DJRA 3FO9B 1X9LA 3MGTB 1PKOA 3AADB 5FKAB 2WZ5A 4P06A 4XXWC 3T8VA 3D0AA 4PP2B 1HZHH 4QLWA 2P47B 3TESA 1N26A 4J4PA 4L4TD 4XH2A 4JDZB 2O6CA 2ZUYA 3GPSA 3QIBC 1IFHL 3FFDA 4KQ4H 3T65B 3DJ9A 4XP6H 5EU5A 5AG9A 4BCYA 1R47A 1KBWA 1OAKH 5ACLA 1DDHB 1PFCA 1GCFA 1I1FB 2NY5L 3NABL 1ZSHA 5F93C 1TZ8A 3CFEB 3MX0B 1ORSA 5F7BA 1BX2A 2ZX6A 3D3VE 4FE9A 4YHZH 5IFHL 4CBPA 1I7TA 4J3OC 2NY2B 4E41A 2ITDB 1DBKL 4NNYB 3T6WA 1CD1B 3FH5A 3HKZA 3QUXC 3LEXB 5IMOA 1CFSB 4PJ7B 2QADC 4AQ8C 4ONFL 1F3JA 2BXZA 5T3ZH 1EZLA 2VKXA 4N5UA 5L6YL 5E1IA 3WLWC 1U8OA 5DA4A 3BQUC 4AVJA 3LNHA 4JJ5A 1AZBA 2I85A 1GZPB 4KKBC 3SDDC 1Z5LA 1PG7W 2NXYC 4RQQA 4GG6E 1WS7A 5TQ2H 5LBVA 1NMCC 1CN4A 1Y0LA 4JMNA 1QRKA 3OX8A 4RZCA 5D4JA 4FA7B 2HT4D 4ZNEE 1UATA 4KK9C 4N87A 4PJEF 4KK9D 1OTSC 2VUKA 2XTJE 2J55A 1M4KA 3CG8A 3DSNA 3N42F 2Z4QB 1N4XH 1T1ZB 2QQNH 5T3ZD 1IT9L 3IJSA 3O9WB 3D5OF 5L88L 2ICES 2WLYA 2YK1L 3LQMA 4X83A 2C4FT 3ARVA 2NUTB 4I4WA 4R26L 4XP5L 4P2QE 4W70A 2E46A 4PJHF 3AU1B 1UWEL 2BSRA 4UT6A 1CU4H 5HVFB 1RD6A 2FQFA 4RBPH 2GYSA 1UB5B 4DAGL 3B9VA 3OXSB 3RYMA 3LPPA 4C56B 3FBQA 4JFZH 4U0RC 3F5WB 3T0EE 4KH2A 3MNMA 1NFDF 5I1KL 2JH2A 1QR1B 4MB1A 1I7RA 1UOLA 4U3SA 1U95B 4LNVA 5LUMA 4AKPA 4K07A 3BIBX 4QTIH 3BZFA 3F7KA 5JZ7D 1B88A 1NL0H 2CR3A 3GMLA 3QORC 1N7MH 1T1XB 1PNDA 5FDWA 1XGPA 4C4KO 3QORA 2MCPH 4AW7A 4RWHA 3ZE0F 3KCPB 1QABA 4TVPE 5C2BL 1HI6A 2O6PA 4M61A 5JW5A 2FIKA 2J6EH 2VH5L 3DUSA 4KUCF 3CHRA 1I7UB 4KH9A 4L4TB 4U6VL 4Z0XB 1J9QA 2BO0A 5D93C 2PTUA 4GUQA 4F7PB 4JFHE 2GUYA 4LVOB 4LF3A 1F41A 1UA6H 4AUJA 2DWTA 2F1BA 2DTSA 2R69H 3FQTB 2Q10A 2YEZB 1LK2A 2CALA 3N2JA 4WFEE 3P69A 2OR9H 2ZKXA 5GRVL 4HF5L 2LAAA 3LXBA 5MEPA 3A47A 1OEZW 25C8H 2OFQA 3CXHJ 3NJFA 2Z31A 4WI0A 1TTAA 3FPXA 3VJ6B 2FWOB 3O3EA 1WIUA 1WUNT 1S6NA 3CQPA 3HZYB 3PHOB 1R3HB 1DBAH 3QZPA 4L4TE 3FOLA 3T2PA 4PJ9A 3GHEL 2L7UA 3UG4A 4UDTB 3ET9F 4OZIF 2IGTA 4HXBH 2X6VA 5HGHA 1PZUB 1UOVA 2Z8RA 5CU9A 5J0BA 2JKNA 3U0WL 5HYSA 5KVMC 2O30A 5F0PB 1N59B 1YUHA 5AVWB 3GNMH 3LXCA 2Z1PA 3BSZH 1Z0NA 3HZVA 1XF4B 3NCFB 4PWJA 3VVVA 2DMCA 3HMWH 2F54D 4CU6A 1C7SA 4GRMB 5CP7B 1R0AH 2PPCA 2FJFB 1HH6A 4HUKB 3IE4A 3PP4H 3RWJA 4KHTH 5I6KA 1S9XA 1WZMA 3DV6A 2VR3A 4LO9A 2JJWA 1TQSA 1J8HB 5B39B 1UC6A 2EO1A 5D5MA 2J5WA 1Q0YL 3AS0A 2D31B 2AJVH 5CGBA 4PWKA 2XZAL 4D9RD 1WBZB 1NC2B 1WA2X 2CKBA 3QC6X 4HCFA 3VXME 4RAUA 3E6HA 3HI1A 2BVQB 1GGYA 3LS5L 4Z78B 3VFPB 4GIAA 3F05A 4DN4H 4N0CC 1AKJA 1T7ZA 2NW3A 2L0DA 3ZSTA 5AZEL 4R90H 5ESQA 1OCCB 3BWSA 3KPLB 2OX5A 5CP3H 3SDAC 1IEAB 3L1OH 3W56A 1ZSDA 2XSKA 4M5ZH 3VWKD 4HUUA 4J4PC 1NKOA 3ZDYB 5I0ZA 3MR9A 2D3JA 2JELL 3HNVH 1E9QB 2FGWH 1T89C 3GSWA 3INUH 4DGVL 1FNFA 1JDCA 4LBEA 2V2TA 3KG5A 3VGGA 3MJ7A 2XIIA 2J12B 1DLHB 2ZTBA 2EIEA 3GTVA 3OKMA 3HZKB 4CVZA 2XVKA 1A9VA 3VFWA 3PWLB 1LTXA 2V7NA 4BFNA 2YD9A 1PX3A 4OCRL 3EGDA 3L3GA 1NGZB 1W0VB 5FGCB 3ZKND 3NN8A 1LVEA 2D8KA 5DZLA 3D9AH 4JDEA 1S9WA 2BW5A 3VSQA 3VI3F 1W0YT 4ES9A 5KZCB 1L0YA 2YHGA 5EO1B 1E5AA 2J6EA 3QCTL 4NRXB 5HYJE 1A6UL 1DUZB 1B4TA 2AV7A 4S0TD 2AZAA 4N4YB 2HZHA 4XE5B 4OCRH 4ZUWB 2JTDA 4FHJA 2Z7UA 3GB7B 4WFFE 3WY3A 2DQIL 4Q74A 3RL2B 1IM9D 4HIJA 5LKNA 4X4XB 1N70A 4LK4A 2GITB 5SWSA 4HH9A 3VCLB 3TO2A 2DQGH 4HALA 1ZXKA 5FW8A 5KANG 3ZE1E 1JNLH 5H37G 3WY4A 1JVOA 3QJZA 3UJIH 5JW3H 3BLPX 1LEGA 4G6MH 4DO4A 4K7PL 1ZVYA 1Y6MR 5H94A 4X5WB 3GB7A 2VLMD 3VU2A 4NRYB 4NM4H 3ZLQC 3DMMD 3ML9A 3V0VB 5I5JA 2YPLA 4OCXL 3SOBH 2NXZB 2W88A 4K9EH 5E2WH 2F54A 4MBRA 1Z1WA 1UADC 2PYED 4GKLA 4LHUB 4JUSA 2VDLH 1OO2A 2J56A 3KM2A 3QIWC 1R5VB 5TH2A 4HPHA 2ZJSL 5AW2B 3BFQG 2RR3A 4OD3L 2HXAA 1XSOA 2Y1VA 3S37H 4GG6B 3HC4H 1NAMH 1EK3A 4DGIH 1XCTA 4RWYH 5DUPL 5AYUH 5T3ZL 1MWAA 1YEJH 1Q9OB 4ILDA 4B41A 1U58B 4Q58C 4GKSB 1GOGA 5L6YH 2XV2A 5D7KD 1BHGA 2GJZA 2OTWA 3LNEA 3HUJA 1I3VA 1RZIA 3OKMB 2XCMC 3PWUB 3BDXA 3UP1A 5E8EA 1LO4L 1NBVL 2IGFH 1QFUH 1F1DA 2NYKA 5F9DC 3Q43A 5G4NA 2OS7A 3LQZA 4X5PA 4H8QA 4LRIA 3C5SB 2J73A 4M56A 1J12A 5SX4H 3RTQD 4XCEB 1CGSH 4YDMA 5FLVA 2PYEE 4PPTA 4WSJA 2ZNXA 5IHUH 4P46D 1NSNL 3MV7E 5JXED 1OF2B 3X12A 2R83A 1NGYA 1P69B 4JY5H 1SDAB 2IDFA 1MG2C 2H9GA 5CF3A 2G9KA 4WI3A 4LL1A 3NDZE 3T8MA 1ZT1B 2FJGA 3L7FB 2EECA 2FDBP 2SEBA 4HIQA 4NQED 1Q9LB 2BIQA 1DYZA 2R0KL 1D5ZB 4F37K 4M29A 1FL6B 1Z9PA 1NDTA 4MB4A 1AMYA 3L4VA 1RULH 4HV8A 4NO0B 3QQ3B 5FCUL 1HZKA 3QCVH 2C7FA 2R1WA 4JGUA 2X4NB 2PYFB 3CLEL 3PJSA 5J9PA 2ALWA 1J5OH 3VXRA 3FHEA 5DD0L 1KCUL 1ND0A 4LASH 3UL4A 4AE0A 1E40A 3OF6D 1ZLUK 5AVYB 3PDDA 3WN5C 4BKLB 5IK3A 5E2VL 5L4IA 1TCRA 2EXYC 5EU6B 4HLEA 5CUSL 1C12A 1N59A 1YUHB 2AERT 4XNXH 5C0AA 1CF8L 1PY4A 4KKCD 3V0GA 2GABA 3VWKC 5ANMA 4MDJB 4P2QA 2PETA 1UTDA 4MZ2A 3QI9D 3MRMA 2DLFL 5E6IA 3TEYA 3C75A 4ELMF 2C7UB 3PNWB 1AGCA 3VSVA 5F7DB 3QRGH 3FT4B 1L6XA 5E8NA 2BX5A 5EIIB 5FDYA 1LEKB 1FV1A 4XMLH 5L8LB 4ZAKA 5E2VH 3NVQA 4NQQA 4WI0B 3W2DL 1BFTA 2Z34A 1O7DE 3DK0A 2AV7B 1E2ZA 2Q8BH 3OLDA 5CZXC 4Z7WA 1ACCA 2Q86B 1PMYA 3QEHB 1OIOA 4O4YH 1OF2A 4YOKA 4Y2DD 2QBWA 2YGQA 4L1LA 3KLQA 1YAIA 1QHPA 3FU8A 1N64H 4JO4H 5HDBF 2CGRL 3C5SA 5IM7A 2V7HA 4NKMB 3WGVB 3EGDB 4NUGL 3UTSA 2ZAHA 1DFXA 4DO6A 1GSKA 1KDIA 5INDA 4WWPA 4ZMXA 4TS6A 4PBDA 3JV6B 1S5IL 4I48A 1XGRB 3S8WA 2FX9H 1WHPA 4NO3B 1D2PA 3U1SL 1PIGA 2EDJA 3IDJB 3QEUA 2UYLB 5CSGA 5E4IA 5LGHH 5JQ6L 3B7UX 1QVOB 2XBDA 3TBBA 2WAQA 1FVCA 2ZCLL 5TK4A 3BMWA 4YDIH 3MRPB 2AQ1A 2XWEA 4PGJA 5ETUA 2JQZA 1EEUA 1ID5I 1K6QL 2X1XR 3LZFL 3NCWA 3DBXA 4OIFA 5H35B 4GXFA 1J88A 1CB4A 2XN9E 1OSYA 2A6DB 2GIYA 4M6OL 5I6NA 4KBPA 2WC7A 5KW9H 4I18B 32C2A 3L1FA 3U25A 2TRHA 5BZXA 1SLWA 1VSCA 4HCGA 4IRJB 3VXQB 3DJTA 3WAKA 4I3SL 2YGOA 3S35L 3OJDB 3SPIA 2FUQA 4W6WB 4KK5D 4HWZB 4X7TB 4OGAD 2H2PD 4N0FA 1NJ9B 3QUZA 1TFPA 5IVXE 2DLEA 4NN5C 5EFIB 5I8EB 3HFFA 5EU6D 1JN6B 1OXYA 1U8JA 2EYTB 2H2SD 3BYYA 1SLXA 3N0PB 4BDVB 1KWGA 1RUAH 2R0ZL 1NOLA 2DQHL 2QPDB 1MLCA 1YSOA 2PR9A 3MRIB 4EZJA 1MW2A 1A3QA 4GEJA 3SDAA 1B4JL 1NUFA 2K8QA 5C0RL 3QI9A 5CEYA 3FOLB 3T0BA 3G6AA 2H41A 4PSPA 1BQHB 1IBYA 2Y6TE 4X7DC 3LS4L 2Z91B 1MAKA 4FXTA 2ZCKH 3PHOA 4PVNA 2ODHA 4YDZA 5EZJA 3V0HA 1QWHA 3VJ6A 2FHCA 4ZUVA 3RA7H 4FQHB 1E9PA 4YHIA 2JK5A 4UQ9A 1EJ6A 1MRCH 1WD9A 1RUQL 2A73A 4LQ1A 3S3SA 2O6DA 2Y6SC 2YFOA 3GO1H 3OKEB 3TFKC 2J25A 5I8KH 1CI5A 3CH8A 3WJMA 3TVMB 1JXDA 4PB0L 2ROXA 1DDHA 2HLFC 4HFUL 1CG9B 4ELMA 4O58H 4J8QA 5EMYA 1KXVA 3VNZA 1JGVL 4N2AA 1XDTT 3WKMH 5FFOA 5FA4B 1MCDA 4X4ME 1FFNB 4NPJA 1HSBA 3GJEB 2CA4A 1X7QB 3ZQWA 5EOQH 4KVCH 3HAEB 3KPLA 3QJRB 3NGBB 3BPNB 5AVXB 3TP4A 2B2XH 2GTWA 4M8QA 4NQCB 1XEDA 4PJ9C 2VKWA 3PUCA 2VITB 2CRMA 4D0CA 1ETA1 2EEBA 4WU5B 4B9CA 1QAWA 3V7AG 3U6XS 3QFJE 3VFRB 2EADA 5T3ZE 3IGKA 3MOAL 5HYJA 1K4DA 1SLUA 2V17H 2R1XB 2KZWA 1RZFH 4PGEB 3ELQA 1DCLA 1J1PH 3WIFB 1H6FA 5DYOB 4WUUA 1CTNA 1DEEA 1XO8A 2YD5A 4ACTA 1VGKA 1LQSR 1FZKA 1QFPA 3T3MF 2FTAA 4ISVA 3FN0H 3L4XA 3SYAA 1MEXH 4C56A 5J6HA 1PX4A 1P7QB 1NBZB 4HJJH 4HKBA 1T21A 5BNXD 1BPLB 3JVGC 2VB5A 1DN0B 4KTEH 1XZ0A 4UT7L 1HCVA 1OL0A 2Y9RT 2Z3FA 3RWCB 4I3RL 5IEHA 4JPKL 4ZNEA 5MHSD 3HPLB 4WZ9A 1I9RH 2DIJA 2QSVA 4ZMAT 2Q5BA 5L4FA 4G11A 2EE6A 2V2WA 4LLVA 3FJTA 3QK0A 4GG8A 1SFDA 4AVIA 3HZYA 3WNPA 4X6DF 1RJYA 4LP8A 2IFGA 1HU8A 5IMKB 2WCPA 2OPCA 3AWEA 3I50L 2Q7YB 1FNEB 1I9RL 4ZI8A 2FGZA 3TBSA 1ADQH 4GI6A 1MCQA 3KAAA 3X13A 5JIDA 3O8XB 4EI0A 2VMEA 4OCWL 1YEGL 2CO7A 2A9BA 2XBZA 1S7VA 2B3IA 3MA7A 5EU3A 3LVEA 3KPNB 1AAJA 1YNKH 3O6KL 2HRPH 4P9MH 3V6BR 2X12A 4LLUA 5TPWH 2ARJA 2VDKH 3FTGA 1FNEA 1KBVA 4UZSA 1E4WH 5K9JH 3IYLW 5B8CA 2H2SC 3TOPA 3OMIB 5IEKB 4L2YA 2A4EA 3H54A 1DQML 5EOCH 5C7XH 4KJQC 3VQLA 1TZGH 1U9KA 3KWXA 5E5LA 1J05B 3DI3B 4MA3B 3UAJC 3RVTD 4WO4D 3R8BB 4JR9L 1OAYL 5C71A 4G9FB 4N3TA 1LLAA 1ZGLM 2AJXL 5F9OH 1K8IA 2R69L 2XZCH 5B8CC 2X10A 1E4WL 1FYTE 1YQ2A 3ARED 3GQFA 3KPSA 3UERA 2OR9L 4QRSB 1JPST 2WKOA 3GZKA 3VAEA 3H53A 3JV4B 1IIKA 1X7SA 1A7RL 4PI0A 2PCPB 4LHQB 1KTRL 5F9WC 1T2XA 5LG1A 3F8UB 1N5YH 3NJLA 2ATAA 1N3NB 3MCLL 2YD4A 2HRGA 1OHZA 4BA0A 5B4MD 3QDHA 3I6LD 2AI0L 3S37X 2LVEA 4NKIL 5GGVL 2BOCA 1CLOL 2OKMA 5HYJB 1LYQA 2C3GA 4M5SA 1PKQA 4HXBL 1PG7X 4IYKA 4DJMA 4E9YA 5LB1A 2UWEE 1PJWA 4JFDB 2LAGB 2Z4QA 4WUUD 4JY6A 3OR7B 2ZOLA 5F0LB 3P4LA 2CCVA 3MUGA 4K15A 1A6PA 3ME0A 1JXGA 5J6GA 2VAAB 2C4FU 5I19L 3O2VL 2AQ3A 2FT7A 3OX8B 2Z1KA 4E2OA 1CE1L 4JO1H 2X2JA 1U8CA 1KXQE 4G5ZL 1S2EA 3MJGX 5GRJH 4Y19E 3WD5L 2NY6D 2B8OT 4QHPA 5FOJA 4OJYA 2D7OA 3DX3A 3GBEA 1QZ1A 3OKYA 2CKBH 3MV7D 4AQZA 4GPVA 1QO3B 4QRRD 4XMPH 4QGTA 4IS6B 2ZICA 5CJXA 2MJWA 5AZEH 3QEQB 3TJEL 3QWNA 4KKLC 4J3OH 1NGWA 5GGRA 5I17B 5E95B 4I89A 2PXYB 1TF4A 5F71A 3BAXA 1BMZA 5IMKA 3QQ9C 3NIGF 3KYAA 4JO5A 4ZX5A 4M6OH 5D70L 3QEQA 2E3VA 5G55A 2HH0H 3NFPA 3ZSSA 5AOJA 2WLJA 3B43A 3G6AB 4XMPL 4BZ2L 3MRDA 3F3HA 4XBEH 5DMJB 1UVQB 4Z77A 5LGJB 5GGQH 3KL5A 3FCSB 4F9LA 3HPLA 3A0OA 2P46B 4F2MA 2VW7A 4CJ0A 3FTVA 5F7NC 3WEXB 2HWZL 1WZKA 3UC0L 1XR8A 3KGUA 5ISZD 4N68A 4HT1H 4H0IA 4U4IA 2E8ZA 1UASA 4BCZA 3ETSA 1FZKB 1TYEB 2CPCA 4OJFH 4D9LL 3HPJA 1IILE 5SV4A 3K81A 1MXGA 3O4LB 4FLSA 1TSHA 2NTFB 4F7EA 1S7WA 4ERSL 3MRGA 1FIGL 1MI5D 3S98A 4Z7QE 3F12B 4NJAH 3IFOB 3UX9B 5B22A 2CBQA 2EE2A 2XI9A 4I2XA 1WFNA 1OSZA 2UZIL 1FE8L 3JWOL 3MV8A 5EBMA 2NY4D 5AYTA 4NUJB 1XQ4A 1KYUA 5CJBA 4M8QB 3DHUA 1KN2H 3DX8A 3PIQB 3ATBA 3B9KC 4LFHG 1MJ8H 2RACA 3MUY1 3Q1EA 4UZUA 3QXAB 4U1SA 4YHOL 4K94H 4M4RA 3GRGA 5E23A 3M8OL 3GGWA 4XCFH 4HJ1A 1R3JA 1UEYA 1NBQA 4FF9A 3EFOA 4ZFGH 1VDGA 5B3JE 1EJOH 3VFVB 1JNJA 5HHXH 4K3GA 3GRWA 5MEND 4G6ML 2E6JA 2WINA 3EJUA 5D71H 5KW9L 2DQUL 1BIIB 1U3YA 2P5ED 3JUYA 1KN2L 2ZONA 3EJPA 4DGYH 4FQ1L 2FH8A 3K71B 1QNZL 5FPIA 5CEZL 1NEZA 4CVUA 2KI6A 1XSKA 3O6FC 2WVVB 1A0QH 2P8MB 2VQ1A 4QHUA 3T77A 4XN2A 2O61B 2N7BA 1FL3A 2VERN 2W59A 4KGLA 3Q7JA 4U0QB 1ONQB 5C0FB 4LCIH 5CBAB 5F7UA 3BH4A 1YEDB 1Q72H 3S37L 2KPNA 5IW1A 2WQAA 3KE0A 5AYUL 3QDGA 1YYCA 1S7TB 1FC2D 4JKPL 3SCMD 2E7LA 4PV1C 4WTZA 3D9AL 1SXBA 2MHAA 3VH8B 4GW4A 1G7LA 5D1XB 1E6JH 3LB6C 3WKPA 4WI5A 5KJRH 1I53A 2CHDA 1G1OA 3RUGE 5LQBH 5AW0B 1H8NA 3SHSA 1X5ZA 5FYLD 1F13A 2VLJD 4XVOA 1FSKB 2OMVA 3QRLA 4U4BA 4NZRL 5E2JA 1UXSA 4F1ZA 5D72L 4ZXBC 4ZFFB 3H1ZA 1MCIA 2J21A 1QKZH 1YQVL 2IG2H 4HWZA 2YD8A 5AB2A 3H6AA 4KK5C 2H3XC 4N25A 1MFMA 1A6TA 1NCUA 3C08H 1R24B 4ANWA 1LO5A 2Z0BA 4MNQA 5TDNB 4JB9H 2V3EA 3ECUA 4P46C 1F00I 2CIIA 2F53B 5IB3B 1DN0A 1YMME 4G8EB 2MOGA 4HHAB 3T8XB 2AEOA 3VGAC 2BVEA 5D96B 5CEXA 3BH9A 3FQ4A 4OFKA 5LLIC 4J8RA 1XMEB 2YAOA 4PJDB 2C1PA 1WWCA 2EDKA 3Q5OA 3CFIC 3L95A 3N43B 2AEPL 1QRNB 1WJ3A 1UYWL 2VXQA 4ONGH 1U3HA 1ZVHA 4ODVL 4UCFA 2X4NA 4UT6L 4WHYH 5FYJU 3CZJA 5KVGH 2HJKB 4PVLA 4HV8B 2V5YA 4X9GA 1YEKH 2R15A 4LLYB 4MHHI 4WW2A 5EU4A 4A6YA 1E27B 4HH8A 4Z3TA 5IT2L 1ODUA 4DW2H 3RFZA 5HDOA 4JM4L 2CM6A 4OTXL 1LO3H 4RAVB 5DS2A 3ULUE 2F74B 2OXHB 1FG9C 2R56H 4QXVA 3HAEA 1XCWA 4WRLA 4XX1G 5F96L 3VD2A 4MZRA 2X1QA 4TSCH 5HJBA 4W9LC 1GOFA 2YD7A 3CZFA 4NHUB 1CFTA 12E8L 1H3WM 1CICD 1ZTXH 2GK0B 3T1WA 4AEIL 1AQDB 4FZEH 4FXGB 1ILSA 1CG9A 1BG1A 2Q86A 2G0KA 1L7TL 4YZFE 3NRPA 4AXWB 2K6YA 3AY4C 3Q05A 1YEEH 4F2ME 4JPSA 2E7HA 1KTDB 3JZYA 2A7BA 3HNTH 4DVRH 5ALCL 3PWJA 1CGVA 2WQWA 5IBLC 2YKLL 1SDDB 4KKAD 3DPBB 1ORQB 3AUWB 2G5UA 5AW1B 3ILEA 3BPCA 4H1LG 1BM7A 1U8KA 3HZ3A 5DJAB 1BA9A 1WD8A 4L8BB 4EE2A 5AVSB 4Z0BH 4M1DH 1B3JA 3DV4B 4KO5A 2VMDA 5ESVB 4EUPA 5DI8A 2DQFB 4S2SB 3U9PH 2ROYA 2FUTA 5D2LB 1EHLH 2LU7A 5I71B 3LIZL 5CEXB 2GBVA 3ZKNC 4BFOA 4LHJB 1CDYA 3SGDH 1ADWA 4LDEB 5IB2A 4IBLT 2OQJB 3UPCA 1JDDA 4PG2C 3K3QA 4NSKA 1CD9B 1G5GA 3AB0C 1HH9A 2J7LA 5DUML 4ZD3L 3ZZSA 1MRDL 2X4RB 2ZG3A 4LZKA 4MMXB 1I82A 4MS8D 4QXTB 2PWEA 5L8KB 3FUIA 3GK8H 2EDDA 1RHHA 4HWBA 4PJFA 5DS8B 1BEYH 1DQMH 5EOCL 4WVRA 4AIZA 3U6RB 2DLIA 3I9PA 4PH8A 4LQFL 4LGRB 5GGSY 2A9DA 5AD0A 4G82A 1SEBA 2J57A 2Y7LA 3P4OA 3BZ4B 4HX1A 3TO4D 3HG1A 3VG0L 1K5NA 3BJ91 2OMUA 4EZMA 5T1LA 4ZUTB 1RJLA 1EZVY 2MHAB 4JFXB 4MFHA 4X9FA 3VH8A 5H35A 4QO1B 3VGHA 4I85A 4U3CA 3D39A 1JGLL 1JSYA 1MQKH 1KTCA 3AWFA 4NZTH 3DMMB 4MRCA 4B95C 3L4YA 4PHZA 4Y8AA 5AAWC 3HS0C 2AK4A 4XMKH 5KYYA 5AAMC 2Y23A 1RIVH 3IDYB 2EZ0D 4PREA 5I24A 2FK9A 2J88H 4LGSB 4XP9L 5T5FA 4Q14A 2ZXCA 4IBZA 4XVTL 4U6YA 3C6LB 5ACZA 4WJG3 1PQZA 4ENED 3BESR 2IDTA 2VISB 2XV0A 4PJBB 5DJXB 5TGBA 5L7XH 3LH2L 5D1XD 3MMEA 5SWZD 4ZUSA 5MEQB 2R23B 5A6MA 2QLVB 5CD3B 1EVTC 1JCKA 4YQXH 3BISA 4MKMA 3Q6FA 3REWA 3KBFA 5GQBA 5CGYD 2D3NA 3BP7B 3BH8A 2DD8H 5FB8B 4S1RH 3WFBH 1M2VB 3D85B 1S7QB 3CCHA 3EYFB 1WPCA 5F8QC 1E9QA 1M3IA 4B5EA 1RURL 4A2FA 4ODXA 4J23A 5E4OA 4BUHA 3D3VB 4G42A 4XBPA 1XH3A 2C9PA 4U1IA 1RUQH 4HFUH 3RL1B 3U7WH 5IW6A 3BSZL 3D2UB 1QFHA 4LHUD 4TL5A 4X5RA 1QLEL 3U0WH 4AMXA 1VGEL 2I24N 2GK2A 4ZAKD 2XG4A 3C5XA 1TVHB 3HN3A 1XXDC 1FV1B 5H94B 3QWQB 3QQDB 5DMIL 5JMOC 1AGCB 2WOYA 4K94L 1QTYT 4XRCB 2XX0A 2OM5A 3QHZH 2AITA 1CICC 2BFVL 4H0HB 5CJXC 1CBVL 1HYSD 3V6FA 2Q8AH 1U21A 3FQRB 1VEMA 3HI6H 1UFGA 2HX8A 2KZ1B 2ZXGA 2NYYD 4PHXA 1K8DB 5H4YA 2XZZA 1C16A 4PN6A 2DI8A 3FUNA 2HKFH 5DVLA 2CJ3A 3FCSA 2AXJA 3CBKB 3EYVB 4RDQG 3FF7A 4X6DB 4C4UA 3MRDB 2JB5L 4CKQA 3BPNC 4KX9A 3W39A 2P80D 3FSAA 1W91A 1MDTA 2DKUA 4HT1L 4H26A 2GFBB 4P04A 5DC0A 3V79C 1RZ7L 2EIDA 3ARFC 1AQKH 2Z31B 2E56A 3L7FA 3WU1A 4GBXD 1AXTL 1V8HA 1UZ8A 2OK0H 4G6FB 2JKTM 1ZLVK 2H9GB 3CQFA 2BVYA 2H3NB 4YNYA 4XO5A 1LP9F 2V5MA 4AQ1C 4HOXA 5E9DA 3DVIA 3MLZL 1FGNH 3FRUB 4TQEL 2W60A 4XOCA 2X05A 4U1LA 3ARZA 3CC5A 4HW6A 3MV9D 3QG6A 4EKXA 3KCWA 1RK0B 3B7RL 1MFCL 2E4TA 4P2RD 4XCEA 4R97B 3T71A 4DKTA 2JTYA 4JFPA 2BSCA 2EDEA 3MKGA 4X6BB 1AZUA 3TA3D 5DHDA 3MGAA 2WP3T 4AUYA 3C5JA 3F7VA 3LKSA 3WEAA 4AGMA 5JA8B 4XCFL 4KOBA 1MVUB 3FQXA 3PWUA 3ES6B 4XP5H 4AYFB 1U8PB 3C5ZC 1WICA 4GAYA 4Z78A 3M1BB 5CZVH 1IX2A 1RUPH 3GDCA 4DAGH 1BJ8A 2UWEA 5GGRY 3SSGA 2VLRD 1E5ZA 5B7FA 3BZFB 2MQCA 4WTXA 2ADGB 1J8HA 3CX2A 5B39A 3C60D 3SCMC 5JW3L 4QAWA 3KXFB 5JYMA 3W81A 4DK5A 5LNGA 2DQGL 4U33A 2JQMA 2YJQA 1CF1A 4XNMB 1T2QL 2J71A 4Y4KD 3VDCA 1TZGL 4TF4A 4QTHA 1LWHA 2JMRA 3ABMB 3TBWA 2JIXD 3AG1B 3LEVL 1SMDA 1BWMA 5DO2D 1UB5A 2Q7NA 5CZKA 5EUOF 3TEUA 2QQLL 4ODUB 4BQBA 3DX1A 3S3CB 5D9SB 3RJDA 3E9UA 1BMWA 4WKZB 1GYWA 1PFOA 3GSNH 3HZMA 2Z31D 3RY5A 4HKZA 1CLYH 5GJSL 4JFUA 1HTYA 1SXNA 1K8IB 1DSWA 4J3VA 2WLIB 3NYKA 1FJ1A 4J3UA 1N0XH 4G9FA 4JG5A 4B3EA 2CUAA 4IIQA 5FWRA 3EYVA 4F24A 1KBBA 2H2PC 1UXSB 2V9TA 1EO8H 4M62L 1OZUA 2GJ6B 5J06A 1BVZA 3ALWA 3DTXA 2QDVA 4DGIL 3ZR5A 1RZ8A 5HI3D 4EUPG 4OLZL 4UAOB 4NKIH 5GGVH 3WY1A 2EVIA 4Z5RA 2PWFA 3SJVD 3Q8EA 3VUAA 1P4LA 3VXPA 1WFMA 1HVXA 4PMFA 5JOFA 4JQVA 4KITB 4HIIA 5LGYA 1GVIA 4F7CB 3K6NA 5I1CL 1UWEH 2VZ1A 4IOSD 3RLSA 2AQTA 3KEDA 2WQUA 5E9NA 4WU7B 4ZQTA 4HKXA 4E41B 4G80B 4G9FE 2ADJA 1OPOA 1XGTA 1KXTA 1WQVT 3K4DA 4L1DA 3VFWB 2J8UB 2ZUUA 2QQKL 1UD4A 1QQDA 4GY4A 5KVEH 1DJSA 3QNYA 5B21A 3Q8FA 3EOAB 3RKDC 2B08A 1RJCA 3EOTH 2V2XA 3O6LH 3P73B 1CXEA 3D0LA 3GSXA 2CKNA 3TIDA 4AYID 4BUGA 4PWGA 5LWYL 2ZSVB 3AGWA 1IKFL 3SDDA 2XWRA 3WNIA 5BRZE 3I50H 2NNAB 4K7FB 5EZOH 2IF7A 4OZGF 1QFWL 3BQUA 2W94A 5KEZA 2WXGA 3Q1SH 1QHQA 5D1XE 4Q2ZA 5BZWB 3PCYA 2DQMA 1TTRA 4K3DL 3SDCB 3WV0A 2NW3B 4MVBD 4AQ8A 3C8HA 4F9PA 1LWJA 2BVQA 2MKWA 2O6FA 2R9HC 5FW7A 5IHBA 2G9HA 2J8UE 1N12A 3D4ZA 2FX7H 3B3IA 3GUFA 1JFHA 2BZCA 1RK7A 1XCXA 1CF8H 4ADIA 2ZPKL 4C8XA 4QT5B 2NX5E 4AQAB 1ZPUA 4JAMA 2NY2C 2VZTA 4RSVA 3FQUA 5FF6B 1F4YL 5FM5M 5AYQA 4FJYA 1AJ7L 5T3XE 2CNZA 1EIBA 4HCRA 3BPLC 3QI9C 5B7EA 2VMFA 3C8KA 3MRJB 2HFFA 4E9RA 2UWEF 1FFOA 5DT1L 5HJGA 3VSUA 4RQQB 5K1NA 5L7XL 4PBXA 2EDHA 2Y2TA 2OMWB 2WXQA 2AXHA 2YRLA 1PIFA 4PW3A 3SDDB 5HGHB 4QNPE 5DD5L 1CD8A 1VJSA 4XXWA 2P8PB 3LKPB 1G7JB 4P2RB 2YC1A 2ITCB 2DIAA 4O4YL 4QRBA 5DRZB 5ICUA 1MJJB 3CSYA 4ELMB 3UFIA 3HG1E 5DJ8B 4WQOA 4Z7VB 5EC2A 5HJ3B 1H3PL 3GXMA 4PJ5A 3QNYB 4XI5C 3WJMB 4NOBA 2B77A 2BP8B 3V4VA 2VXVL 4PD4J 5C0DB 2AI0H 3QZOA 5HHPA 1HJBC 3DETC 3MNZB 1J1XH 4FXKC 3L4WA 3BZEB 1BXXA 4FQHA 2X4QA 1G1KA 3CPUA 2QJDA 3OSKA 4Z3EA 4A2LA 5D2LA 1I3UA 1U8LB 4FERA 3WNKA 3VACA 4EUPB 4EIBA 5F7AA 1IEBB 5FM5O 4EOWL 3LZPA 1NAMA 5AOLA 1RFDL 1BAGA 2KERA 3OKOB 6TAAA 5F0MB 2R0LL 3BPCB 4R7LA 2B20A 2ARJQ 3S36H 3GLAA 3M17B 3BSGA 3CSTA 2V33A 2IH9A 3HE7D 5AKRA 2VLKD 1URIA 3EOYG 2BHUA 3WKML 3QPQD 4YR6A 2FGWL 1CIDA 1HYSC 4EOWH 5ILTL 4JY6B 5EU6E 1NMAH 3KJ4C 4J3TA 4PRNA 2RGSA 3E38A 3OL2A 3QDJB 4AM0B 1AGEB 4WI7A 1FH5H 4Q4IA 4ZNCD 3WIIL 2WJ7A 1Q0XH 4ZOBA 5D7EA 1EAPB 2N1KA 4WKZA 3HHRB 4CBZA 3GJFB 4Z7OF 1BP3B 1BZ7A 1WP6A 4GFTB 3VXUA 3CV5A 4QWWC 4UNIA 3H55A 1DQVA 4J6IA 2AEIT 2DYSB 3GMPA 3RNQB 4EDXB 3LRMA 3VE0A 2YD6A 4W93A 1EH9A 1FE8H 1RZFL 1UT1A 2Z92B 1AE6H 1FVCB 2HUEA 3VTMA 1RLBA 2JLPA 3SJVB 4A2MA 1UD5A 4LLYA 2GUOB 1JRHL 4NQEA 3KPSB 1HFUA 3V6OA 4PRHE 4GXVH 4H44C 5JO5B 1D5IH 2X70A 2RD0A 1CYXA 3C5ZD 5INCB 5DXWA 4JFTA 1CFVH 2UUDK 3BP4A 4WW2F 3C6EA 1KTLB 4K71C 1MFDL 3Q3GB 5CD3A 3ULUH 1HHHA 4NC0B 4GXUN 3VXRD 3QWOB 2FR4A 1BFOA 1TZOA 1Y0LB 2R4SH 4JHAL 4F93B 3NIDB 3GO1L 3EGXA 5DVMA 3IJ9A 3HKFA 1MRCL 2QKIA 2M83A 4GAFB 4CSZA 3I02B 4OI8A 3KS0J 4YJZL 1FBIH 3Q2CA 5C0AE 1V27A 3MA7B 4LSTL 5LBSA 5KVFL 5JNYB 2LFGA 4LIQL 4Y5XC 3P9MB 2MEJB 1VCBC 5GZNC 1JVKA 2YZ1A 1EEZB 1GGCH 4ZG1A 5F3HB 1FFQA 5D5ME 2HKFL 4FFTA 4BJLA 1WFUA 4M7JL 2Q7YA 1EZVX 2N4IA 5CP3A 4BK5A 3D85D 1CVSC 3MBWB 3P4MB 2LE9A 4J5VA 4YLQT 3LRKA 1JGEB 5J1AA 1PCSA 3LEVH 3U6RA 4AIZB 3HVNA 4PJ8D 2BNRB 1Q94B 4TSCL 5EG6C 5EO0B 3H7BB 1SQ2N 2OI9B 2F8VA 4B9YA 3TASA 3MNWB 4L9LA 5D7IB 3TA3C 3MO1B 5ITFB 4LCVA 4RFEA 2N0KA 3VFSB 3ZHNA 1DSFH 5IOKA 2Q6WA 4ZBJA 2ZX8A 4NGHL 1R3IL 1UGKA 4UINL 3LVTA 4B9IA 1JPGB 1OTUD 1UZ6F 5E6RB 2EC8A 2BXYA 3A67H 4TVUA 3BKYH 2AJZA 5ESVA 4FQLH 1KGJA 4BKSC 4FG6D 3MVSA 3EOBA 3DSFH 1MVYA 5D1XC 8FABB 4EVNA 4YK4B 4N2FA 3NUKA 1MH5A 2YLHA 3EH4B 4FJZA 4R7DB 1YLBB 3EJRA 3N9GH 1L3NA 2I27N 1KCSL 2PW1A 3TPUB 2IMMA 3P3TA 2D0FA 3IAPA 1UEMA 2Y7NA 2YBRB 3NCYP 4YIQB 3MRBA 1LDPH 3RWHB 1R33A 1IGIL 3UTTD 2GTWB 4NQCA 2EAEA 3BKCH 1AO7D 4CMHC 1PLGH 3S4SB 2C4XA 4LLDB 4W9FC 2K45A 3QIWA 5F72S 4PGCA 4LIQE 1X44A 3VTTA 4JNXA 2LU5A 4JZOA 4UNTA 4L8CB 3PY9A 3DA0A 4IRSB 1LE5A 4F7EB 4V33A 3APCA 4N2DA 5GXBB 3WJJA 3O6LL 1MFAL 4JO2H 5F96H 5IOPA 3NFSL 3I9GL 2CXGA 5C0AD 4FRWA 1UUSA 4KDWA 3L3HB 3L8QA 1T0NB 3HC3L 2ZF8A 3RY6A 4F7MB 3U79A 4DK3A 3TF7C 4ALAH 3TIEA 2D7NA 3MMEB 4HP5A 3RZCD 3IGAA 3LZOA 3BQVA 2FJHB 1CE6A 3VFOB 3IFPA 1CDIA 2GG1A 2OXGA 2P5EB 3BI9X 4XVSL 1VZGA 1G6RL 1I8AA 2IAMA 1FCGA 3BVWA 4J3OG 4JG0L 5F7FA 5F89B 2BM3A 3D0VA 1R46A 3T4YA 5CEYB 1N67A 2X89A 5I1HL 1JI1A 3DUHA 3HNSL 1M42A 3ULVD 1O7DC 2O5XH 2XA3A 4LASL 4RETB 4LHUA 1TTGA 3IXTB 4AJVA 2ZT9C 3IMTA 3PP3H 4P5TD 2FEEI 3HB3D 3RILA 4HX1B 2EYTA 2R39A 1SVCP 2NQ3A 3MRCB 2NY2D 3ULUC 2HVKB 4Q97A 2ZOTA 3F6IA 4BQ8A 1W6WA 1KJVB 1UJTA 4TUUA 5I30L 1A2YB 2CBOA 1B2WL 3HNSH 4N1CA 1ZV2A 3ISYA 5JHLA 4LEBA 5D7LB 3QRGL 3EYOA 4YXLH 2FJUB 1AD9B 2HJLB 1F3DH 1T1YA 1IBDA 4I18A 2YPVH 1QWUA 4XNUH 1XR9A 2DM4A 1XF1A 2Y06H 1HQ4A 2P9RA 4JFYA 4WFFD 3U82B 3VI3E 1HL9A 2V9RA 2VZUA 3IXAB 4NNXB 4H4NA 3Q3GA 1S7UA 5HHOB 3GIVA 2G4EA 3O3UN 4OLXL 3NACH 1EUUA 3EDFA 4IKJA 4WFGD 1M1XA 4P3DB 3QUMH 5A7EA 1H6EA 2H6UA 1KV3A 2IH1B 3B2DC 6PAZA 4UT9A 3ZL4H 3W5MA 3JWNG 2P5WB 5DRWA 3T77B 3BD3A 3AB0B 1HILB 3EO0A 4LSSL 5D2NA 3UZEC 1A02N 2CKBL 4WENB 4G43B 3VRJB 3P9LA 4MMYB 5CGMA 4ECNA 5D7LE 1KY7A 4GP4B 5E0QA 3BOVA 3TONA 4Y2NA 5C97A 2ED8A 4AOFA 3OB0H 4FEMA 4FNTA 2V9QA 1WHOA 5A6IA 1ZT4B 4XPAH 3FU9A 4TN9A 4UIKL 2V2TB 1UD3A 3TH3T 1IBHA 4LQFH 2NXYB 3W1ZA 4HIHB 4LVNB 1MXDA 4NDMB 3VI3A 3OKNB 1D3CA 1KIPA 4N2GA 1L5GB 4TOYH 4HUNB 4R2GB 1CL7L 4DPAX 5CBEB 3ZKMD 4N26A 3MBEA 4QF1B 1OP5H 3ILQD 3FO2B 5JLZB 4JFQB 5CJOH 2HJFA 3PV6A 1X9UA 4L3FA 3K2KA 5TJWK 1S7SA 4UUJA 2LABA 4F33A 5F9JB 3BGAA 3FFCE 3P4NA 1MFBH 2ICWJ 1ZKAA 4YFLI 2WMPA 2CDGB 4PJXE 3ARFB 2GJJA 2Z31C 3WELA 4DKAA 4FN0A 4X0KA 4Z3IA 2P5EE 3X11B 4PRPB 4YAQA 1A9EB 4ADJA 3AQYA 3FTYA 4NYLB 4M8VA 1U30A 3VXNA 1FZMA 2BC4B 3QXUA 4P2QB 3FT3B 3MJ9H 1UHVA 2KKQA 5ADOH 3DJZA 3BE1L 3IJEA 4E9VA 3JWOH 1YEWA 3BH9B 3MNZA 3FOMA 2CU9A 5TDOB 4ZMZA 5IB3A 3HG2A 4FQIL 1WA1X 3LHPL 1IC0A 2BP8A 1BV8A 3UGXA 1SFHA 5DJ8A 4GG8B 4PP1C 4Q89A 2D7PA 1R24A 3ABZA 4MMZB 5E99L 4AJ0A 4XPHH 4U49A 2CGZA 4R9HA 5EO0A 4LKXB 2X41A 3NFPB 2Q0ZX 1TQBB 1X7TA 4I0PB 4LL9A 43C9A 1YJDL 5IG7A 5D93B 2K3TA 2OMWA 3IJHA 2ETWA 2W91A 5BZZA 3NEOA 3P4MA 4W81A 3ZT7A 1KBPA 3LHPH 4MAYC 2CJUH 3NABH 4H5SB 2GI7A 2A9MH 3C9NB 3FT3A 5F70A 4KKLD 1DBJL 4PCSA 1KG0A 3B2PA 2AJUL 3GSOB 4PJFF 4PTUB 5BRZA 3L9BA 3BVUA 4PV8A 3PV7A 1WGVA 3P11L 2IADB 4C56D 3AREB 7CGTA 3B2UC 2X9ZA 4IQHA 4RZKA 3HJ0A 1A1NB 2FD6H 4KQ3L 2NY6B 1QSFE 2KBGA 3B6SA 3EYSH 4KFMA 3LN4B 4HJTA 3S9DB 4OUUB 3M1OA 1PKQE 4F8NA 3IVKA 2CNYA 4FHBD 4X5XB 3UG5A 2VAAA 1NOAA 1RK1A 3FO2A 5JLZA 2HG5A 2Z93B 3KDMB 12E8H 2WYZA 4PAZA 5AUMB 3T2LA 1R6VA 4NZRH 4QHMB 3QYMA 3FZUD 2DRUA 5FO8A 1KXQA 4BH7A 4HXAH 4LDLB 1FFNA 4S0SD 5CINH 1UZGA 2X4TA 4KJWD 4AQ1B 3FT0A 4N6QA 2OMZB 2EH7L 4WGKA 4U1SB 4OZGA 3R7RA 2XXCB 2QGCA 2M26A 3BPOB 5EC1A 3IPFA 3RNQA 4JLRA 2NY1D 4Y19D 4PJAA 1SJXA 1G5AA 3O45A 4Z3HA 4PJDE 4YGVA 1TU2B 1TJGL 3AGVA 3KR3L 2YAHA 4HXAL 4PGDB 3SBWC 1F4WH 2IXQA 4RLDA 5IIEB 4ODVH 3OWEA 5DJZB 4PR5B 2QQLH 2OJZH 3AXHA 3VG9C 4QRRB 1FVEA 4RESB 4FQXD 1D9KC 1YMHB 3L7EB 3OXRA 2JKJA 2VLRE 4R83A 4DW2L 4H8HA 1IM3B 3MTRA 3ZO9A 5K9QG 1K4CB 3W5NA 3MROB 3CFDA 2A74B 5SWSE 1ZD6A 3ILPA 3BT2H 4P2OA 3RGVA 3SQBB 4CDHA 5IWLC 1MHHB 5J1SC 1DUZA 3EYQC 1QSEB 3CXFA 4FFYH 5IUSA 4QXWA 5AW7B 4DT2A 2GBTA 5EU3B 4YXHH 3ZZ1A 3NGBC 4FFVC 5LN4A 3G5XB 4D0DB 5ICYB 5DHEA 2ZAGA 3LN5B 1DLFL 4G6FD 3PLYA 1CXHA 3IE9A 5IQOA 4KROD 4N1HB 4Y16C 2UX7A 5LJYH 1H6UA 3KPMB 1ETJA 1XVSA 2JKRM 5D9SA 4IRJD 1F45A 1N4XL 1OGAD 1WRFA 4CMMA 2EUZA 4OCSL 4PJHA 5FA3B 4A2EA 2AQ2A 5AOMA 3J2PA 1BVLB 3AAZA 4OZFA 2YAPA 3OMNB 5GRVK 3D25A 3Q01A 2AFNA 1UXWA 3PYCA 1ANUA 1EUTA 4P4KC 5ICXB 3ZRFC 1EO8L 1L4IA 1NCBH 5A40E 1KXHA 3X3FL 1AVAA 1Q1JL 1QVOA 4N22A 3LYRA 4ZJ9A 3U2IA 3T65A 2IV9A 2CBMA 1B90A 2ENYA 4XH2B 5DC9B 3FKUS 1XZ0B 2GT9A 3RWCA 5EV7A 3GS4A 5KAQG 2GIXA 1D9KA 4OF7A 5CCGE 3IMRA 3N1GC 4I48B 2D7TL 4Y4FD 2RH0A 3FUJA 5IB4B 2ZKWA 1U3JA 3V0WH 2WIMA 5D4HA 1U6AL 5INDB 5DD6B 1N5YL 3G9AB 4A6YL 4N90E 2IEPA 3SGDI 4EN3C 4HWNA 4LPXA 1WEJL 5IOPB 3PGDA 2QPSA 4Z76A 5DZNA 3ESMA 1CYWA 3EF4A 4N8CL 2MCPL 1XIWB 1CGWA 1P1ZB 3VSTA 2BWDA 5F88A 5B38B 4QRAA 1N18A 4PV8B 1EXUB 1KNOA 5IMMB 1RZKH 4KO9A 1WC7B 2AZUA 1SUJA 3MRQA 2ORBL 4GRWE 2FJFA 4XB3A 2PABA 4HK3J 1BQKA 4PRPE 1DQIA 5AL8A 4NCC1 1AKJD 1G0XA 3C87A 4LGPB 3NQKA 3CN4A 1H3XA 4PRHB 1MOEA 4R7VA 5GSVB 3AM8C 1KJ2H 4AQEA 3TPUA 3V0EA 2BY2A 3R18A 4HJ0D 5H37A 4CSTA 5E8NB 1YYLL 2WY3B 1MCOH 1DVFB 3ASWA 4BFFA 4IMKC 1CBVH 4ZQKA 3F83A 4PGZA 2NSMA 3RIFF 4Z7QB 2YXFA 4YFDB 4FQXA 1BVKA 3PABA 1Z9MA 1OWWA 2W9LA 4XNYH 2CLVB 4CC4C 1K8DA 3B2VL 3EGSB 1OAXH 2DQJL 4WFED 1ZJBA 4R4BB 4YHIB 3APDA 4BKLA 4D9LH 3H6JA 5BPPA 3NBNA 1MCOL 4MJIE 4QEGA 4NZUH 5DSCB 2XWBB 4GMSH 2W0LA 1FRGL 1PNCA 5DRNB 3DX9A 2OP4L 4BFJA 2YN3A 3IS0X 3C60B 1SHMA 4XBEL 1CFQA 3R1GL 3QCUH 5HI3C 2PW2A 4QRFA 1QTSA 3FU6A 3T4AA 3K8LA 5JHDD 3NCMA 3LTVA 4LSQL 4O51B 3RKPA 4B9GA 4Z1PA 5L9DL 2ZWKA 43CAA 3DVGA 4Z7WE 5K33A 4PLOB 1U8JB 4BDVA 5JW5B 2E76C 4HWBL 4LL4A 5L2JA 4F80A 3TZVB 3IDIB 1QG3A 3BIAX 4ZOAA 1BXUA 4XBPB 3O0LA 5B3NA 2YO3A 1T7YA 3SGEH 4AIOA 2YBGA 3ARUA 2WP3O 2VN7A 1ECZA 3F84A 4FXKB 5DD1L 1S7QA 3CCHB 4YEFA 4LSQH 4G5AA 3AXLA 5D1QB 4HJEA 2BFVH 2HLEB 3CZSA 3L3DA 5CWSA 5J89A 2CCWA 5HGBA 1Q9KB 4NENB 1QWNA 3BVTA 1IJNA 1ZTXE 5JPNB 4N2KA 2R23A 4UMGA 1I31A 1MCWW 2EIZA 4FJ6A 3QNXB 4MXWL 2VISA 1U58A 3HW7A 3SOBL 1JUFB 5GGSA 3QZMA 2BP3A 3EG9B 2WYHA 3HEIB 4PREB 4IW4C 1QBML 4K5PA 4XVJL 2DYPD 4OJAA 3FUKA 1JZ6A 2JB6B 1A3LH 3DDGA 3B8SA 4XN5A 3UCRA 4G9DB 3BWUC 5MERA 5FV2A 2I9TB 2JB5H 4KXZH 3JV6A 2F5AH 3ZDZB 5D2LE 5ILTH 4FQ1H 3HE7B 1KYFA 1W80A 1SOXA 3GXNA 2APFA 3FSZA 3A6BH 2YWZA 5M7QA 1A4JA 4W6YB 5HYSG 3U0TA 4P5KB 1EGJH 2WCGA 5IF0B 1OD7A 4W9KC 5KBNC 2X3AA 1L9TA 4NKMA 1JWSA 1JYNA 2ICCA 3KWWB 2OCCB 5ALCH 1RJZA 2X2HA 1X4XA 5SX4I 3FB6A 2X0VA 3SPGA 3LEXA 3NIGE 3ALXA 2MQ3A 2GPZA 4HIJB 5CINL 1TZHA 3QISA 3K1DA 3LKOB 3CHQA 3CHPA 4N0UA 4ENEC 2WVUA 1OAZL 1WBXB 2XIBA 3APFA 1E9PB 4FYQA 1GGCL 2H1PL 4N2HA 4P0DA 4TNWK 4U1KB 4A63A 2YD1A 2DY2A 2F61A 3BDBA 4CN1A 4N20A 3QZWG 3TT3L 4PD4K 2RCSL 3CNKA 2YD3A 3W39B 2CLZB 1XF3B 3P2TA 1AR2A 3B9KB 5FYKU 3H2WA 3IWVA 4I18C 5DJAA 2BCKA 3ZUCA 1MFNA 2CXKA 2NYYC 1SJEA 3MCG1 3QRFM 1DUYB 5DEFB 3F7QA 4AWJC 5AFAA 4XP4L 3PWPB 3X14B 2PCFA 4WWNA 4AG4L 1JZHA 2P49B 2PWDA 1CE6B 4RIRA 1AI1H 5DFTA 3NIGB 1SJHA 2RTTA 4K3JH 3SJVE 3ETTA 2R2CA 2ZCZA 3N1PC 4K5LA 3P11H 5CD5C 4ZO9A 5IVZA 4JN2A 4Y5XB 5GZOA 1EJFA 4FLHA 3UZVB 5IV2B 5GGUB 3O2DH 4AMWA 4X8JA 5CFAA 3IN0A 1AQDA 2L7EA 4HOZA 5I73B 5I82A 4V2CB 2R2EB 4YXKH 2DS4A 5HBBA 5JDSB 4WV1A 1H5BC 1J11A 4RRPA 1FL6A 4AL8L 2XWTA 4QD2E 1TUPA 1AG6A 1T0OA 1NDMA 5DO8A 3WDJA 5DMYA 2WVSA 3UH8A 3ZHDA 2YARA 2QSTA 4O02B 4J3BA 5A2AA 2J1XA 4UANA 4HSAC 3BUDA 5I75B 1NEPA 1I8IB 4PS4H 1A7OH 2CRZA 1ACZA 2J8HA 4YIQA 2F68X 3UAEA 4Z9KB 5M94B 1NSNH 2QHRH 1PLAA 5E03A 4A39A 1HXMA 2JQAA 4WW2B 1UURA 5EU4B 3VFGH 1MREH 5T33L 4GI8A 1KFAH 4IGBB 1J86A 3D85A 4W9EC 2DYPA 1OCZB 3U30C 2Z65C 5D5MB 2CM5A 3MPCA 4RNRA 3TN0B 3QFDB 5IBLD 4HGMA 2ADIB 4N8VA 1U3HB 4PJ8A 5GGUA 5KSBE 5E8EB 4YSCA 2IBBA 3M07A 1YNTF 1L7IH 4LBAA 3FRPA 2GJZB 2OTWB 4GRMA 4KTDL 2BWQA 1FN4A 2NW2A 3ULVH 4PLNC 3HZVB 2R8SL 4NM8L 2K4AA 4WI8A 2CIIB 2F53A 3OMZA 1CLOH 4RFEB 5IM7B 4AYMC 2WBJA 2WBWB 4OT1H 3VRLF 1T5XB 1GPOL 3KDPB 3MNWA 4L9LB 2XJKA 2VDKB 3TO4A 4PJ9B 3TJPA 3VFUA 2XYBA 4FQ2L 1BM3H 5TH2B 3EOAA 3ROLA 1SLVA 3CFJA 3LIUA 4P2RE 5HPMB 1TPXC 2BNRD 2BS71 4L37A 1DJXA 3HI5L 4J7RA 2NNFA 4OSUL 2QVMA 4WHYG 3D87B 2N01B 3KEHA 4LOEA 3VFTB 4FYTA 1J5CA 4G6JH 1VENA 5ESAB 4JM2D 4LMQE 4UIKH 3ROLB 5K9QI 1BQRA 3ZJAA 4WHDA 3X3GL 3M7FB 1AO7A 1MF2L 2C3XA 1ACYL 2BMKB 1OPGL 2IALA 2P28B 3BVXA 2OL3B 3O6FB 4WK0B 5DRNA 5SWZA 3IWUA 3LKNB 1N8ZA 3EYUL 2KUTA 5C0AB 1D6EB 5C09A 1MZYA 2K6WA 2YAMA 3HHSA 5C0CB 4AH2B 2WO4A 2FL5B 4HG4J 3GZPA 1EFQA 1A9BB 3W0WA 4U1GB 1E7VA 4I0KA 2YN5A 3T6ZA 4RA3A 5DT1H 1VZIA 3ABLB 1WA0X 1IC1A 1VPOH 1ACYH 4KAQH 2WQXA 1SBSH 2BNUB 3FONB 2WVTA 4M1CD 5C9JB 4MJ4A 1IAII 3TCXA 2XFXA 1SM3H 4PB9H 1D5ZA 2DEWX 1BGXH 2YUZA 3SDXE 3UC0H 5GS0H 4J39A 4ANVA 4OFYD 4LAQH 2Z92A 4MJHA 4TUOA 2VAJA 5GZNA 3PWJB 5C0IB 1DZ0A 4D3CL 3ZE2B 2AV1B 5KBDA 4K7PY 4QTHB 1X6LA 2MCAA 2AXGA 3HRZA 2PO6D 5AB9A 7PAZA 3S34H 4XOBA 4NRZB 4YGAB 2YQ3A 4HC1H 2VL5B 4ZSOA 2DD8L 1M7UA 2V6HA 4XNDA 1GZHC 3OJMB 1M9SA 4M5ZL 3IJSB 1Y6KR 3UZQA 2PTTB 4FTVD 3NSDA 3FYIB 3FUMA 1JBJA 1PEZA 4YHPA 2N3JA 4HWUA 3DRQA 4JDTH 2K7QA 2QV4A 1F42A 4U1NB 3V6OC 4FZ8H 4DSYA 2HYMA 4ZFZB 4XP6L 4G6AD 5DHYB 2GT9B 2CUMA 2XZAH 1EJOL 4YSTA 1ZDQA 1KULA 3FN3A 1X5FA 3GSRB 2MSPA 4JFPB 5ALBL 3IDGB 3HCVB 1UVQA 1MFBL 1D5MB 1YNTA 2AXWA 2VL4A 5E1AB 4P9HH 5C08D 3F7YA 1O0VA 1DL7L 2BVPB 1CD1A 4JFSA 5HGGS 1OW0C 1TTFA 4GMSL 2YQBA 4ZODA 5E1HB 4ABVA 3O2DA 5HHOE 1TG8A 1X9QA 2XKUA 4FQQA 1V7ML 1QLRB 1GMIA 4GIPD 1XIWD 1ORSB 2PXYA 3T8XA 4FMFA 3R1GH 4FXGC 1H3GA 2W81C 5MEOB 4A7SA 2QZQA 1BAFH 1J0HA 2ITCA 2XRAH 1AYOA 4RMBA 1YPZB 2CO6B 2VXTL 3RRQA 2PMZA 3FFDB 5JPMC 4L4JA 3C09B 4OF6A 2JJSC 5CM1A 1JPTH 2LV4A 1TJGH 5CKGA 5GGTL 3ZO0A 3CFDB 1JGVH 3NIFF 3C8KB 1I3GL 3LKRA 4TULL 4PRBA 1WT5A 2BOBB 2AVGA 1HZHL 2D2OA 4YSAA 3ZT5A 3MRQB 3KPRE 2VN4A 2A77H 5EO1A 4CNIB 2WXOA 4QYOA 4DERA 1YYMH 2XWJB 3ECBA 4AVHA 6CGTA 2DQDL 4JY4A 1FH2A 3HR6A 5DC2A 1IGIH 1NGZA 3REVA 4HGKC 1X5IA 3WIHH 5KTEH 2XBTA 4EIGB 1II4E 1DQKA 4ZW3A 3FU3A 4QRTA 3RGBA 4ABQA 5TPWL 1EEYA 1E8WA 4KXDA 4QNPF </