4RRPM

Crystal structure of the fab complexed with antigen asf1p, northeast structural genomics consortium (nesg) target pdr16
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
153
Chain Sequence
b'GSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab antibody, light chain
publication title Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics Consortium (NESG) Target PdR16
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 153
sequence length 158
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4rrpM00
4ZBJA 2I32A 2CU9A 4RRPM 5EIIG 2YGVA 2Z34A 2DZEA 2IDCA 1TEYA 1ROCA 5BO0D 2HUEA 2IIJA 2Z3FA 3AADB 1WG3A 5C3IA 4EO5A 2IO5A 5BNXD
chains in the Genus database with same CATH superfamily
5GISL 2PWFA 4ALAH 1NSNL 1RFDL 1RVFH 4MA1B 4KTGA 3RY6C 3K2IA 1QX1A 1FG9C 1MW1A 1CIDA 2EUWA 1U42A 5HHPA 1HN1A 3K4DA 4LQFL 4QHUA 5TE4H 1ZTMA 4F7MA 1KFGA 1FFPA 4WTWA 5C0BE 1A4JB 1GW6A 4OLXL 1WBXA 1Q0YL 4OH2A 2E7DA 4P48A 4ANKA 5KSVA 2F54B 5KYUB 1GGBL 1I8KB 5CMAB 1KJMB 2C7FA 3EGXA 4Y88A 3EJYD 2CO6B 2EXYC 4PRBB 2YQBA 3BT0A 3C6LB 1JF6A 4HIHA 1I3GH 1HHJB 1WBYA 3L4YA 2XWEA 3SZKC 1HX0A 3V52H 4OUUB 4YDIH 3DXAD 3MJ7A 5FO8B 3QPQD 2IWGA 3BP5A 4NO0B 4EI0A 1NC4D 4KXDA 2YSSA 5F1NA 1G7IA 4QXVA 3BGFC 3V0EA 4NM4L 3MCYA 3QBTB 3QUMA 3PV6A 1HFUA 2XFGB 3S5LB 4WUKL 4YX2H 5EBWB 1T1XA 5JZ7D 3UTPD 3IXAA 5I1DB 5C92A 1G7PA 3UAJC 4N0CC 4NAQA 5HGGS 3BAWA 3PQYD 3BKJL 2DWSA 2X6MA 4ANVA 5CLTA 1E5AA 2JTYA 1HILB 3UJJH 1CG9A 1INDL 1PZ2A 2WNWA 5C09D 1M3IA 1UB6B 4NFBA 2D9QB 4F2EA 5K9OA 3AWEA 3NYKA 5I17A 3TPUB 1I9IL 4YGVA 4PLNC 1HWGB 5JQ6H 2D0HA 4CKVX 2WKOA 4D9RD 1Z3GH 5L9DH 4GPVA 5AOLA 2J73A 3ETBF 4Y1AD 4YLCA 5E6RB 2I85A 3G6JA 3IFNL 3DMMC 2XWTB 3HNVL 4EIBA 3VVVA 4ELMA 3B7SA 3CXDH 3FUHA 4H88L 1QFOA 3FCTB 4QRRD 2GKIA 1IGTA 2P48B 3VGFA 5EZIL 5I0DA 4RMUA 5EDSA 3I6SA 2VRAA 1MFVA 4Y2NA 4TNVK 4UT9H 4XC1H 3RY5A 2AXHA 1DN0B 1TCRB 1YEGH 4KK8C 3EO1A 3U46A 4JPVH 2NX5D 3G9AB 3SKOA 3VXQA 3Q3GB 3DVNB 4XRCB 3DK0A 4YVUA 4K7FA 1I1YA 1ZPUA 3N9GL 4GW5B 4RBPK 2BCKB 2L7UA 3NCEB 4KUCD 3K0YA 4OD3H 4AL8H 4HUVB 2MNUA 4P5TC 3B1TA 2HFGH 3TT1L 1KLUA 5CBAB 1IIKA 1OALA 4YS4A 4BKSC 4Z7UA 3DSFL 4NZDA 1HNYA 1TF4A 4PJ7A 2NZIA 2H0EA 5HD8C 4BFIB 3QCTH 3SOBL 1D6EA 4L4VB 3RDJA 5B4MC 4N8CL 3V4VA 1NMBH 4WW2B 5ANME 3RFZA 4MCYB 1ZE3H 2E7BA 3MUY1 4QF1B 4F2FA 4N2GA 1UXMA 3J27A 1SFDA 4IRJB 2WKOF 1L5GB 4TSCL 1PAMA 3BT2H 3VH8A 3VXRE 1IUZA 2VC2H 4DEPC 1G9EA 3G6JF 1IC4L 3MJ9H 3W0WD 1AHMA 2A6DA 4YN3A 1RHHB 4ZYKA 4APQC 4ELMF 1GZQA 3NP3A 4P46C 3ZO0A 4F7KA 1NAKH 1C8PA 1ASOA 1OTSC 4U0RC 4JFWA 4HV8B 4R3SB 3ARGC 3MGOB 1SM3L 4FNUA 3S35H 4ONFH 1RVFL 1NGYA 4YIQA 1KCRH 1LEIB 4UMSA 1EFQA 1U4EA 2C26A 5DGRA 4C83B 3NJKA 1LEGB 1AP2A 4ZS7H 1EO8H 5T3XE 4FG2A 4PR5A 4GQ9H 4G9FB 4DKAA 1JXJA 4CBZA 3RY6A 3WO4C 2GJ6B 5CSBA 5KSBB 1CGVA 3QORD 4KKCC 4LXFA 5A16A 1FVDB 3F6IA 1QNIA 2IH8A 2G3NA 4D8PA 2G2PA 4DKTA 3GSQA 1AO7B 1O6VA 1W15A 1V7NH 3T4AA 3VYPA 5F7LB 4MB1A 1T5WB 4Z7UF 3A3YB 1T0NB 4H5SB 4PJ7F 2WVSA 1AKPA 1R24A 3QUZB 4U3CA 1I3GL 2NXYC 3BH9B 4Z7VA 1CDJA 3V52L 1DZBA 4YDIL 5CD5C 4UTCA 4L0ZA 2WWNA 2AABH 4GKLA 4XNUL 5G4NA 1KXHA 2EYSA 3I6KB 3O45A 3IJ7A 3U4KA 3RIKA 1CLYH 3UP6A 4F91B 1OD9A 2I7SA 3QFDB 3GMQB 2AK4E 1JUFB 3LN5B 2PR4H 2I5YH 2YBGA 2H0PA 4H8WH 5AYUL 4AUYA 5I76B 2YXVA 4MD4A 3PIQB 5FYLL 2W9EH 4M1CD 1T4KA 4YX2L 5JW4Q 1GZPA 5DS8B 3T0XA 4IOIA 3CBJB 1DE4B 5AZ2H 1U8HA 3UZEC 3K0WA 4F15C 4RWHA 3NDZE 4OLZL 3S3BB 3SDDB 1BZ7B 3UZVB 4BCYA 4CN6A 3H7BA 2F19H 2YBRB 5E6ZA 4ZUWA 3CH8A 4KZEH 4GKOA 5DEJA 3L17A 3UJJL 3UAJA 1BX2B 2AP2A 1FIGL 4DTGH 2F7PA 2I25N 2CPCA 3PJSB 2XTSA 4JFDE 4KRNA 2EACA 1KPUA 2NY1B 4QJ4B 4Z3TA 1Z9PA 1FZOB 3TBWB 2R29A 3N0PB 3WLWD 1Z3GL 1U58B 4A2MA 2NZ1A 1AOHA 2IDUA 3RVXC 3F6LA 4HKZB 1DQTA 4QAMB 3WMSA 3WEBA 2NY3C 5I6XB 1GHFH 1J8HA 2CK0H 2DEWX 3V55A 3VFWB 2ZF9A 5EORL 3MPCA 3R8QA 5LAPA 2IPTL 1T20B 5LCVA 1BMZA 4Z7VF 2X3CA 4BFFA 3CXDL 3EG9B 3GXDA 4QHNB 5BOPA 3DMMA 3MSPA 2K45A 1GC1C 1ZXQA 3FUEA 3FTUA 5F7UA 1MFNA 4JHWH 3BSHA 3ZZ1A 1Q72H 3IAPA 3RPKA 4XC1L 1CICB 2BNRB 5LB1A 4JPVL 3V5KB 3EBAA 1SDDB 5C3LD 3M88A 1KLFA 3EOAA 3WTTA 4NQED 1I3VA 4LPCA 4JFEE 4OD3L 4AL8L 3CZEA 1SYVA 4LLVA 2HFGL 4FERA 3JTTA 3QCVH 2AQPA 2JV6A 4HJTA 3SKNB 3UC0L 2CHDA 5D55A 1MCKA 2J6WA 4P5TA 1WF5A 3M46A 4G8GB 5C1MB 5D1QB 2R2EA 3V4VL 4AQEA 1HT6A 3OGCB 4B9CA 1UTDA 4PV1C 5SX4H 4G42B 1NMBL 4QJ5B 4XHJC 2AJZB 1ET7A 3PP3H 1DBAL 3B2VH 4QRSA 4JRXA 1EZVX 3WKYA 4BCZA 2BFVL 4RCAA 4M93C 3MOAL 4LLQA 1JPFA 2VC2L 1G6RA 4B3EA 4IBQA 3MJ9L 1D5RA 4HAFA 4JZNA 2YD6A 1JP5A 1LLAA 9CGTA 5IVNA 3SYAA 3FRPA 1NAKL 2PMZA 4FP8H 1NQBA 5EBMB 3M17A 3B2UC 1T7ZA 3K6OA 4JDEB 3O6LL 5E94A 3S35L 3TBCA 4ONFL 3DNKA 4P46A 4WJ5B 1XXDC 2CGRH 2AI0H 1IAII 4XBEH 4I5BB 4FJYA 2WXJA 1EO8L 5DDHB 1RPKA 1U21A 2F9BT 4GQ9L 3DO3A 5EU6E 4OM1H 1U8MA 4HU8A 3WFEH 2AJ3B 1Q1JH 3P1VA 3S0PA 1YUHB 2CJUH 4MJ2A 4LKXB 4MNQE 4HFWA 2AVGA 1Q94B 3T8XA 5EIIG 1YUKB 2YPLD 1UWXH 5LN4A 3UTSD 4PRIA 5I9QC 4ODXA 2HCZX 2X4RA 1FO0H 3B9AA 3IKCA 4K5PA 3CLFH 1C8QA 1H3UA 3LHAA 2XFXA 4JJHA 4L2LA 4G7SB 5IFJA 1TLMA 2AABL 4TPRL 1AKJD 3ZDYE 3OKOB 4IGBC 4FG0A 4XPFH 2E6PA 2VLKD 2OYLA 3REVA 1ETZA 3WDIA 3P69A 1M05B 3EJRA 3EUDA 4FXLA 5TH2A 1XD0A 5LGJA 2OJ1A 2PR4L 2I5YL 4H8WL 5BRZE 5KZCD 3F7YA 3MV7D 3P3RA 4YBHA 2W9EL 1EAPB 2KDGA 3UROR 1BLIA 4IMKC 3NSJA 4OW6A 4TUJA 5AZ2L 2I26N 5DYOB 4I0PD 3MLWH 2VDPH 5E70A 1H9DA 2WHVA 4YSPA 2F19L 2AITA 4X8JB 2ARJA 4LIQH 3UZEA 4PJCA 1UZ6F 4XWGH 3JWNE 4KMLB 4KZEL 2UV3A 5EUOE 5F6IB 3JUYA 4DO4A 5E9AA 3TFBA 1AGFB 1KYFA 5SWSA 2WLMA 7PCYA 4DTGL 4Z7NB 1YZZA 5F97E 3V5DB 2F74B 3DETD 3FPXA 3PHAA 2R29L 1JWMA 3IJHB 2WYHA 2WAHA 2EDEA 4PJGA 3SPVA 3V6ZA 1EERB 5F9WC 1SLWA 1WA1X 2VO5A 1F90H 2CM6A 2VXTH 1B4LA 4YHYB 3H7LA 3ATEA 3MRRA 2QHLA 5FDWA 1GHFL 2CK0L 3I6GB 2HN7B 1SJHB 4LNRB 2AMUA 2APBA 2EDRA 3OMZA 4JQVC 1E28B 1EIBA 2DWEA 5IBTH 4WENB 1AH1A 3WN6A 3QJRB 4YZFE 3LAFA 1MG3C 2RAMA 3O3EB 4ABUA 2NUPB 3EJQA 3VXSE 4JHWL 4KDTC 1SRDA 2NSQA 4RAHA 2KH2B 3T4YA 2D9CA 3KLHC 4I18C 3BVXA 2BP8B 3D3VE 4XBPB 4WEMB 4MXQC 3TS8A 4TQHA 3JVFC 2KUTA 1OAYH 3RL2A 4MNHA 5IB4B 3GFUA 3QCVL 1DQVA 2GYSA 4OF5A 5D4HA 5DFTA 1BSIA 1TQUA 2X9WA 4FHJA 3D12B 4ZW7A 2C3VA 3UJTH 3VX1A 3G5WA 2XXFA 4PJCF 3ZRCC 3HCVA 2X4SA 1A25A 2PTTA 3HAEH 1AGBA 4HS3B 5GGSB 1DSYA 4DO6A 1JWSB 1W0VA 2DQFA 4MNGB 4BKLA 4PJFB 4LSPH 4Q0XL 3B2VL 5KVGE 5EO0B 1TKWA 4I3GA 4PJGF 3UJIH 2P7TA 4U1NB 2LABA 3OVUB 3DOSB 1WJ3A 4YC2B 3PAUA 3HG1D 2DWDB 4KO9A 4TMPA 1JV5B 4FI8A 3C60D 2EYRA 2DWTA 2H6PA 3ML9A 4HOWA 1G7LB 5HDOA 3CDCA 4XMKH 4FP8L 4B9GA 1J5OH 1ZHLA 4J8RA 1TT6A 1S5HB 1CI5A 3EJPA 2IF7A 3W9EB 4TL4A 2RQEA 4JDTL 1T04B 5J1TC 2XBTA 3RWFB 1FE8L 5HGHA 2UZXA 1NANI 3E8VA 1NCIA 4X6DE 2Q6WB 3SBRA 1LDSA 3FPYA 3GHPA 1D5XB 4OM1L 2ESVD 3AJ7A 4MASA 4YUEH 3WFEL 2CIKA 2O6PA 1Q1JL 4JFOB 2CJUL 5CEZE 2VLJD 4L9DA 5FGBC 4N0YH 3S3SA 4Y9BA 1E8ZA 4LSVH 4N2CA 3GEWB 4MCZA 1RY7B 2E0PA 2WWMD 4F7PB 4X4XB 4Z95H 3DWTA 5HY9A 5T1KD 4NNPH 5JUEH 1JS4A 1T03L 2OXHB 3CLFL 2N56A 2P8MA 4G11A 1WS8A 4MS6A 4XZUA 3E3QC 3T3PE 1CXHA 4J3BA 3L3DA 2E56A 4XPFL 4QUOA 1AZCA 3BQUC 4W6WB 4BK4A 4KDVA 3FT4A 4XPTH 2BMKB 3U1QA 5CCGE 4D0BA 3W39A 2JJUA 3BX7C 3ZKSD 4IGBA 2WPGA 4N6RB 5E7BA 2BSRA 3KVPA 1XH0A 1U8OB 3EAKA 3TVMB 5EF3A 1VKXB 4M3JA 5LKNA 4JDVB 5AW2B 3VD7A 5EIVA 4JLRA 4ZFGH 4IBVA 4HIIA 3JXAA 4GG6E 3MLWL 1WZAA 2VDPL 1OKEA 1LK2A 1U36A 1NGWB 1YYLH 4IMKA 4KRPC 4J3UA 4P2QA 1K85A 4UBDC 2K3HA 1ESOA 2DWYA 1Z9NA 4HPOH 4KDWA 2J5LC 4QGYA 4P2OB 4XWGL 2X05A 4F58H 5CHNB 4DOHB 3DX1A 3C5XA 4MJIE 5KYWB 4S1RH 4KRLB 4ZOCA 1CD1B 2C3HA 4MAUH 4R7XA 2EDHA 5B7FA 2X6AA 2V17L 1GVIA 3JV4A 3ZYIA 5FB8A 4KMTH 1F90L 4ZFZB 4HMCA 4DKFH 2VXTL 1FRGH 2ZIDA 3FSVA 3GIVB 1BQRA 3FRUB 3G04A 2DEYX 1H5BC 2EVGA 2BWIA 4AQ1B 4Y2OA 5FK9B 4L37B 1V7MH 4JO3H 2E75C 3GD1C 1PU0A 1RUQL 4C56B 2JKSA 3F62A 1TTBA 3F00A 4M62H 4XWOC 1T6VN 3WIHA 3V7MA 4FFWD 4WNQB 3RWEA 5IB5A 4ZO9A 4ZO8A 2ICES 1EK3A 4JQVA 2R23A 4W9LC 1CMOA 1N6VA 4UOQA 2ZOLA 4LCUB 4Y16C 5IHZB 2YC1B 4MMYA 3MI6A 1PFOA 2CDEB 1ZWIB 4NN7B 5C07D 2F53E 2QVMA 4PWJA 4KDTA 1HH9B 2J6EH 3HVDA 3V4UH 5DHMC 4UQBA 3THMH 1S7WA 2C4FT 5CF3A 4I18A 1OAYL 3MRMA 3V6OC 3IJSB 2NNAA 1JGUH 1HKFA 3UJTL 3N55A 4GO9A 1SFHA 3MNZB 3K72B 4LF3A 1HSBB 4N1HB 1F4WL 1S7QB 2WIIB 1GGIH 1SMDA 5FF6A 3V0JA 1Z9SB 2YEQA 4X50A 2FD6H 2XCMC 4JM4H 2LHAA 5J1AB 2F6AA 4LSPL 5F3HB 1M7DB 1EXHA 3DIDA 1U8PA 2W60A 3UJIL 2CHXA 3RWCA 3UOAB 4BHUA 4MA1C 3SO3B 5GSRA 4JZJB 2UWEB 4UNIA 5HJGA 3VRLE 4MX7A 5IJCC 3BAKA 4O02H 4QGTA 5HGBB 3N1PC 4R7VA 1RXLA 3MRPB 2MPVA 1LO3L 2OJEA 3A67H 1DCEA 4JFUA 1I8MB 1WEJL 4FCAA 1THAA 1ED3A 1MZZA 1AJ7H 5JLZB 5DRZB 4ODSL 3ZYZA 1BAGA 2YD0A 3GYRA 3P3YA 3GJFH 4KHTH 3C6LC 2ID5A 4RX4D 4M1DL 1NFDF 1G7JB 4RGND 2XVKA 4FYRA 2X2HA 1GW0A 4TLSA 2X7LB 4DKDC 3NJIA 2YRZA 5EZLA 4HJ0D 2FHBA 1GYCA 2R1YB 2YPVH 3WNLA 3ECWA 4YUEL 4D3CH 3EHBB 5EO1A 3C09B 2UZYA 2ADGB 3HJ0A 4N0YL 5DRWB 3ES6A 4LSVL 3ETTA 5JIHA 2TRYA 1RJLA 3UZQA 3GSXB 5IIEA 5FGBA 5B1AB 5IUCA 3MRLB 4Z95L 3T5WA 5JUEL 2NDFA 3OKDB 4NNPL 4WI9A 3HHSA 1OZTG 1JD9A 5F1KC 5CN3A 3BP6A 3CX5J 2HZHA 4E9SA 1A1NA 4XPTL 5GGUB 4TLUA 5E5MA 1NLBH 1I3RA 2WLLB 5BS0E 2WYIA 2A0LD 3BQUA 4HC1H 4GRWF 4DP7X 4UYQA 4U4BA 2IQ9L 3LNEA 2MHAA 3BLBA 5E1IA 4FHKA 1FYTA 4ZFGL 1HYRC 4HJSA 3RWGA 1S7XB 1CLVA 1N5AA 1N0LA 1PFCA 1KGYE 1YYLL 3S5ZA 4P57A 4Z7OE 3P2BA 1HESA 3K5SA 2BNQD 4HPOL 2ZAGA 4F58L 1BXUA 4PS7A 3CHOA 1JDCA 1HI6A 4N2OA 4YR6B 4Z0XA 5LO7A 4AYID 1JYVA 3ULVH 3NACH 4S1RL 1QMUA 5IVXA 3Q2NA 3CBRA 4J12A 2WNKA 4MAUL 4YDVB 1ZHKB 4YBQD 5ABDE 4U49A 4ZQKB 1TO5A 3JYBA 1S3KH 5SWZB 2EDNA 4KMTL 4NLAA 4DFIA 2FK9A 4BGLA 4OCYH 2RD0A 4DKFL 2AK1L 2OCJA 1FRGL 4XXWC 3WENA 1A7OH 3U9UA 4Q9RH 3PWLA 2OI9B 3MA7A 2X4OA 1LNUA 3DDGA 4MB3A 1MCWM 1V7ML 4R5XA 4RQQB 3QDGA 3PXHA 1H5BA 5DZ9A 5JW5B 5TD4A 3GZPA 2PWGA 3QULA 4WHYG 4M62L 3E1F1 5F71A 1SGKA 4FADA 3ROOB 5MENE 4HUUB 4JRYD 2WIMA 2GBUA 3BH8B 4DGIH 5EU3B 4XAKE 2YUXA 1HWHB 1BA9A 5K59F 2B08A 4OCRL 1WGVA 4OIIH 4YHKH 3U9PH 2F18A 1HKLH 2IVFC 2P8LB 1V8HA 3GB7A 1THCA 4WW2C 1L6XA 3GT6A 3NJHA 2H0FA 4HWZB 2J6EL 4Y16A 1W8NA 5IEHB 3V4UL 3UG4A 4W9GC 3THML 3WUZA 4IRJC 2ZX7A 3LPFA 1XGPA 5DUMH 1MRFH 2P45B 4CGUB 4OFPA 5DQ9A 3MO1A 4KI5D 3VI3E 4OD1H 1JNHB 1JGUL 1YMMA 3FQ1A 4HLEA 2PXYD 1TTGA 1HVXA 3JWDC 1CWVA 4L18A 2CPUA 3BUYB 2BP5M 1GGIL 1SNRA 2FIRT 4NOFA 5IVXF 2H9GA 2FD6L 4G8FB 2XN9D 4RRPG 5E1QA 1CN4A 1VGKB 3ARUA 4PGCA 5DLLA 5I15H 3HPLA 1Q9WA 3W56A 5IEKB 2AVFA 3TBSB 1SHMA 2F68X 4B53A 3EOYG 2BVQA 4O02L 1H0DB 4IU2B 2RH0A 4PSPA 3FJTA 1DEDA 3A67L 4U7MA 2WQUA 1AJ7L 3DX8B 1KCVH 4F24A 5A40E 4I13B 1A4JA 3P9WB 3BYYA 4KHTL 4N2BA 2F54A 5KYUA 3H3PH 1KXTB 3QUZC 2K6WA 5CMAA 1KJMA 5IKCB 2CO6A 5I26A 1ODUA 1MCSA 1AR1B 1G1YA 3KPOB 4PRBA 5F0MB 3C6LA 4RIRB 4UIKH 5HHOB 1LK3L 3FUIA 15C8H 2BZ7A 1URZA 2YPVL 4EDXB 4DZ8B 1HHJA 1FC1A 4D3CL 3MRKB 4OUUA 5MHSD 1EMTH 5FO8A 1N5YL 3C87A 4JN1H 2DLGA 4NO0A 3SJVB 4UQDA 1HK6A 1RK7A 3WNMA 4DGWC 1XSJA 1FQ9C 2FT7A 2ZKHL 3QJSB 3OKKB 1UT9A 2K7QA 4F93B 2WB1A 3B9DA 4HWBA 1MVYA 3S5LA 1IAIM 4LO9A 4XX1G 1CFQB 2IBGA 5EBWA 1FV1B 2ZUUA 1QFUL 3SDDC 5E1AB 4WGVB 1HXMA 5C0JB 32C2A 4KY1H 4QOKD 5I1DA 2ITCB 3U48A 1NLBL 3SDAD 4KJWD 1CBVH 5ETUB 4HPYH 4HC1L 2BY1A 2J8OA 1PZCA 1X9RA 1D9KB 3L95B 1RSFA 1G94A 2NY1C 2Z9TA 2NZ9D 1HILA 3NCMA 3PXJA 3ZL4H 3SBQA 1UB6A 5GS0D 1SQMA 2PYEB 2HTKC 3S2AA 3OQRA 3TPUA 3AFLA 5CZRA 4ZUUB 5C0BD 1HHKB 3BKYH 3HZ3A 3ECQA 5HDLA 4JRWA 5I6XC 1MKFA 2NCMA 1FYHB 3ZE1B 2D31B 3FB5B 2C3GA 2VXUL 1Z9MA 3PY9A 4F57H 5F96H 1J5CA 3MX0B 2V33A 4LVHB 2XWTA 4OFYD 3JWOL 4KC3B 2VR6A 3D34A 1VIWA 2A9AA 3NIGE 4CRPA 4JY4B 5JPMB 2BOCB 4FQ2L 4OCYL 4RMBA 4K07A 2D3JA 4UANA 3BFOA 5ITBL 1A7OL 4Q9RL 4POYA 3QDHA 1J9SA 4UOZA 4LDEB 1AGDB 1CICC 3U2JA 2N01B 1LL1A 5TPWL 1QFPA 2LFGA 3CN3A 5HPOA 4XXWA 2LLLA 2A5UA 3K7UA 4PD4J 1DN0A 1TCRA 3PAZA 4RMQA 1G7QB 5T5FA 2Q2LA 5FDYA 1ICTA 3DVNA 4XRCA 1DUZB 3VX0A 4GW5A 3T71A 2BCKA 3H4FA 5BZDB 5DJDB 2Q76A 1JYNA 4HUVA 4DGIL 1SZNA 1NIEA 4X8XA 5D1QC 2A6JB 4QRPB 5AW4B 3TZVD 4OIIL 4YHKL 5CBAA 3OAZK 2VCOA 1HKLL 3U9PL 2GTQA 3RIFK 3V0WL 2MNWA 5F21B 5ACZB 4Q7DA 4BFIA 5LNDA 1ZJBA 1PG7X 4L4VA 2JKLA 1NMCB 4X7CC 2HG0A 2XBZA 5DUML 2IIJA 1MRFL 4WW2A 4MCYA 3BSZA 3GBNL 4K94H 1OSEA 4N5EC 1IAOB 2ZCKH 1L5GA 4IRJA 1JPEA 4CMHB 1T5XB 5CLZA 5D4QA 4LT7A 3ERXA 4P5KB 5KYYB 3KPPB 1RHHA 5I15L 4JCWA 3JVGC 3I85A 1JMZA 3AB0B 2E27H 4R3SA 2JI3A 1JDAA 4OZIB 4K9EC 1M6OB 1EVTC 2JKJA 4FXKB 1UGNA 1LEIA 2B8OT 4C83A 4HK3N 3LH2H 5DQDL 1LEGA 3T1FB 2WTRB 1R3IH 5DJ2A 5A3IC 5I0VA 4PVBA 4G6JH 4G1MB 4G9FA 3T8VA 2GJ6A 2P5EE 2Y22A 2VN5A 1KCVL 4TTDD 4U1LB 5EU5A 5ESVA 5KSBA 1FVDA 1L0XA 3WCYA 2VDKH 4L1DA 4C4KT 5C9JB 3WFBH 1AO7A 3WI9A 3OKLB 1XMEB 3PYCA 3QIUB 2F5BH 1T0NA 4H5SA 4H7VA 4O51B 3QFJB 4FYQA 3QUZA 4UIKL 1B4RA 15C8L 1DP0A 3BH9A 3D8MA 2Y06H 3L3JB 1EMTL 4JS7A 2CBMA 2IOIA 4JN1L 4LPVA 4WW2F 3I6KA 2EH7H 1RV6X 3EFOB 3KGTA 3H3BC 1J10A 5L6YH 3A4FA 2XX1A 2GK0B 4L23A 1JFQH 2ITEA 3QFDA 4TVPH 3GMQA 4FL4B 1JUFA 3LN5A 1S7RB 4NKOA 4PLJD 4YSQA 2FH6A 4N2EA 3VXRD 4XP9H 4HGWA 2RFXB 4JRFA 3PIQA 5I76A 4WEBH 5FECB 1WS7A 5DS8A 2IALB 2CK2A 4KY1L 4YJZL 4P2YA 2NY2D 5F6IC 5FFGA 1LTXA 4XNXH 3SDDA 4Q9QL 1BZ7A 3UZVA 1CBVL 1ILUA 2YBRA 4OLUH 4ETYA 1WRFA 5D2NE 5CZKA 3P9MB 2FGZA 3MQIA 4GAYB 1BX2A 2EVIA 3FOLB 1OPOA 4PREB 1W8OA 3TONA 1BF2A 5T3XD 4YHYC 3SSGA 4G83A 2WKLA 2ZX8A 4AMXA 3BKYL 3TBWA 5KSBF 3L3IB 4CVZB 1U58A 3ZVVA 3C6SB 1SJEB 2X1XR 1FLRH 3F65A 4HKZA 4DN3H 2PCFB 1CJYA 4R4NC 1YY9C 4F57L 5F96L 2V3EA 3VFWA 3KYOB 4WTQA 5DO2D 5D7KD 1T20A 1NBVH 1AXTH 1G9HA 3EG9A 4QHNA 5B39B 5B3JF 5FOBB 1UZGA 1WBZB 3FCSA 3ZDYB 1SEQH 4KKLD 1DQDH 2X1QA 3Q13A 2AK4D 1N18A 4FTVB 3P3UA 5EOCH 5B7EA 2BNRA 5A2FA 3BYTA 1VADB 2O5XL 1SDDA 2EIBA 1DVZA 3VVWA 5TK4A 4XC3L 2R1XB 3LEYH 3QWQB 3ZT7A 4M5ZH 1FFTB 5ERWB 3SKNA 3PABB 1CFVH 4A2HA 2ZT9C 4G8GA 1OGAD 5D1QA 4Q14A 1IQDB 3RL1B 1P7HL 2PO6C 3GSRB 2YGQA 2H32H 3HOGA 2XWCA 4GLRI 5CJOH 4TVUA 2LE9A 4QCIA 5FFLA 1QR1B 4KH9A 2EDJA 2AJZA 1GRWA 1CFTB 3KPSE 3N06B 3H6AA 3O3AB 4K94L 1YNKH 2A9NH 2GJRA 3VQ2C 4YC2C 5IMOB 4AOFA 2ZCKL 2VDMH 2FLBT 1GS6X 2QTVA 4J23A 1HYSD 2WNXA 2H8PB 1L4IA 3ZK0A 1YY8B 3VXUE 1AQ8A 1K9TA 3WE6B 2VZUA 4UNUA 2QSTA 1TO4A 1V3LA 2VMFA 3CZLA 5H37G 4HPHA 1A6UH 1BIHA 3QQ3B 4BA8A 2QELA 3VWKB 1PTZA 2D7NA 1MDAA 2XYCA 1PSKH 2VDNB 3DJRA 4JRLA 5EBMA 2E27L 2F7IA 1NEUA 4JDEA 2LAAA 1LO2H 3GEFA 3GO1H 3JVGA 4WJ5A 2OL3B 1DJXA 1KTDB 3IGUA 3BXNB 5F0JB 1RHFA 2AXFB 3GMPB 3LH2L 2V37A 4I5BA 2AKRB 1QLEB 4NFDA 1R3IL 3DO7B 2YD9A 1JVKA 5DDHA 2VB5A 4G6JL 4ANXA 4LDLB 3IRPX 4NZFA 3FU9A 4FQHB 5FAAA 3FT3B 2AJ3A 5AVZB 1YUHA 4LKXA 3ULUH 4DP6X 1YEEH 3D3VB 3WFBL 3VA2C 2BW4A 1WCQA 3Q9PA 1Q94A 3AMKA 3JSSA 5F7WC 3V4PB 1RH8A 1KEGH 1NBCA 4X4KA 2F5BL 1OE1A 2NX5B 3M45A 5J89A 5JMOC 4U1JB 3IU3B 1J86A 2WBWB 2Y06L 3U7YH 2XA8H 4MYPA 3GBMH 2FVNA 6CGTA 2WLYA 4EI6B 5CFHA 1E4HA 1D3CA 1FFNA 3OKOA 4KKNA 4MD5B 2EH7L 1CD9B 1XGZA 3WGVB 3DSNB 5L6YL 1OAQH 2HVBA 3TVMC 3O2WH 1JFQL 4TVPL 1M05A 1ZS8B 1HHHB 3AU1B 1VPOH 3L48A 4XP9L 5EWIH 4I2XA 4JPIB 2C3XA 3BPCB 1TQBB 1EAPA 4WEBL 3CFNA 2YGVA 4MMZB 1UT2A 1ZAGA 3FOMA 2TSAA 5DYOA 5FV2A 4P2OC 2W59A 5JOFB 3LRSB 4XNXL 4LLAA 1WIUA 4A6YH 4X8JA 3FUDA 3UC2A 3QXUA 3O0RH 1UM4H 4IM8A 3SE4C 1AGFA 4GEJA 2A38A 2FUQA 3OAUL 3QQ9D 1FL3B 4FFVC 3V5DA 3U4EB 2F74A 4J3OD 3IJHA 5EU6D 5EEVA 3TPKA 5I0XA 2IH1A 3N40F 3S4SG 1RZIB 2WWKO 4AQ1C 4BK8A 2FIKB 3MV01 4MNQD 2NQ3A 2Z7ZA 3OTTA 1FLRL 4DN3L 4LEBA 2ZWKA 2JE8A 3GTTA 3KPMB 5DFVD 3I6GA 3B9KA 3X2QB 4W9FC 2HN7A 3Q8EA 2VISB 4NYLB 4N0UA 4NPKA 1SJHA 4IRZA 4LNRA 3T0WA 1AGEB 1RLBA 1NBVL 1E28A 1HAUA 3ALWA 3B7UX 3D39E 2ZF8A 4ZW5A 5JNYB 4S0SD 4AJ0A 2AAAA 5I82A 3FSZA 4E9QA 4JKLA 1OAKH 2NUPA 2XV0A 4NN7C 1BVZA 1INEH 1SEQL 2R59A 3D0LB 1PCXA 3ZTCC 4YSEA 4KWUA 1PX8A 2NLJB 5E8PB 4N25A 5EOCL 2UZPA 4ZPVB 1OCRB 3EJUA 2JELH 3IMVA 5BRZD 2WXNA 2WCPA 5C08E 3H85A 2BP8A 1P5UC 4XBPA 3UYRH 3WAKA 5I6OA 2WD0A 5I75C 3LN9A 4FG6D 4Q6IB 4E9WA 3LEYL 1SJXA 1UFGA 1TLKA 4M5ZL 3IJYB 2J56A 5IB4A 1EXGA 4B9PA 3WLBB 1ET8A 2ENJA 4NOBA 1S7SB 5MEOB 3SQOH 1CZ8H 3GNMH 4U1MB 5E1GA 2JLLA 2EDDA 2WVVA 4NRZA 3ABZA 4HS3A 5GGSA 1UKSA 4L2YA 4G8EB 1JWSA 4MNGA 3SO3C 4Z7NF 4JZJC 3UP1A 3IFLH 3NFSL 4H13C 4PJFA 4HCGA 1YNKL 2A9NL 4KKRA 5T33L 3FFCE 5DRNB 3DGDA 4P5MB 4U1NA 4Q89A 3CZJA 3DOSA 5B39G 3SDXE 3BUDA 2MJWA 3IKKA 2DWDA 4HIEB 1JV5A 1ZLEA 3ARYA 3D06A 2Z92B 3RAJH 3B9VA 1TPXB 1J18A 5F9OH 2QT6A 3POCA 4NQUA 1G7LA 5F7DB 3MLRH 5SX5K 2Y7LA 1PSKL 2WQVA 1S5HA 1RURH 2BFGA 2FRGP 2NUTB 3F01A 5FYJE 3W9EA 5L4JA 3KW7A 1E4KC 1T04A 4PY7B 4HCRA 4U6TA 3RWFA 3VXSD 4E68A 4UM9D 4ZMNA 3I75A 3EHBC 2Q6WA 4MVBD 3C09C 2QQKH 1EHKB 1NEZB 1D5XA 5A2JH 4N90D 1I1CA 5ECJE 1X5IA 4JFOA 4H0HB 3ULUL 4K4KA 1YEEL 5HYJB 1J5IA 5DK3A 3KPNB 1JHLL 3LKRB 2AMGA 4YXLH 5F3BB 1KEGL 4ZXBA 1CGSH 3M1OA 4FZEH 1IM9B 3TWCH 5KYNA 3DHPA 5JO5B 1WAEA 4X4XA 5F9AC 4C8XA 4F7PA 3V0GA 3U7YL 2OXHA 4GMTH 2ICEB 2XA8L 3AMLA 3GBML 3FT9A 4MTMA 3WY2A 2GAZB 1OP9A 1S3RA 2Y7NA 5A2AA 1SXZA 2ZSWB 1I7TA 3P0GB 4FFYA 3DURB 3FTGA 4MZ3A 5D7LE 5I8EA 4FYSA 1ROCA 4K23L 4WHYH 1OAQL 2BMKA 4XP5H 3O2WL 1ECYA 3BVTA 3S98A 1NGXB 5C71A 4O2EB 4N6RA 1VPOL 3ISRA 3B7TA 1BZDA 5EWIL 1U8OA 3TVMA 5EC2B 1VKXA 2WQXA 4JDVA 1W9XA 1N7MH 5IMKB 3C5SA 2ZYIA 3WS3B 4XNMB 2KQNA 2UX7A 4B9KC 1NGWA 2WWOA 2Z1PA 3VQLA 2CNZA 7FABH 1EBAA 3GSUB 4FFZA 4N8VB 3X1BA 4A6YL 3LSOB 3CSGA 2P5WE 3MRGB 2EO1A 2ZXQA 3O0RL 5CHNA 1UM4L 3O2DA 3O8XD 5KYWA 4ENZA 1CD1A 5EV7A 1JGEB 2D3NA 4W1TA 1AXSA 1BVLB 4X7FC 1BECA 3SE4A 1A14H 4ZMLA 4XPGH 2JNZA 2OI9C 1XF5A 4ZFZA 5CEZD 2VMJA 1KIRB 4NBZB 5D1XD 3OGOE 1OGPA 2YGPA 3ARWA 4RRPA 35C8L 4AQ1A 3GS4A 1M9SA 2Z8WC 4L37A 1HSAB 4TKWA 4CVUA 3QZNA 3DTDA 3SEPA 2HT3C 5F9JB 4C56A 2COQA 1QUPA 3FH5A 4J39A 2FYVA 4RETB 4WGWB 5BV7B 1Y07A 1W72H 1NKOA 3L08A 4PAZA 4PGZA 3UFIA 1OAKL 2MPAH 2A9BA 3EJTA 3LNFA 4PJBF 3CTTA 4ZT1A 1X5KA 3UTSB 3IDMB 4LCUA 1BVNP 5IHZA 2YC1A 4GSUA 4AVKA 1HC1A 2CDEA 3K1DA 2JELL 2TAAA 1ZWIA 2I9LA 2VLMD 3LX9A 1WAPA 2Q5BA 4PBWD 3UYRL 4Z5RB 2VGLM 1HH9A 1RZJC 3DGGB 1A8JH 3IDIB 4LPUA 3EDFA 3I84A 1CE6B 2ZOUA 3IJSA 1G87A 1YPZF 2FL5B 1E90A 3FT1A 3FTWA 3OMNB 5DVOA 1ACYH 1DFBH 3RRQA 2JKXA 3MNZA 3K72A 2VITA 1HSBA 2Q20A 4AM0Q 1S7QA 1A3LH 2WIIA 2ZWNA 3SQOL 5C97A 3FU7B 3QRFM 4L4TE 3AZUA 1ETB1 1Z9SA 2MIZA 4RNRB 5EB9A 1J05B 4ODTH 5J1AA 2BCMA 2R9HC 3IFLL 5F3HA 1M7DA 4TNVF 2APSA 3MOBH 5A6LA 3MHZA 4HA1A 5CGBA 4MBOA 4JZJA 2UWEA 5DA0B 1UATA 3D85D 1A7PH 5EOCJ 3VGEA 4E36A 2R39A 5HGBA 3MRPA 4LCYB 3RAJL 3EDEA 1I8MA 5F9OL 4KO7A 4A7QA 1GYUA 3ARFD 3MLRL 5CGYC 4YQXH 2HUEA 4G6ML 1AQDB 5E2TH 4HCRL 1XF1A 4N85A 2QFPA 1AR1C 2JCCB 3OB0K 4EMZA 5HYIA 4GUCA 1TTAA 1G7JA 2VMCA 4U4IA 1OK8A 2CBPA 1U3YA 3V7AE 4B60A 1ZV9A 2QQKL 3BZ5A 1E4KA 2XX0A 4W4OC 3RLSA 1UM5H 3MTRA 3PXLA 3VFGH 2R1YA 3RGVA 4RAVB 3QJFA 2CQVA 1UOVA 2FYYB 2BO0A 2ADGA 3DOIA 3QIWD 3RI5K 3P3SA 4Y5VB 1KWKA 5DRWA 4YXLL 3WV0A 1KYDA 1TZAA 3M1CA 1MJUH 4R83A 1OTUC 3GSXA 4FZEL 4AT6B 3TWCL 3MRLA 3VI3B 4ELKB 2H1PH 3OKDA 4PJ8D 3RYMA 4GMTL 4HVBA 2BS9A 2NY6B 1UASA 4L3FA 1CLOH 4XMZA 4HP5A 1N9PA 1NL0H 3S8GB 1QW8A 4B41A 1JSYA 4Y9EA 1E27B 4YXKH 4OQTH 5IJBC 4FQXA 4HH8A 4PI0A 1JZ6A 5GGUA 1D9KC 2MFNA 2IGTA 5FUCE 4G6KH 4AVIA 2XZCL 2X44D 2ZJSH 5B1JC 2WKGA 1CFNB 2UWEF 5HYQA 2RB8A 4GUPB 4JM0A 4NBYB 4P06A 1FAKT 1U8JB 1N7ML 3QAZB 2FX9H 1S7XA 3ZW3A 4Y2DB 5HI4C 4HJ1A 1WUNT 2WBJB 3QE5A 4FFZL 3A4AA 1M1XA 1ZPLA 3FZUC 4OSUH 1MAML 7FABL 2G5RA 3FUJA 4NQDE 1OCOB 5JHDB 2JB5H 4D9LL 1NIFA 3HG1B 2C9UA 4LVHC 4YR6A 3FMGH 2NY4B 2AEQH 2VUOA 4Z7WA 1CDYA 1YSOA 3I9PA 5JPMC 5K9JH 4PJ9D 4YDVA 1ZHKA 2W80C 4ZQKA 4GBXB 3RNQB 4HW6A 5SWZA 4XPGL 5D2LB 3KPRE 3QHFH 2EE6A 2IGFL 2W5PA 3Q8CA 3DLQR 3WHXA 4AIOA 4DVRH 4HLZH 4MYWB 5JIQA 3P0YH 3ELAT 3MKKA 2D3LA 2YPKB 3VXTB 2NQDA 1MFMA 2EEDA 1XBDA 2HLFD 2H41A 1UUSA 4EOWH 1JNNH 5CNHA 3U82B 3BOVA 1FZMB 3ROLB 1BF8A 1CDIA 4LEXH 2NTFB 3ROOA 3LQAL 3KE0A 2WZPD 4HUUA 1G7HB 1E40A 4J6IA 3BH8A 1WZKA 5EU3A 2MPAL 5C0GB 2C9QA 1PZ5B 3HZMA 4XVSH 4U3SB 2ADIB 4OI9A 5BS0D 1NMCC 1PQZB 2P8LA 1DJSA 4B6ZA 4L05A 4AK1A 4N8VG 5EO9A 4HWZA 4BINA 5IEHA 2XVGA 2X53A 2IADB 3HPJA 5C0FB 3UGXA 4KJPC 5D1ZD 5J3HD 3RVVD 1AFVH 3ULSA 4CMHC 2WQ8A 1JNHA 3FDWA 1QWUA 2APTA 1DFBL 3C12A 1QSVA 3QJVB 3QZWB 1OOWA 4I3RH 5E2UH 2IAMD 3BCDA 5F1SA 3HVNA 3BUYA 4DP2X 1HL4A 1A5FH 3DBSA 3UO1H 3R18A 2CXKA 3GXTA 5C0ND 4Z7WF 1MHCB 3L6FB 4XO5A 4ODTL 1JZIA 1ONQB 3X12B 1SXAA 3VXMD 3AB0C 4G8FA 4TYUA 2E8YA 2Z7UA 5ABAA 3T9WA 1AS7A 1QPXA 2R2HA 5DJ0A 1VGKA 3MOBL 2XNAB 3DUHA 4RFNB 4FXKC 3SE8L 5JW4R 1CQYA 5IEKA 1O9ZA 3TBSA 2VO8A 2ED9A 5FYLE 1A7PL 2BSTB 1V27A 4PJIB 1H0DA 4IU2A 5DHVH 2LLGA 3WKPA 4P2AA 1QSZA 1JRHH 3CHSA 2ZWLT 4PLOB 5E6ID 1QSEB 4GP5B 1A4CA 4YQXL 1AMXA 3DX8A 1MHPH 5E2TL 2NW2B 1Z0NA 2P80A 4GO8A 2P52A 2ODIA 3QIUC 1OEZW 2YXWA 1KXTA 4XAKD 2G9HB 5IKCA 4MA7H 4GXFA 3KPOA 4RIRA 2VDRH 5HHOA 1UM5L 3MRBB 3VFGL 4EDXA 2WQWA 4ODHH 4DZ8A 2UY7B 3AG3B 3G6JE 3D69B 1E6OL 4LHJB 4Y2LA 1LWHA 4OF8A 4FL4C 4L1SA 3GSOB 4L5FE 3D2UB 3IDGB 1MJUL 2YARA 2H1PL 3U30B 1FVEB 4P23D 1L7TH 4XNQA 2E74C 3OKKA 3JQOB 3OKYA 4WLCA 1HHIB 1NL0L 2QL1A 3W5NA 4MJ5B 4POZC 1CR9H 4NQXA 4IBSA 4YXKL 1CFQA 1FV1A 4OQTL 2Q2EB 5E1AA 5C0JA 4OIBA 2XT1B 4AEIH 3FTXA 3E80A 5FO2A 1MQKH 2ITCA 4G6KL 2ZJSL 2CO1A 5EBLB 3NA9H 3RWDA 5SWQB 1IAMA 3ARED 3T2NH 2IBZY 3QC6X 2BNUA 1A66A 3KL3A 1X9UA 3L95A 1U4FA 2EC9U 3V0DA 4PJ5B 5B1JA 3CSBA 1NGQL 2XJKA 4Z7UE 3ABMB 4PJ7E 2ISDA 1RIUH 2HWZH 1NCDL 2PYEA 5CP7B 5IB2B 3L13A 4JKMA 3NVQA 4OSUL 5IGXH 2OYMA 3VYOA 4ZUUA 2Y23A 4HIXH 1OPGH 3G9VA 1YEFL 2JB5L 3H4HA 1REIA 2P5EB 5MP6H 2D31A 2AEQL 3FB5A 4XOEA 2APXA 3JZ7A 3VD3A 1RD6A 3NCFB 4QLRA 4F37K 1YDPB 5ALBL 3MX0A 5K9JL 1KC5H 3HC0B 3NFNB 3DX6B 1U33A 4IOFD 3EJYC 3QHFL 5JPMA 4JY4A 1QTPA 3UTQB 2QVKA 5H37H 1QPKA 4DVRL 4RGNB 3P0YL 4HZ1A 1AGDA 4A2DA 5ACMA 2DMBA 5GS2D 3RZCB 3OWRA 4AQ8C 3HMXH 1WG3A 1JNNL 3L16A 6PCYA 2YGOA 1G7QA 2V4LA 1NOLA 4LEXL 4WKXA 2UY6B 1FIEA 4UDUB 2EE9A 1DUZA 5BZDA 4NP9A 5DJDA 4XNYH 5KVFE 1FN4B 5E9DA 4C4UA 3N85H 1JZFA 3ABGA 3PGCB 4XVSL 1R5IA 4QRPA 4PRHD 3RE0A 3TEUA 3LPWA 1C5CH 2MOGA 2AQTA 4NUQA 3MYJB 3TT3H 1VFUA 4ZMPA 5ACZA 1BIIB 1IM3D 4H2AA 3MLPA 5J06A 4KUZH 5I8OH 4UT7L 3SYCA 5BRPA 5LNGA 2G4EA 3KH3A 4HUNB 4TNWK 3QR1A 4FQLH 4Z7VE 2FX8H 1TJXA 3RTQD 4D9QE 4IBWA 1IAOA 1IZJA 4I3RL 5E2UL 4NWUH 1WK0A 4EZMA 2E4FA 3ZE1F 1A5FL 3QUXB 1T5XA 2HRPH 3UO1L 1NDGB 1L0PA 3PAYA 4QDGA 3VWKC 1WDAA 4FF9A 2AJUH 4P5KA 5KYYA 4EE2A 5J13B 3BWUC 3HZYB 1OGTB 4ZAKD 1MJJB 3KPPA 5HHMD 3KBFA 2BVOB 4WU5B 4XO8A 5IBLC 5HYSB 1RUMH 3RDTB 4BRJA 4XMTA 1M6OA 2WM0A 1OARH 4FXKA 5I1AB 3VDAA 3GS7A 3FHAA 1JRHL 2XKNB 3FU5A 3T1FA 4PCTA 1E5BA 2WTRA 5KVEH 3T2OA 4G1MA 4AH2B 1XEUA 4U1LA 3I3DA 3ILDA 3PS6A 3GC3A 4XAWH 4TL5A 1MFAH 1LD9A 3HBQA 3GXPA 3WJJC 5C9JA 2F0CA 3ATAA 3NH7H 4MA7L 1QA9B 3VD2A 3A6CH 3OB8A 3OKLA 3QDJB 5I19H 1GGUA 1FC2D 3L5WB 1TZIB 5KANG 1G0YR 3QIUA 1JZEA 2VDRL 3N44F 4O51A 3QFJA 4PWKA 4Y5YB 3RKDD 3S4SA 4JCLA 1LO4H 1SOXA 3FHEA 4I77H 4KTYA 4ODHL 3N1FC 1EWHA 3L3JA 1J8HE 4N2FA 3LKQA 1KTJA 4KH2A 3BVUA 5E4OA 3S36H 1A6WH 3EFOA 3OKEB 5IJVB 3O6FB 3S3DB 4HUKB 3CVDA 2GK0A 3VXPB 1TQBC 4Y0GA 2AF2A 3S8FB 1G5GA 3I9AA 4MMZC 4KFZC 4ES8A 3WTVA 3MDJA 4IBUA 5EOQH 4PUBL 1CR9L 5H35B 4PB0H 4DP0X 5FECA 5HJ3B 2F08A 2X4PA 3VFPB 5LXGH 1HL9A 3SKMA 3TA3B 3NA9L 1QKZH 3LPGA 3LPOA 3T2NL 3U0TB 4QIRA 6PAZA 7TAAA 3P9MA 3LYRA 2ZCLH 5LGHL 4GAYA 4FI7A 5L0QB 5CINH 2V5YA 4PBVC 3FOLA 1XTMA 3S35X 1RIUL 2HWZL 3EYQD 1ZSDA 2HFFB 4JG9A 4UAHA 2Z7WA 1PCSA 5IGXL 4FEMA 4HIXL 1OPGL 3TNNB 2G9KA 3WFDH 1ES0B 1I9RH 3L3IA 2EVJA 4CVZA 1D2OA 1KCBA 2DM7A 1G9MH 3C6SA 5MP6L 5K9QI 1SJEA 4JKPH 1XF4A 2PCFA 2P28B 4JRXE 3WDHA 2GSMB 5HHVH 5DVNA 1KC5L 3LNDA 4OZGB 2VN7A 3T0EB 3KYOA 4KVNH 1PJ9A 4UINL 1NEPA 2OSWA 3VFTB 5B39A 3WTYA 3TX4A 4OU3A 1OE2A 4U6YB 2ZZUT 2OYPA 3QW9A 5HVHB 4NERA 1U8KB 2IDCA 4HJJH 3VRIB 5CFAA 3HMXL 3BGMB 1VF5C 1XMWA 4HALA 4FTVA 4Q6IC 1UZ6E 1VADA 1ILSA 4AQ8A 1BAFH 2C1OB 1F3JB 4XNYL 1BG1A 2R1XA 4FLSA 3GI9L 2D0FA 4J3TA 2NY0D 1JXFA 1PIGA 4UWQB 3R0MA 1N2RB 2RIKA 5TTRA 1BG9A 5F44A 3TT3L 3PABA 2NXZD 1PY4A 5HI5D 1VFOA 4P9MH 4NBXB 2NPLX 3AM8C 1J1OH 1IQDA 1EDQA 3L3GB 1OP5H 3GSRA 4L8BB 3V0AC 4O2CB 3FC8A 4KUZL 4OZ4B 2L04A 5I8OL 4JFFD 1QR1A 1DQJB 3MJWA 4PRIE 2X2YA 4QOKB 1TZGH 4FQLL 1CFTA 3O3AA 2FX8L 3CVHH 4NZ8A 4Y4HD 5IMOA 3IN2A 3PQYA 3II2A 4NWUL 5EA0H 2GITB 2H8PA 3ZX1A 2MCPH 3IFPB 4GI6A 1YY8A 2J1WA 2HRPL 1TPXC 4B9IA 2IO5A 4WWKB 3KJ6H 3WE6A 2LU5A 2DYPB 1ZEAH 5IT2L 1OTTD 2AJUL 5D7JB 2QVTA 4J7RA 3CN0A 4LRIC 3QQ3A 3VWKA 5CEYB 3ZHKA 1RUML 4KI1A 1URLA 3OJDB 1OARL 4EPSA 2PN5A 3DIVA 2OL3A 4PTTB 1Z5HA 2VOTA 2ZX9A 4ZMAT 1ZVHA 4WI7A 3BXNA 3GMPA 2AXFA 3DX7B 3ULVD 3DO7A 2AKRA 2XZQL 4PJCE 2YAPA 1ZGLB 2J1XA 3FT3A 5C08B 4XAWL 5SWSE 1MFAL 1NDTA 4KXZH 2FO8A 4PWEA 2VM9A 3MUZ1 4JMXA 1F4AA 2HKFH 5EEYA 3NH7L 2MCG1 2OW6A 3V4PA 2WCSA 4PLKD 1JZ4A 4PJGE 3A6CL 2ICEC 2VN3A 5LNEA 1EGJA 1M7IB 2W07B 2NX5A 3LXUX 1QUNB 5DZVA 1LO4L 4I77L 2Q87A 4J2XA 4TM9A 4EI6A 3PL6B 4MD5A 3S36L 4DJMA 4PEEA 1KN2H 1A6WL 1Z3RA 4DQOL 3T2LA 2NW3B 3KPSD 5KUKA 3LKOB 1II4E 3DRQB 1AHWB 5KVMC 1X5ZA 2R0WH 1HHHA 3AU1A 3W1ZA 4Z76B 1KB5B 4X9BA 3VXUD 3WNPA 5BZXA 1KENH 4JPIA 5LBSH 3BPCA 4PB0L 4GY4A 4YHNB 2OX5B 3HFML 3E9TA 3PG2A 1QFHA 2XQYK 3LRSA 3BWUF 1QKZL 2X1WL 4EN3D 2F5AH 5CLXA 5DWUH 3AG4B 2FHCA 3GF8A 1OXYA 1C16B 3Q7JA 3NA4A 5CINL 3HBGA 2NNCA 1FL3A 1BXVA 4LCWB 1MNNA 3BN9C 4ZTOH 3KWXA 2XIBA 4S1DD 2EXTA 1T3FB 3WFDL 4ZFOL 5F7YC 1I9RL 1RZIA 1MVUB 1MVFA 1BMGA 2FIKA 2EIZB 1MCRA 4K73A 4JKPL 4FQJH 5CO1A 5HHVL 3KPMA 4NDMB 1I1AB 2VISA 4FTDA 3UYPB 4NYLA 5BV7C 4WWPA 4KVNL 4IKKA 1AGEA 4KITB 1B0GB 4BV1A 1Q9OB 5FO9B 4KTEH 2CBOA 4E2OA 3KYMB 4CUCA 5IOKA 5JNYA 2W88A 4HJJL 3H9YA 3D0LA 1FNEB 3MLUH 2NLJA 3L4WA 5E8PA 4ZPVA 1ZLSL 1URIA 1HE7A 3FONA 1ZLVH 3CGTA 1BAFL 2R0ZH 1OHZA 4Q6IA 4HH9B 3PRZA 4JEGB 3WLBA 1GZHC 4MHHG 5MEOA 1OB0A 2ADFH 4P9ML 2B1OA 1J1OL 3DJSA 1WCBB 2FEDC 1V3KA 1QPPA 4U1MA 1KBGL 4ES9A 2JCWA 2P5WB 5AW3B 4GKSB 4ANUA 2GY7B 3L3HB 4R4BB 4G8EA 3AM8A 5I2IA 1TZGL 2NY2B 1MHHB 3CVHL 5HYEA 1A6ZB 5DRNA 4P5MA 3AS2A 5EA0L 5DEFB 1G0DA 4BZ1A 2EUVA 2HTLC 2QQNH 1Z9LA 3KJ6L 4DVBB 1ZEAL 4CNIB 4HIEA 5E00A 5FO7B 1MLCA 1ZOXA 2Z92A 3EYVB 3LV3B 3ESPA 3GRWA 4BFBD 1RUPL 4KAQH 5GRYA 2VDNL 1BJ1H 2GG1A 5F7DA 4CC0A 2JSFA 4WCYH 3D39D 4LRIA 4FA7B 2NUTA 3INUH 4PRNB 2C4XA 1E8YA 2H26B 1H3WM 4WO4B 1QEWB 1RKRA 3GXIA 5ID0A 1ET5A 5AQ0A 4P2QE 1UACH 1NEZA 3TJHC 1W2KT 4PP1D 4Y5VC 1BF5A 2XWJB 2Q9OA 2ZSVB 4TULH 5SV3A 5IHHA 2JH2A 5HYJA 2P26A 3FH7A 3KPNA 1GS8A 3LKRA 4R5VA 1E4XH 5AKRA 4EQ3A 5JXEC 5F3BA 4K3GA 4H1LB 2NY6C 1NCHA 1IM9A 5AAWC 5GZOD 3WNJA 5JO5A 1JRHI 4IOSA 3RBSA 1DVQA 4Z9KB 4LQ1A 3VWJB 43C9B 1IFRA 3CX5K 2BM3A 2GAZA 3CZUB 2UXTA 2ZSWA 2VT0A 4LBEB 3DURA 1H19A 3ASWA 1KN2L 5IG7B 4NKQB 2OJZL 5I30L 1D5IH 3FFCD 1NGXA 3N41B 3QAZC 4O2EA 1IBGL 4P3DB 1S9KC 2R0WL 3MBWB 3L4VA 4Y2DC 1IQWH 2WBJC 1KENL 3BSGA 5EC2A 5LBSL 1GS7A 4J4PD 4WFGD 3DTXB 3DECA 4ZBJA 4XNMA 2GJZB 2YFOA 5GS3A 3M8OH 4NT6B 1UWXK 4ZW6A 2NY4C 3QPXH 3GSUA 3MV9B 4N8VA 2F5AL 4LHQB 3L2NA 4AEFA 3ASOB 3ABLB 2XV3A 3MRGA 5DWUL 2QPUA 5FYJD 2Q8BH 1CDHA 3CUPB 2A9CA 4GBXC 4LOEA 4PJEB 5IZ7A 5TE7H 1F4XH 5CCHE 3C9NB 1JGEA 3V79C 4QR7A 5CWSB 4HAGA 1BVLA 4ZTOL 4JFZH 3GK8H 5KYXB 2OW7A 5CU9A 4KKBD 1Q38A 5AWNH 1SN0A 3RTLA 1ZTXE 2VDLH 4S0TD 2DI7A 4J3SA 2Y7QB 3KH4A 2X89D 1KIRA 5C8JB 1NPUA 4EQ2A 3IFOB 3G6AB 4L8DB 1HSAA 1WZMA 3ZPDA 4AUJA 4GRWE 5F9JA 2DMGA 4RLDA 5JIPA 4KTEL 5TQ0H 3GSNH 5DFAA 2VUKA 5D7LD 5F8RC 3GLEA 1A8ZA 4EUPB 3UTSA 3F05A 3IDMA 3MLUL 4M5YH 4U05A 1YLBB 5LAXB 1E9QA 3MOQA 4Z0BH 2V0AA 3HHRB 1YEHH 3NIFE 4Z5RA 3PHOB 2R0ZL 3P4OB 4QO1B 3T0VA 3DGGA 3IDIA 1OQOA 2BVEA 2GBVA 2O5NA 3GTVA 2FJGB 2RQ8A 1UWEH 2FGWH 5DSCA 1CE6A 3VMOA 2FL5A 5CIPH 2X9XA 1PY0A 2ITFA 2ADFL 2EKSB 3ZE2B 1VFBB 1LXMA 3RWJB 3NK4A 4WW1B 3W11C 1R4XA 2B16A 3WXVH 4TVPD 3FU7A 2Z31D 1GZHA 1KXVC 3EF4A 3GINA 4RFNC 4QXTB 5IB1B 3FBQA 4HZAA 1J05A 5TGBA 2B4CC 5DJ6B 2DIAA 1RU9H 1CCZA 4K5OA 4OZFB 1X5YA 1BJMA 1MCIA 1ZV2A 5CZXC 3BVDB 4BZ1L 1V3MA 4A04A 3BDBA 2OMZB 1DN2A 1BFOB 2QQNL 2ZWSA 5KAQG 3UPRB 1U8IB 3E3QE 3GRWL 5K59E 1IC5H 1I8IB 5T3ZE 3K5RA 4LCYA 4E41D 1U95B 4KAQL 5DJZB 4F9LC 2LU7A 2EADA 1EXUB 3RIFF 2O30A 4PY8I 3OPZL 2A9DA 2BSDA 5AB2A 4WCYL 1AQDA 1FYTE 3INUL 2JCCA 4LEEA 3VXOA 4LOUD 4ODVH 3CCHA 5J1SC 3QZOA 2YEZB 4HX1B 4N1EA 5HHPB 4NNXB 3LVEA 4QHUB 1UACL 2VDOH 5KSAD 1YYMH 1MSPA 2XETA 4RAVA 5KSVB 5IVXE 4TULL 2VZSA 3GZQA 4XVUC 4BYHA 4M6AA 2FYYA 3D25B 3U30C 3UBFA 5B7MA 5CZVH 3B8SA 4UB0H 2CJSA 2ODHA 3WGUB 2OMXB 4ELKA 4TQPA 3EXLA 3FO0H 3LIZA 2Q10A 2H2PC 2X1OA 1IKNC 7CGTA 3O4LB 3HS9A 4JG1L 1XAUA 5AAWA 2RALA 4S1SH 5AOKA 3VAEA 1E27A 3BP5B 1R75A 2JI1A 3QDGE 5D6DC 2EO7A 1D5MB 2W38A 3ARVA 1J12A 3QRBA 3DTUB 4EN3B 1D5IL 2QDVA 2ZXDA 3LZPA 5FGSA 1CE1H 1R46A 1CF8H 2ATAA 3TIDB 1CFNA 1YEIH 1XGTB 1FNSL 4K8RD 1IQWL 4GUPA 1AS6A 1I82A 1U8JA 2D7MA 4P05A 2WP3T 2R83A 2WYZA 2F7RA 4X4ZA 3VU1A 4JHZA 2QADD 3BDYH 3JZYA 3KGUA 3KR3H 5INCB 2WBJA 3TCXA 4P9HH 2X4TB 3AAZB 1TJHH 3IJEA 3QPXL 3II1A 5IJDC 1KV3A 4TRPH 4DF9A 2Q8BL 5JHDA 3QJZA 2JCCF 4W70A 3P2DA 1TJIH 3HG1A 2KT6A 5KBLA 1J9CT 4IEFB 1F4XL 1YMME 3WS6C 2P8PB 2MMXA 1GYAA 1SVZA 2I7OA 1Q1PA 4OF3A 5FW6A 4JFZL 3GK8L 4GBXA 3RNQA 4RGNC 4M6NL 2GSIB 3V6OE 3U6RB 5D2LA 3NEEA 1T1YB 4K9EH 4XN8A 2VDLL 3RZCC 1OD7A 4JKNA 2Y6SD 4R7DB 1P7BA 4DGVL 4RDQG 2YPKA 3VXTA 4PD4K 4XB8A 1AXIB 3T6VA 3GQFA 4OUOA 4ELMB 2DM4A 2KL6A 1OAUH 1FZMA 4PRAB 5TQ0L 3DUUB 1M6UA 2DJUA 1DBJH 4WI2A 3GSNL 2N1KA 3DX4A 2QTEA 1G7HA 2BPBA 2GBTA 4QXWA 5C0GA 3S34H 4MLSA 1NCOA 1PZ5A 3APFA 3CLEH 3KAAA 3O6KH 5HVWA 4TLTA 2A6KA 2QQLL 4U3SA 5BQ7B 1NUFA 2ADIA 5T1LD 1PQZA 3SKOB 5CSGA 4G5ZH 4Z0BL 2F54E 4PRPB 1YEHL 2G2RB 2JJSC 2OR8A 5KBNC 4CU6A 2BRQA 1UWEL 2FGWL 2IADA 3C5ZD 3RVUC 4YVNA 5C0FA 2I24N 3UXFA 1OK0A 4Y7MA 3P3TA 3QUXC 5I66B 4K7PH 4OB5H 1JMXA 1WC7A 3QZWA 5FV1L 4NQDD 4WZ9A 5EZPA 5J13C 3WXVL 1D6EB 4Z7QB 1T89A 4N4YB 3V4VB 3L5HA 2DD8H 4L3EB 1MHCA 3GZOA 3L6FA 1ONQA 3X12A 2G5BB 1RU9L 4RWYH 3RDTC 2XNAA 1KXVA 1RK1B 5D2LF 4OCWL 3F12A 2YQGA 2WZ0A 2L8AA 4LFHD 4ELDA 2BY3A 4B97A 3VD9A 3TIEB 1O7SA 4PJIA 1IC5L 4RRPM 5FGRA 2VC2B 5C0AB 5J6HA 4XP6H 3SE9H 3CPUA 5IJKC 1BZQK 1VDGA 4X0NA 1QSEA 1A6AB 1IC1A 1QI5A 3BZDA 1DJYA 1QTYT 2NW2A 4F9LA 4G59C 4ODVL 4Y5YC 2BSCA 1KXQA 2FQFA 1VB9A 3EJZC 2YRPA 4B9YA 4PR5B 2EIKB 2VDOL 3MACH 1EX0A 2WJ7A 1YYML 4B7IA 1AD0B 2QJDA 3MRBA 1AC0A 1PKQB 2UY7A 4KU1A 3QR2A 2K1MA 3O6FC 3D69A 2EKJA 2Z93B 3GRGA 5DK2B 4JFYB 5CJBA 3T4AB 3GSOA 5CZVL 4MFHA 4GSDH 1UENA 3QYMA 3D2UA 3IDGA 1G43A 2GJPA 4QWWD 4OZFG 4AV0A 4FZ8H 4Z7VB 3RPIB 3FO0L 4M1GH 4KI5C 1BJ1J 3IDXL 1HHIA 3C08H 4MJ5A 4ADIA 4EKJA 3GJFK 3NMEA 4I1NB 3TA3C 1IKNA 2D73A 4KXZI 1HEHC 2ZP0T 5I28A 1TSRA 3OR7B 4J3OG 1CE1L 3ZGHA 1CF8L 2C9XA 5L0QC 5EBLA 5D6DA 1YEIL 1IVLA 2CH8A 1FFOA 1KFAL 4MD4B 4PJIF 3QNZB 3TEZA 4LE8A 4Z77B 3MBEB 1ZGLP 2G60H 2V8LA 4PJ5A 1WFOA 5A2BA 2VR5A 2NT0A 3KR3L 3CJJA 4P9HL 1OE3A 5CP7A 2X70B 4LL1A 1TJHL 2GIMA 1S78C 4HUXB 4JJ5B 4XMWA 5IB2A 2AQQA 4L4VE 4TRPL 4JE0A 5F7FA 3D85B 3O2VH 1G1KA 2PTUA 1R9FA 5HJDA 5HDBB 1MFUA 4H8QA 3T0EC 5I0ZA 3PP4H 2OTUB 3VMPA 5I1IL 2V2XB 4JDZA 1FFQA 3MUGB 4X6CB 1YDPA 1S8DB 3ATDA 3HC0A 1A9EB 3NFNA 3DX6A 3UAEA 3IAGC 1RJCA 5HVHC 3WS6A 3Q48A 4KMQA 4MS8C 3UTQA 1DTUA 2ZAHA 1Y7VA 2QV2A 2V9UA 1UXLA 1NAMH 3SKUD 1UA6H 4G6AC 3RZCA 1OLZA 1S9YB 1MCEA 2VQ1B 1WHOA 3DVFA 3MNWB 4QAWA 1ZCRA 2YN3A 2ZUWA 4BRVA 4UTBA 1OAUL 1QSFB 2ZTBA 1ACCA 1IBYA 2K70A 3WNIA 1DBJL 2RTTA 4UDUA 2AJYH 2DIEA 3EO9H 1FN4A 4EJ1C 3KEHA 3S34L 3PGCA 3CLEL 4KBPA 3O6KL 4G9FE 2IH9A 2GJ6E 1DQLH 1E9OB 3GMRA 4DP9X 5KSBE 1K2DB 3MYJA 4PJ8B 4G5ZL 1P9MC 4JGJA 1KLFB 1BIIA 1U8LB 3PREA 1AO7E 4D7PA 1BQLH 4BE5A 2V5MA 4KJWC 4QTHB 1G6VK 1T1ZB 5DEZA 4X99B 2HMIC 1UXWB 1JZ7A 4WTZG 1C08B 1SJVA 2JJSA 4ZSOB 4YHMH 2NZ9C 5LQBH 4K7PL 4OB5L 4WWKC 5K1VA 5B3JE 3M7FB 2N0KA 5EZOH 3M7OA 5D7JC 5K69A 2DD8L 3AT9A 5CEXB 1GY2A 1YQVH 2ICCA 3IE9A 1B9KA 4XO4A 3HZYA 1OGTA 1OP4A 1MJJA 2HUHA 1XCQB 5FWQA 4NCDA 4WU5A 3HG2A 2PP8A 1K3IA 1N4XH 4GP8B 4UOJA 5HYSA 5FS5A 3RDTA 3F83A 4LLQB 4FQQB 5I1AA 1VCBC 4XP6L 2BIOA 3QEUB 2GC4C 2XKNA 4WV1B 4X9HA 4JQIA 5AW1B 1QVOB 3MJGX 2EC8A 4OVVA 5CJQH 4IBLT 2YIHA 4AH2A 1H6EA 4G43B 3TBTB 5E94B 5IJKA 3N43B 3DK2A 3P0VH 1OF2A 3Q01A 3GLDA 2HX7A 4WK2B 3OHXB 3B2MA 1QA9A 3HNSH 1E3XA 3KWTA 3QDJA 2YFNA 1TZIA 4RFEB 2FJHB 5AAPA 4Y5YA 5F1IB 5DMGC 1SOQA 5DEGB 5M95B 1N10A 3PL6C 1I4FB 5K1NA 4HK0B 1FL5B 3H2WA 4KO6A 3IDJB 1AHWC 2NDGA 1TCMA 4WKZB 2ZNXA 3OKEA 5D7EA 5IJVA 3O6FA 4IDJH 3PNRB 4D9QD 2EXYD 3H0TB 2HLAB 3VXPA 4M7KL 1GYWA 4FZ8L 4BKTC 4KQ3H 1UWFA 1I9JH 2CCWA 3C08L 3JBG7 1VGEL 5H35A 4M3HA 2VR3A 5AFAA 3IK2A 3ARXA 5HJ3A 3T2QA 3DV4A 2BNRE 4W4NA 5GXBB 2PXYA 4NQCB 2KZWA 3VFPA 1RZKC 4PVMA 2W94A 3U0TA 2A2QT 5KJRH 1IILE 3QZLA 3BZFB 1UVQB 3RP1A 4MQ7B 2YUZA 1ZA3B 2G60L 1WYJA 3GXNA 4JVUA 4WUUD 3VXMB 5IFHH 1TITA 3BUPA 4D2NA 3US9A 4DPCX 1I7RB 4G8GE 5K39B 3QCUH 4KNTA 4PGJA 3FCUB 5D1QE 2HFFA 2XTJD 2VDPB 2R56H 3B2PA 3UAJD 1CBJA 4N0CD 3TNNA 3SO5A 1ES0A 3O2VL 5IMLB 1I1AC 1W6WA 1FWXA 4C55A 5AKSA 3PP4L 4RISH 2CA3A 1A9BB 4CL7A 3ILQC 4PV8B 1LP9B 1TENA 4OZGA 3T0EA 1EO7A 5TDOA 4MXVE 3P77B 4K15A 4AYDC 2XWXA 5D72L 3VFTA 1J8HD 2ITDB 4UQ9A 4A63A 4U6YA 1S7VB 2M83A 1NAML 1UA6L 1U8KA 1PDKA 3T3MB 3HHMA 4ABVA 1LMKA 5JORB 3SKJH 1VRSA 3DMMD 3BGMA 3MFGB 1OHQA 1IARB 2E59A 4N6QA 1UOLA 3ZKXB 1EFXD 1O7DC 2A4EA 3LH8A 3MRNB 4JL1A 4JN2B 5TF1H 2C1OA 1F3JA 4H26B 3EO9L 3VI4B 1K8DB 4YEFA 2PABA 3MNVB 4KI5F 4EF3A 3TEWA 4NAMA 4CU8A 1DQLL 5FYKH 4FQCL 1XT5A 2RHEA 3SGJC 4P23B 5JHBA 4KK8D 1JZ3A 3MLSL 3L3GA 3S96A 4L8BA 1BQLL 2NY2C 3BPNB 4O2CA 4OZ4A 3UTTD 4A2EA 4M8VA 1U41A 1Y18B 3SGDI 1DQJA 1P9MA 4QPEA 4P5TD 4QOKA 4BQBA 4JM2B 1ECZA 3HS0A 1MPAH 4YHML 5LQBL 2XN2A 3D7PA 4WHCA 5EZOL 1F86A 5DC2A 2GITA 5HD8D 4JUTA 3IFPA 4F9PC 2MEJB 1RULH 1QO3B 5GS0H 2ZUVA 2DYPA 3J2PA 4FN0A 4JRXD 5B4MD 3HAEB 4OZGF 1WICA 5D7JA 5CS7A 2N7BA 4DESA 5AENA 1PL3A 4B5EA 1N4XL 5CEYA 4I2XE 2CXGA 4WO4C 1CL7L 2FCBA 4WTXA 2WINA 2WQAA 3SDCD 4XT1C 2KZBA 3OJDA 3VYNA 5I8KH 1OV8A 1UM6H 4NUGL 4PTTA 3U0WH 1Z6JT 1MCQA 4L8CA 2C7UA 3B5TA 2H6PB 2P3YA 1PLCA 3DX7A 3QO1B 5CJQL 3M6DA 4Y9CA 1NBYB 2EXWD 4Q97A 4J8RB 4APQD 4P46D 1ZGLA 4XI5C 1DO6A 4KKLC 1OTSD 3CFBB 1H6FA 4LCCB 1M42A 1TQTA 3ARGD 3P0VL 4Z7NE 1ZV5A 2ICWJ 5E51A 3WEMA 2ZG3A 1Q4NX 3ZJAA 5GQBA 3BIAX 3DJ9A 4FLQA 3QEQB 4I7ZC 3HNSL 3ZHDA 3AGVA 2YN5A 4J6RH 3K81A 3VWJC 1XWVA 2HA1A 1GOGA 1HS6A 2HT2C 3MJ8A 4LMQI 1M7IA 2W07A 1QUNA 2CIKB 3BEWB 2J8UB 1NC2B 1UD4A 2FWSA 4KKCD 4PRID 3AITA 2FECL 3PL6A 4G7YH 4PRHB 1EZLA 3PV7A 5E6SB 2XG5B 4LB8A 2W65A 3BAYA 5K93A 1X7QB 3FW6A 3LKOA 4FJ6A 4LL9A 2IPKB 2W92A 1BV8A 3QDAA 4KQ3L 2B5IB 2NXYD 5E2JA 5I73B 3BPLB 1J0KA 1HZHH 3V9EA 1U30A 5I6NA 3E6FA 3LS4H 2OKMA 2OX5A 4KZCA 3RTQB 2R27A 3ELQA 2DKUA 1OO2A 2G3MA 4KFMA 1VZHA 2IMMA 3LEXB 5HTSA 3RILA 1BWWA 4XMLH 5KJRL 2BSRB 4GAGH 4O00A 2DLIA 5TE6H 3KS0H 1C16A 2A6IB 3ECUA 3LB6C 3RI5F 4KK6D 5IFHL 4Y19B 3S88L 2HKAA 1SHWA 4IJTA 5HHMB 5INDB 4WSGA 1TNMA 4LCWA 4FA6A 4GG8B 5BO1L 4CDGC 2H45A 2R56L 2XWDA 1C5DB 1T3FA 3HS8A 1VAHA 1MVUA 5ITFB 5SWSD 2EIZA 4MNGE 4LGRB 4RISL 4PJFE 2B77A 4G6FD 4G8IB 1ZVYA 2C4FU 2OP4H 3G08B 3L5XH 4NDMA 2FO4A 4UILH 1FJ1B 1B0GA 1Q9OA 2QZQA 3FB6B 5IV2A 1EJFA 1XL4A 1R34A 3RVXD 4QKTA 3X1EA 4XPBL 3W2DH 5FUCC 4B27A 2O61B 2NY3D 2RGSA 4HOXA 1FNEA 4J27A 3T04D 4X7TB 4QXUL 3ARTA 4DUVA 1KJ3H 3L3KB 2WO4A 3QC5X 1PF3A 1EDYA 4WNSA 3I74A 1NFDB 4HH9A 1GJWA 4R90H 3BESR 2FHFA 5C2BH 4LLWB 3VJ6B 5A7BA 5ACLA 1WPCA 5LGYA 3VXRA 5C0IB 4NHUA 1WCBA 2IAND 1MW2A 1JZ5A 1SUHA 3SGJA 4HD9A 1MF2H 1UGKA 4KZ0A 5DMJB 3ENEA 4GKSA 3L3HA 4Z6AT 4KKAC 1JG9A 5GGRB 2X6VA 2CLRB 1MPAL 1MHHA 1RZFL 1ZANH 1A6ZA 2QMKA 2WJ5A 5B21A 4BFKA 5C6WH 1U3NA 2CJ3A 1N64L 5DEFA 1GA2A 4FOMA 2X41A 5GS0L 1SDAB 2Q0ZX 4DVBA 5T3XH 3MGTA 4CNIA 2AGJH 4LVNB 4IRSB 1HAWA 5KN5B 3LV3A 4F9PA 3L5JA 3NBNA 3LZFL 4XHJD 1ZLWH 5KANI 1CFBA 4J28A 5GSRB 1DQIA 1SF3A 3L54A 5C6TH 4MX7B 1KOAA 5I8KL 4PRNA 3X17A 3NTCH 1F6AB 2H26A 1UM6L 5EF2A 3ISYA 2JTDA 3U0WL 4WO4A 4O02B 1SLUA 3OR6B 4KO5A 4Q74A 3DKHA 2VLLB 2FSEB 3DC0A 3FH8A 2XWJA 5AOIA 1T0MB 2EDMA 2VQTA 4FXTA 3EYOA 4NI6A 3MRIB 2ZSVA 1EZVY 4XE0A 3K6DA 2E76C 2X1PA 3B2UD 5IHUL 1JF1B 1JFHA 2DQJH 1R3JB 3GJFB 2APWA 4ORZC 4MCMA 3IU4H 4J6RL 4H1LA 1E67A 2ZICA 2IWKA 3LOWA 1H3GA 1FBIH 2CUHA 4YZWA 1IO4C 4M03A 5EO1B 1Q9LB 3CH1B 43C9A 3VWJA 4AGOA 5AVWB 3ES6B 1H3XA 4LBEA 4G7YL 4OGYH 3EH3B 5IG7A 3TOPA 4LSDA 2JIXB 4C56E 4MAZA 4TF4A 4KJQC 1OGAA 2OSLB 1ZT4B 1QZNA 4P3DA 1AANA 2OR9H 1MCLA 1W8EA 2GVYA 3QB7C 4JFFB 4LPWA 2X42A 1HZHL 3CBKB 4ONOA 5FHAL 5FUOH 2EUXA 3OLDA 1IFGA 3LS4L 1F2QA 3EIFA 4IGBD 2GJZA 3OPUA 4N3UA 4NT6A 2IG2H 1I3RB 3MKGA 3WY4A 2CHWA 4XMLL 1MJ8L 3MV9A 2YKLL 3KXFB 5TE6L 5JHLH 3WHE0 3CUPA 2ATKB 1OLLA 4PJEA 4MD0A 2DW5A 3C9NA 1EA9C 5AVXB 3OZ9L 4RSVA 2F1EA 4Y9FA 4U1HA 5JTWA 5KYXA 3EGDB 2YA0A 1J0IA 3STLB 2MSPA 2DQIH 4OTXH 5L2KB 5CD3B 5I1GH 1I7UB 3FNKA 5C8JA 2OP4L 1SBSH 3L5XL 3MV8B 1XGYH 3IFOA 3G6AA 4F3FA 3B4NA 4L8DA 4UILL 2UWEE 1FCGA 1KCUH 4XX1E 5GGVY 1JTPA 4OFQA 4RDQF 2P42B 2J88H 1V55B 2IDSA 3PWLB 3L8QA 5AW6B 1NCAH 3W2DL 4EUPA 4MAYB 4QD2E 3PDOB 4C58B 3N41F 1M71A 4YDLB 3X11B 5DMIH 1S9WB 1TEGA 3IBEA 1KJ3L 3OD3A 4AL8C 3V4LA 2VLRB 4B0MB 3PHOA 3P4OA 4X98B 4QO1A 3OKMB 3Q6GH 5GSVB 4ZG1A 1IL1B 2DQDH 2FJGA 4R90L 2Z1KA 3MMEB 2X4UB 3AQYA 4F37F 5C2BL 5L88H 1HNGA 4U6VH 4AIXA 2D8KA 1JHTB 3N91A 5TDNA 1V54B 1S9VB 2EKSA 1VFBA 2GIXA 4FXGB 4L8SB 3RWJA 4WW1A 3ZR6A 3KLHD 2VYRE 4BUGA 1N6UA 5DURD 1MF2L 4PJEF 1ZE3C 3FYEB 4QXTA 5IB1A 5HVFB 1QWHA 3GKWH 5DQ9B 3LS5H 1PAZA 5DJ6A 1ZANL 2P47B 3FSWA 4OZFA 5TF0A 3D0VB 3SIKA 4ABQA 1UJTA 2DQCH 1TJGH 2OMZA 3WFZA 1RQ5A 1CIUA 2OCFD 3BZEA 1E5ZA 1BFOA 2H0JA 3RVWC 2H9GB 1Y0LB 1U8IA 4J3OH 5BZWB 5T3XL 3UPRA 3RBGA 2AXGB 1EANA 2AGJL 1I8IA 4MZIA 1U95A 5DJZA 1EXUA 2YD2A 3EDKA 2VE6B 3VG0H 3Q1SH 4BK5A 4U7SA 4NWTH 5FUZH 5C6TL 5CJXC 5DU7A 1JWUB 3NTCL 2JK5A 4PMFA 1CGXA 1YECH 4I0CC 1NCGA 2YEZA 2GPZA 4HX1A 2NOYA 4OBRA 2JMRA 4NNXA 4TNWF 2VNCA 4IK6A 4L1TA 4ZFFA 4JFQB 3EFDL 3WEXB 1TQWA 4M4PA 2WXQA 2HJLB 3T4AC 1YJDH 2CHZA 4BQ9A 1JPSH 4Z7WE 5C86A 3GM8A 3HR5B 2DQJL 2O6FA 1CL7I 2V5TA 3D25A 3QUKB 5KBKA 3IU4L 5SWZE 2QVFB 1FHGA 1A21A 4QHLB 3GBLA 1O9WA 2OMXA 3TFKC 3ZE2F 1K72A 2LVEA 3T2PA 4MZ2A 5HVGB 2QKIB 2VABA 3O4LA 1E5UI 5IW3A 2EIDA 4OGYL 2Y7MA 1D5MA 4KNUA 4WU7B 1E5YA 1T7XA 4CU7A 4Z7IA 1B0RA 2X4NB 3JWNH 4H8WC 3MBEC 4JVPA 1U3HD 3WNKA 3TIDA 1CXKA 1XGTA 5FCUH 4HBCH 4BZ2H 1XGRB 4OLWH 5FUOL 1IGIH 5T3ZD 1HXMB 4J3OF 3A0OA 1TVDA 4ZTEA 3UDWC 32C2B 5INCA 3BQUD 4R0LB 2X4TA 4XTRD 2ED8A 3AAZA 2YMOA 4XB3A 2FECI 4XR8C 3TJEH 1P7QD 2J4WH 4N24A 2B3IA 1FYTD 5ICXB 1MI5B 5ISZB 3QWOB 1E5CA 2FE0A 2E86A 4YDNA 5D7SH 3CK0H 1KN4H 4IEFA 4AENB 1T2XA 2P8PA 3HB3B 3TO4B 4WSKA 5AALA 3VGAB 1AAJA 5IUSA 2GSIA 3U6RA 1N26A 1QLEH 1T1YA 1JOIA 4KRPD 4ODUB 4PW4A 4ETQB 5MEQB 4UBDD 4YLBA 3SQBB 1ITBB 4OTXL 4R7DA 4NENB 5I1GL 3TBYA 2EDKA 2NY5L 1SBSL 4XMPL 5C0RH 1XGYL 1ND0B 1F5WA 2A9MH 4MHHI 3P4LA 3ILPB 4PRAA 2NYYC 3DUUA 2J88L 3V9CA 2X0VA 1EH9A 1NCAL 3QDGD 4PJ8C 2XTLA 3WKNA 1G1OA 2L0DA 3S3PA 3KS0J 4LEOB 1C9SA 4XNAA 3SOTA 5BQ7A 3NPSB 4WVRA 5IQ7H 5DMIL 4UT9A 4QHKI 4OCXH 3ZKNC 4PRPA 2G2RA 3GDBA 3QAQA 4A2FA 2Q76B 3Q6GL 1BBJB 4XWOD 5KVGH 4PPTA 4HJEA 1CDCA 5L88L 5HHOE 2DI8A 4UZGA 4U6VL 4L0YA 5I66A 4Y16D 3AROA 5D7HA 3R7QA 1ZHNB 2IC2A 3LNIA 5AW5B 4A1RA 3BAEH 5D4IA 5EIIB 4BQ6A 3RX7A 3SJVE 3K4ZA 5DJXB 1YMMD 4L3EA 4WY7H 3GKWL 3H42H 5BO0D 1ZIBA 3LS5L 1UD6A 2G5BA 4LLUB 5FX3A 5KTEH 3IWUA 2ED7A 4P04A 1RK1A 4FD0A 2DQCL 1IJ9A 1TJGL 4YZFF 3F7KA 4WV1C 4GQZA 4ENEC 2ATPB 3TIEA 3O9WB 2WB7A 4ZX3A 1QBAA 1GGCH 3D18B 5C0AA 4IJ3B 1JTTA 3CN1A 5E2VH 3MJ9A 5BMFH 3EBHA 5CEZH 3TNMB 3L7EB 4BELD 1A6AA 5JDSB 4EIGB 1SDYA 3VG0L 3HZVB 3NAAH 2YWZA 3EYFB 4NWTL 3OHXC 4OCLC 1DSWA 5FUZL 5J57B 4F5CA 4ALAL 4MRBA 5GJSH 5D1XA 3EH1A 1FZJB 4E9RA 4R9HA 3B3IB 2PYEE 2R69H 1G9NH 5CJXA 5DJ2B 1P7KB 5TE4L 1LJMA 5KS9B 1AD0A 2J20A 2DOCA 5EU5B 3ZE1E 5ESVB 3F8UB 4EAEA 1YJDL 1PKQA 1JPSL 1UJ3B 1F11B 2FEJA 4KGLA 2Z93A 1BMWA 1A4AA 2D7TH 5DK2A 3NCYP 5GPRA 4JFYA 3C6LD 2VDKB 3OAWA 4M9OA 3P9LB 3DX3A 1EEQA 5D71H 5LBVA 4BBWA 2XQYA 4PBDA 1Q0EA 1I8AA 3L2LA 4Q58C 2KLTA 3RPIA 4M56A 5BUAA 4NO0D 4PM1A 4Z7QF 2R4SH 2Y4SA 3J07A 2JFCA 4X9YA 2WGNB 4HISA 4IU3B 4G70B 4P4KB 4AE0A 1JVOA 2CNYA 3OR7A 4OFIA 5C0NC 3K3QA 2LU3A 4AGMA 4NKOB 2BSSB 4F8TA 3B6SB 4GEIA 1MW3A 1SMOA 4HBCL 4BZ2L 4HGWB 4XP4H 2QQQA 3QNZA 4OLWL 4PJHB 1IGIL 3MBEA 4JO8A 1R3LB 4OT1H 4QRPE 4Z77A 2UZIH 1UOWA 2IDFA 1T6WA 3S6CA 2I07B 2X70A 4HUXA 4JJ5A 3TJEL 2DLTA 2MCAA 1BZ8A 2NR6C 4JW3A 4NC2B 2J4WL 4XCNB 3UDWA 5BVPH 4KY2A 4TUOA 3T6ZA 1QNZH 3D85A 3HRZB 1VESA 4GFXA 3K6SB 3HUJB 2DV6A 3Q1EA 2E6QA 2OTUA 4N20A 5D7SL 3ZKMC 2V2XA 1D7FA 1I1RA 1KN4L 1L9SA 4U2ZA 3OC8A 1EHNA 3KPLB 3PE9A 3MUGA 1E65A 1V5JA 4TVSa 4X6CA 1S8DA 3ARFA 1A9EA 1SXBA 4DSYA 5JQ6L 4JAMB 3J7HA 3R4DA 2M2DA 2KS0A 2OMYB 5L9DL 3CMGA 3GMNB 4XBMA 2WW8A 3ZKXC 2E7MA 3BVVA 1L9TA 4GSXA 4L1LA 1K5WA 5C0RL 3K2UH 2QEJA 2Y24A 4DQAA 3VFSB 5C3IA 1S9YA 3VCLB 2VQ1A 1FNGA 4OZIE 3MNWA 1RMFH 2Y69B 2BZDA 1QSFA 4V1DD 3FCSB 3BPOC 4FFTA 4UI2A 5EZJA 2B9BA 4P23C 4APXB 1JV2B 1ZHBB 3N6YA 3B37A 4UT9L 1A7NH 3MLZH 1E9OA 1YQ2A 2FEEI 3BPNC 1YEGL 1K2DA 4MXWH 4TLKA 5JQHC 4PJ8A 1T6BX 4OCXL 4PFEA 3KNBA 3MRQB 3VM7A 1U8LA 1DJHA 3DRTB 4PI2A