4RRPM

Crystal structure of the fab complexed with antigen asf1p, northeast structural genomics consortium (nesg) target pdr16
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
153
Chain Sequence
b'GSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab antibody, light chain
molecule tags Immune system
source organism Homo sapiens
publication title Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics Consortium (NESG) Target PdR16
rcsb
total genus 27
structure length 153
sequence length 158
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4rrpM00
4ZBJA 2CU9A 2Z34A 2IO5A 2IDCA 2Z3FA 1WG3A 4RRPM 2DZEA 3AADB 2HUEA 5C3IA 4EO5A 5BNXD 2IIJA 1ROCA 1TEYA 2I32A 5BO0D 2YGVA 5EIIG
chains in the Genus database with same CATH superfamily
4HC1A 4NN5B 1ZHKA 1YEWA 4A6YL 3NJVA 1KBGH 2PPEA 4LLQB 3FTWA 4BE5A 1MVUB 2C3XA 3A6CH 2BFVL 3ARYA 3BIKA 3LNHA 5BRPA 3ZHDA 2Z7ZA 3GSRA 5FA3A 3VXUB 3A6OA 4P5TB 1AP2A 4UQAA 5BVJA 1J5IA 2WVVB 5JLZB 1KJVB 4GW4A 3JWNG 1UZGA 5IHUH 2D7NA 4IIQC 5HGGS 1Q9WA 1TCMA 2F58H 3MREB 5DRXA 1A9BB 1E40A 1LP9E 2UWEA 2FJSA 3B7TA 3PWPE 2DQGL 3CMOH 4LKCA 5B4MD 3TIDB 4X7SH 4XVJH 1S7WB 3PGFL 4C56B 5LQBH 2V9QA 3MV8B 3NH7L 1WAAE 1SXAA 1B4RA 2ZSVA 3HHMA 2J72A 1NCCH 4S1RH 5TDOA 3NK4A 3DETC 4KQ3L 4LMQE 5HGDB 3JT2A 3G6AB 1AMXA 2A83B 4ZAKD 1AHMA 2BOBB 2JXMA 2WP3T 2DQCL 1ZSHA 4G80B 4G9FB 3TZVB 3BZFB 3QJZA 4E41E 5C7ZA 1ZOXA 2NNRA 4JFXB 3WHE1 3FSWA 3MLWL 4TULL 3EYSL 4PW9A 4H0IA 4JRWA 3U9WA 3QUHA 3KJ4B 4N25A 4OGXL 4ZUWA 1AS7A 2K7PA 3ZSSA 2ZPKL 4PP1D 3PQYA 1AKPA 1HSAB 3H2WA 3ULUH 1NFKA 2Q76B 3X3FL 4NM4L 1WO2A 5MERA 2IWGA 3DO3A 3ESVF 4HISA 4IHOB 1CVRA 2GI0A 4JG9A 4HMDA 3WO4B 4TSCH 5KS9B 4CMMB 4CVXB 1BJ1H 2KPNA 5B8CA 5IVXF 4N8PA 4S1DD 4IM8A 1EAPA 1CXEA 4GI8A 4PY8I 3PWNB 1A4CA 1TKWA 3B6SB 3IU3A 3BVNB 4I1RA 1OSYA 1UB5B 3KWWA 5J13C 3U9PH 1WFUA 3A67H 32C2B 1D9KB 4U6VL 3IM1A 4XZUA 5D6DA 1BDYA 1TZ8A 2BS9A 4HU2A 4KO6A 2WN2A 5DDHA 1RKRA 3FPYA 5GISH 3KXFE 4KJWC 1U30A 2ZCLH 3TLRA 4P9ML 3DRQB 4HF5H 4R7NB 4BSVA 1UD8A 3PFQA 4KK8C 1G7PB 1U4FA 3QJTB 2C26A 5IREA 3DIFA 1J0YA 5EOTB 2EDLA 4K71C 4U6YA 3AGVA 2FQFA 1SJHB 3GHBL 2PYFB 4MNQA 3E6HB 1XCTB 2LLNA 1CLVA 4KH2A 5IHZA 4PY7B 1WD9A 4A7GF 3QG7H 3NTCL 3H0TA 4BRVA 1X6NA 2Z31A 5I1IH 4FCHA 1DUYA 4GBXD 4YSRA 3NJXA 3LSOA 1ADQA 3GB7B 2EYTB 3WY4A 2IV9A 3LRHA 5L6YL 1WFOA 4A7UA 5BS0B 3UGEA 1FFRA 3DX6A 4NAJA 3V0AC 1ASQA 1RJLB 4FTVB 4CU8A 4PUBH 2XTLA 3VFMB 1CQYA 4N2AA 2D4DA 4KX9A 3QJHB 4NO3A 3BD5A 3FQWB 4RAUB 1TDQA 3T0BA 4Y7MA 2IBZY 3SYAA 2EVGA 1X3DA 1ZHNB 3ABGA 2X4NB 5E9AA 3KYOA 4NWUL 2C9QA 3C5ZA 1IUZA 3LQAH 5FKAA 3B3IB 1NIEA 2IAMB 5SWZD 4L1HA 2W60B 4WKZB 1RK0A 2BSDA 2AK4A 4QHNA 1TTRA 3DBXA 3MOBH 4QTFA 5DLML 4TSBL 3MRCA 3FQUA 4XMLH 3KPMB 3TV3H 1IM3B 2HVKB 5I75B 2LHAA 4GXVH 2NY6D 4L1LA 3TA4D 5DJ8A 3GSVB 3FB8B 3E6HA 1D9KC 1QI3A 4AL8L 1MCIA 2F7IA 2YS4A 2CO2A 2EEBA 4F33A 2YN5A 4MSWA 5DD3L 1LWJA 4GBXC 2KQNA 2YRZA 4DGYL 5J1TC 3TXAA 5JPNA 3IPEA 4HOZA 1FWXA 4X8GA 1M53A 3GPSA 3IMBA 1QW8A 5CWSB 4ZPTB 1JGEB 3TBTB 3VFGH 2J1ZA 1NUGA 4YSDA 1AGCB 4HX1B 4I7ZC 5FUCE 1LHZA 4P2QA 3W9EA 3ZE1F 5C0JA 3U2SA 4AQ8A 3CFQA 3BKML 3FHQA 4MCNA 3VXSA 4OQTA 4TXVB 5E2TL 1KN4H 5KG9A 1EAPB 2B0SL 3ILQD 1FNEB 1YPZE 5INDB 3QHTC 3VACA 4FI6A 3E8UH 1DQDH 1UD4A 5T3XL 4HK0A 4N5ED 4M7LL 5B8CB 4G6AD 2P5WD 1HI6B 2DY2A 4PW3A 2BSCA 4NOBA 4XOEA 3ULSB 3WXWH 3WE6B 1ASOA 1U8NA 2V2XB 3ZHLA 5JHLA 5D7LE 3CX5K 1A21A 3K2KA 1OPGL 4LLWA 1IGIL 5D1ZI 1SBBA 4Y7OC 3CE1A 2VWEE 1I1RA 4QD2E 1JZGA 2WY3B 1RUPL 5KBKA 3CCHA 2Y2TA 1KBVA 3TO4B 5DD6A 1EDHA 4FFYL 4Z78B 3VO0A 4PJIA 2AJ3B 3MLZH 4G7QB 4KHTL 3OG4B 4CA4A 2WXIA 4JFWA 2QVFB 3GUTB 5KS9E 4BWUA 5KVDH 4AGOA 1YY9D 1VZHA 4UT7H 4QT5B 5DVMA 5FGBA 1ZJAA 4TVPE 4M7ZB 1F3DH 2X1PA 5C08B 2DDQH 1PX4A 2VC2H 1NUFA 5EIQA 5DMGC 5FIEA 2ZPKH 4MS8C 3WELA 2ITFA 1ZS8B 1M1XA 2B59A 2I69A 1WITA 1YPZF 3O2WH 3R4RA 3VG0L 4L0PB 1FFQA 2VL5A 3MOAL 4RFOH 1X5FA 3HLKA 1KCLA 5DK0B 5EV7A 3WMSA 4ZMVA 3DMMB 4QGYA 2AJZB 3DV6B 3CDZA 1OOWA 2J57A 2VM9A 3M7FB 2JJTA 4ZNCD 4E42B 1KPVA 3BPNB 2EIBA 1WZ1L 3LEYL 3TYFA 4FG6C 4A7TA 3GMPB 3O11B 5ADOH 1J10A 4YWGH 3TBSB 5I1GL 2VUYA 2WMPA 1AD9B 3BZDA 4MMXC 3MRDB 3BCDA 1S3KL 3AQYA 1OK0A 4IBZA 2H32B 4AYDC 2BSTB 3CFKA 4YXHL 1PY4A 4FC3E 1PY9A 4BM7A 4TVPL 4MXQC 1ZY9A 2NLJB 1E4WL 1EJ8A 4QF1B 1UCBH 2H0PA 2YC1B 1KENL 3O4LE 5IUCA 1HEZB 4JFDE 1PG7W 5B39B 3KH4A 4MJ6B 4WENB 3BRFA 4JO3H 1DN2A 3GBDA 4E0RB 3ZKQD 2MHAA 4L37B 1EAJA 1U91A 3VXPB 2YRPA 1SLUA 4N68A 1K4DA 2PMZA 3UTTB 1L9RA 1R4XA 4BZ2H 3KPSE 1IAKA 3ARDC 4U3SB 3BSHA 5FYKH 3SQBA 3LNIA 3NZHL 3HW7A 3VXME 1MW0A 4UU9B 1L0XA 3TONA 3L48A 3U30B 4QPEA 5MEND 2D2CC 1R5WA 1E67A 1XL6A 2CKNA 3PPSA 2GSGB 1OTSD 2QQLH 3QUYD 2BOBA 5KOVC 5I30H 1XGUA 5JOFA 5M94B 1HZKA 1EJOH 1FYTA 4QCIA 3VSTA 5DMKA 5BXFA 3CHRA 1RSYA 3TVMC 4L8BA 3WXWL 2Y7QA 2N59A 1D5BB 2P45B 1BVNT 4WUUA 4APQD 2EC9U 3MRDA 2Y69B 3GRWL 3TA3D 3W37A 4UYPA 1QHPA 3RTLA 1Q9OB 1BM7A 3MUHL 4RMUA 4BGLA 3IDYC 3GGWB 4JZJA 2HPTA 5CUSL 3N43F 3HLAA 4OZIF 2E7CA 4HPHA 2Y22A 5D7IF 1OALA 3WDJA 1DQML 1EVUA 4BCYA 3UZEA 2VQ1A 3CFEB 3RDTA 1PEWA 4FJ6A 4P2OB 1G6VK 1R46A 2PPFA 4PS7A 3BEVA 2X10A 1WWAX 1P5UB 3I2CH 1HXMA 2XXCB 4XXDA 5I5RA 4TNFA 1XGTA 1M7DA 1E4KC 1EXGA 3ROOB 4KTGA 1KCWA 2A6JB 5T1LA 1XFPA 3QIWC 1T20B 3W9DA 5ANHA 1TNNA 5T1MA 4UOJA 4I3SH 5I1HH 4FZ8L 2G75A 4WU7A 4X6EA 3TPUB 3QUMA 3KHQA 5K9JL 5EZJA 1PCXA 1T6WA 4ZXBA 2Q9OA 3MJ9H 4KKRA 3T4AC 3F6IA 3WHXA 1NA8A 2AW2A 5EZIH 1LNUA 3IKCB 4XAWH 3SKJH 4YK4C 4PJBF 4L2YA 4HDIB 4CBPA 2F9BT 1KCRH 2VR6A 4GRLD 1UJ3A 2PP8A 1C9SA 3K2UL 4DEUA 1QR4A 5GPRA 3RY6A 3ZR6A 1NCTA 4FKKA 2EKJA 3KCPA 4H2AA 4QTHB 2QTEA 4Y5YA 3QO0B 4LRIC 1AGBA 4NO2A 4R90H 4XP4H 4RGNB 4XRCA 5G4NA 4R2GC 1V7NL 3K5SA 3S4SG 4OKVA 4BWWA 1JWSA 2J21A 2GTWB 1QTSA 1QRNB 1WUZA 2W92A 3KPRB 4YSCA 3BFQG 1MJ7H 3LKSA 2XWDA 2GUOA 3AREB 2JJSA 3HZYA 3R0MA 5I76B 2FYYB 3QDJB 3IDIB 3W38A 2HZHA 2DB8A 1KYUA 2R56H 4JM2F 3IAPA 4XPFL 3NAAH 3ROLA 3W2DH 4R7LA 5LAXA 1IL1A 2CHXA 2ZKYA 4IMKC 5BZWA 3IGKA 1CGTA 1XGRA 5ITBH 3G5WA 3U0WH 1G9NC 4LCWE 2QL1A 1MLBB 1R3IL 2NT1A 4QOKB 4XO8A 2BP0A 4I3SL 3F5WB 5I1HL 3FFCA 3IDNA 3VRJA 4KUZH 1Q72L 4DP4X 4M93B 3GIZL 4FXKA 5ESQA 4B3EA 1DLFL 1AACA 2X4PA 5I6PA 2IDCA 4ZI8A 5IWLC 3VD9A 3OAZK 1GZHA 1R24B 3CZLA 4GXFA 3TBVA 4BBWA 4UT6A 4KUZL 3ZTNL 3C08L 5JXEA 3MBWA 1G1KA 3GIZH 1X7QB 3MJ6A 2KBGA 4AK1A 2HT4C 3L2NA 3CHPA 4JKLA 1DO6A 3QUZC 2AKRA 2BIOA 4XI5D 5HPOA 3KWVA 3N42B 4Z95H 1LWHA 2VL4A 5C3TA 2N7SA 3L4CA 4XPBL 3EJYC 1JZDC 2J25A 5CIPH 1RK0B 3TWCL 1SVCP 4OJFH 5DJAA 1ES0B 1JUFB 1QNIA 1UURA 3LV3B 3SSGA 4AQ1B 2IG2H 1AXTH 1HH6B 4KMLB 5DC0A 3PQYB 1TZAA 5L8KB 3P30L 3RZCB 2LABA 3LHPH 3L95B 3LN5B 3R4DA 4FG0A 4LCIH 1BVZA 3LS4H 1F3JA 2XZQL 4A7QA 4TQEH 3G5XB 4L1TA 4XCFH 4MQ7A 3VCLA 2JQMA 3OG6B 4CADB 1Y6KR 1EWHA 2DQFB 1HFUA 2C7FA 2YOCA 1AQHA 3V52H 1QAWA 5IHUL 3ZDXF 4LP5A 3ZQ9A 1A1NA 3OHMB 4ECNA 4NQEB 1IC7H 4YXLL 4ZMAT 3HE7A 3PJSB 3Q3GA 3P3TA 3EYOB 4MJID 5DQ9A 5D7KD 3IMSA 1PPIA 3LB6C 5FOBB 4K8RH 4KK9D 3WKPA 1Z0MA 1N26A 3QIUA 5CKAA 2ESVB 3P77A 1HL4A 4QYAA 1S3RA 2OV0A 4Y4KC 4D8PA 1USZA 5KUKA 3GMNA 4WK4B 4JPVH 4XAKD 1SN2A 1AQDA 4MBRA 4GW4B 2AVGA 5L8LB 1BZEA 4DPAX 1U8PB 4NZFA 1KPRB 2C4XA 2VDMH 2DLFH 1SYVB 1D7DA 3VFNA 4G72B 4AC4A 2XXMB 2A6IA 3RFZA 3K80A 2EDNA 2QTVA 1DVYA 4IBUA 2Q7YB 4WWKD 3L4VA 2B1AH 2PO6D 3SKMA 3I3BA 3MVSA 5I17A 5JNYA 2F1EA 5F7DB 2AS5M 4KI1A 1W0YT 5JHAA 3ZJAA 3MGAA 1YEHH 1NDTA 2FD6L 3KM2A 1ZIAA 2YKLH 4MAYC 2YSTA 3PWPA 4AE1A 4GW5A 3GF8A 5B3JF 1VRSA 2BDNH 2FIRT 3MRQB 4OR1A 5I75C 4L9DA 1LO5B 1GOHA 1MFBH 3QIUD 5FW7A 1OGAD 4D9QD 2W9EL 5CZVL 1LO2H 3F64A 3GMOA 1GW6A 4UV4L 4BXSV 2NX5A 4NNPL 4YR6A 1AGFB 2DQJL 4CC1A 3WMQA 3SGEH 1E2ZA 1OTTD 2CO4A 4NKDA 4UT6L 5E1GA 4YHPB 5TQ2L 3FO0H 4QAWA 3ZGIA 2X9XA 3S3PA 1IIIA 3VGBA 3ZZLA 4XN9A 1H9VA 1YNTF 1BG1A 5FKPA 2WSKA 4JCWA 2AC0A 1NCHA 4ODWA 2E9GA 1QSEB 1WBYA 1MHPH 1WGOA 5BZWB 4ONHA 2Y2WA 5D7IB 2WO2B 1TU2A 1Y18B 2P5EB 4IYKA 2MPAL 3ELQA 5DI8B 3K6NA 2V5MA 5FFLA 1LEIB 1FNLA 5TTRA 2GEQA 3I75A 3KLHD 1DFXA 4LARH 1AJ7L 2B5IC 4WW2C 3V5KA 4P04A 3VFTB 1KCUH 5B3JE 1OD7A 3QR2A 5HD8C 3TO2B 2BH0A 4C58B 3QUZD 2HYMA 5D2LA 5B1BB 1JZJA 2ENYA 4PUBL 1TETL 4ZYKB 2EP6A 3SPIA 2JKRM 5KSUB 2L3BA 4CMHC 1HQ4B 2HVJB 2WLNA 4TUJA 1OF2B 5GGRY 3TN0C 1A3LL 2Y1AA 2KL6A 2E76C 4ZJ9A 2DL9A 3QZWB 5KVFE 4FXTA 1JIBA 3U30C 4XPGH 1WYJA 3P54A 3VMOA 2CZNA 4H5SA 2YZ8A 4LU5H 2FSEA 2VZOA 5FYJD 1S9YB 1IKOP 1T1ZB 2BWDA 4MD4B 5HY9B 3J7HA 2EYRB 2F5BH 4JHVA 1NBYB 1TVHA 1I3UA 4GXUN 2IDTA 1FZOB 1UD6A 1DJYA 1A64A 1NCCL 2AZUA 4PREA 1I9EA 1QMUA 4GS7B 1NGYA 2GIXA 3QIBB 2VGLM 43C9A 3IPBA 1F41A 2Z4QB 5GGSA 1CDCA 2OTUA 1T0PB 3ISYA 4LP4A 3NCYS 1S7QA 1CB4A 2R2CA 3PABB 4TUKH 1FYTD 3A22A 1GOGA 2GJJA 4PJAF 1J9QA 1WFJA 5IESL 4GP8B 1ZT7B 2Z93A 1OB1B 5BNXD 2VLJB 4ZMYA 2ZICA 3L5JA 4PRAA 3FUEA 1TETH 1KZQA 3CSGA 4PJCE 3U82B 3I50L 1A2YB 4Z7VA 5FHAL 4HS3A 4NPYA 2X70A 1FG2B 4K3JL 3F7YA 3VXNB 1S7TB 3BH4A 3QZBA 1DQIA 3AUVA 5DJYA 3WIIH 4GKSA 1MFVA 2DLGA 2VXTH 4JB9L 2DWTA 4G5AA 1P5VA 3DHMA 1M05A 1A0QL 4HSQA 1SOKA 2A9CA 2DZEA 4AMWA 1YEFL 1VACB 3MMEA 3MRPA 3U9PL 3DX1A 5DD0H 5I1JH 5AVXB 3BMWA 3U48A 2FO4B 4A2LA 3NEXA 3VFPB 2P5WE 3TT1L 1O7DC 4K15A 1OGSA 3PFUA 4ODSL 5JHDE 2ZXWB 2NW2A 2V33A 3CN1A 3L6FB 4XMKH 3IDXH 1V3JA 4G9DA 1WLHA 5E5LA 2FLRT 2EILB 4BIKA 3G6DH 4HJEA 3BVUA 5JHLL 3ARBC 4ZQKA 3V6OA 4XPTH 1LO5A 4P5TD 3GMQB 1DSWA 1M57B 4IRSB 1FRGH 4LOFA 1MCEA 3ARFC 5IW6A 2F8OA 2COQA 3MNZB 3ULUF 1CFNB 1XGQB 2X70B 3FSOA 4QRPE 3G6DL 1A7OH 5INDA 1KIQA 4RFNC 3MJ7B 4WUUD 1T7YA 4APQA 3S5LG 3O0RH 1VESA 3IBEA 4C56D 2H45A 1JRHL 4Q56A 4PRAB 2QPDB 3KL3A 3SZ6A 5A2BA 3V79C 1EVTC 3T3PF 3DECA 1G6RA 3FRUB 3KCWA 4Z0BH 4E42A 1H5BA 5F96H 3MACL 4F58L 1ACYL 5I0WA 5JMRA 3IJEA 2CR6A 3QZOA 4FULA 1T21A 1YEIL 4M93C 4ZAKB 1LGVA 4ABQA 3FUDA 4AYFB 5KYXB 3D69A 5DS2A 4JGJA 1KPRA 4G9FD 3TZVD 2R27A 4E36A 3MX0B 2EE0A 2LQRA 4WV1C 2XSKA 1E90A 1EA9C 3HRZC 3ZE0F 4L3AA 4IKKA 2VSDA 5I5MA 2ZG3A 3LKOA 2HX9A 4PWKA 2CJUH 5L7XL 3GXFA 4TM9A 4C54A 1QQDB 1NBYA 1TVHB 3U7AA 43CAB 5ICZB 2DM2A 5D1ZD 2PTVA 1UACL 5LGJB 3G6JF 2ZX9A 4JANA 1KTLA 3BZ4B 4QRRA 1JZIA 4F20A 4IGBB 1TEGA 3BYTA 1BLIA 3MV9B 2AMGA 2IXQA 2DYSB 1K5NA 3GHBH 2N7AA 5HHOA 1ADQL 3EFFA 3NQIA 3ARZA 4NKMB 5D5MF 3AXLB 1ERNA 3HZKB 3RGVA 3MRJB 1IQWH 2V2XA 1VGKB 3B4NA 4ADIA 2VRQA 2Q1EA 1D9KD 3O9WA 3KBFA 2TRYA 5HI4D 3NP3A 5LCVA 3DX6B 3FPXA 4IOIB 1ZS2A 5I6XC 3IYLW 5J06A 1UUNA 4XVOA 4GI6A 5FYKD 4XGZA 1E4HA 1JHLH 1WIPA 4A1RA 3CVHB 4TSCL 1P1VA 4ZO8A 5F7LB 2BWIA 3T3PB 1IRAY 4CW1A 2WXJA 2C4FT 1HYSD 5CBEA 4YHKL 1GPOL 3RIKA 4FZEH 5HDRA 1NANH 1Y6NR 4NWUH 4OGAC 2WQRA 2G9HA 3HAEB 4UQ3A 3EAKA 2NCMA 3GRWH 4EN3A 2NCEA 4MYWB 2GUYA 1R5VA 2H9GA 4DK3A 1SVBA 5EPMA 5GJSH 5BS0D 1J1PL 1HYSC 5A16A 1I7RB 3AZUA 2Y5QA 4MFHA 3UTSA 1NJ9B 1PZSA 5JIHA 2ZAHA 4YBLB 1UKQA 3L2LA 2VJ0A 5I8EA 4AVJA 3Q1EA 1NGWA 4R4BB 5EEVA 4FKHA 2QQQA 2XV2A 4NNXA 5ICUA 4PRPE 5FDWB 2AK4B 3MV9E 4AY0A 2IPTH 4PJHE 4U1MB 4M48L 1Q1PA 2IAMD 1DQJB 2CBMA 1KTDA 4WEBL 3KPMA 3UBFA 5ERWA 4OGQC 1AQKL 3L9BA 4PS8A 5ETUA 3X17A 4DHLA 3IU4H 1G87A 2BP8A 4PWIA 1DSYA 3BKCH 3HG1E 1FZMA 5IFJA 1G5GA 2AV7A 3RWJA 1YEIH 2NY6B 4MYPA 5AOLA 4X6DF 3SO3C 3EJQA 5E9DB 5AVWB 1CLYL 4HPOH 2EE9A 3L5XL 4WRLA 5LCVH 5HHOE 3UC0L 5KVDE 3GJEB 3VU1A 3P2BA 1AD0A 5CFHA 1BVOA 4WI3A 2H7WA 3C6SA 3LXAA 4UCFA 1MLCB 2J12B 2LTQB 2ZIDA 4FQQA 4GG6B 1AIZA 2WN3A 3ET9F 4JGMA 3FAWA 1JN6A 4ANXA 5D93B 1M7XA 3LJ3A 1EPFA 1KGCE 1T6VN 3K3QA 3HBPA 3QQDA 4LF3B 5C2BL 1QQDA 1T3FB 4Z77B 3FT3B 3D39E 1YYLH 2DWEA 4OD3L 4BCXA 1MJ7L 1SDYA 1A02N 1BX2A 1QLFA 3HI6H 2JJSC 1G7PA 4V1DA 3QWOB 3D05A 4Y5VB 3FBQA 2FK9A 3WCYA 3CSTA 4N86A 1RJYA 2V8MA 1IEBB 4GI9A 3UO1L 3CQQA 4DERA 2P5WB 3UIZA 2BP8B 2OMZA 4I18B 1ZSDA 4JBSA 1RK7A 1IGYB 3T0VA 4GO8A 3BPNC 1U21A 3NZHH 3NGBB 3GLZA 2BIIA 3G5YA 3GI8H 3C5ZD 1F6LL 3CG8A 3DX9A 1U3HC 1ML0A 4LL9A 4U6HA 3SYCA 1SLXA 1II4E 1MG3C 3PRZA 3HBZA 2O1AA 2FUQA 2OMVB 1F4WH 5FO2A 4JG0H 2C9UA 3QYCA 1R5IA 4JPVL 5KSVA 2C5DC 4FXGB 4NIYE 5DMGD 1DBBH 3FUKA 3TO4D 2X2UA 4FABH 3AU1A 1H5BC 3SQRA 1YNLH 4KKQA 4UAOB 3T6WA 4FZEL 4G6FB 2WLHA 3FMGL 3TM6A 3RI5K 3VWJD 4OI8A 3GK8H 2M83A 4TNWF 5BV7C 3O8XD 1H3XA 5KS9A 1E9OA 3NFNA 3VB8A 1A6WL 1JF1B 5C08D 4ERSH 5D1ZA 5E6RB 3HMXA 4LPYA 2X4PB 3IXAA 1YEDA 2R0KL 4YGVA 2ZNWA 4MMYB 5GGUB 2EYSA 3SE4A 4IU2B 3SE8L 2XWCA 3DMMD 4J3OD 4H0LC 1S7UA 5B1CA 3L3OC 4N20A 4BD4A 2BFVH 2AVFA 3EGDA 4MA1C 4BA8A 2XRAH 4AW7A 2BY0A 1RZGB 4JO1H 2VT0A 1U91B 5BUAA 2YARA 3RA7L 4AEEA 3IDIA 1SFDA 2G0LA 4PSRA 1I9JH 1YDPB 3MRMB 2XIDA 1RZJH 3LEVH 4Y5VC 4IBYA 1WQVT 3CSFA 2X1QA 5DS8A 1OP3H 4WNQB 3IXTB 1VFBB 1XR8A 2DQIH 3HC3H 5EF3A 3HHSB 2DDQL 3U25A 3D39D 1MUJB 4G1MA 1YEDB 2BINA 3WTWA 3C75A 4XNUH 4M4PA 2VDOH 4JDTH 1N5YL 4XC1L 3MOAH 4RFOL 3PUCA 4EBQH 1WBZA 2Z0UA 4XBEL 5F44A 5GSRA 1T0MA 2QFRA 3OBAA 2BO0A 2J5LB 4WWKC 2JLLA 4MNQE 1SEQH 2EIKB 5GRUL 3HNSH 5IQOA 4N2OA 4DN3L 5CIPA 3IFPB 3Q9QA 3MLPA 2I9LB 3BXNA 1L4IA 4N4YB 1U92B 1WA1X 4IOSA 2Q87A 2ZSWB 2X4TA 4G42B 1VAHA 3BSGA 2LW3A 4G8AC 4LESA 4YHZL 1SPDA 2OR9L 4GUQA 5AZUA 3MI6A 2AJYL 4ADJA 5DJ8B 5K9KA 5IVNA 2WWKT 5MENB 1BREA 1MIML 1ODAA 3QUYB 4NRXB 3ZOAA 5KYXA 4LEEA 3VI4F 3OZKA 4QHNB 4QAMB 2TRHA 4X5LA 3FT1A 4P23C 3CZGA 1PD0A 4Y4KB 4XMUA 5I9QC 1IEBA 5GGSB 1ZTXE 1Z3GH 4LDLB 3O6KH 3HC3L 3LRSA 4EVNB 1MFBL 5GZNC 4M7KH 3CN4A 4FQXD 1A6TB 1OIOA 1RLWA 3BGMA 4XMVA 5AW5B 3M1BB 3UFIA 1AGEB 5C92A 1UA6L 5AVQB 2QDVA 5IB5A 4EF3A 3MJ7A 3QUKB 2APSA 2YUWA 4GRMA 4F24A 4BZ2L 4CC4C 1WC7B 4F2EA 5KOMC 5D8JL 1VSCA 3WJJC 5HY9A 5C09B 4HV8B 4HH9B 1EAOA 2K3HA 4L3EE 1BQHG 3K2MC 4Q74A 2WV3A 2UYLB 2WLLA 2RFXA 4KKBD 5C0CA 3FT0A 3FRPA 1S6NA 1CL7I 3L5XH 4XTRD 5DJYB 3C9NB 4RFEB 4P2OD 5GZNA 4U1GB 4RRPM 2O6CA 3MO1A 5EZIL 1TYEB 1JGVL 4YSSA 2A9BA 2JQAA 2N1TE 4PI2A 3LPPA 5E4OA 3NA9H 3FT2B 1GC1C 1J8SA 3MV01 3K2UH 4N87A 4J3WA 2R1YA 1RHHB 3GDBA 3IBOA 5CJ8A 2AK1H 3TO2A 5F7KC 2VDRL 1CFVH 2Z93B 1PAZA 4D7PA 5FV2A 2IGFL 3AXHA 3FL7A 3X12B 3NJIA 1LK2A 4C55A 1PZBA 2WKLA 2OMBA 2GSMB 3GYRA 3EDDA 1FO0B 3KYMB 2NX5B 4YR6B 1T7XA 4KNUA 2B4CC 1ZT4A 2NX5E 4FQ2H 4HFUL 5GS2D 4LPUA 2X53A 5IOKA 32C2A 3K6FA 3SODB 2IJ0C 5DT1H 1UA6H 4MDJA 4G7YL 4E0RA 2X09A 2CMRH 5EBMA 2Y24A 5KUMA 1YSOA 4JRFA 1BOGB 4YQXH 2VQ4A 2WUCL 4U0QB 4NRYB 1T1YB 2APTA 3OF6A 1V3KA 1Z5LA 1R5VB 1S7VB 1O5PA 3WGVB 5E00A 4PSPA 1LK3L 5IR1B 1N5YH 2J2ZA 5DRZA 1E4JA 1UB6B 3WS3A 5I15L 1QRND 3KPRD 4K8RC 4TMPA 3RY5A 3CSBA 2O5YL 4RIRB 1CG9B 4N1CA 4Y5VA 1CGVA 2XPYA 1K4CB 1AXSB 4J28A 3N43B 3LKPB 2CHDA 4OZIB 4XODA 3WJLA 1FNFA 3VTMA 4Q97A 1JV2B 2CLRB 3U36B 1AS6A 1BHGA 2AQQA 4E9LA 2O6FA 1LO4H 5HVHB 2B9AA 4OCXL 1OW0C 1AI1H 5EU7E 4P5MA 1XF4A 4MX7B 1TJMA 3UBXA 4HXBL 4NC1C 2DYPA 1BWWA 1EZLA 3SKMB 3G5VA 1JZEA 2MQ0A 2NY4D 2NYYD 2XI9A 2EE6A 2F7RA 3UDWA 3ULUL 1NCGA 1QSFE 1ZTXH 2IWFA 1F6AA 1L7TH 1TJHL 3RWFA 3JXAA 2PYFA 3KVDD 3PDDA 4ZYKA 2DQFA 1IGFL 1C12B 2CM6A 2ZCKL 3V4VB 5FYLL 4X42A 4NWTL 1FV1A 1C1EL 4LSRH 1AC0A 4DQAA 3IJ8A 1N64L 5E6SB 3MDJA 3F3HA 2Q3XA 1R3IH 4QXUL 1E8ZA 3QEUA 4LP8A 4Z0XB 1XF1A 4N0FB 4OZIE 3FCUB 1MCRA 4A7VA 4W70A 1ED3A 3DIDA 5CEZE 3S37L 2HMIC 2Y4SA 4YDVA 5CS7A 4DW2L 1T83C 1DEDA 1NC2A 1T83A 5AW4B 1CFQA 4H8HA 2XWBB 4Y2DC 2NY1D 5J11C 4WI7A 4EI6A 4P3WA 4MX7A 4FNTA 3HI5H 1SEBA 2F2HA 3RNKA 1LTXA 2R23A 4AIOA 1J05A 4Z7NE 4JFZL 4JY5H 4N2IA 4LARL 3IVKB 2X4SA 3MBEB 5AVVB 1QLRA 2IH3A 2X4QA 3TFBA 2D3NA 3T2PA 3FQTA 4HG4K 2OJEA 2ESVD 5B22A 3WS3B 3P73B 4IRJB 4OIIL 1I1YB 4RGMB 4U6TA 1NCNA 4B3VA 5IQ9A 3O6LH 4JFEE 4YIQB 4PJXA 4IRSA 4K7PX 2ADJA 4H8VA 2OMVA 3CZJA 1INEH 2BXYA 1SEBB 3W57A 1RJZB 1XTMA 5HYFA 1C5CH 5KBPA 1BOGA 5E24E 1NBZA 2YPVH 5EC2A 3LY6A 2AQ1A 4PWJA 1KLUB 2WVTA 3ULVE 3O6LL 5FLUA 2NY5L 3B2PA 1HK6A 1NANI 3QGVA 4M29A 5IB1A 2XETA 3PHSA 3C60C 1IM9D 5A2IH 5IB2A 1GJIA 3CXFA 4X5WA 3QCTH 3AQZA 3HMWH 1A9BA 2HRHA 2V17H 4IGBA 4HJ0C 2VW7A 4OJCA 1A6UL 1Z5HA 1CBJA 3TEWA 1CGXA 3KH3A 2VXSL 4TQPA 1R3LB 4M8QA 1E42A 4Z7QB 1CXFA 2K9FB 4JPWL 2GUOB 1KEMH 2R0ZL 3D0LB 4FQ1H 1OGAB 4UDUB 1FBIL 3EDKA 5I76A 4UNUA 4CMHB 1QLEH 5F93C 1GOFA 5DVOA 2P9RA 5IJKC 4IU3B 1BCIA 4M1GL 4UTBL 4J5VA 4JM4L 2VXSH 1WBXA 2ICEB 3MLUH 1U58B 1SQ2N 2PYEA 5T5NG 2WKOA 3QFJA 3RGBA 3UJTL 1KSRA 1IV8A 3EGXB 1AZCA 2D3VA 1ORSB 1L0YA 3SKNA 2WYTA 3OC5A 5SWZE 4DUWA 4YHML 2VDMB 5JYLA 4I85A 4PLJD 4ACPA 2FO8A 4HT1H 4H2CA 3VRIA 3QRFM 3NSYA 2ENPA 2VLRA 2W65B 2P5ED 1LEGA 3OR7A 4LLUB 4O51B 5AKVA 3VYOA 1GSMA 5MHSD 3APDA 2OSWA 3VFVA 3GIVB 3UAJD 1HCYA 3MKKA 4HJ1A 4F7CA 3HUJA 1ONQB 1YEKL 3PU7A 4N9GB 4QO1B 1P84J 1O7VA 4I4WA 5DQJA 1OSEA 3SGKC 5MENE 3SPVA 1OLLA 3UZVA 1UWGL 4AGMA 2JIXB 1A65A 4U3XA 4JHZA 3RVUD 1FZJA 1HL5A 5KSBB 3RL2A 2BHZA 1R3HB 2E46A 4XN4A 1ZLWK 3L1OL 4JREC 1ZRUA 5H37A 5H4ZA 1BF2A 3I6GA 3P0YH 4JDEA 4ATWA 3GO1L 3MLXL 5EBMB 5E1QA 3LRKA 1JERA 3J07A 3WJJA 5JIPA 2IO5A 2NZ9C 4TUKL 1UWGH 3D8MA 4EKJA 3BVVA 3N3EA 4B9YA 2AXWA 3NCWA 4MKTA 3OF6D 4KV5F 1NFAA 3GEFA 1FLRH 2BP0B 2Z0BA 4AEIL 5IBUG 3FQ2A 3X12A 2Y7LA 3ZKXC 3ESOA 2DMBA 4MAUH 2AEWA 1ZTMA 4P2RE 5CP7A 4X6DA 1DBAH 4ZSOB 1A7NH 4X6CA 3UAJC 3O2WL 4X4ZA 1EQWA 1GHFL 3ALWA 3QIBD 4ABWA 3M46A 5JA8B 2FYYA 3QDJA 4OUUB 1IBHA 1T0OA 3MJ9L 2YEZB 3GK8L 3STLA 4HH9A 5LWYL 2VISA 5IBTL 1OP5K 1FYTB 4KI5F 1DN0B 1UVQA 1R3JA 1IE5A 4JFDA 4Y5XB 1JNLL 2UY7B 4OLUH 4TSBH 4ENEC 1T5KA 3SN6N 2ZX6A 4XPHH 2OZ4L 2VLJD 2BMKA 5GIRB 4JQVA 1SY6A 4HIJA 1ZVSB 2XACC 3OQ3B 1V7NH 5DVPA 2YUZA 2VLME 4Y16A 1C8PA 1SN0A 4LSVH 1I1AB 3VQ2C 1KIPB 2BHYA 2BVEA 2R9HD 5GGUA 2G4GA 5KJ4A 4ANVA 4BFJA 3FRPG 3M86A 3KXFD 4MASA 4KK5C 4CUCA 1MCSA 4GAYB 4N28A 1T1XB 2DJSA 2FHCA 3VXTB 5BJTA 3MN8A 4FFZH 1LEGB 3GJFA 2G75B 4K94C 1IKFL 3ARGB 4IKLA 1WCBA 2AGJL 4U1KB 2PR9A 3ZR5A 1AC6A 3Q0HA 3GXIA 4BQBA 4CVZA 5ACZA 1O0VA 1FYTE 35C8L 3DVGB 1O7DE 1SNRA 3RVXD 4HFWA 5E2TH 1QFUL 3W39A 4QHLB 1HIML 3MX0A 2PCYA 2PR4L 1NCBL 3ILEA 5T3XH 2PWFA 1OM9A 3MRHA 4WFGD 3OB8A 3LH2L 4OM1L 4Y5XC 4Z18A 1ACYH 3NT0A 5I1AB 3FQXA 4R96B 1HQ4A 2HVJA 4TUJB 4BELD 4NKOA 5CJXA 3V6FA 3VXTA 3B7UX 3JV6B 3WNLA 4D0BA 4IRSD 1AQDB 2AERT 1E4WH 2YRLA 5DD6B 4UDTA 2FB4L 5LBSL 3RWGB 1A6WH 1MFCL 4EXPX 5B1KA 3G9VA 2B9BA 2VLKD 1L9SA 4G8IA 5F6HI 3UTSE 4WUUB 1IEAA 5EF0A 3BUYB 3WEXB 3WHE0 1DEEB 2BMKB 1OHZA 2E6JA 3P9LB 3FOLB 1WFMA 3JTSB 3CFDB 1MJ8L 4U1SA 6FABL 3FT3A 3HG1B 3US9A 2ZZUT 1WISA 4XCFL 4UMGA 4OD1H 4XMWA 3O9WC 2OI9C 2YUXA 3STLB 4YPGA 3ZDXB 3WNKA 4KDVA 4CADA 5CU5A 3V0EA 4MZRA 4NUJB 3QDJE 2WYIA 5C0EA 3TEZA 4DK6A 1FFOA 2VWEC 3VXSE 1QBMH 3FONA 1SUHA 3WIHH 3U6XA 2CA3A 4UZSA 2QEJA 1ZGLP 1QYGL 3MJ9A 3PP4H 1KN4L 4D0BB 1LILA 2HLEB 5D1ZB 4Y4HC 1W0VA 5ADOL 5E6ZA 1KPVB 4IIZA 3VM7A 1J9CT 3G9AB 3TOPA 3BWZA 5J6HA 3FQXB 1KG0B 1MF2L 3C08H 4M9PA 4IGBD 4NI3A 1W72B 2H41A 3MV9D 2BLFA 3VYPA 5T33L 2AP2A 1X7QA 4LSSH 1MAJA 2BSTA 1DJGA 4XWOD 4PJIE 3JWDH 4QXGL 5LO7A 1GGIH 2EDQA 1G1OA 5C08A 2FQDA 4U6HB 1LM8V 3L7EA 5DJZB 3TZVC 4F2MA 5A16B 1PSKL 4JR9L 2FBJL 5C0AA 1PAMA 3HOGA 4RFNB 5BJTB 3MR9A 4LCYB 3VI4A 1DCLA 1S7SA 3QQ9C 4EAEA 4Z23A 3BWUF 3IRZA 2NUPA 4S1QL 3CDZB 3B1TA 4UT7L 1BWMA 3U2IA 4OT1L 3FSVA 3U6RA 3QJHA 3AB0B 1F11B 4Y1AE 4JM2D 3T4YB 1Z6JT 3VX1A 2H3NA 4M61B 2CDFA 4OJEH 3RWEA 3WLBA 3ZU8A 3VFSB 5E8PB 4DUVA 4PQXA 2HP4A 2BS71 5C07E 5C86A 1MLCA 1NLBH 1E5UI 3FXIC 4H13C 4ALAH 1E6JL 4F15C 4JPQA 1NEUA 1GY2A 3H8NA 4R0LB 5AAWC 4DGUA 1DQQA 2WQ8A 2WZ6A 1CLYH 3WL9A 1I7UA 1KDJA 2HFGH 4DOHE 3DSFL 3GS4A 4XP4L 2LLGA 1FI8C 2MPAH 4GW1B 1CGSH 2R2HB 2AK4D 1EFXD 3UYPA 2CJSA 4G7SB 2DAVA 2NQ3A 1CE6A 4Z7WE 4AV4A 2WP3O 3QZNA 2X2HA 1G43A 2FT8A 2AQSA 2WIMA 4Z7OF 2ZXEB 8FABB 3BESR 1ODUA 2IOMA 1WAAF 2Z8SA 3L4XA 1DBJH 1LQBC 4G83A 3NIGE 1TJHH 2CLVB 4F5CA 2XRAL 4HUWA 5DEGA 2RMNA 2CDFB 4B5EA 3SPGA 5E9DD 3DJRA 2AF2A 4ANWA 3UX9B 2D2OA 1OB0A 1Z9NA 2IWKA 2YD7A 1SJXA 2JB6A 5G4OA 9CGTA 3DO7B 1PQZA 2Z35B 4BZYA 2HX8A 2XN9A 3NSCA 1XH3A 3OKDA 1SYSB 4NENA 1XF3B 2LU7A 2VKWA 3QUML 2NUTB 4K5OA 4PGEA 1ONQA 2FATL 4E5XA 3D69B 4WHCA 3F01A 3IB4A 4ICWA 1P5UC 1OWRM 4KROB 1JZ2A 3LCYA 4GRLC 5IB4B 2PR4H 1H5BB 2IAND 5TQ2H 1R9FA 4N6RA 1PS3A 3JTBA 4P59L 4JFPB 1Y07A 2HKHH 1QRNA 3KDMA 4JFOA 3MRIA 4AJVA 3C9NA 3ETBF 2WVUA 1OSPH 2NYYC 4PRIE 3P4OB 5HPMA 4JZOB 3HVNA 1B4JL 1QEWA 5TQ0H 5JOEA 5EA0H 2XZQH 4I0KA 2E7BA 2ZXGA 5CCGE 3C5ZB 2LT9A 3UPAA 1W0WA 1WAAA 3LAFA 3N42F 5IW1A 4PJEB 1BXUA 5C2BH 1OM3L 1RK1A 2UZXA 2QGBA 1QVOB 1YEEH 3QSKB 4BZ2A 2IPUG 4U6XA 4U3HA 4L05A 3CLFL 1WWCA 3UBGA 5F9JA 1C5CL 4M8RA 1CDIA 1NDGA 3V6FB 1CLOH 5GGRA 4G6FD 3DRQA 4PJ5E 4X80L 3ML8A 3VWJB 4E9YA 2WPGA 4LXFA 2BSSA 4KK6C 3O8XB 4NFDA 3AWEA 4NI6A 3R7RA 5ABAA 4OIFA 2IFFL 3T71A 3I9PA 5L2KB 1Q90A 1U3JA 1QLEB 2AFNA 4F2FA 3IF1A 4JVUA 4J6RL 4M5ZL 1XCTA 4P9MH 1ZE3H 4WI0B 3W39B 2VDML 3VFWB 4YDZA 4DGIH 4OCRL 3IGAA 3W3BA 5BQ7A 2XBZA 1VKXB 2ZSWA 3SBPA 5L8JB 3JWOL 1UXWB 2W5PA 3PJLA 1BM3L 5MP6L 1A4JB 1IARB 1PZ3A 3HS8A 4KVPA 4XPBH 3E80A 4FN0A 5DJCA 2IH8A 5FA3B 3VXUA 4D0DB 2JKXA 3BT2H 4X6BA 3BWAA 3KEDA 4YGAB 4OFDA 1JSYA 1RZFL 4WTQA 1CWVA 4GSRA 5AW6B 2ZP8A 4E2OA 1CFBA 4YH6A 3LHPL 2PNDA 1J1XH 2QSTA 3LIUA 1UB5A 4ERSL 1MIEH 4WHYH 3D39B 4KC3B 4PLKC 1L3WA 2BVTA 4WKXA 4HUMB 1M6OB 4MNHB 2VN6A 3ZMNA 2YAOA 1U8OB 2IDSA 3O2VH 5LG6A 1FNHA 4NT6B 4O02B 3O8XC 4H0GA 4PS4L 5ECJE 4H1LH 1I3GL 3T8XB 1PG7L 1PNCA 5EIIA 4CMMA 4CVXA 4HS6A 4PTUB 2YAHA 4CC4A 2VZVA 4L8CB 4FLSA 5F9JB 5I66B 1BYNA 4YBQD 1Z9SA 2XKUA 3EG9B 4NC1E 4OZ4B 4Q58C 3FOMA 4LOUC 5KS9F 4I1PA 2LVCA 5F1NA 2JVUA 2EUWA 5EORH 3RGHA 4NC2B 4ZZFA 1MCJA 1SHWA 2O6EA 1YHPA 4U1LB 2B4CH 4ZUWB 2IDFA 3NA4A 1VACA 3MMEB 2GBAA 3WAKA 3S88L 1LJMA 1K4DB 5E0FA 3TFKC 5HDQL 5LXVA 3DHPA 3HJEA 3RJDA 2X6CA 3EYUL 2ADIA 4KRLB 4EI0A 4OM0L 4N0RA 4YBHA 1MN4A 3ZZSA 4M3HA 5ID0A 1ACXA 5E2WL 3U0PB 4LVNB 4UNTA 2Z7UA 1KTCA 1R47A 4PGJA 3L1FA 4QNPE 3RWIB 3SDXE 4Y4KD 1FFPA 1U95B 4M5TA 4XN8A 2YEZA 2R83A 4HQQL 3ZTEA 4FKEA 5LGYA 4FQXB 4KUCD 5MHSE 1AHWA 3IEAA 1ZDQA 3RX7A 4JVPA 2ITCB 3KR3L 2ZJSL 5EO9B 4DN4H 3D3VA 3P1VA 5H8DA 1ZT7A 1XF4B 3EJTA 4XN5A 1F90L 2V5YA 5KW9L 5C09D 2AQ2A 1MW1A 2CBOA 1NFDF 2BDNL 5FA4A 4ENED 1SBSL 2XZAH 4LMQI 5AB0A 3VXRD 3ZO9A 4MA7H 1VENA 1G7MB 1TQTA 1AOHA 3ZKND 1DLHA 1VLXA 4TQIA 4RZCA 4UV4H 3MC0A 5F1OB 3VXRE 4X83A 3P40A 5D7JC 4X5PA 2DM3A 5TE6H 3L13A 3IDUA 3LKQB 4NJAL 4WEEA 3WIFB 2Z4QA 1LMIA 3SCMA 2WQWA 3QWOA 4N0YH 3IF1B 3I02A 3HI1B 1HNYA 1P4BH 2I24N 5BOJA 5DJDA 2QZ5A 5K5YA 5DSCA 5E0QA 1DJIA 1RI8A 2D7QA 3BVTA 4ZUTB 1FZOA 3DVNB 4YHYC 3OKLA 1F86A 1I8KB 3K2IA 3VYNA 4FFYH 3L17A 2NZ9D 3L3OA 2AQNA 2NX5D 3L3KA 5IHBA 1JGLL 5JNYB 2PN5A 1H6EA 5E8EA 4OUUA 2YQ3A 2DQTL 1OGTA 2DQHL 3OR7B 1NAKH 5I1CH 1TG8A 3QJVB 3WTSA 4RAUA 2VH5L 3QR0A 3GI9H 1A6ZB 5KW9H 1U8HA 4JFFA 4WHTB 3S48A 2R1WA 4Y4FA 4AM0B 1SZNA 1A22B 1DFBH 3EYVB 4OJYA 4PGBB 1DBKH 4NJ9L 1BXAA 4AUUA 2A9AA 4HWZB 4WWNA 5CCKH 2DJUA 2X1XR 5JQ6H 2BP3A 1AY1H 4YHNB 2FGZA 2YPLA 3EJYD 4X6CF 4WJG3 3PDOA 4QHMA 3C8DA 3I6GB 1WZ1H 3DUSA 1FGNH 4I9WD 4WAFA 4JFPA 1BZ7B 3CFUA 5I6NA 5KG9B 4NSKA 4ACTA 4MJIE 5C3LD 1E0OB 3DX8B 4AIZA 4XVSH 4L5FE 4M5YH 5DUPH 5F71A 1LDSA 3SYOA 2AI0L 4HW6A 4OZFB 2YXMA 3M7OA 1NKRA 3T0WA 3C5JB 1KIRA 1UOWA 3FQNB 3MPCA 1LDPL 4DQOH 4HHGA 2YFOA 2CLZA 1ZV9A 1JK9B 4ETQA 5D1XA 4H0HB 3VDCA 4QRSA 4M6ML 4MDRA 4X7SL 4TS6A 2QV2A 4AYID 1AQ8A 4KI5E 3TBYB 4W9IC 3KYKH 2NY4B 4M9OA 4AENA 1PX8A 2WXQA 2G5BA 5I16B 2WXGA 1E28B 3US0A 4YS4A 1U8JA 2C9SA 2KQMA 3EJZD 4G8EB 1BZ9A 4NZUL 3D85A 4UBDC 3SY0A 2ORBL 3KS0H 1HL9A 1R3HA 4NP9A 3RNKB 3EIFA 1VB9A 3VMNA 2NLJA 4OBRA 1TJIL 2CLVA 2OSXA 3I6LE 4O4YH 1E9PA 2P8MA 1VFUA 2YLHA 4LNRB 3A23A 2YK1H 1JMXA 1LO4L 3RL1A 3QULB 1TTFA 4JFQB 5E95B 3PP4L 3HPLB 1SXBA 3FONB 1KLGA 4PB0L 3K4AA 2F5AL 1UHVA 3O45B 3D4CA 2ZUUA 1CXKA 4EDXB 1M9WA 2EH8L 2ITDB 4M7LT 4ELMF 2NY1B 3V4PB 3BGAA 2YSSA 3D2TA 4RX4D 5EBWA 2VZUA 2AQPA 2QLVB 4A38A 1NGPL 3OJ2C 4X5WB 4UILL 1OE2A 3VD7A 5JYMA 5F7UA 5FOBA 4E9QA 3RX9A 4HJTA 3MBED 3UP6A 3ES6A 3PV7A 3LZOA 4WNQA 3QRGL 3WLWC 4D8PB 2EDEA 4RA3A 1JZ5A 1U8IB 2NY7L 3U0TA 2DLIA 1G7HB 3U46A 1T66D 4HGWB 3LS5H 3V6ZA 3TNNA 2ETWA 1JWSB 1OAJA 4M62H 2BNRD 4PY8J 4IRJD 1BSIA 2WAQA 4HWBL 4WNSA 3S35X 1QUNB 2JCCA 3VI3B 1I8LC 4WUUE 1S9XB 1MHEA 1AFVH 2G2NA 2Q7NA 3C6EA 3Q13A 3QQNA 5IVZB 2DBJA 3WNNA 1AIFA 5CO1A 5FEBA 1IJ9A 3B5TA 4FNSA 1B4LA 1NWOA 5CNHA 2BM3A 5C08E 2BFGA 1CT8B 3BFWA 1EXUB 1LE5B 3L4UA 3V5DB 5DZVA 3NJKA 1MXGA 4L9LA 1Y0LA 4K7PH 1IM9B 5ERWB 1E5AA 2APFA 3SDYL 4ATTA 3VD1A 1K6QL 1YY9C 4F1ZA 2R0LH 4R6UA 3I85A 4LHJB 3AITA 3JQOB 1O9WA 1I85C 5DVLA 3RP1A 1M4KA 5BZDA 2F8VA 1UD3A 1HEJC 3B2VH 3OLIA 1CDUA 4QWWC 3L08A 1CG9A 2DMHA 2UZYB 3DX9B 3HAEG 3DUUB 2VR7A 1JK9A 1MAMH 4ETQB 1U8CA 5CLZA 3KYKL 4PJGA 1YNTA 1ZKAA 2NTFB 4NEHB 3ZTDC 4DPCX 2BZ7A 3VD4A 1E50A 4AYSA 3V0DA 3B2VL 3ILQC 4FG6D 2AJYH 4KXZI 1E9QA 4B5ZA 5DLMH 5GSVA 3HS0A 1SY6H 2JKWA 5DUML 4NRYA 3EJJX 3KE0A 4GKZA 5GGQL 3S34L 5LJYH 4ODVL 4X4KA 5FYKU 1M56B 1MXDA 3HMWL 2VISB 5TDOB 2QKIA 5D1ZC 5EMYA 5CEYB 1ZV2A 3S36X 3DTXA 5CM1A 2B1OA 2DJMA 1UG9A 3AREA 3HNVL 4GG6E 3KLQA 1IFHL 1QBBA 2W0FA 5FWRA 1V7ML 1QEXA 4OZHE 2UWEB 1AG0A 4HDIA 3FFCD 2WYHA 4FFZA 4XVUC 5DFTA 4Z76A 2BNRE 4EUPB 3KCPB 3FUJA 4QTHA 2JIXD 4HKXB 4AYBA 3MRJA 3QI9A 4KJPC 3O45A 1N3NB 5DHDA 1KCVL 4YK4B 3C6LC 5C0IA 3TBWB 2IF7A 1GHFH 2IAAC 1TJGH 4EBQL 4R96A 4IOFD 3BW9A 5IJKA 1UFUA 4KJYB 4NO0B 4IS6B 4N90D 4HA1A 3WHXB 3JTTB 2ZXDA 5IBTH 1H6TA 5B8CC 1SEQL 2XV6B 3DX0A 5ETUB 2ZYRA 3MODL 3VJ6A 1B0GB 1I7TB 2PABA 1PIFA 1CYWA 4KRPD 3UIYA 1ZDSA 2CSPA 3Q2VA 1T04A 3T4YA 3LQAC 1TLMA 4W93A 4ZUTA 4PJIF 1N7MH 4G42A 3QW9A 1B9KA 5I18L 3BPCA 5I5IA 3WE1A 1P2CB 2JLPA 2EUZA 2I5YH 2JCCE 3HZMB 3V0JA 4LIQE 1SN5A 1URIA 2FEEL 4AMXA 3IFPA 5HHMD 2OSLA 4N22A 4WJKB 1IGJB 4K0OA 5CZXC 4OCWL 4AIEA 3MXWL 3UYRL 4I3RH 1MI5A 3FO1B 1YPZA 4NQCD 4UV7H 1KGUA 3NSFA 2GJ6A 5AOJA 2FX8H 3D3VB 3BH9A 3M8OL 5DMIL 1AR2A 1T1YA 4PVMA 4AT6B 4QKXB 3IMTA 3CN0A 4K5PA 2XZZA 1HS6A 4HLJA 5GZOC 2E75C 3QPXL 4H8WL 3VTTA 2YD0A 4D0CA 1RL1A 4LDOB 1DJSA 2W88A 2E4FA 1JV5A 1I1AD 3CJJA 4HBCH 3QO1B 5C0DA 4QRPA 4OFVA 3KXFB 4K7PY 5ADPH 3QORA 4GEIA 1P7QD 1ZA6B 3OKKA 1F3RB 1NFDE 5H35B 2H47C 2P5EA 1FO0A 2AV1A 3ARGD 3ZQWA 3E8UL 4Y4FB 3HEIB 3GBMH 2X6BA 2WC7A 5GS3A 4LOVA 1AGDA 1WC7A 2ZE0A 5EA0L 5AOZA 1AI1L 5HI3C 5L9DH 1KT2A 4ZQTA 2XWTA 2NDGA 3L54A 3U7YL 4HXBH 5I6MA 4HEPA 4TUOB 2PP7A 2X3AA 5E08L 5LNDA 4XPAH 1E8YA 3QCUL 4ICXA 4PJAE 4WWPA 4UNVA 2MNWA 2JJTC 1KJ2L 1JXFA 4OLYL 3RIAF 4I3RL 5C8JA 3BP7A 2X3BA 3OMNB 1JXDA 3VQ1C 2G0KA 2V8LA 3ZDZE 1XZ0A 5HHXH 4ZODA 4DAGH 4FRWA 4MJ6A 4G7YH 4HJGB 4AEHL 4OF6A 4XXWC 3SO3B 3DC0A 1BIIA 2VLKB 3OR6B 2GSIA 2EYSB 5FUOL 3ETSA 2DM4A 4HKZA 3FB5B 4M1CC 3VI3E 4F8NA 4U05A 1RUKL 1GSKA 2QKIC 3BAEL 1QD0A 1FC1A 3U4BL 1CFSA 2ZWSA 4LBAA 3UC0H 1IC5H 2OCCB 4N3TA 2ZUQC 4JE4B 4U1HA 1NGZB 3HG1D 4H26B 3BIKB 3THMH 5F3BA 3BWAB 1PLGH 3RBSA 3WFHA 1WF5A 3CK0L 3ARQA 4PJFF 1CI5A 2NY4C 1HSBB 3P3UA 3FU7A 4DIXA 5EU3B 5JPNB 4DN4L 1QX1A 1UKSA 2NNCA 3B2MA 3HRZA 5L2KA 2OCJA 1FFTB 3FZUD 4C4KO 2JI1A 2GT9B 1RU9L 1S3KH 1N4XH 3LKRA 1X5LA 1G7HA 3G08B 1NIFA 2AANA 2B59B 4LCUB 3EO0B 3ZDYE 1N6QH 4H88H 5F89A 2XQ0A 5EUKA 4HWEH 2P26A 3R8BB 5FGRA 2IQAA 2P8LA 3PWPD 4YDIH 3LQMA 2VIRB 1CK0H 4UZUA 3ZMRA 3GS0A 3NACH 4DKFL 2VSCA 1OF2A 5KVGL 2F68X 1F8TL 3T04D 3HRPA 3MLVL 5DMIH 1QNZH 4G1EB 2AEQL 3U1SL 3H56A 4LCCB 3WJMA 1HNFA 5J3HD 1A8ZA 3VFPA 2OMYB 3HKZA 2FX9L 4PV8B 4BDVA 4DCQA 3QVAA 1CQKA 5JPNC 1JF1A 1R3JB 4ZFQA 2E8YA 2FT6A 4GAJH 2KI6A 4P46B 2K0RA 3RRQA 2XA8H 3T8XA 1ES0A 1JUFA 2X9ZA 2HT2C 2HT3C 4ISVA 4MKMA 1YN7B 3A4AA 4PJXE 1D5IH 1K8IA 3M17B 3QUXD 1BVLB 3FS9A 3KAAA 2F6AA 3D0VB 1O7SA 1OCZB 4PJ8A 3TS8A 2QKIB 3DVFA 2YWZA 4ONHB 4HOXA 3BKYH 4MAYB 4JM2B 3JV0A 4CJ1A 3MODH 3ABKB 2EADA 2R51A 4JY5L 4UTAH 4KTDH 3DSNB 4WGWB 2JKJA 1JHTA 1OM3H 1PMYA 1P9MA 3TBYA 5AW9B 1Z5LB 2DYPD 1DQJA 2DICA 3MLUL 4NM4H 1CK0L 1VF5C 3K6SB 4R2GD 1UUSA 4WWOA 4GRLA 3JWOC 3C60A 2MTAA 2XXFA 4OFPA 4AJYV 3A6BH 1OCRB 1A1MA 5FYLD 4DAGL 5BRZE 4MRCA 3GINA 2NNXA 3EDFA 3QJUB 4NNXB 3KLLA 3T0ED 4EQ3A 3U1SH 1JPSH 2APBA 1U9KA 1NIDA 1ZANH 4PJ8B 3CVHA 3ELAT 1Q1JH 2E9BA 1EFXB 2VDPB 4UT9L 1FYHB 1S9YA 4P23A 5I1EL 4XWGH 4FQXC 3VM5A 4OCRH 1LEKA 3DSNA 4FYTA 2ZUTA 3DUHA 4G8FA 1SJEA 4N2NA 1VGKA 4TV3A 1MFMA 1OSZB 1RZQA 4IHOA 1MPAL 3FB6A 1B90A 2ATPB 5LBVA 2I27N 3RHWF 5C0RL 1E5CA 3OXSB 5K9JH 5D1QC 5KSUA 4XO4A 4NDMB 3V5HA 5B38B 4FEIA 4R4NC 2HG0A 1ECZA 3ARBB 1OARL 1UJTA 4P0DA 4RISH 1KBGL 5FB8A 1KCUL 4JZOA 5TF1L 3R8QA 1ZEAL 3QQDB 4IIQB 3H0TB 3NVQA 3GSOB 1BGXL 4LBEB 5SX5K 8PAZA 2VMFA 2CR3A 4KROD 4U1MA 1PY0A 3QG7L 1I8KA 3N91A 3Q48A 2IANB 2A2QT 3Q8BA 4B41A 4JG5A 5GGVY 1MCDA 3UDWC 3WY1A 2VW4A 1AZUA 1CTOA 4Z7UF 2YGVA 3QB7C 1HSBA 2YPVA 3GSNL 3IFLL 3S8WA 2KERA 1RZ8A 1ZT1A 3DGGB 3ZZQA 3KJ6H 4KNTA 1KACB 5FO7A 2A6DA 2WO3B 3I6LD 4JANB 4G8FB 2VOTA 5CXPA 3BUDA 4NKDB 5D7IE 5DTFA 2FJFA 3NCXA 4FMFA 1Z2KA 3SDXB 5C7XL 4QDGA 3CMGA 2BC4A 5BOZG 2YD6A 3G08A 5C0AB 3Q01A 2DMKA 1GMIA 1DDHA 2HUEA 2Z4TA 4WCYH 1L5GB 2WQXA 5C3IA 4KQ4L 3P11H 2WBKA 1S7XB 3F83A 1AFVL 1JGUL 3GXPA 4Q7DA 3N44B 5DA0B 4P5SA 4YSTA 1ETZA 4WVRA 5A2LH 1TT6A 4IBWA 2H2PC 2Y36L 5E8OA 3GMQA 5E94A 2OL3B 3MKGA 5FFOA 1DQLH 4HGMA 4ODHH 4F37K 1NCIA 2YAMA 4ZTOL 4Y8AA 5DHYA 1TSHA 2CE6A 1F6FB 1HE8A 2ADGB 3DDGA 4DFHA 2Y1YA 2A74A 1UFGA 4G43B 3CAFA 3P3RA 4PCSA 4PWHA 1KIUA 2FBOJ 4G6JH 1ZLUH 5C0EB 1TQWA 1EGJA 4UMSA 5L2KD 2ADIB 3NBNA 5AYUH 4RMTA 1UWXK 5ANMA 2WUBL 1QRNE 1INEL 4ZXBC 3F58L 4TOYH 5A7EA 2P43B 3IXTA 4KY1L 3BT0A 4HUXB 1GY1A 4DPBX 4ZTOH 1QA9B 2V6HA 4YHIB 4EI6B 1KNOB 3AMLA 5KVEH 3A6CL 3LEXA 3HG2A 1CICB 1JPEA 2HWZH 5I66A 1XZ0B 2AJUH 4ZQKB 1Q0YH 4LSDA 3MV8A 4FADA 2R4SH 1HYRC 1M2OA 1JVLA 2JKTM 3OC8A 3QXUA 4MCYA 1N70A 2DRUA 4KQ4H 2WCPA 2VN5A 5EORL 3BZEA 4Y1AB 2DQDL 3SDCC 3OGCB 1NEPA 2CHWA 3SEPA 5GJSL 3AXLA 3HZKA 4HXAL 1H8LA 1FNGA 3OXRA 1BJMA 1V3MA 3I6KA 1XTLA 3BUYA 4N2MA 1NPNA 5IEHA 1XDTT 2YEVB 1INDH 4MMZB 2XKNB 4RBPK 1SDAB 3D25A 2KHAA 3MUGB 4XNQA 1XB6A 2VDLL 1I31A 2IQAB 1KELL 4F5CE 4WO0A 3UPRB 1XCQB 3IRCA 4W81A 1KYOJ 5H35A 5DC9B 2X7LA 2CALA 3O6ML 4PIBA 2RIKA 1DYZA 3Q06A 4PJ9C 4GKSB 3L1GA 1YQ2A 2EE3A 4OFYD 4YJZL 5EF2A 5H94B 3BDBA 4H8WC 4YHMH 3L81A 2BVOA 2O5NA 2V0AA 3ISWA 4Z7VB 4NBZB 4X9FA 2YRBA 1OT2A 4R4ND 4U1JA 1IX2A 2PW1A 3TF4A 1HDMA 4WDIA 5LXGL 2DF3A 2WXNA 1M1XB 1HCFX 1TJGL 1E3XA 3HI1A 3DPDA 2XBDA 2HJFA 3ZDWA 3C87A 3O2VL 3MBWB 2J1XA 4MWFB 5FYLH 4Z3JA 5KJRH 1DBML 1NOAA 4FQPA 5JPMB 1KXQE 4F7PA 4EZJA 2MMXA 5GS0D 3L4ZA 4U6VH 1UENA 4YC2B 2FLMA 4ODBD 2OYLA 4C83B 3TT3L 5EUOA 2P8PB 3BQUC 2X5PA 4JGUA 1TUPA 3EKCA 4XWGL 3VRJB 5D2NE 4Y1AA 4MD5A 3S4SA 1JGUH 2X6MA 1ZVSA 1M9SA 3GZQA 1FSKB 4YBQC 4BK4A 4XCYA 3FUFA 2C3GA 3MRGA 4HWUA 3VXRB 4K5MA 2DIJA 4H8UA 2NDFA 5CEYA 2W9DL 3H4FA 3TVMB 5GS1A 2FBRA 1QKZL 4RISL 4V2BA 5G5DB 4K8RD 1PEZA 3LQZA 4Y1SA 5DMKB 3QJRB 3MYZA 4JQXA 4KZDH 4CN1A 1DBAL 12E8L 3LKNB 5BVPL 3IMWA 1DANT 2BJMH 4KO7A 4RRPG 2FO4A 1E9QB 3S0PA 4YC2C 1YECH 4YFLI 2W59A 4K2UH 3BX7C 5FUCC 2X4OA 3UTQA 1GH7A 3Q1SH 4ZDHB 2JF1A 3SOTA 3CTTA 1UM5H 4JJHA 3C6LA 4JDEB 1PKQB 1HC1A 4XPHL 4XE5B 3ZE2B 1NBQA 4PFEA 4AV5A 3VXNA 2JB6B 4MSWB 5KZCB 2PLTA 3KHOA 1L9OA 4BK5A 1ZLWH 3EF7A 2X12A 3LQAL 3MTRA 4FFVD 1Q0XH 5JW4N 4C83A 3PGCA 3M1BA 4M6MH 3QAZB 4OCYH 3QCUH 1IGYA 3DARA 1WZMA 4AKOA 1P1ZB 5DYFA 3MCKB 2Z92A 1UXSA 3DBXB 3BN3B 1QWUA 2D0GA 4V11A 3OX8B 1DZBA 3AAZB 3HN3A 2A6IB 2OYKA 3PAVA 3KYNA 3CFEA 3RDTB 2EO1A 4BFFA 5C0CD 2VMDA 5BZDB 4TTDD 1RZJL 3JWDC 4H20H 4M03A 2DBLL 4M3JA 1VADB 1BYOA 5EZOL 1TJIH 3RY6C 3I3DA 4PJGE 4YUEL 4X98A 2BVPA 4GP5B 4XN1A 4R0LA 3FU0A 4EZMA 4LAQL 5KTEH 1IGTA 1WWWX 2I7SA 2FT7A 2XV3A 2YK1L 3CFJA 2QPFA 5DUBA 3ZW3A 1IBGL 3T2QA 4YDJA 4F3FB 2MPVA 1Z0NA 3L5WB 4XBEH 5ICYB 4HJJH 3IFOB 1JNJA 1CZ8H 1FFPB 1U95A 1M2VA 5B38A 4IDJH 3L4WA 3CIQA 5SWQA 1QZNA 4NBXB 3LPWA 4ODWB 2KS0A 4PBWD 3WLBB 5C0IB 5EBWB 5JXAH 2QZQA 1PTZA 4WI8A 3G5XA 1U42A 1IBZA 3EBGA 2VXVH 3NZSA 2I9TB 2XVLA 3FU5A 3PHQA 4HWBA 2O5XL 1TITA 2DD8L 1V10A 1AGFA 2EVFA 5DHXB 4HBQA 3U46B 5M7QA 3OKYA 2WINA 1DVXA 5DUMH 2C3VB 5AEAA 3UAEA 2EXWD 4KOBA 1FO0L 3CVBA 3LH8A 5DQ9B 1D9KA 1S9WA 4AG4L 3MUY1 2C3WA 4P9HH 1YUHB 3KPPA 3TEXA 3WAJA 3GTTA 4AX3A 4LCIL 3OSVA 2JV6A 2Y6TE 4EZLA 1QKZH 3GSQB 1EEUA 3N55A 1DHKA 3TJEL 5H37G 3VH8A 4J4PC 1I1YA 3SCMC 3PL6B 1IQDA 5D2NA 5GZOA 2XY2A 1F3JB 3TCLB 3NAAL 1S7RB 1N59A 2KZWA 2NTFA 4OLVH 4F7TA 2Z8RA 4B9PA 2APXA 2YMTA 5T5FL 5T3ZE 4DVBA 4RSVA 4ZUUB 5EEZA 1KB9J 4JZNA 4MA8H 2NYKA 4MMXB 3WI9A 4GO9A 5I74B 3RE0A 3IDGB 1BP3B 3GMPA 4TN9A 2BNRB 2YA2A 2UXGA 3H42H 1N9PA 4BSJA 2IC2A 5I8OH 5J4MA 3GM8A 2IOOA 1A4BA 1J9SA 2PF6A 2Z35A 1M7IB 3E1F1 2K9UA 4EDWL 4X0NA 2DD8H 4GT7A 4MZ3A 5EDXA 3VXMD 4YO0B 2V3EA 2OS7A 3CFIC 5FUZL 4JFTA 2XUWA 3FHAA 3UOAB 2J1KA 1R3LA 2YPLB 1RPQA 3S35L 3AM8C 4AOFA 4N8CH 4ZMWA 3B9KB 3P9LA 5KSAA 3STZB 1I1FB 1BZ8A 4QTIL 5CZXD 2BSSB 4N2HA 3APCA 3EYVA 4OGAD 4ENZA 1ZWIA 5DFWH 2XKNA 4FFVC 2SEBA 1MRDH 1NEZG 4MQ7B 4ELME 1REIA 4AVHA 2ED9A 3K4ZA 4YDMA 4YDIL 1A6ZA 4UAHA 3X1NA 1QVOA 2Y7OA 3TO4C 1F2XK 4Z3IA 1JP5A 1FHGA 1M7UA 5KTEL 3DUSB 1ZMYA 4JO4H 1ZA3A 4OVUA 1L6ZA 2G60L 3UTSD 4C57C 1JWUA 1FG2A 1MRDL 4NNPH 5CEZL 5EUOF 4B27A 3EADA 4QRUA 4FL4B 1MSPA 3MZGB 1M7IA 5HPMB 4KXCA 5HDQH 4JPIB 4AMKH 5IGXL 1BZDA 3V0FA 1KNOA 4AM0A 4M1DL 3RIFK 7CGTA 2GK0B 3F7VB 3SGKA 4LSSL 3DOIA 1JPFA 5E2WH 5FYLE 1OXYA 1AMYA 2DQUH 3CIAA 4KROC 4KITB 5C9JA 4WFGE 5FDYA 1IU1A 3IWUA 5MP6H 2VXVL 3FF7A 3GBML 2MCMA 1R24A 1AXSA 3ZHNA 4AYEC 1D5XA 4YSAA 5IBLD 3WJLC 1J5CA 4M02A 3EZ8A 1QACA 4WV1A 4HIIB 1XGPA 5EEUA 2VDQH 4IMLA 3VFUA 5INCB 3FFCB 3HE6C 4KKPA 5CMAA 3AWFA 5I73C 3CZUB 3CHQA 3KPOA 3TJEH 3RVWD 1QW9A 1YUHA 3KPPB 1MEXL 2WXKA 4LFHG 3HZVB 1DUZA 4LLDA 1NLDH 2EEXA 1Y1UA 5K9OB 4FJYA 4PVLA 4NO0D 4W9GC 1IAII 2OJ1A 4YUEH 4QRRD 1VHPA 5J6HB 4KQ0A 3QQ9D 1KEGH 2YGNA 4Y0GA 4A04A 8FABA 4JN2B 4ANKA 2X9YA 5D1XE 2OAAA 1F56A 1H3TA 1ZVNA 4XBGA 3ZLQC 1EBAA 5FCUL 4B97A 3FT2A 4KRPB 4WFEE 2QPEB 2Q2LA 3MGOA 2Q76A 4JDTL 2WJ7A 4MAYA 4WEBH 3VFTA 5JW3H 1HZHH 1OL0A 3V5KB 1EO5A 3RWHA 4U1LA 1QWHA 1D7CA 1OSPL 1H8OA 2XVBA 2OXGA 4JPKL 1XF2B 3ARSA 1ULVA 1MCNA 1BZ7A 1T2QL 1S5IH 3HZYB 3ZDYB 4ISVB 1SMOA 5EZJB 4DUXA 5HHMB 2C9PA 3O6FD 3NIFB 4E41A 1E5BA 4UZGA 2HG5A 1QSEA 2VDOB 4PJCA 1OVZA 2BERA 2VERN 2M2DA 2BVPB 2O4EA 4NQCB 1VDGA 4Y4HD 5D7JA 3HIZA 2PWHA 5DVNA 3RNQB 2NNFA 2O5XH 3D3VD 5HDBE 1P4LA 5TE4H 2OR9H 7FABH 4PGBA 1MOEA 5LBGA 3KPLB 2FBJH 4C56A 4N1HB 3CHOA 3QPKA 4NCC2 4N9GA 4DP0X 1RPKA 3D12B 4GRMB 2A0LD 1RULL 3D48R 4NQQA 1J7VR 3QEQE 1FDLL 1GYWA 1HHJA 3CVHH 2IFFH 5DRWB 4HOWA 2OYPA 3NGBC 4GAAA 1P7QB 3FFOA 1CXLA 4WHYG 2W65A 2AXHA 4O51A 4XBPA 5HVGB 3W2DL 2D03L 5CF3A 4PG2A 5SX5H 4LEBA 4Y4FD 2ZUQB 3D34A 1EMTH 1F00I 3PWLA 4RQQA 1E8XA 4OZHB 2EXYD 4TNEA 4L29A 1T1ZA 5FYJH 5B7EA 4BINA 1AKJA 2E4TA 2YKKA 5AOMA 4OCSL 2CKBB 4U1JB 4BFNA 4LOUD 2IPKA 2HKHL 1XXDC 1BW8A 2UZPA 1C08B 1N12A 1QFWI 2DQUL 2NSQA 2VM4A 2K70A 5F6IB 4WI5A 2Y7SA 3BLBA 5DJXB 1IC5L 1WA0X 5CSZB 5CJBA 4D7BA 4HJIA 1FORL 3MUGA 3QJFB 4YX2H 1B4JH 5TQ0L 3U0PA 5JOFB 1O9ZA 1FBIH 4Q2ZB 3SYQA 4LSTL 1CDHA 4PAZA 4BKTC 3L3DB 4PJDE 1CC3A 3MRFA 4AIXA 4R7DB 2O26U 3GSXB 1T22A 1FSKC 1H3VA 3MLYL 2E9WA 3ULVC 1JXJA 4LSPH 5E6ID 4XI5C 3GRGA 1JAEA 5GS0C 3CQPA 2Q86B 4P8QA 2KUTA 1KV3A 5AW2B 4CGUB 3KGUA 4V2CB 1N8ZB 3BEWB 5E6UB 4XMTA 4H88L 4NQEA 4N85A 1HXYB 4HS6B 5F0PB 4YXLH 5AKRA 1CURA 4P46C 4X2UA 2KDGA 2ODIA 3FO0L 4CN4A 2AJ3A 4FOMA 3S3CB 2DTMH 3BH8B 4XVJL 1FJ1B 1CIUA 1OE3A 4DTGL 4KDTC 2ZUVA 5D96B 1KIUB 2ZD0A 1MCWM 3MBXL 2GY7B 4DEWA 4WO4A 1IAKB 4KV5E 4NJAH 3N1QC 5HVHC 1MVFA 3IDMB 3NABL 4GSXA 3IXAB 1A4KA 4I2XB 1I8IA 5TPWL 3TC9A 2W80C 1KPUA 1MY5A 4TL4A 3PWPB 1A25A 2DL2A 3FAXA 5IT2H 1PDKA 4LVOC 5AL8A 5EOCH 1WWBX 4LQFL 5A43C 2A5UA 4P05A 4PH8A 3ISRA 4QXTA 3N44F 4MMZC 3RILA 1L3NA 2GQHA 1FE8H 3QPQC 1RCYA 2R29H 1MI5B 4P46D 1A6AA 3HUJB 2KZKA 4X8XA 4Z0XA 1H15A 3GTNA 1KN2L 4GO6B 4D9RE 1R75A 2H0EA 3QUXB 2BNUA 1QLFB 4Z78A 2LR4A 3OXRB 4L3EA 1KIPA 1RZKH 1U2CA 1ZT1B 1PNDA 2APVA 3C2AH 3DGGA 4Z7WB 4MAYD 4A2MA 4AUYA 3RWFB 3WO4C 1WP6A 3PG2A 3TT3H 5IHWA 5AZEL 3KPLA 2Z9TA 1JGDB 4JL2A 1MY7A 1S78D 1D5ZA 4PJFB 1H3PH 2VAJA 4H5SB 3NJLA 2QHRL 5E03A 2IANA 1NZRA 4HC1H 3RG1C 2JB5L 1RZKL 5EFIA 2A73A 1HZHL 2ICWI 2DYPB 3K91A 4U1GC 4W9ZA 2IAMA 5K59E 1CO1A 4N2EA 4BFGA 1QHQA 2CDGB 4I88A 4R2GB 4CJ0A 5IESH 4M8VA 4GRWF 3T6ZA 5DK2A 2DQCH 2J56A 4N8VG 5F6HJ 4TUOA 3M1OA 2HXAA 3T0EB 1U2HA 4KFZC 3RWJB 3MLWH 3SDDB 4PJ8D 5LNEA 3REVA 2NUPB 1AY1L 3P69A 5GRXG 1ETB1 3NN8B 4JM0A 3RFZC 2QSCH 1XH0A 3UYOD 3BDYH 3SBWA 2HT3D 2HT2D 1Z66A 3HNVH 3TPUA 1MQKH 4LPCA 1E8WA 2F54E 2DQEH 3PHOA 4XXCC 3RVTC 1FGNL 3JV5A 1DL7H 1LMKA 1WJ3A 3MNMA 1OSZA 4FQCL 3DETD 3AMKA 4A66A 4KY1H 5FDWA 3CWGA 3K4DA 4XVSL 4Z7QE 4UTAL 2R59A 1HWWA 5D4JA 2VITA 2IGFH 4WWKA 1E5YA 1KTKE 4C59B 7PAZA 1NFIB 4XPGL 4D0CB 4HAKA 4TNWK 2FJGA 5D1QE 5HD8D 4U33A 1KCBA 3MCYA 3ARBD 2MIZA 5EO1B 3O81A 5I8EB 2ZUWA 3ARRA 2CMRL 3WOVA 2QGCA 4ZXBD 4BK8A 4Q4EA 4QRSB 2LFEA 1HEHC 1CE6B 2UZYA 4LCWA 4B7LA 2QQNH 1SYSA 1XIWC 4ODTH 3ESNA 4QRTA 4ZFOB 3OAZH 3BVXA 5FXCH 3SBRA 4BFBD 5C2UB 4HKBA 4DGWC 3DX8A 3B6SA 3IU3B 3TBCA 3QQ4A 4AE0A 1SY6L 1BVLA 5I15H 1A7OL 4NO3B 3QJOA 4Z77A 4JFYA 3TNMA 3WFCL 4HOMA 4XVTL 5ISZE 2B1HL 4JPWH 2XTJC 3G04B 3RVVD 1QUPA 2GTWA 1XGYL 1S2EA 2XWBA 3KW8A 2ZG2A 1Z7JA 4J2XA 5AALA 1EHAA 3B9AA 1TVDA 2W60A 2K78A 5JUEL 3CHSA 1OKEA 4IS6A 3RFZB 5C0AD 1XEUA 4JY4B 2ZOOA 1SBSH 2XZAL 5AUMA 5HHOB 3QPXH 2Y5TB 4FGMA 1BQRA 5D5ME 2OMYA 4FNLL 1DQQB 3WL9B 3UROR 2BNUB 1JNLH 4OLUL 5LGJA 2ERJC 2MHAB 3DJSA 3HG5A 4Q2ZA 4WFHD 3QJXA 3RY4A 2Z34A 4P99A 3IE9A 4W9EC 4J1UB 2X9WA 4X99B 1KTRL 4AQAA 4CSZA 4GQ9H 2Z3FA 3DJZA 3OMAB 2EVHA 4AK2A 3JYBA 2CPCA 4XMLL 3DWTA 5HHNB 3S3DB 1IEAB 5C71A 3RWEB 2QVKA 1X9QA 4YVNA 5GISL 1A1MB 4NZTH 3TEYA 1MRCH 1UT9A 1FL3B 1HXMB 1Q94A 2YAEA 3BAWA 1AYRA 4KO9A 3V4PA 4DP1X 4HZLB 5EIIG 4JNXA 2AXJA 3FQRA 1CICD 1KV7A 3GI9L 5I71C 1GYUA 3QIWA 3CSYB 4LCYA 5JHLH 2OX5B 5AB1A 4W9LC 4IQHA 1YY8B 4HMEA 4POUB 2AHIA 4NKOB 3IRPX 3AGWA 2VXQL 1EO8L 4GYBA 1XHHA 5GGQH 1ET7A 2V7NB 5BVPH 1T0MB 1HHKA 5I1KH 1K2DA 4R8WL 4OLEA 4H25A 3RL1B 3LPFA 1OOAA 1NCBH 5CBEB 4X7TA 4Y1AD 1T5XA 2YXWA 5E8DL 2VLKA 3NK3A 2ZAGA 4M1GH 4K55A 1P1ZA 5CJXC 2VZTA 3CV5A 4ANUA 5F7AA 1WS8A 1GGUA 4FI7A 4QRFA 1X5GA 2G3XA 4FYSA 3TJHD 3TWYA 1BFVH 4ONOA 2VYRE 5GRVL 2RTTA 4GKOA 5CCJA 2CPUA 1U8JB 2FWOA 3HG1A 4P49A 2LE9A 4S0TD 4ZMLA 2HUHA 2UVFA 1K72A 2I25N 3BVDB 1CT8A 1RZGA 1S46A 4FFYA 4N1EA 3IS1X 3BP7B 1UTDA 1HJBC 3KPSA 3IDNB 2NSMA 2X4OB 4A7SA 1MHHA 3BUBA 2D7TL 3A5VA 5F1NB 1G9MH 3L3DA 3OLGA 1UOLA 4ZW3A 5AW3B 3B56A 2ORBH 3RWDA 2WZ5A 3VB9A 2J5WA 3G6AA 1GZPB 3QJFA 3SDAA 1BFSA 1DJZA 1ILSA 3SD2A 4MTMA 1N7ML 4K9EL 5AW1B 2D7TH 3KMDA 3VA2C 5I1AA 1EUUA 3QDMB 1MVUA 4GB9A 1I3RA 4DKFH 3PV6A 3SY6A 1QBML 3EXLA 1CFMA 3JZYA 4WLCA 3SE3C 5ES4B 5FCUH 4MQXD 4FQHB 1FAKT 3QFDA 3FYIB 3HZ3A 3L7FB 4IGBC 3LEVL 2VDPH 1QLEL 3D7PA 4P5MB 5BO0D 3WUWG 3UPCA 1J0IA 2KKQA 4NKIL 2VE6A 3RB7A 4JRXB 4IBQA 4WFHE 2N0MA 3QUKA 2ADYA 1YAIA 3PNWB 1DQVA 4CKVX 1ZVYA 2WIIA 3W5MA 1FFNB 1A4JA 3H9YA 5F0JB 2BWQA 5DRWA 4AQEA 3QXVA 2MOVA 3TVMD 2IH1B 1S7QB 3BFOA 5DURD 1RJYB 1HH9B 3QNYA 2VAAA 5DK0A 5E2VL 1CD1A 2CO7A 3RUGE 4QGTA 4PJ9A 4OFIA 2IADB 4GT0A 3NA9L 4NFBA 3GNMH 3PGCB 1NCOA 4JPIA 4X7DC 4DZBB 4LASH 4C47A 3Q2NA 4XXDB 3EUDA 2Y72A 2IAMC 4Z7QF 1U3HB 2ICES 3V0IA 1I3RB 2UVEA 2ZONA 1E4XL 3D1MC 3A4EA 3ZT7A 4EN3C 3L6FA 2LV4A 2NQCA 4PRDB 5EU4A 3HA0A 2DWDB 3N85L 4G70B 5J3HC 3M8OH 4ZFOL 2XOTA 4Y2LA 1C16B 4I2XE 3R19A 5D2LB 5DLLA 4HPYH 5KZCD 1RK1B 3RGVC 3BLPX 3DMMC 5JA9A 1YO4A 5I19H 3EH2A 5C6WH 1B6UA 3VFMA 2JH2A 1QZ1A 5D7LA 3MGOB 3UO8B 9PCYA 4OZFA 4HD9A 2ICWB 5T3ZH 2E3VA 1YN6A 3JUZA 5IOPB 4PIRF 4M43H 1MW3A 4JM4H 1NUNB 4HUUA 5HP5A 2J71A 3OGCA 1EJOL 1XSOA 4KDWA 5JHDD 3LD8B 5SWZA 3POCA 4JDZB 4F37F 1GW0A 1XGUB 3RDTD 3SYPA 3OV6A 4XNYL 2PYEE 4LSTH 4LVHB 3TNMB 2K4AA 3N41F 3WIHA 2M26A 5FKPB 5C0CB 3SGJC 3SIKA 3DYMA 5CINH 4P2QE 3QDGB 1WBYB 3TESA 3T6VA 1MHHB 4P57B 2ZKXA 4YL9A 2Q8BH 4IJ3B 3UZQB 4ZW5A 2B15A 5SV3A 1UH3A 4CNIA 2O6PA 1N0XL 4NUMA 4Y2OB 3H3PH 2IALB 2G9KA 5I28A 4WV1B 2VSKB 4NZRL 1Q0XL 3QXAB 1EUTA 4UB0L 3WBDA 2YQGA 2Q0ZX 5E4EB 3RKDD 3FNKA 4OAWA 5F9DC 5KAQG 1RXLA 2P47B 4N9OB 4WW1B 2UV3A 3OKLB 2BK8A 4PRNA 5C9JB 3ULVH 2Q7AA 1B2WH 3RL2B 5E8OB 2N1KA 4JY6A 4CL7A 1KBBA 1SHMA 5AG9A 5MENA 2R69L 1GGCL 5KBMA 4PJ7B 3FQUB 1CFQB 4F1SA 3MRLB 2ICEA 2VZSA 1JI1A 1TIUA 2OTWA 5DQDH 3ZGHA 5F72S 3O6FC 5IJCC 4HCGA 1OPOA 1S9WB 4NHCL 1UASA 1OE1A 5AZ2H 4OBSA 5D7EA 2BW4A 2NOYA 2X4NA 3UACA 3SKUD 5GRUH 3E0GA 2IH3B 2FCBA 3P11L 4MJIA 4WY7H 4GY4A 4Y9EA 3E2HB 2MTPA 4RGNC 5GGTL 3MV7E 1E65A 4QYOA 3A3YB 5MEOB 4XC3H 3UCRA 4UQIM 5MI0C 5A3IC 5JW4Q 3PL6D 4MLIA 5T1DH 4LDCA 2VC2B 2Y0SA 4L4JA 2VL5B 3L7FA 1CL7L 3HNTL 4LLAA 4WHDA 4NPJA 2HLAB 1LEIA 1LWRA 4I8DA 2WAHA 3GXTA 4IKIA 5KYUA 4G71B 4PY7A 1GCFA 3G5VB 4QWWD 3QEUB 2GJPA 1PLAA 2VCOA 4ELDA 1I53A 4JO1L 3DHUA 3EYOA 3K72B 3PS6A 4FTVE 3AT0A 3W0WA 4Q6KA 5EU6A 3KDPB 4MB3A 4XXCA 3IFNL 1L9MA 4OZIA 4GAJL 4HEME 3I2CL 4AGQA 2DTML 3SBWC 1JYVA 3AG1B 3DNKA 2JKSA 3Q9PA 3OXSA 3D52A 1BBDH 2EO7A 3VXMB 4BKLB 2ARJB 3MLRH 5MI0B 3QDAA 2WZPD 3MBXH 1JXKA 2NW3A 4ABUA 4BQ9A 5I23A 4AKQA 2FIKB 3IMVA 3UBXI 2ZP0T 2YPLD 3P4OA 3B9KD 3LMJL 2WZPA 5D1QB 3O3AA 4S11A 3JUYA 4FAAB 4JFQA 2FUTA 3ZDXE 1J9TA 3P3SA 1VGEL 3X13B 1QSFA 3BE1H 4KTEH 4FQJH 2VMEA 2X05A 1OP3K 3QWRD 1NTDA 3R0NA 5JZ7C 1IM9A 5I74C 5IT2L 5IQ9B 3RAJL 1Q9LB 5EOCJ 1PLBA 2CR0A 5DHVB 5CLWA 3APNA 2GCYB