4RRPM

Crystal structure of the fab complexed with antigen asf1p, northeast structural genomics consortium (nesg) target pdr16
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
153
Chain Sequence
GSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab antibody, light chain
publication title Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics Consortium (NESG) Target PdR16
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 153
sequence length 158
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4rrpM00
2IO5A 2IDCA 2IIJA 5BO0D 1WG3A 5C3IA 2CU9A 4ZBJA 5BNXD 1ROCA 4EO5A 2HUEA 2I32A 1TEYA 2Z3FA 4RRPM 5EIIG 2YGVA 2Z34A 3AADB 2DZEA
chains in the Genus database with same CATH superfamily
5FGCE 3ROOA 4DKFL 2GK0B 1CQKA 4XNZB 5IEHA 4XMPH 1GYWA 4HKJA 4XC1L 2XG4A 2GI7A 2CGRH 2OKMA 4WJKB 3WFEH 5LGJB 2UXVA 3AREA 3OHXB 4FEIA 1GOFA 1XF5B 4LB8A 3N1PC 3CHOA 5D1XD 5KVDE 3WO4C 3WIFB 2DIBA 4AGQA 2OI9B 5I6XC 1AHWC 3MV9D 1B4JL 3O6KL 4V2BA 1JF1A 2MCMA 3PHAA 2FBRA 2R9HC 3QG7H 2AZAA 3KVQA 5DWUH 3QA3A 1USZA 5I6XB 1AHWB 1E4WH 4N2OA 4N6RA 4JHUA 3TURA 4OJFH 4R90L 2YPKA 1TKWB 4ODXB 2B9AA 3GSRA 3ABLB 3W56A 4PJ6A 2QMKA 3GK8H 1SN2A 3LSOA 3PHSA 3O41A 5D4QA 4L3CB 5BVJA 1SJEA 3RWJB 2VLKA 4KC3B 4L4TA 2A0LC 43C9A 1J8HB 4WWKC 3ZTNH 1JNJA 1I7UB 3O45A 4I87A 2DQGL 5DRNA 5EC2A 5I76A 4PH8A 2R69H 3GRBA 4N26A 1OAXL 4PRHE 2E7DA 4FFYA 5HJ3B 3PWPB 2C9UA 2ZJSL 3S35X 4LDCA 4PJ9D 3WXWL 4OI8A 5E4IA 1THCA 1IFHL 4K3HA 1YYCA 5D1QC 2H3NB 4HCIA 2KPWA 1OTSD 4YL4A 3FSWA 2GY7B 3HG3A 4HUWA 3VAEA 5EG6C 3U7AA 1S7UB 2OJZL 4GXFA 4MDJA 2IWFA 3KS0J 4LNRB 1SQMA 2O5ZL 2UZIL 5KSVA 2AEQH 4NO2B 5D7SL 5ITBL 3QIBC 1IVTA 3FU7B 3QUXA 2EDYA 3UBGA 3OKMB 4LOEA 2O6FA 2F7OA 3TF7C 3IDYB 3EBHA 1U3JA 3COOA 1KNOB 1HVXA 3GSOB 2ZXEB 3HFFA 3MJ9A 5H2BB 4Z77A 3KW7A 3QPQC 2VSKB 5KOVC 1T1WA 4G70B 4MJ6B 5IBLD 1A5FH 1TJGH 4QKTA 4NQEE 4BRVA 2DQCH 3H3KA 2ZX6A 3WEMA 4MLSA 4ILDA 2OXGA 1IC5H 3UERA 1FNSH 2F1AA 4B96A 1WCQA 3APCA 4LSTL 3QJTB 5JA8B 1XGQA 3HN3A 4KXZH 1PQZB 2HX8A 5CINH 1YN6A 2YBRB 4N0YL 3TT1H 3V9FA 3GXTA 1FFQA 3MRCA 2EDHA 3WIHH 1BQHG 1XDTT 3ARSA 3MLTB 3E1ZA 2VC2L 4AV5A 5FO7B 5ABDE 3FTGA 2HUHA 1IJ9A 4W70A 1CFNA 2ADFH 3HPLA 4BK8A 4YDKL 3NGBC 2AQNA 3RDTA 3RFZC 3V0FA 2H5UA 2YAOA 2Y5EA 4Q9QL 2B3RA 4IEFB 1AGBA 3HPJB 4OD1L 2NW3A 2UWEB 3VXUE 4ODWA 1DANU 4RX4D 5DHYA 4PBWD 4JRFA 4Y5VB 1ROCA 3FUJA 1TNMA 4Q74A 1VEOA 1ZXKA 4BRJA 4DGYL 5D7IA 5B7MA 4G9FD 4Y16D 2DMBA 3QGVA 4OZFA 3RUGF 4UBDD 1ZK9A 3X1BA 4X6EB 1OV8A 3L3DA 3QUYC 1MAKA 1TQWA 4AZ8A 2OA9A 3NN8B 4NQVB 4FYSA 4Z3HA 1G7PB 4OZGA 5CGYD 4L3EE 4ZAKA 4OLWL 3CIAA 1L6ZA 2E6PA 4PRDA 4JHWH 4L23A 1TG8A 2HJKB 4BQBA 4NQQA 4XC3L 1DJIA 3QK0A 5CIPB 1MF2H 1L7IL 5JW4R 3MJGX 4ANVA 2X9WA 3DPBA 4JL2A 4U31A 2AXJA 4IGBB 1F4AA 5TFSH 3JWNE 4NIYE 4NFDA 3SCMA 3L3IA 1JBJA 4ACTA 4X7DC 4JFPA 5ERWB 3LMJL 2VM4A 3OKKA 3UTSA 1QFUH 4PP1C 5BZWA 2HRGA 1HNGA 3D0LA 1A66A 3OR7A 5HHPB 2DI7A 1ND0A 1E5UI 5E6SB 1M7UA 3EJTA 3LEVL 2W59A 4MRBA 5HJBA 2XWEA 4HK0B 5CEYB 5LN4A 5IMMA 5EDSA 2YUZA 2HP4A 4P5MB 1HQRA 4ZO8A 1I85A 2BNUA 2L3BA 2QVTA 2VKXA 4N2GA 2WYZA 1OP4A 3A4AA 3GXMA 1Q90A 3F7LA 4FXKA 3WYRA 2LW3A 2CA3A 4XCNA 5DRXA 3HZYA 4M4RB 1NDMB 3OKLB 4PAZA 5AZ2H 4F9LA 1T4KB 4I3RH 1C08B 4KJQC 1QR1B 5ACZA 1CGSL 4K0OA 5B7EA 3QJOA 4EI5D 3FPXA 2VLRD 1JWMB 1OAZH 5BRPA 3ZTCC 1Y1DA 5JHDB 4HH9B 1IAIM 2X05A 5I73B 4MS8C 3MBEA 3VYOA 3OLIA 1QSZA 5D71L 3RUGE 2NNAB 4FQXB 2Y5QA 2FECL 4YLCA 3ARDC 1W0YT 2E76C 5C0AE 4FQQB 1GOGA 1D7DA 2OV0A 1ZT1A 3U30C 4FG2A 3PJNA 5GGSA 3WFCL 3FB8B 2PWHA 2Y2WA 3GT6A 1RZIA 3GLAA 4HIXL 3VA2C 1QEWB 3U30B 4U33A 4OU3A 4Y0GA 1VFMA 3GB7A 2XWRA 2YMOA 4NM8H 5KYWA 5GGVY 4HA1A 4TRPL 4OIIL 3S48A 4OZIA 2O5YL 2MCPL 1YYLH 2V17H 1C5DA 4KQ0A 4KI5F 3VDAA 4BFKA 1N4XH 3GBNH 4QO1B 4I3SH 4GH7B 3BPLC 1TVHB 4PVNA 1XX9C 1NC4A 3GSQB 4QT5B 4EEEA 3TJEL 1NAMB 1N8OE 4XN9A 2K6ZA 1T5XA 5IKCB 4JX0A 4E41A 3BPLB 1IAOB 2DWXA 1QSEA 1UWEL 3OMAB 4XCYB 2Y2YA 3Q6GH 4Y19D 4IBUA 4NZFA 1DUYA 3SDYH 3W1ZA 1MRCH 2BH0A 1B2WL 4KAQH 4GAJH 4NHUA 4RGOL 4PJ9B 4ZRGA 5F3HA 3RZCD 4J8RB 4XTRC 2JKXA 3EH1A 3FBKA 4Z7OF 1CL7I 1ZLUH 4IRJA 4UIKL 5L4IA 1MIMH 1BBDH 4MXWH 4HEME 4HLJA 1IKNC 1DEEB 3NIFF 4M93C 1E8XA 5JORB 1PY9A 4AXWB 5B8CA 2H26B 2WQXA 4BHUA 2XPYA 4AI7A 2BOCB 1T21B 3IJEA 5EEUA 4NZJA 3TU6A 5JHMA 5M7QA 1VESA 4KZDL 4G5ZH 4DO5A 2FJGB 4ZMYA 1ESOA 2G75B 5GRXG 1Z5LA 4WO0A 2G5UA 5FF6B 4M43H 3P77A 4M1DL 3A67L 5E0QA 3ZKMC 4KUCD 3UBXB 1QRNE 5IQ9A 4G43B 2C7UB 5ALCL 2NT1A 1J12A 3TPKA 5I16A 2GIMA 2J6EA 5I74B 2H45A 4CA4A 3C6SB 3K6SA 4WV1C 4CMHB 4LIQE 5D1ZA 3T4YB 3I02B 3VWJD 2VH5H 4KI5E 1XCTA 5HVHC 1ZMYA 5IB3A 3HG5A 1JFHA 4ZD3H 1CG9B 4WW2C 5EC1A 1P5UA 4BZ2H 4FADA 4OF3A 2QBWA 4F7PB 3LRGA 3ARWA 5K9JL 3GHEL 1HH9A 2WWMC 3KYOA 4J1UB 3R8QA 4WWID 3AS3A 3GMRB 4TOYH 2XQYA 3DSNA 4X4YA 3VCLA 1FV1B 3QT2A 2KZ1B 1R5IB 4XPHH 1HSAA 3ATAA 3HHSB 2FX7H 4JFHE 3UDWA 2OK0H 2BY1A 1R3HB 2K7PA 4P59L 1MVUB 1UCTA 5M95B 1DLHB 2C9VA 1EZSA 1SYVA 3BXNB 3FYIB 3ZXAC 1W8EA 4Z7OE 4Y16B 2Y1VA 3ZTJH 2CHNA 4NRYA 3LNHA 1ADQA 1DZBA 3QS3A 4RZCA 3WG7B 5C71A 4GKSB 3ZZQA 3N42F 4O58H 3ULSB 3O4LA 2PW1B 4M3HA 3SHSA 4Z8FH 3NIFE 5E23A 1IAIL 1NBYB 1AS8A 3X1FA 3IJYA 4X6FA 1YECH 1M4KA 5EFIB 4QXWA 2E8ZA 3WDIA 1U21A 3RX9A 4P23A 5AVTB 2F7QA 2IADB 5F3BB 1LO5B 25C8H 2VABA 4TUOA 2V2XA 3FPYA 2Z35A 3ASNB 1DZ0A 2CBMA 4JDZA 1FDLL 4HF5H 2P47B 1U58B 4R26L 1AI1H 3B9KA 2P49B 1DVQA 3DARA 3IWVA 3U7YL 1AMXA 4PGBB 4QXTA 1A25A 3IFNH 3T0XA 1EHKB 1KWKA 2HFFA 1RZKH 2VUOA 5DJYA 2JIXA 3O3AB 4N5ED 1F1GA 2WK2A 2VZOA 4M8UA 2PXYA 3II2A 1TLKA 1QQDA 2H6PA 1PZCA 4P04A 5GGRA 5H94A 5CLYA 2VDRB 5SWSA 4KK8D 1ROWA 1AZNA 1FYTE 4N68A 4ZUVB 43CAA 5L8JB 1T83A 2ADJB 3CZKA 1J11A 4CVUA 1WICA 3DROA 3HNSL 4ZYKB 4NYLB 1NOFA 2UV3A 4NN5B 3CBRA 3M17B 3VFOB 32C2A 3T6XA 5SWQB 5F7MC 4JG5A 1S4IA 5BV7C 5E03A 3D0VA 4PLOB 5FW8A 2FH6A 1DE4B 3JV6B 3L3JB 5I82A 2FLRT 2X40A 4ZXBD 3D34A 4K8RD 7CGTA 1PLCA 1OLZA 1C5CH 5J11C 4QTHA 2VLRB 2JJWA 3SQOH 4AKOA 3JVGA 4YE4H 5C0IA 2HXAA 5CZKA 1KFGA 1EWHA 1XCQB 3GLZA 2WZPD 3QXAA 5C07A 3SYQA 3WXVH 1KSRA 3G08A 4HCFA 4TPRH 2QZQA 3KYMB 4FOMA 1FFPB 3OAZK 4I0PC 1K85A 3QUMA 4E5XA 3LH2L 2PKDA 3DX6A 4ODHH 1OAYH 2AV1B 3O4OC 3BVNA 5E56A 5BPPA 5DD5L 3QFDA 4H1LB 1KTDA 4I0PB 2F2HA 3WIIH 3OV6A 1H8NA 4XMKH 4N6QA 1FBIH 1NMAH 2R2HA 3BT2L 4RDQF 5EBWA 5CGMA 4P3CH 5IESH 1NCCL 3CXHJ 1HWHB 3KWUA 3MCYA 4RGNE 3IPFA 4LLDB 4W68A 2V3FA 1KZYA 5DK0A 4OUOA 3CLEL 3ULUF 1F58H 1VGEH 1M1SA 5C8JA 4IOFD 2JK5A 1DBBL 4HWEL 1Q1JH 4PGEA 3KPSD 2AJZA 1CLYL 3CZEA 5DEGA 1ZSDA 2JELH 4IMLA 4BKLA 4RFOL 3KLAB 2VQ4A 1CF8L 2LAAA 1BVKB 2R29L 4MWFA 3AQZA 1XSKA 4R8WL 1S7SB 2FH8A 3DHJA 4MMZA 1EXGA 2FR4A 2CLRA 4UM9D 3WDHA 3F7KA 4K07A 4GMSL 1OY3B 4G8GA 3JQOB 3C08L 3QDME 1D6EB 3DHMA 4FERA 4LRNL 4XNUL 4FHJA 4Y19B 9CGTA 3LKRB 5KWYC 2VISA 3MRNB 1U92B 3L45A 1HWWA 2NZ1A 2KUTA 2X10A 3P9LA 5AQ0A 3S35L 4F8NA 4AVJA 2ORBH 1T3FB 3UCQA 2VE6B 1IX2A 4Y2DC 3DO4A 4NENA 3POCA 4OJYA 1YEIH 2I85A 3RZCB 3DO7B 3MFFB 3VFNA 1L6PA 2F7PA 2X4QA 2OMWB 5CZRA 3IGUA 1C1EL 3G04A 1XF2A 4RRPG 3BRDA 2B08A 1BEXA 1JHKH 1F2QA 1NUGA 2IWKA 2X4PB 4C56A 4D9QE 1Z66A 1KMGA 1FZMA 3CVHA 5FOJA 2I7OA 5IMKA 3P11L 2XLLA 5K9KA 1S7WA 4YHIB 2CKNA 2ZPKL 3B5GA 4RGMB 4X83A 4KH2A 1ZDSA 2JF1A 2R2EA 4KVNL 4GMTL 4XO5A 5MP6L 4IMKC 3MJ7B 1LL1A 1RPQA 4AEIH 3HAEH 4K9JA 1S3RA 1QSFA 5LGKA 5GRUH 3T0WA 3H3PL 1MCBA 2R2CA 3AXLB 4QRQB 3SGKA 2CRMA 4UTCA 4AITA 2ZXGA 4TLUA 5EU5B 1OL0A 1AQMA 4U2ZA 5EOCJ 1G5AA 4HWUA 2GSMB 3A4DA 4RAUB 2WKLA 3K6OA 3BN9D 3VFUA 4PY8J 3EHBC 4YE0A 2ZSWA 3NEEA 1O5PA 1KBGH 2EEAA 2ZF9A 3VWJB 4Y4KA 4GI6A 3MRKA 4UV7H 4B5EA 5F88B 4FYRA 1QMUA 1I1FB 2COVD 1HN1A 4UWQB 1MHEB 1ZVNA 2Z31C 2R4SL 3CLFH 3NSXA 4UOW1 2OCJA 1UQSA 2A99A 2W0FA 3JV0A 5JQ6H 2WVVA 1LWJA 1K2DA 1T0OA 5D7JA 1CE6A 4OB5H 3V9CA 4GBXC 3IT8D 3LIZH 1NTDA 3NFPA 4KQ3H 1FJ1B 4NUMA 5KTEL 2V7HA 2ARWA 3AU1A 5D72L 3V4PH 2WTRA 1NLDL 4WK2B 1KIRA 1CL7L 5T3XL 1CGTA 3Q9PA 1E3XA 3S8WA 1EZUA 3DMMB 3ISRA 3O6LH 5B22A 1P7HL 5HDBF 5TE4L 5L2KA 3BP6B 3H55A 3VFVA 4YVUA 4HDIB 3UTZB 4M4PA 4Z7UB 3BH9A 3A6OA 3O6KH 4F27A 4YHKH 2X41A 1YC7A 5D96B 2G9HB 1D9KD 3GJEA 1OCOB 4EN3C 4L4VB 5C7ZA 5EOTA 4AYDC 2Q10A 2ENJA 2FK9A 5EORH 4Y1TA 4AC4A 2X1WL 3ZE2B 1WFNA 2FX9L 2ZWYA 3RILA 2JQAA 3RWHA 4EN3B 2FEDD 4AGLA 4QXGL 4BUHA 2LVEA 1DQVA 5MENE 3BZEB 1T6VN 4GG6A 1FL6B 4PJDB 5EBGA 1N0XL 5KVEE 4GEIA 1U8NA 4TL4A 3VFRB 3ZZSA 4KY1H 2EIDA 2OJ1A 2EC8A 3FSVA 2PR4H 2DQGH 1JDDA 5DJ2B 3CHXA 2QQLH 4HFWA 1S9VA 1OAXH 3EO1A 4FF9A 4W9FC 5KSAD 3TXAA 4OF0A 5DQ9A 4LK4A 4XO8A 2CGYA 1IFHH 4WFGE 5TF1L 3FSZA 5F96L 5DURD 1SEQH 3WI9A 3BQUC 2LR4A 3GQFA 3GGWB 2OJZH 1BQHB 1KG0B 2M8XA 3KNBB 4JDTH 4JKNA 4LSUL 4RWYH 4G82A 5JIHA 4O02B 1IBYA 3MCG1 3B2MA 3HBQA 2BDNL 4B9JA 3ULUH 1HYSD 2QR0A 5AWNL 3ZJAA 2JKWA 2OTUA 4LCIL 4U1GB 4ZFFA 4S1QL 2XNAB 4X4XB 3U9PL 2DQDL 3DX7A 2G4GA 3PXLA 5HDBE 5BNXD 2B1AL 2CCWA 4M7ZB 4PWKA 5E8OA 4QRRD 1A4CA 35C8L 5B4MC 1KYFA 1QLRB 2H0JA 2UX7A 2D2CC 2C7FA 4JFXA 5CNHA 3ZYIA 4UAOB 2ADGA 1ZVSB 3FQXB 2EZ0C 3HZVA 4UOW0 4QOKE 1A3LL 4NHCL 2VRAA 4JUTA 4PREB 3HUJB 4FC3E 4YBLB 3EJQA 5J57B 2DM2A 4PFEA 4JQIH 1WAPA 3H85A 2YA0A 4UMSA 2K6YA 2XN9E 3SJVA 1MWAA 4A7GF 2XBDA 5BS0A 4PRBB 2WXQA 4M6AA 3BAEH 1I1CA 1NFDA 4WSGA 1EJ8A 3KPSB 1ORQA 3F6LA 3CMOL 1Y18A 1P2CA 1M7XA 2CRZA 2NDGA 4DZ8A 1KGWA 3MLYH 5EUOB 2VL5A 4Q9RH 4ANKA 2NY4C 4A7QA 2ERJB 4M6ML 5BQ7B 4X9IA 4PRHD 3TCLB 4MQ7A 2GK0A 3GRGA 2BVOB 4IDJL 4URTB 5CUSH 2A1WL 4HWZB 4H40A 1A3QA 3PUUA 2EIBA 3BFQG 4UM9B 3NJGA 1IGFH 3H42H 2J6WA 4BELD 3UABA 4QDGA 4RMSA 4QNPF 3TC9A 5LGJA 2XG5B 3OHXA 4OGAC 3SQRA 1XF5A 1H3WM 3AM8C 4IRSB 1PLGH 2J7LA 4JO2L 4M3JA 3U36B 1DVZA 4CRPA 1VZHA 4CN6A 3WIFA 3QZPA 4RLDA 3V7AG 3IDMB 3CBJB 4YSEA 4LCCB 1I8IB 1DVFC 2IBZX 4G71B 4W9CC 1QEXA 1ZSHA 3MCKB 3T08A 2HFGL 1AHWA 2AJUL 3HC2A 4JCLA 4NNYB 4N5UA 1FO0L 1QABA 2B5IB 3U9UB 5CP7B 2K9FB 3K2MC 4OLWH 3IMWA 1KTBA 1TKWA 1F18A 1UKQA 3HE6C 3GO1L 3O11B 2BXZA 4ODXA 4LSQH 3PDGA 3QAQA 3VRIB 1L7IH 5K1JA 3HE6B 2BLFA 4L3CA 3RWJA 3QRGL 4I1NB 4ZW8A 2HT3D 3NCYP 2HT2D 3DDFA 1J8HA 5CMAB 4GT0A 3GLDA 1I7UA 3ARRA 3RHWK 5D7EA 3LMJH 2SEBB 4MJIE 3AMLA 1A4JB 3PPSA 4OT1L 5I1LB 2CAKA 3NCEB 1MN4A 5HJ3A 3PWPA 4HZAA 1VDGA 2J5LB 4PWGA 1BG1A 1NCGA 2H3NA 1SY6A 3RVXC 3SE6A 3S96B 3X14B 1FZJB 4NQCE 5B39G 4LNRA 3KM1A 3VXUD 1Q72L 3NCFB 1HL8A 1XGYH 4NO2A 1Q0YL 2ZT9C 1L9TA 3FU7A 4FFWD 3CQPA 3PWNB 4OQ1A 3OKMA 1MAML 3UYRL 3KYNB 3ZL1A 3PYCA 2H32H 3E3QE 5AOMA 3T71A 4QNPE 3HKFA 1K5NB 5KVDL 3ZU8A 4ODUB 1T1YB 5JHLH 1KNOA 3GSOA 5H2BA 3LQZB 2NQCA 1Y7VA 3AGVA 2V5MA 2WOBA 4KZ0A 4MJ6A 5D71H 1CI5A 2WQSA 3BKCL 1A3ZA 3NP4A 4JREC 2QKSA 4NGHL 1OT1A 4D0CB 5AB0A 5EF2A 4WI5A 4L3ED 4LPCA 5AVQB 4Q0XH 1FG9C 2QJDA 4NWTL 4M8QB 4QR7A 1ADWA 1PQZA 2YBRA 5AD0B 2BSDA 4JAMB 3DJRA 4OLVH 4ZNEA 1U3ZA 3MLTA 5FO7A 12E8L 4FLSA 4Z3JA 4O2EB 1D9KB 4HKZB 2WNGA 4W9LC 4TRPH 5T1DH 3HZ3A 1A21A 4GAYB 2X87A 4DUWA 1BXXA 1PZBA 2O5YH 5E6UB 4IEFA 3HPJA 2UWEA 1DVXA 1AACA 1X6NA 4S0HA 4QLWA 1ZY9A 3RY5A 4Y5VA 2WLLB 5FYJE 3T4AB 3GRWA 3LZOA 4XP5L 3ZK0A 2CGZA 3TJEH 2V4LA 3UIYA 3EH5B 4PEEA 2CQVA 3L4UA 4WUKL 4WTZG 2SODB 3IBEA 4WK0B 2JJVA 3ABZA 4X6EA 5D4HA 2WSKA 1M56B 5KSAB 2XOTA 1A8ZA 3EGDB 3NN8A 3QXWA 5CJ5A 3IVKB 1B88A 1G7PA 1XQ4A 2HA1A 1O7SA 2J72A 4IIQB 4NUGH 5DURB 3DHPA 4RQQB 4WUUE 3QJHB 5C86A 5L88H 4NZDA 4L1SA 2HJKA 3EGXB 5CIPA 4GAAA 2NSQA 5I66B 3PNWB 1UGNA 2G3ZA 1GYAA 2HPOA 4IGBA 1WISA 4WAFA 2MKWA 5C0AD 1ACYL 4XCCH 5CCKL 2V5YA 2QHRH 4IRZA 5GGTA 4XBEL 5ERWA 4ZG1A 4ZFOL 4XBMA 3BI9X 4J39A 4KZDH 4QRRB 3IDIB 1XH2A 1JNHB 1CLOL 2N3JA 2FWSA 4L5FL 5HHPA 4QUOA 1XGZA 4MJHA 3DIDA 1QZNA 3RI5K 4BZ1L 2I24N 4HK0A 4KI1A 5CEYA 2UXTA 4P5MA 5ALCH 3WJJA 4UQEA 4X7CC 3CK0L 3OWEA 4AEHL 3K46A 4M4RA 1EGJA 1NDMA 1PD6A 2I9LB 2JB5L 3ESUF 3OKLA 4NKIL 4F3FB 1T4KA 5KZCD 1C08A 5IGXL 1QR1A 5HYFA 4GSDL 1T6BX 2OCCB 3EOTL 5LG1A 3TJHD 3ATFA 4F9PA 2EUVA 2X42A 1ETZB 1JWMA 4OZHE 4PBVC 3GHEH 3LPGA 5AYUL 5JHDA 3TCXA 4HH9A 2ICWB 4Z3FA 2C26A 3VTTA 2JQZA 4PRHB 5HI4D 2NNAA 4MD0B 4KDVA 4FQXA 5JQHC 3Q8EA 1MFAH 5G4MA 1AGCB 1UA7A 2Q20A 1ACCA 2XJLA 4LLAA 4EE2A 2CXKA 2LVCA 3VTAA 3VGDA 4RIRB 5E99H 4FQQA 3UPCA 1TU2B 2G60H 5E2VH 2WXFA 4X4MA 4XVUD 3FB8A 5FCSH 4NQXB 3BCFA 1TQBC 2E74C 2GC7C 1VEPA 1QEWA 3LDBC 1OM9A 1OP5K 2AK1H 4PCKA 4B9FA 1JNLL 4DW2L 3QWNA 4JHAH 1HE8A 1IAIH 3VGAC 5JHBA 1LNUB 1TQBB 4ZX4A 3CPUA 1CXKA 3EYSH 3MXWH 5AW0B 4G59C 4ELDA 3MOAL 1O0VA 1U8JB 1PKQE 4FNRA 4JS7A 3INOA 5DRZB 3KPQB 4WO4D 5GRVK 3SE4A 3WKPA 3WELA 4QO1A 4Y5YC 4R26H 1H3UA 1BD2E 4UNVA 1PFOA 1TVHA 4QT5A 3GSQA 5E24E 1NAMA 5AB9A 2QLVB 3H53A 1KT2B 4OTXL 3MXVL 4ONGL 4TSCL 4ZNCD 5IKCA 2Y7OA 1IAOA 2BWIA 2IO5A 3MOBL 3MX0B 4XCYA 1HJBC 4YR6B 4Z7IA 4Q6YA 2Y72A 4KI5D 4LOFA 4FDWA 2VR6A 4KMTL 4DKAA 4O9HH 3NSJA 4C4KO 2VAAB 2YKLL 2VDOH 4PJ9A 2D9QB 4UU9B 4JO3H 5IG7B 4J8RA 5DS2A 3AVEA 1DCLA 3KPTA 7TAAA 2J73A 2WAHA 4EZLA 1KIQB 3EIFA 2QPFA 1WVZA 2C9RA 2FBJH 3FQ4A 3VXSE 3X3GH 2CDEB 2JV6A 1YEFL 1DEEA 2WO3B 5EF1A 1TQTA 1M7IB 4MDIA 4JFHD 5SWZE 1IVLA 4QHNB 5JORA 4AXWA 2H26A 2F74B 3KM2A 2EUWA 1F6FB 1CIDA 1FE8H 2BOCA 1T21A 1E6OL 4YGAB 1XIWC 2GEEA 1E40A 4JW3A 4G80B 2FJGA 1QWUA 2G75A 2R7EA 5FF6A 5IVZB 2VM9A 4MDRA 2BW5A 4KOCA 4IU3B 1YEHL 3UBXA 1H6FA 3LH2H 1XZ0B 4XNYH 2V6HA 4G43A 2C7UA 5A2IH 3T9WA 5DD5H 2R0LL 3DX0A 4UT7H 3BT2H 3C6SA 2QEJA 2Q8AL 5L6YH 4U3HA 1OK0A 3T4YA 5DUMH 2DQIH 3I02A 4Y4HC 3GBDA 4Y88A 5A2LH 4HXBL 3GI8L 5A2AA 3UH8A 2D7TL 2G4EA 1CG9A 1IUZA 1YG9A 1UWXK 3VD3A 1C9SA 4F7PA 1HIMH 4HPYL 4A6YH 1ECYA 4KK6D 4YHOH 4J1UA 5GISL 1CXIA 4HWEH 1CURA 5F9AC 2NY0D 3GMRA 1CLYH 4H20L 1G9MC 3RRQA 1FV1A 5TQ2H 1R5IA 4RX4A 1CICD 2VDQL 3HHSA 5J6GB 3P2TA 2R29H 4GP8B 1R3HA 1MVUA 3ORJA 1DLHA 2DQJL 3DX1A 3BXNA 3KGUA 3WAKA 3LB6C 4Y16A 4GMSH 3UMNA 3HMXL 1LO3H 3SE9H 1YEKH 1YSOA 3C08H 3TO4D 4EKXA 3GLEA 4NAQA 4LRNH 3FFCE 4GKSA 5EBLB 1FNLA 4K94C 3ULSA 3EDDA 2PW1A 4GXVL 5KYNA 5AYTA 4DAGL 3WTWA 1PVHA 4LBEB 1J5CA 1IBZA 4O4YH 1AOZA 1ONQB 4HOXA 1NBYA 5DC9B 1KEGH 5A3IC 2WV3A 4JPVL 4PIBA 1E3ZA 5EFIA 3FOMB 4AVIA 1KDIA 3V9EA 4ZSOB 3L4ZA 5F3BA 2IADA 1LO5A 1E2VA 4GUQA 2IH1B 3A47A 3GMLB 1U58A 4JFZL 1PPIA 2P4AB 4NLAA 2KL6A 2ZPKH 1R5WB 1D7BA 1PCXA 1HXYB 1BIHA 4PGBA 4XHJD 5DEJA 4IJ3C 1M9SA 1RZJL 2DH2A 4LPYA 3MGOB 4YK4B 4BWTA 3O2DA 4S0TD 1G6RH 3O3AA 4XMVA 4W9ZA 1KC5H 4U1LB 3ZKSD 3KWXA 4RGND 4FKHA 4ZO7A 2F8IA 4FL4C 4V1DE 2F9BT 3U4KA 4G7VL 5AVVB 4ZUVA 3DVNB 2AAVA 4R5XA 5IOKA 3VQ2C 4HIHB 1RZGB 2ADJA 5GS2D 3PABB 4ZYKA 4JE4B 4Q4EA 4NYLA 4YEEA 4KROC 4FLOA 3M17A 2P7TB 5CP3H 3VFOA 5SWQA 3FU6A 4B9PA 4R7DB 4I1PA 2WVUA 4ZQTA 2VR4A 3JV6A 1DE4A 5KZCB 3L3JA 4QRFA 3IE9A 2KHAA 5D8JL 3RY6A 4NRZB 3QWOB 2M2DA 3A6CL 4M03A 2VLRA 3VGBA 3K2KA 2R4SH 5J6SA 1TJHH 5C09E 1RI8A 1XCQA 4ISVB 2IPTH 5I1KL 4DF9A 1X9QA 3KYMA 5E8DL 1FFPA 4YWGL 4P48A 4P2AA 1RZKC 5I0WA 5F93C 3TVMC 5L0QC 5T3ZE 2G3MA 2FGWH 2AV1A 2Y1YA 4FNQA 3U1SL 4I0PA 4H1LA 4LRIC 5LBSL 5C3IA 2G5RA 3W9DB 5ES4B 1GZHC 1MJUL 3DSFL 2ZYSA 5F0LB 1FGNL 1CYWA 4LOUD 3U4EB 4LLDA 3L2NA 4HJ0C 3T77B 1A6VH 4LE8A 1UXWB 3ECUA 5ISZD 1OCRB 1FWXA 4MZIA 3UGXA 2FWLB 4CW1B 4OQTA 4IKNA 4WO4B 3KLAA 4Z3EA 4KPHL 2FX9H 3D25B 5PAZA 1BVKA 5LG6A 4A04A 1S7SA 1OWRM 2LV4A 3VX1A 3ULUD 1M6OB 2CO6B 3MMEB 2E7MA 3B7UX 3IS0X 3QJQB 3WNNA 2MHAB 1Q9LB 4YDLC 1QTYT 1D6EA 3CZFB 1N0XH 3L3KB 4Y19A 3LKRA 3MRNA 1U92A 3DLQR 3V6OA 2X3BA 5IREA 1T3FA 1WD9A 2DYRB 2VE6A 5BRQA 5JOPE 1G87A 3EW3B 4YDLB 2ZUXA 2F08A 4ES8A 4KDTC 3RZCA 3DO7A 3MFFA 4OGQC 2OMWA 1J48A 2HTKD 4PR5B 1CDUA 1R3KA 4BBWA 3AG3B 1LVEA 2PPCA 2X4PA 3NYKA 5TF1H 2J55A 2F8XC 2FVNA 1YAZA 4YHIA 4XNXL 1UM5L 4J3OH 4PJBF 3Q5TA 3BISA 2FWOB 2WY3B 3C6LB 1QNZH 1G1YA 3LEXB 3MJ7A 4JMNA 3I50H 5FK9B 4S1QH 5CBEB 4JB9H 4LVHC 3H6AA 3REWB 4IMKA 3QUKB 4KFZC 5EN3A 1PS3A 3EFDL 3AXLA 3QSKB 4QRQA 4DZBB 2CR0A 4BSWB 2IAMD 1NC2D 2DL9A 2Y1ZA 35C8H 5G4NA 3OAUL 4KRPD 5EU5A 1RAMA 3ZRSA 3BD4A 1YRKA 4HH8A 4LVHB 4F8LA 4XPGH 3MNDA 3SGEI 2Y7QB 3INUH 5C0CB 4CU7A 2X3AA 2F5AH 4RAUA 3FUMA 5E4EC 1DBAL 1DSWA 3QYNA 3EJUA 4NT6B 4JGJA 1LO4H 4NQTA 5TPWL 5FUCC 3VWJA 4AJ0A 4AVKA 3Q8AA 5F88A 5I1HH 1I1FA 5J89A 2D0HA 1MHEA 3Q2CA 3PP3H 4K7PY 2Q5BA 3CMOH 1QKZH 3A23A 4F8QA 3NTCH 1Q1PA 1CICB 3HG1E 3SBQA 4PJIF 1FJ1A 2IV8A 4FG6C 1DBJL 4K71C 3MGAA 3PDOB 3FZUC 2R1XB 5ACLA 2DIAA 1TCMA 5DD3L 5F70A 1AZCA 3DMMA 3HAEB 1IFRA 3B43A 3TO4B 3VD5A 4Z95L 5IQMA 3TF4A 2VGLM 1ED3B 4B60A 3BP6A 4JFYB 4PJHB 3CFCL 7FABL 2DJMA 1ZPLA 1URZA 4HDIA 3UTZA 4JKPL 4R4NC 4G8EB 1CD9B 4Z7UA 2VXQL 2YKKA 4XODA 1KCRL 4P3DB 3LNFA 3L08A 4HAFA 4PJBE 5FHAL 3WMPA 1Q9OB 1TFHA 4LSDA 2G9HA 1VFAB 1NCNA 4PY7B 4L4VA 4XPFH 4FTVB 3LRMA 4J3SA 1CFMA 4NUJB 1E28B 1UH2A 4PJXF 3WNOA 1JZHA 4EN3A 3GO1H 2IGFL 3SBWA 1XSIA 1ZLSL 3BZEA 1G43A 4Q97A 1FL6A 2APVA 4PJDA 5GQBA 3PDDA 2EVHA 4QOKD 3VXRE 3QRGH 3DX4A 4LSRL 1R19A 4JY5H 5E6IC 3KLHC 4ONFL 3VFRA 3GYRA 1WEJL 1NUNB 3SGJA 1H3TA 2ISDA 2XN9D 5DJ2A 2R56L 2FEEI 2W92A 4MMXB 5E6IB 1BPLB 1D5RA 4YSRA 3V4PB 5A1AA 2BVPB 5I0XA 5C2BH 3ZW3A 4G72B 4A7VA 2C3VB 1IKFL 5JXAL 3ISYA 3HC3L 4EDWL 3MLUH 3KNBA 3GGWA 1BQHA 1KG0A 3S34H 2ATKB 1F1DA 4O02A 4KWUA 3ZIYA 1L0PA 3VDCA 4E9LA 5TGBB 4PJIE 5BMFL 5J4MA 3B8YA 3MRBB 3UYRH 2XNAA 2WZPA 4X4XA 3EXJA 2VXSL 3F6JA 3ZE0F 2BIHA 3V0DA 4WWNA 3QHZH 4ZMOA 2J71A 5TK2A 1RSFA 1QLRA 1RVFL 3L9EA 3OAYH 4L0ZA 3D6GA 3BAWA 1IC0A 5KJRL 3D7PA 1ZVSA 3FQXA 2X9XA 4XRCB 1KYDA 3VWKC 3K6FA 3ARVA 4LLUB 2NSXA 4MS6A 3MDJA 1JPFB 3HUJA 4PREA 5DO2C 4PJXE 5E94B 1BDYA 1KBWA 1KGXA 5EZOL 1QUPA 3HS0C 2AQQA 1CXEA 2G3XA 4AMXA 4OJDH 1CDIA 1YYML 5ISZB 4PRBA 2ED8A 4KKQA 1NCJA 5I1GL 3HW7A 3KPSA 1AFVL 1WD8A 2FJUB 5D2NE 1MI5E 3IRZA 1B2YA 1KY7A 4GQQA 5EUOA 3SGDH 2WSPA 1JXKA 4XPAH 1NIFA 3X13B 5BQ7A 3TCLA 5KN5B 3S36L 1EA9C 4HQQL 1BFOB 2BVOA 4POYA 1F13A 4HWZA 3TV3L 2ZP9A 4UM9A 4A7TA 5L7XL 1N19A 1C8QA 4MHHG 4HC1A 4OFQA 4U1HB 3UX9B 2XG5A 5ECGA 4ZFZB 1KEMH 1X9UA 3N2JA 2GJRA 1NGZB 5D6DA 3A6BL 1VCBC 3HFML 4G6FD 4EKJA 4IRSA 3EXLA 1ZPUA 1A6AB 3L4TA 3EDKA 3U36A 3V0VB 5K9QI 3SDCD 3IDMA 2PP9A 2FEJA 4LCCA 1I8IA 4QRPE 4JO4L 5EB9A 4CVWA 4NPKA 2NY6D 3R1GL 3HMWL 2OZ4L 1MCFA 3MCKA 1DDHB 1SLUA 4NNYA 3U9UA 4FZEH 4QF1B 5CP7A 1HZHH 2O93L 1IKOP 5FYLH 2ADYA 3O11A 2DQUL 1AGEB 3LOWA 4Z76B 3LHPL 1IZJA 3K2UL 3VRIA 3ZE0E 4CMMB 3B7RL 2V9TA 1YY9C 1A7RL 1V3JA 2VW4A 1RV6X 4GSXA 4J3OG 4DCQB 3B2VL 3BIKB 4TULH 3HE6A 1XEUA 1WRFA 2PWEA 1KN2L 5CMAA 1UXSB 5BZXA 1LMIA 1Y6KR 1OAKH 2SEBA 3I6KB 4YSDA 1NC2B 1SFHA 2OMUB 1BF5A 1A4JA 1YEGH 4FKKA 4KRPB 5I1LA 4L5FH 1M9WA 5JW4Q 1BECA 1OTUD 1YNLH 3QORD 4A2FA 5A7BA 1L3NA 3W81A 2N01B 2X1PA 1SN5A 1I7TB 3S96A 2VJ8A 3VFPB 3X14A 4RBPK 2XZAL 1FZJA 2PF6A 1EZVY 5TD4A 1G4RA 3RX5A 1PLAA 4NKIH 4MNGB 3ZKND 5FYJD 1JZ8A 3PWNA 5D4JA 2X2UA 3LKSB 3TYFB 3KYNA 1S3KH 2ZWSA 1J88A 4LASL 1ACXA 4UNIA 1CU4L 1K5NA 4GUCA 4ODUA 5HHNA 1JERA 1T1YA 2X7LB 1T2QL 1EHLH 3LQZA 5F6HI 5HGGS 4PB0H 4CBZA 1ODUA 3M86A 4DOHB 3ARYA 4X9YA 1QHQA 4RMTA 5FWRA 4M5YH 2O4EA 3GS0A 3P73B 4FX5A 1BJMA 2IDUA 1FLRH 4D0CA 4HOMA 1RD6A 3NJHA 3E7JA 2CALA 1BVNT 2CHZA 4WWPA 4EQ2A 5E9NA 3SY6A 4M8QA 1MFEH 4XBPB 1BM3L 4UINL 4DK6A 5J7CC 3RPIB 2W94A 1TJXA 3N5AA 3O6ML 4JRYD 5AD0A 2R69A 4JAMA 4NUQA 1BMWA 1OTSC 3WEBA 2YQGA 4PRIB 2WSDA 3FO2B 4AQOA 3P3TA 4X8GA 3C87A 3MLPA 1PTZA 2VR8A 4O2EA 1D9KA 4HKZA 1KTJA 3NDZE 5D70H 5F7NC 4GAYA 2PR9A 2YUXA 1U4EA 1I8LC 3MOAH 3POHA 1J5OL 5C6TH 5I0ZA 1AANA 3FCSB 3CMGA 1RUMH 2IWGA 1E6JL 4OLXH 5FA3B 1J0JA 2WLLA 1MCLA 3T4AA 4ZMVA 5ESAB 4G7YL 1ZTMA 2ZUTA 1UB6B 4QOKB 3HI1B 2H32B 2F7RA 4DVRL 2MCAA 4OCWL 1MZYA 2IGTA 3G6JE 1AGDB 1MELA 4KRMB 4A2GA 2LT9A 4AGNA 4WI4A 5DUJA 3MA9H 4AL8H 5KSAA 1AS6A 2VXUL 1UZ8B 3EGDA 4KMTH 3IVKA 3MLWH 3G6DL 1JI2A 4X9GA 4CKQA 2Y7LA 4PJ8D 3V52L 3SYOA 4IIQA 1KB5H 4RQQA 4LESA 4LLWB 3QJHA 4WSKA 3U2SB 4OD3H 1BQ5A 4JG1L 2OMNA 4PJGB 5EN2B 3EGXA 1ZANH 2H41A 1XVSA 5I66A 3PNWA 2G2PA 3WIHA 2F68X 1IT9L 4HOWA 3DV4B 3V0JA 1TPXC 3Q5YA 5T5FH 4EZMA 5FHBL 2JQMA 4JM2C 5DMGC 3QUHA 3R4DA 3RGBA 4Y4FC 4QRRA 3IDIA 1JNHA 2XA8H 1TPXB 1F11B 1O6VA 2NY3D 4R4BB 1DJGA 4XAKE 3Q8CA 5I75B 1DQDL 1NSNH 4HS6B 4OM1L 1YEHH 1NEZG 4G8AC 3HNTH 4Y4FB 3SDDC 4FCHA 2B1HH 3S0PA 1TTAA 2BVQB 3CFJB 3Q6FB 2YJQA 3ZRFC 4F58H 4P9HL 1L4IA 2XI9A 3CBKB 1HL9A 2I9LA 1BD2D 3SDDB 4F3FA 3D52A 2VWEE 4P4RB 2Y3NA 4C4UA 3GI8H 2I07B 2WO2B 3NEXA 3NRQA 3PL6C 5HDQH 4ZS7H 3P0YH 2V3EA 3VVVA 2Z1KA 3ES6B 3EJPA 1ETZA 1BGXH 4A39A 4CSZA 2UVEA 2QPSA 1RFDH 1EK3A 2QSCL 2C5DC 5DFVD 2H1PL 2ICWA 2IPUG 1QVOB 5DJ8B 4PRHA 3BRFA 1W80A 4Z7VB 4MD0A 2ZXCA 2KPNA 4KKNA 3D4CA 4ZT1A 1ZTXE 2FEEL 2VLKE 4L4TE 1AGCA 2NTSP 4X5XB 1JHTB 2WXNA 3O9WD 4RIRA 2AW2A 1JD7A 2DQJH 4G9DB 1TU2A 3VXSD 4XI5D 1LDPL 4MA7L 4G6FB 2BP0B 3HMXH 4NQXA 2WOYA 3JTBA 4ZX3A 3K71B 5D7IF 4HYTB 3W11D 4GXVH 4DAGH 3SKJH 1OP3H 2NY6B 2R4RH 3P69A 5IJDC 1LNUA 1MFDL 1WG3A 4X99B 4UV4L 1U8JA 3DIFB 3KS0H 5DRZA 2C1OB 3KPQA 1GCFA 4OZGF 1EMTH 1GZQB 2WUBL 2IQ9H 5C0ND 5HTSA 4JFZH 2DDQL 1ZLUK 1KN4L 5KUMA 3TASA 1PZAA 1KT2A 2ZKMX 1OD7A 3LD8C 4PVBA 1AE6H 3MX0A 5JMOC 1E27B 1I7ZB 5DZJA 4YR6A 4DKDC 5I8KH 5KAQF 1H6UA 2N0KA 4EZKA 3LD8B 4NC2B 1IC7H 3MJWA 4QRUB 4TMPA 3DETC 2E7LC 2VAAA 3QORB 4UU9A 3GSWB 4A67A 5IG7A 2OMVB 3LN4B 4N2FA 1UH4A 3EF7A 3I6LE 1QPXA 3SD2A 1KIUB 1KIQA 4XZ4A 2GIXA 3VXME 3NJLA 3NPSB 3CFIC 2QSVA 4QXUL 3LZQA 2Q8BL 2CDEA 4XXCC 1HKLH 2DQTL 4UILL 1M7IA 4MXQD 4QHNA 4AMKL 1IM9D 5J0BA 3W9EB 1RUQL 5DEZA 2F74A 3B2XA 3M88A 3CFMA 3WSQL 5H8DA 4IOIB 1MLBB 3A6CH 2RB8A 5CJBA 2V7NB 3SEPA 3C9NB 3VI4B 5EBMB 3FFCD 4G80A 5ID0B 1PCSA 5TQ0L 2BIMA 4PBXA 1TLMA 5IVZA 2J88H 4IU3A 4YWGH 5D7IE 4KQ4H 2IMMA 1XZ0A 4WDIB 4YHYC 5ICXB 4BCZA 1GYVA 3OTTA 2Q6WB 4G6AC 3U7WH 1J1PH 2FSEB 3UCRA 2I5YL 3WD5L 3FN3A 1T03L 1BLIA 5LBSH 3UIZA 2VZTA 3E6FB 3FUIA 4JRYB 1RMFL 1MJUH 1ZTXH 2YD3A 2AK4B 4OZGE 1L9SA 3KLQA 1GIGL 5AAPA 2VDOB 4PPTA 5D93C 5EU3B 1M05B 4RRPA 5AUMB 3U1PA 1A1NB 3JWNG 1SOQA 3BAXA 3U4BL 1I31A 1MHPH 5G55A 3MRIB 4V1DD 2VR3A 2WBKA 5JW5B 5J6GA 3DRTB 1A6UL 4YXKH 3UTSE 2I7SA 2WZAA 3PG2A 4AM0B 3ME0B 4QTIL 2Y6SC 4YSOA 3WO3B 3TS8A 4YDJB 3A21A 1QFWI 5EBLA 5I1JL 2B1OA 2MNUA 2DOCA 4LBEA 1ONQA 3WY1A 1UWFA 3ULVF 3MODL 2Q1EA 4S11A 2E46A 5J1TC 4PJ8B 3FOMA 5C09D 1PZ3A 4F24A 1N59B 2WLKA 3HRZC 4ZSOA 1XH3B 4FKEA 3MLSL 5AZEH 2IH1A 3MJ8B 3GMLA 5BW7A 5T3ZD 3UEZA 1DLFH 4TSBH 4XNXH 1UM5H 3FKUS 3RA7H 1R5WA 2D2OA 3W38A 1HXYA 4BZ2A 4B9ZA 3QH3B 4A6YB 3QXVA 3BSGA 3MGOA 3RVUC 2H2SD 3SYAA 3GM0A 2OR9H 2PP8A 4U1LA 2NY3B 6PAZA 3KG5A 3VX0A 3GDBA 3TL5A 4A37A 3D33A 3DVNA 1PG7H 2AJSH 3QIUC 1XBRA 2WKOA 2FYVA 4HIHA 1RZGA 3BPNC 3TBBA 3D2UB 3PABA 3X2QB 1KACB 2P7TA 1TFPA 1ECZA 1HAWA 1ASPA 3QZMA 1R3IH 1OLLA 2BS9A 1SNRA 4R7DA 3T1FB 4DGWC 1UT1A 3LPPA 4JFEB 2XHNA 1K3ZA 4N0UB 2BHFA 3DYMA 4NRZA 3QWOA 4OLYL 5EWIL 4H25B 3HB3D 5IJCC 2V5SA 4ISVA 1V7NL 3HE7C 3Q1SL 1VGKB 1PSKH 5JOPD 4JGNA 3ARZA 3IMUA 4YS4A 4ZUTB 1OAQL 4S1RL 1Q0XL 3ULVE 15C8L 1CYGA 1SOXA 2VDMH 3GBML 3VXSB 1AHMA 1AR1D 2PCPB 1VJSA 1G6RB 2JI3A 3W9DA 5FO8B 3FUFA 3W37A 5J5EA 3CFKB 3VH8G 1PNCA 5D6CB 1XR9B 3CFCH 7FABH 1ES0B 2F58H 3U4EA 3Q8BA 1WWWX 1II4E 4DP6X 4PW3A 1MFCL 1OO2A 3P1VA 3UJIH 3WLWC 1KCRH 3T77A 2QVMA 1RJZB 3ZKQD 1UXWA 1U6AL 2CUAA 3LQMA 2DQHL 3PRZA 2RCSL 2TRHA 3CPLB 4JM4H 3HN8A 4P5TC 1FGVL 4CW1A 3UADA 2F5BH 4WO4A 2WM0A 1U3HC 2MNJB 1I1AC 1P53A 1I4FB 2JKTM 1FN4B 1EDYA 2ZYIA 3D25A 4PCTA 1LO0L 5LWYL 4RNRB 1MAJA 3LQAL 5JLZB 2XTJE 1ZLSH 1M6OA 2CO6A 3H2PA 3GS4A 3K6IA 1JI1A 3MMEA 4XX1E 1BZDA 4J12A 2MHAA 1Q9LA 1E4XH 2GBUA 5DQDL 3CZFA 3L3KA 1KB9K 1E7UA 1WEJH 1G7IB 5HDOA 5I9QC 5I18L 3BWUC 1AY1L 2NNXA 3MUY1 1GJUA 4Y9FA 1PLBA 1QOKA 4PR5A 1U91B 3GZOA 4CKVX 1WH0A 4DJMA 2YMXL 4BFNA 2L0DA 4JFSA 3FF7A 4YC2C 5JXAH 1ETA1 4N8CL 3ARGD 2CO7B 2WHVA 3HG4A 3O6FD 1UFUA 1JNNH 3CVIL 1YPZB 1I3RB 4AYFB 2FWOA 3C6LA 1M1XB 3LEXA 5BXFB 3LS5H 1Z1WA 5BMFH 4YHNB 5J13B 2YAHA 2WQ8A 4HIJB 1OHZA 1U8OB 3OBAA 5CBEA 4GRLD 3REWA 4NZ8A 1ML0A 3QUKA 5ANHA 1FFOB 1RUKL 4DZBA 1GXEA 4BSWA 3QJXA 3UPRB 4AGPA 4HCRH 3I2CH 3L5HA 5DS8B 5DO8A 1KYUA 2Y7QA 4OCRL 5C0CA 3ARFD 1W91A 2NZIA 3QCUL 1F45A 3O4LE 5AKSA 4AEFA 4NT6A 4GS7C 1TNNA 1MHCB 2Y36L 3FTSA 2F0CA 3JXAA 1A1OB 2WXLA 3EYUH 4S1DD 1EV2E 4F8PA 3WOVA 1IQWH 1UACH 4MYWB 1WCBB 3VXRD 4J3OC 4Z3IA 2A9ML 5DVOA 4B97A 4LOVA 3EYQD 4V1DB 5FYLD 2EE2A 3MNVB 1CICA 4EQ3A 3UAAA 5CEZE 3GMPB 3PQYE 1WWAX 4AIXA 2WLHA 3AY4A 3PDOA 2R1XA 3TV3H 3BSZH 3G7TA 2OW6A 1O6SB 1UT2A 4F2MB 1U36A 1TMCB 4GRMB 3JWOH 3WENA 3CGTA 5SWSE 4YDIH 1G6VK 3HAEA 3TO4A 4TF4A 1ED3A 5CFHA 4PJHA 4JFYA 1B6DA 2DYSB 3WGVB 3S88L 3HN5A 2V2WB 1LQSR 3HFMH 3WKQA 4G8EA 1VPOL 3FFDB 4OM0L 4JFQB 4H8VA 4RFNB 2XUWA 4WEUD 2C34A 4P3DA 2E7BA 4AQ8C 1HEHC 5K69A 5MEQB 1A22B 3MBWB 1Q9OA 1VFAA 4PY7A 1HXKA 3HMWH 2OZ4H 4FTVA 4WJG3 3U0WH 4NUJA 2HJFB 2NXYC 4XOEA 1GW6A 4MA1B 1E28A 3LIUA 1G1OA 5DA4A 4K2UH 2J44A 2KMWA 2IF7A 4JG9A 2N1TE 5LCVH 4LVNC 3BGAA 3NIGF 4UDUB 3MREB 3EBGA 1A7RH 3E8UL 1MFBL 4H44C 4HEPG 5C07E 1N6QL 4WF7A 2W60B 5KVFH 3CDCA 4MTMA 3N41F 2AEWA 1KN2H 4PJ5B 3QCVH 4YXLL 3OC8A 5F9OH 1MEXL 3GS7A 3HI5L 3LIZA 3Q43A 4HIPA 5CZVL 2OTWB 4MMXA 5E6IA 1RUAL 1DBML 3V4PA 2BVPA 1O7DE 4XVJH 5GZOD 3Q0HA 1UURA 2C3VA 3FC8A 4FQJL 1G0XA 2ATKA 2DM4A 1CD8A 3EF4A 3ZN6A 4P4KB 1FPTL 5IFAL 3D4ZA 2WUCL 4Y2NA 3PHQB 3G9AB 3ZT7A 3HZMB 1IC4H 3HB3B 3MRBA 4NO0D 4CGTA 3TJPA 1MW3A 4L8DB 4LASH 5LGHL 1FHGA 4N24A 1NCIA 5D7HA 1SHWA 3NQIA 3IFLL 3MUGB 2VW7A 3NH7L 4QRPD 3IAGC 4TTGA 4G8GE 2CIIB 5IF0B 3ZTDC 2X6UA 5LXVA 4P9MH 2R51A 4FQ1L 3B37A 5IHUL 3QS2A 5CHNB 1AR1B 2VM3A 2Y6TE 4HLEA 4XRCA 2FUTA 5IHLB 3ZDZF 1BZ8A 4WTZA 1BM3H 1UUNA 2KI6A 4LLUA 5E08H 1JPFA 1RZ7L 5E94A 2DIJA 1NGQL 2AKRB 4HOZA 2BSED 3GKWH 3MN8A 3KYAA 4GRWH 2Y7MA 3RVTD 3Q44A 1IGCL 1RHHB 2HRPL 3NIGE 1MCWM 5ISZA 1FSKB 2L04A 4Y9GA 4NNXB 2EXYC 1CFVL 5H4YA 5C0JB 1Q9KB 3DXAD 1UTDA 4J4PC 1X5ZA 3BDXA 1CJYA 1KENL 4YDMA 2WC7A 3X13A 1J5OH 5KN5A 3WY4A 1BFOA 1N5YL 2HMIC 1E6JH 5AAWC 1J1OL 2O5NA 4WVRA 4X42A 3HC4L 4G7YH 4U1HA 4BWWA 4TTDC 4FMFA 4ZFZA 2HVBA 4M29A 3FCTB 3QHFH 1NGZA 4Q14A 4DVRH 2J2ZB 2WYIA 2GJ6D 2YA1A 1UT9A 4X80H 1A6AA 1MXDA 3DV6B 2PO6B 3V0VA 4EPSA 2WBJC 3EO0B 3VO0A 1T04B 5EOCH 3MRRB 3WTVA 2VERN 4CADB 1DVTA 4JQXC 3EJCA 2Y24A 4H26B 1Z9OA 4NO5B 1BOYA 2YK1L 3G6DH 2WBJB 2Y1AA 1DDHA 4LU5H 2YRLA 4I13B 4BFBD 4KOBA 4QF1A 5HJGA 4PLJC 3O2VH 1CDYA 4G3YH 5AZUA 3ARGB 2ZAGA 1AGEA 1RERA 2ZE0A 4JG1H 3O6FB 4Z76A 4JQIA 2VLME 1X7SA 3L8QA 3D69B 4BCXA 4CMMA 2E9IA 3PXHA 3OZ9L 4DCQA 3BIKA 4BQCA 5CD3B 4D2NA 3ZT5A 4GRLB 4I85A 2X1OA 1UXSA 3ZDZE 2D03L 1XGUB 3I6KA 2P5WD 1NC2A 2OMUA 4PJBB 5GHWL 3T65B 3K1DA 2AJYL 2EABA 2YEZB 1C16B 3ARFB 1GC1C 2WQUA 3MRQB 4OM1H 5L2KE 4JJ5B 3S8GB 1I7TA 2HVJB 1OSPL 3U1QA 3ZSSA 5C0GB 5E1HB 3VFPA 2VQ1B 3WNKA 4AT6B 3GSNL 2B0SL 4P2OD 2EIEA 3DGGB 4WENB 4LL4A 5B1BB 3RU8H 1SRDA 1PKOA 3AT9A 1WFTA 3VYNA 3ZDXF 3KR3L 4MNGA 4K55A 3RVWC 1P4UA 5F7FA 2HT4D 3B5TA 4OJAA 3LKSA 3TYFA 3ZLQC 4MQXD 5T1JA 4M6OH 2P3YA 2X7LA 3RWCB 1NMCB 1AQ8A 3WTUA 1S78C 2G2RB 1NFDF 3TFKD 4O00A 3B2UC 4DN3L 1B3IA 1X5LA 3SOTA 3VXQB 1UM6L 4AC2A 1UH3A 3LXCA 1EO8L 4S10A 3P73A 3PS6A 4AH2B 5FR3A 1ZHKA 2JH2A 1KTLB 2JJTA 3DUHA 3OAZH 2CM6A 3TO2B 4AZUA 1J5HA 4XBPA 1GSKA 3OJVC 1KXHA 3IPEA 3WJLC 2WLYA 4MA7H 4ZFOB 1UCBH 2O6PA 3RPIA 2D7MA 5C0RL 4KO5A 6FABL 4Z7NB 3R18A 3ETBF 4OCXH 2WINB 4P2YA 2CG9X 2XWCA 3FO2A 4PRIA 4DUXA 3C2AH 5BO1L 5BOZG 4FRWA 1IGYB 4S1SH 2H7WA 2LU3A 5KBLA 3QO0B 3MC0A 2KLRA 4ODSH 4ZOEA 3LVEA 3NJMA 5GSVB 2A4EA 1JGUL 2HLFD 4WEMB 1AZVA 1F41A 1OPGL 5JIPA 5IMLB 5DMKB 2EKSB 2ETWA 1E7VA 3FCSA 4JJOA 3ARED 4XAKD 3WNJA 3QAZB 4ZMXA 3KJ6H 5FA3A 1KBBA 2FB4L 5ESAA 1UB6A 4QOKA 3HI1A 2H32A 1G84A 4JDEB 4W9DC 3E80A 4PYGA 3UZQB 3ZL4L 1AGDA 5JHLA 4UAHA 1ZRUA 3TBTB 2YAEA 5B38B 4OLUH 1NCHA 1Z2KA 5C0BB 3O0RH 2HKHL 1UZ8A 2X53A 3D3VB 3FCGA 1OHQA 3ZDXE 1HH6B 3BC9A 3GTVA 5GSRB 3DDGA 2YN3A 3X17A 4YX2L 1Z9SB 4LLWA 2F54D 5EUKB 3QPXL 3U2SA 3SJVE 4B6ZA 4QXUH 4PJGA 5EN2A 3JWNC 5HVWA 5BS0E 1BYPA 4QGYA 1NFDE 4HGMA 1OF2B 4AYMC 1NANH 4WSJA 2BIIA 3ARBB 3KVPA 3DV4A 4NO0B 1DO6A 4N3TA 4NUPA 5IT2H 3WSQH 1PX3A 4IDLA 9PCYA 1KJ3L 3MJ6A 4Q89A 4PG2C 1INEH 1N0LB 4MXVF 3RPKA 5C0FB 2LLLA 3FF8A 4K9EL 2JTYA 2NY7L 1EQWA 1F11A 4R4BA 3ZQXA 2DLIA 3N9GH 4GW1B 1RIUH 4N2EA 4HS6A 3KDMB 1HOEA 3QFJE 4Y4FA 1J1XH 4UQIM 2BVQA 1U8MB 1NEPA 3CFJA 2NY2C 3Q6FA 4ZTOL 1HINL 5I5IA 3WHXB 3CNKA 4HGKC 1DL7L 3SDDA 1EVUA 4XN5A 4P4RA 2YSTA 4DP7X 3ESNA 2JJSA 2X9YA 3JT2A 1QBLH 2I07A 3N44F 2DKMA 1TQCB 2B77A 1OQXA 3ES6A 3FHAA 4M7KL 5L7XH 3DXAB 2BS8A 1KB5B 3FO1B 3CXDL 3C8HA 3V6FB 5KBPA 1WWCA 3GXPA 3L3OB 3WFBL 2YR3A 1QVOA 5DJ8A 4WNSA 3ZDYB 3RJDA 1RK7A 5F7EH 1A0QL 3SO5A 4Z7VA 2H3KA 2QTVA 4XWGL 4X5XA 1J8HE 1K4DB 1JHTA 1A6UH 1UHVA 2WB1A 1CDCA 4H88L 2UWEF 4JY4B 1CGWA 3I6LD 4OGYH 4V33A 5ALBL 3ZGIA 4G9DA 1M71B 3VXMD 1SUHA 1G0DA 1DSFL 2BP0A 2GJ6B 3SPCA 3PWPE 3CVBA 3TV8A 3OB8A 4L1DA 1ET5A 1NINA 3K71A 1S5IH 5I1JH 4LSVH 3FQRB 1OCWL 3RDTD 1JZIA 1UYWL 4R7XA 1E9OB 4PRPB 3FS9A 3AC0A 5KVGE 4XNDA 2E75C 4H4NA 3QZNA 5D1QE 3TX4A 1GGYA 2UUDH 4X99A 2E5EA 5TE6H 4XO3A 1D5IH 2VDNL 3EAKA 4BHUI 5EEXA 3DIFA 2N7SA 3P4NB 2C1OA 5A40E 3MLSH 4MXVE 5MI0C 1GZQA 1LQBC 2IEPA 4HPOL 1JZEA 2WTOA 2VZVA 1XT5A 4DT2A 2X28A 1TZGH 4G6MH 5IMOB 1JRHH 3P54A 3WFDL 5C9JB 2AABL 4GSQA 1D6VH 3V0WL 1E27A 1I7ZA 2E9JA 2ENQA 2P5WB 1DQLH 1NQBA 3E9UA 3KBFA 4HHAB 1CMOA 4LXFA 5DDHB 1CTOA 3DJSA 3QDJB 4QRUA 4ZAKD 3QORA 4MNQE 1G1CA 3GSWA 1PD0A 2OMVA 2AXHA 2Z7UA 3LN4A 1YEDB 4XMLH 4Q56A 2ZD0A 1BSIA 5D1ZI 3CFBB 3D30A 4BIKA 1WIUA 2KZWA 1SDAB 3WS6C 1KIUA 2X4RB 3RVVD 1T0NB 3OL2A 3ALWA 5IJKC 3O8XD 3PWVB 4N22A 2Q9OA 3KVDD 1CI3M 1FIEA 2NXZC 3W9EA 2H1XA 5BUPA 5ADPH 4XXCA 2ICEB 1MLBA 3QJUB 4IOIA 4M62L 4IK6A 2UWEE 5EWIH 2V7NA 3RKPA 2NXZB 4FFYL 3VI4A 3C9NA 5EBMA 4HUXB 5ID0A 3JWDL 4NPJA 4HULB 2RACA 4KHXL 3Q1SH 4KKAC 3SPJA 3D9AH 4DK3A 1F4WH 1VZIA 4XN2A 4WI0B 1RZJC 1HZKA 4NM4H 4G6JL 3BUYB 1OAQH 4OIBA 3BGMB 4WDIA 3OG4B 1Q0XH 4IM8A 4OCSH 4MZ2A 1N67A 5ICXA 3W57A 5F3FA 2Q6WA 1KB3A 1HK6A 2FSEA 1A7PH 5JXED 3JUYA 1H5BC 4U4IA 1JN6B 1S7QB 3J7HA 5GGQL 2LTQB 5CKAA 2I26N 1IAKB 4KK9C 3S4SG 3E6FA 4JRYA 5I71C 1NGPH 1NCAH 3S37X 1XD1A 2AK4A 2YPVH 2GTZB 1H5BB 3MV7B 5HHXH 2LGNA 2BK8A 4DNLA 2P9RA 1MQ8A 5EU3A 1M05A 3MJ9L 4X8XA 5AUMA 2FRGP 1A1NA 2QKIC 3RGVC 1U6AH 3WDJA 2RCSH 2PP7A 2K3TA 4AE1A 1JFQH 4D9RE 2CRYA 3G5YB 2JKIS 3CFUA 2EKJA 3MRIA 3RGVB 1P69B 2DEWX 3V5KB 1PEZA 2OXHB 5JW5A 4QI3A 3DRTA 5IB2B 4L18A 1KCVL 1LO0H 2BY0A 4ODVH 1MDTA 3LQAH 3P9WB 1CB4A 2DYPB 2NNCA 1L7TL 2OMXB 2WCPA 4AM0A 3ME0A 3BUDA 4YDJA 2W9EH 5C2UB 4P46D 3F7RA 3SKUD 4H8HA 3X11B 3KGTA 3RI5F 2CJUL 4JG0L 4UYQA 1WP6A 3TTSA 4CVZB 5I18H 2FYYB 1KGCE 2GI0A 1S6NA 3HNVL 4PJ8A 5CO1A 5DHMC 1IJNA 2TSBA 2J1WA 1QBML 3GMOB 1N59A 1EANA 3J2PA 4K3DH 4X7SH 3H1ZA 1XH3A 2F54B 3O3EB 1GAFH 1NKOA 3EH2A 4LSSL 2YMXH 4NNPH 4AYSA 4FABL 1A64A 3MJ8A 4GW4B 3RYMA 4N8CH 4JL1A 4HFUL 2M83A 2KKQA 4PD4K 5GIRB 4AYBA 3QH3A 4A6YA 5JPNC 3KZ8A 4KKZA 1ZHBB 1X44A 2MFNA 3FQNB 3U46B 1HNFA 2XZQH 4XVSL 4E42B 2VQUA 1F86A 5K39B 2VN7A 5CCGE 1HXMB 3C75A 1IGMH 5DZLA 2R29A 3BO8B 1EBPA 1ZV2A 4NKDB 5K9QG 4X4ME 5IFHL 3IDXH 2BNRE 2WQAA 1I9IH 2XRAL 2YRZA 1OGTB 2EDLA 3D2UA 4FXGC 1WAAF 4TUJB 5F7LB 4DUVA 2R8SH 1ZEAH 3QCUH 5I8EB 4HIEB 2Z7ZA 3Q8FA 1Z9LA 2EDXA 1BW8A 4FXGB 3PAUA 3A22A 4KX8A 3T1FA 5I23A 2XTJD 4JFEA 4N0UA 4TQHA 4FZ8H 2OAAA 4H25A 1R0AH 1QLEH 3FTZA 2A9AA 4TSAL 5FYKL 2ODHA 2A74B 2YZ1A 2ZKWA 4IBTA 3H54A 2J4WH 3T3PF 1VGKA 4NZTL 4XHJC 4KITB 3VACA 2NUPB 2APBA 4ZUTA 1U8LB 2J3SA 5J8OA 4NPYB 1B0RB 2B3IA 2A9NL 4U1NB 3GHPA 4EUPH 3VXMB 3X3FL 4RGNC 1BHGA 1GA2A 2NNFA 3TBSB 3VXSA 2MIZA 2PCPA 1YLBB 2MQCA 5FO8A 1G6RA 4ZS6D 4M1CC 4PS4L 3WMSA 3CFKA 4L0YA 3MKKA 5DD1H 5D6CA 1XR9A 1ES0A 1GH7A 4QYOB 2YARA 1XO8A 3FH8A 2WD0A 4WEBH 4P99A 5TDPB 1RJZA 2R15A 2FE0A 1TJMA 2QVIA 3CPLA 4MBOA 4A38A 1M3JA 4OY9A 5CP3A 3TH2T 3O2WH 3F7VB 4FQIL 4JKMA 4N2NA 4YFLF 5DU7A 3D2TA 4M7LH 2R0KL 3K91A 3NCXA 1FN4A 1I4FA 4PBDA 5FGBC 5BQDA 4CN4A 3KWWB 3GI9H 5T5NF 4RNRA 2FX8H 5JLZA 1NBZB 3CX5J 2WNXA 3E8UH 3MRJB 4U1JB 3O4LD 1E5ZA 1DHKA 2IG2L 4TVPL 1WAAE 2B15A 2CKBH 2XY2A 1G7IA 1X4YA 2P43B 5E2UH 4Y8DC 4P23D 4PLKD 4L8CB 1KYAA 4TYUA 4X4KA 1DBMH 1U91A 3LZFH 4LFHG 1WFMA 2VDMB 1X9RA 2ED9A 1INDL 5B1CA 1RJYB 3IF1B 4AW4A 1NCBH 1AD9B 2HH0H 2OJEB 3D8MA 4UOJA 3O8XB 1HE7A 2DI8A 5CEZD 3ZKXC 2CO7A 3PQYD 4WGKA 4JQVC 1UJ3C 1QYGL 1YPZA 1I3RA 4AYFA 3VW3L 3D08A 1M1XA 5IFAH 3ULVL 2P48B 2WUCH 5BXFA 2OSLB 4YHNA 3CSTA 4HIJA 5H37G 2GJPA 1U8OA 4K7PX 1B9ZA 2BXYA 4BA8A 5LGHH 1LM8V 5C0DB 1ZE3C 1DBKH 1FFOA 1GHFL 4AJVA 1ODAA 2P28B 2A6KB 1JMXA 2JLLA 3UPRA 3LTVA 3NIDB 1P6FA 3MQIA 5DS8A 3DOHA 1PAMA 2ZX8A 4X9FA 3BIBX 2EE0A 5IHUH 1CR9L 3F58L 4JO8A 4NJAH 5CLXA 1WGVA 3VFSB 1OF0A 5CXPA 1RZFL 1H3GA 1FH5H 1MHCA 4J7RA 1F4YH 2JJUA 1A1OA 1RZ7H 4LGSB 1U8HB 4Z0XB 3WKML 2CO4A 3VD0A 4XGZB 2R59A 5C07D 1F3JB 3MACH 3SOBL 1IGCH 2DWTA 2HRPH 5JZ7D 2Q76B 1WCBA 1BA9A 4Y89A 1BIIB 1NAKH 1NL0H 1CFVH 5KYXB 2G0KA 5JR1H 2HPTA 1GS6X 4TNGA 5EIIG 4V1DA 4MA3B 4XPTL 3MNVA 3GMPA 3MLXL 5FLUA 4H0LC 2IC2A 4XR8C 3QDGB 1DVYA 5AVSB 5KS9B 3C2SA 3LH9A 2EE6A 1O6SA 2RA1A 3E0GA 1TF4A 2MOVA 4GRMA 4PWFA 4F2MA 3BOVA 2IAMC 4DGIH 4P46B 1DR9A 3HCVB 1T66C 2V2WA 4R4FL 1G4MA 4PHZA 3FFDA 4JFQA 5MEQA 4NBZB 3MBWA 4HMEA 1DO5A 1FAKT 1JZ4A 3MSPA 4AJWA 1JPSL 4PHXA 2ZZUT 2HJFA 4OW6A 2AGJL 4PSPA 3ZZLA 2YPLD 2ARJB 5HGAB 5IJBC 2AEOA 5FYKU 3FUDA 1P7BA 2AQ2A 3H9ZA 3ZBMA 4UDUA 3FNKA 4D8PB 4DP1X 3MREA 3NA4A 3BJLA 4KVCH 4YLBA 5SX4H 1FZKB 2ZWNA 3OZ9H 4B53A 2W60A 2G0LA 2ITCB 2XWXA 1WE5A 3F7PC 1K8DB 3KPOB 3IFOB 4PJ5A 4NKMB 3OWRA 4NN7C 2XACC 1AOHA 4Y9CA 2RJMA 4N9GB 3SO3B 2OTWA 2DLFH 4OF8A 4PJFB 1M3IA 1BOGB 1IBGL 2CBTA 4TUKH 3BKJH 1Q8MA 1J0YA 3IM1A 3RIAF 4KUCF 1ET7A 1T7VA 1AVAA 3AS1A 3PWJB 4M61B 3QEGL 1OSPH 4IKKA 3TEUA 4E9TA 1VKXB 3SE8H 4UQCA 5T33H 3CLWA 5AAMA 2VJXA 2ZUQC 1F6LL 2D7PA 3CZGA 4P4KA 3ILQC 2FZ3B 1QA9B 2IGLA 1JP5A 3PHQA 5F72S 3HZMA 4Y5XB 5L9DH 4JN1L 2ZWKA 3B34A 4L8DA 2F6AA 2XWDA 3BAIA 3IU3B 4Z6AT 2G30A 4PB9H 4I77H 4XP9L 2KC0A 1NPNA 3MUGA 5I1IL 3A4FA 4DN3H 2CIIA 5IF0A 1UM6H 4CUCA 4BQ8A 5IHZB 3MRFB 1ITBB 4Y19E 3BVUA 2E59A 4O2FB 4WI6A 5CHNA 3EBIA 5LXGH 1V3MA 2PTVA 3WHE1 3TZVC 4YN3A 3N85H 4ADIA 1V7MH 2NR6C 5JW3L 4PGDB 3WNLA 1T7WA 2EYTA 1HHKB 2AKRA 3IFPB 4UZSA 2K45A 2Z8VC 3TZVB 4E9XA 1RHHA 3UAFA 5BO1H 2OYKA 4NNXA 1JMZA 2FHCA 4FNUA 4JE0A 3UAJC 4KUZL 3W3BA 1KV7A 1Q9KA 1L5GB 5C0JA 4X50A 4X4ZA 3QZLA 1C7SA 3RJOA 2FWUA 3HLAB 1WFIA 4MJ5B 1OPGH 3NZHL 5F71A 4FQHB 3QIWD 3ZE2F 2EDKA 5FCUL 2QQKH 1TYJA 4M6NL 2DMCA 3PGFL 3RG1C 4X5RA 3FCTA 2J2ZA 2MTPA 3QW9A 2IDFA 5BV7H 1BEYH 5KUKA 3DV6A 1JCKA 2PO6A 3BH4A 4ZMTA 3EO0A 1A6TB 1CBVL 1T04A 4A2EA 1JZ7A 4N2DA 4DQOH 5I6NA 3MRRA 4IBYA 1OM3L 2XX1A 4CADA 5C7XH 1CVRA 3FK3A 3ARUA 4DKEL 4H26A 4NO5A 2WBJA 4YHZL 4DGVL 4WU7B 1CYXA 1XF4B 1Z6JT 2E7CA 1K6QH 4PGCB 3QPXH 1OB0A 2IFGA 3PQYB 7PAZA 2X3CA 5DLLA 3D69A 2YHGA 3QQXA 4GRWB 4UZGA 4XXWA 3V0IA 4JR9H 5CD3A 1X5YA 1SQ2N 4PS3A 1TQUA 1WS8A 4YBQC 5E5RB 1HHHB 5EU7E 4K3EL 1YZZA 2Y0SA 3H3BC 1PIGA 4GRLA 5D2LB 2P46B 1KJ3H 1XGUA 3THMH 1BWWA 3CN0A 4PJBA 1MCSA 2ROYA 2F61A 4HBCH 5FM5O 5CJXA 2AJVL 2YEZA 1C16A 1DJZA 3ARFA 1USQA 1JV2B 3MRQA 4JJ5A 5AVRB 4U1IB 3RKDD 1W6LA 3L5XH 2HVJA 3FCBA 5C0GA 5DLMH 3S37L 2AI0H 1JIBA 1IIIA 1W72L 2VQ1A 3W2DH 2CNYA 2LFGA 4AT6A 1K3IA 2VXTH 3L6FB 4UB0H 2A6IB 2IWEA 3CN1A 3E3QC 4OZ4B 2COQA 1YJDL 3B9EA 4L4VE 4HLZG 4ZK8A 4GINA 5IHHA 4PCYA 5FB8B 2W65B 1JWSB 2XVLA 3FT2B 1MHHB 4FFZH 1I53A 2FTAA 5E7FA 4MCNA 3ZE2E 3TWYA 1O9WA 4M5SA 1RURH 3EFOB 3WHE0 3F65A 8FABB 4HUMB 2I60L 2EDNA 4PS7A 1LDSA 3RWCA 2HG0A 2G2RA 3WFBH 1GGCH 1SMOA 3ZE1F 3KLDA 1TVDA 4PJDE 5EZIL 3TYGL 1D7CA 1Z5HA 3VXQA 2R2HB 4NI3A 3RP1A 4XXDB 2ZG1A 2IQAB 4AH2A 3TN0C 3TA3C 5AFAA 4U6VH 4H88H 1KTLA 4TUUA 3FO0L 3TO2A 3KPRB 5F1NB 4K15A 1AKJD 5CWSB 4ZFOA 3GSXB 1WAEA 3Q2LA 1XFPA 4WJ5B 3RL2B 1OQOA 2WINA 4BE5A 2R1YB 5MEOB 1Y0LB 3QI9C 4RMRA 3JTSB 1IGYA 1E4KC 1KELH 2VSCA 4CJ0A 1F6AB 3QO0A 4P9HC 2H0PA 4JO1L 5GSVA 2YPLB 3L9RB 4J6RL 3VGHA 1KYOJ 2VDNH 4I18B 5JQIB 5JHAA 5IMLA 5DMKA 2EKSA 3MBXL 4XAWH 3NZ8B 1FH2A 3PAVA 3QFJD 5MHSE 5BUAA 4U3XA 3VQ1C 2E8YA 4OD2B 3K4DA 3NQKA 3HRPA 3JZ7A 4IKJA 4JDEA 4N2CA 2JNZA 1ZS2A 3UZQA 4LARL 1HCYA 4JN2B 3VRLF 3V0WH 3GTTA 3TBTA 5B38A 4PSRA 4F93B 1T2XA 2B20A 4ONHB 1TMQA 2BVTA 3DX8B 5LAXB 5C0BA 3NIGB 2R9HD 3D3VA 5GZOA 1HH6A 2ICWJ 3AACA 3HUJE 5GSRA 4QRTB 3S4SB 4N25A 3VG9B 1P5VB 2QSTA 1Z9SA 3N41B 4GQ9L 4MA8L 4NN6C 2GCYB 4PUBL 4X6DB 5EUKA 5CBAB 3TNNB 1UB5B 4YXHH 3QEUB 5INDB 5E2TH 1OF2A 4KK5C 3KPSE 1DTUA 4H2AA 4HHGA 2GABA 4LHUG 3ARBA 5EUOE 4NOBA 4NO0A 5TDOB 3QRFM 1CQYA 2A0LD 3TT3L 5HHQB 1WGOA 4WWKD 1N0LA 5C0FA 4RCAA 2DBLL 3IMRA 1JYNA 4QJ5B 3EYVB 3MHZA 5HHVH 1G7QB 3F01A 2BFVL 3L17A 3UEQA 3HKZA 4GW1A 4PP2B 3VU1A 1BQLH 4ZMZA 3KDMA 4YPGB 5D1QD 3J07A 2X4OB 5F1KC 4XOAA 2CRIA 4DQAA 4HU8A 3IN2A 2Y07H 3U6XA 4PJEB 2E27L 1U8MA 3B8SA 1I9JH 3OKOB 4U6YB 5IWLA 2CD0A 5A16B 1EUUA 3B56A 3K80A 1GZPB 3WHXA 1MY5A 2K3HA 5DRWB 2EDBA 5G5DB 2BSEA 2FLMA 3H6JA 3QIBD 1GW0A 1ZXQA 2P8MB 3RJQB 1G9NL 1ZIBA 4LMQE 4B3EA 3FMGL 2DW5A 2MKLC 1I3VA 2HRLA 4XN4A 3V4VL 4WWOA 3ZYJA 2JCWA 3RDJA 3DXAA 3FO1A 1KB5A 3ZDZB 4DIXA 5BRZD 3V6FA 3L3OA 1W16A 3LCYA 3QPQD 1TJIL 4HIQA 4MVBC 3SDAC 4F7EB 3QIWB 4B27A 4U4BA 4MNQD 4DP9X 1MW2A 4NC1E 2XVKA 1K4DA 3HEIB 4JY4A 2CMRL 4F92B 4HUUB 1M71A 5DA0B 5T5FA 5GS0L 1MWAL 4Z5RB 1E8WA 2GJ6A 2ITFA 1SLVA 2A83B 2O26U 2ZCKH 1AJ7L 1U30A 3S9DB 4L1BA 1DQJB 3FQRA 4ZDHB 5ILTL 2CJUH 4UDTB 5HHOE 2CO1A 4CN1A 1E9OA 4TNFA 4PRPA 5I0DA 3WTYA 3ALPA 1AR2A 3GZKA 5F0MB 2ZWZA 1ZGLP 4L8SB 1QBMH 4XP4L 3QUZC 2PPAA 1RUPL 2NT0A 4LSSH 5I6LA 4EOWL 4OSUL 2YGPA 1A7OH 2K6WA 4L05A 4FABH 1OW0C 5DMIH 3OJ2C 4E9YA 5DFVC 2LFEA 5IMOA 3VXTB 1WHOA 1PW3A 1NZRA 4H0GA 5C9JA 3FN0H 2MH4A 4AQ1C 3RGHA 3F00A 3EUDA 3UBXI 1IGIL 2ZYRA 1CZ8L 3DOSB 2V5TA 1U33A 4FNLL 1OZUA 1T4WA 2P5WA 4HHAA 4XVSH 1TYEB 1AXTH 3DJTA 1QASA 3P4MB 3QUYD 4HAGA 4CC4A 5DDHA 3KPLB 2YN5A 3QDJA 5FW6A 4AENB 4BK5A 5JOFB 4KKLC 1YEDA 3WY3A 5DI8B 1G9EA 3CFBA 4NAJA 5IFHH 2XRAH 5AVXB 2X4RA 4NXKA 1T0NA 2BHYA 4W9EC 3HMXA 4XMUA 1QPPA 2PW2B 2VZ1A 2DWSA 5AKTA 1YEWA 3PWVA 1QSVA 2XWZA 1DUZB 2V9QA 5FM5M 3WS6A 5FEBA 2JKRM 1ILSA 2M26A 2HAZA 1F97A 4AOFA 2I32A 5GZNC 3CFEB 2ICEA 2A2QT 1RLBA 1ZAGA 5C0NC 3S2CA 5DD0H 2X6VA 4HUXA 1J0ZA 3MNMA 5FYKH 3NSYA 3VJ6B 5J12B 1E5CA 3CVCA 4PP1D 2AJXH 2VB5A 1SY6L 3KBEA 3QFGA 3B4NA 4WI0A 2HWZL 4JPIB 1E2ZA 3BUYA 5D4IA 2WQRA 1FCGA 3BGMA 2EP6A 3SYPA 2GFBB 1S7RB 2A9NH 4U1KB 2MMXA 3VNZA 3X3FH 2GITB 4TQEL 5BZZA 1AKJB 5F9WC 2HG5B 1JN6A 1S7QA 3PE9A 5I0YA 1MREL 1IAKA 2A38A 4YFLI 4TLTA 3VUAA 4NJ9H 4ZFGL 5E4OA 4LHJB 5I17B 2XIIA 2GTZA 3UJJL 1KGYE 1H5BA 3D1MC 3MV7A 4KJQD 4DPCX 4U1MB 1R3JB 2YFNA 1XSJA 2V2TB 3O3DB 4FQXD 5E5LA 1E90A 1KGUA 3VU2A 2YD1A 5GS1C 3G5YA 3MLVL 4MS8D 3RGVA 3UGEA 1JPTH 5KJ7E 1E0OB 1QX1A 3V5KA 2OXHA 3GIZH 3QFJB 2F8VA 1BQRA 1CF1A 2RFXB 3HHRB 5IB2A 1KCUL 4KMQA 2BNRD 2VDLH 2Z7WA 4WU5B 5GS1B 4JKWA 3ARDD 1UA3A 5F1SA 2FUQA 5DZPA 4QRRE 1VKXA 2DYPA 1CLCA 2OMXA 2EUXA 3BRGC 1CGXA 1EFXD 2BS71 2IG2H 4WI2A 4TVPH 4HD9A 3WO4B 3X11A 5G4OA 1UEMA 4GI8A 1WFJA 4OH2A 4HUNB 4L8BB 3RAJL 1FG2B 3ZX1A 2FYYA 1YC8A 1OCZB 1XD0A 1N7ML 1A7NL 1GPOH 3GMOA 4RETB 1UD3A 4YH6A 2XV2A 3M7FB 3GMQB 1XH0A 2F54A 3O3EA 5DJ0B 3LRKA 5LBSA 4R7LA 4GJTB 4YJZL 4GW4A 3FUKA 1KGIA 5E9AA 5T1KB 3BLKA 4F37K 1C5BH 2AP2A 3MUZ1 4KJPC 1UENA 4R0LC 5GIRA 2Z65C 2YFOA 3NSDA 4OLZL 4LAQL 2V5RA 4N0CC 3TBYB 4WWKB 1ZHBA 3FQNA 3U46A 4APQC 2NMSA 4E42A 3LQAC 5E8EB 5K39A 4IW4C 1GHFH 1HXMA 1MJ8L 2CBPA 3BO8A 3ZVVA 4NKDA 5D1QB 1Q94B 3ILPB 1GGUA 4XTRD 5F9JB 5FO9B 4WKXA 1OGTA 4ORGB 5KW9L 3L9YA 4TUJA 2W9DL 1CR9H 3F58H 5I8EA 4HIEA 4FQPA 2WLZA 4FXGA 4IRZL 1BZ7B 1S9YB 3QIBB 4X8JB 2VMFA 4HJTA 1NWPA 3FT9A 4JCMA 5IQ7L 2X1XR 4DTGL 2ZOWA 1SM3H 4RBPH 4X8CA 3CSYB 3VXPB 2ZCLL 1WA0X 5BRZB 3KPNB 4XOCA 5CU5A 3T6VA 3Q2NA 4HPHA 2X1QA 3UFIA 2A74A 3W5MA 4YVNA 2CWRA 5LUMA 3FB5B 2CZNA 3RIKA 2NUPA 4KZEL 1M6UA 5FAAA 2OSYA 4MNQB 1U8LA 4HEPA 3ZKMD 3LVTA 4NPYA 1B0RA 4ABUA 1OAUL 3N44B 3OM3B 4L1HA 4M5TA 2NY1C 4U1NA 4N2MA 1EGJL 3VXMA 4P2RE 3TBSA 4R6UA 3R0NA 4UNTA 4E9VA 1P4IL 4FQCL 4O5LL 3RURA 2MRYA 1TTCA 5GRJH 3QCTL 5LKNA 1GGIH 2IVFC 4LPWA 4QYOA 3VB8A 1NBCA 4MB5A 2EIMB 2XZCL 5TDPA 1EAJA 3EDFA 4DFHA 3IGFA 4ZOCA 3NGBB 4LVEA 3BE1L 5HHMB 4AG4L 1H9VA 2WWMD 4JBSA 3RFZB 3T0BA 1JPSH 3KE0A 1PD1A 3F7VA 3LKPB 3OLDA 2YOAA 4K3GA 4EIGB 3UYPB 3KWWA 2PCFB 4I2XB 4LCYB 2YRPA 1BCIA 4BFRA 1AHKA 4OJCA 1NBZA 3MRJA 4OZFG 4U1JA 4DP0X 5FGBA 1QLEB 3K4AA 3KPMB 3VFWB 4YUEL 3BYYA 4NSKB 3GHBL 1KXQE 2R27A 2Z0UA 3L7FB 3QUYB 4OFVA 5JMRA 1MCHA 5HI5C 5KOMC 5EOQL 4L8CA 4LL9A 2EC9T 4FQLL 2CR3A 4EUPB 1J7VR 4WKZB 4QHUB 4TQPA 1XMEB 1OTTC 1RJYA 1FFRA 1NKRA 2WKOF 3IF1A 1AD9A 2OJEA 2X6BA 1NAML 3O8XA 1WZMA 4G1EB 1OSEA 1H8LA 1W0WB 3IRCA 1T1XB 5I8OH 4D94A 1LK2B 2IH3A 3N6YA 4N4YB 1KCSH 3LS4L 3M1BB 2OSLA 4PCSA 5GJSH 1FFTB 4JPKL 5KSUB 2PETA 2EADA 4NFCA 1HWGB 2FO1A 5C0DA 4KDWA 2EILB 3DVGB 3AS2A 5JPMC 2CPCA 5E6ZA 2A6KA 4YHML 2VR9A 4N20A 1GS8A 5I1IH 3CQFA 1JVKA 4F7TB 3VXNB 3I9IA 4BXVA 1IRAY 4UTBH 1QD0A 5JXEA 3VFSA 1M42A 3AMKA 2FBOJ 1WIPA 5D5MB 3L81A 2CKBB 5I19H 3PFUA 4IQHA 4JM0A 1PU0A 1OSYA 2ITEA 1U8HA 2QZ5A 4NIKB 4Z0XA 5TTRA 3KWTA 3UO1H 4XGZA 4RSVA 4ZSOE 1RIVL 2OR8A 2YD4A 1F3JA 1WZ1H 5IVNA 4LDLB 2Q76A 3EO9H 1BIIA 3AXHA 3HI6L 5KYXA 4KUZH 1M7DB 4WI8A 4ERSH 2UX6A 2MNWA 4MA3A 4LO9A 4I0PD 2RQEA 3FOLB 1GJWA 2VXVH 3ZO9A 2BNRB 3QDG