4RS8A

Apo structure of novel pnob8 plasmid centromere binding protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
84
structure length
84
Chain Sequence
b'YIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQMATAELEKIRKLVEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Dna binding protein
total genus 30
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rs8A00
3VB2A 4GYGA 2ZKZA 2EFOA 1MDMB 4RGRA 1F4KA 1ZLJA 1PUEE 3FMSA 1USTA 3ZMSA 4I0AA 2K4BA 1HQCA 2J5OA 4XLNF 1FT9A 2QUFA 4L9TA 1WSUA 1FYLA 1YFHA 3J80Z 1ZG1A 3ZP5A 4ESJA 1ZGAA 1XGNA 4CXFA 4N0BA 4UHTA 2W57A 5LEKA 3TKYA 5D5VB 3L9FA 3FMQA 2HFHA 4XSZF 3WU1B 5D8KB 3H3UA 1U6GA 4QLCU 3MEXA 4WX9A 3SFZA 1IUYA 1HSTA 3CUQC 3R0AA 1D5VA 2G7HA 1I6XA 3K1PA 1SD5A 2YX7A 3G73A 4HZFA 1D8JA 1BIBA 1HSJA 5KVRA 3R6SA 1LJ9A 1G3WA 3WODF 2E7XA 2XAQA 3ZMVA 1FYMA 3KCCA 2HKXA 4OIOF 4I01A 2IRFG 3EYIA 1KYZA 1BOAA 4ESBA 2VT2A 3LA2A 4LB6B 3I4PA 1XGOA 4ZYGA 3KP5A 2KJBA 4P96A 1K79A 1DPRA 2IA1A 4Q48A 1KQ9A 1IN5A 1TW3A 3ZPLA 2CQKA 2A61A 4L9NA 4BAYA 5BPIA 4EGZA 4AIKA 4EQQA 2VC0A 2Y0MA 3FXUA 2QWWA 2FQ3A 3VEPA 1FLIA 1T39A 1OYYA 2RQPA 5EEHA 6PAXA 3N97A 1Y0UA 3KP7A 1EH7A 2FMYA 2RKHA 1RZ4A 5CVIA 3DPLC 1LDDA 3GWZA 1YIOA 2A6EF 1KQ8A 5E8GA 1JHFA 1B1BA 2D1HA 4A5MA 1DUXC 4S05A 2HYGD 5D8LB 1Z91A 1DDNA 3IC7A 3IWZA 4PDKA 2F2EA 2BYVE 2DU9A 2OA4A 4L9VA 2HQNA 3D5LA 1ZHFA 2OZUA 2GZWA 2XHKA 2FE3A 3KEQA 5FO5A 5BS6A 3HTUA 4MNUA 4OINF 4AIHA 1P6RA 1JE8A 3KP3A 4M9XA 4A2UA 4FX4A 3GZ6A 3F21A 2VONA 2HGCA 4ZYHA 3V7RA 2GXBA 4HW0A 1SFEA 3GF2A 5DUKA 4MQ9F 3WTTC 2MLKA 1R23A 3KZYA 5E1WA 3E6CC 3HOSA 4HF1A 1VTNC 2X4HA 3ABTA 2EK5A 3W6JB 5LHIA 3IKTA 1KU3A 1W7PD 2EFQA 2P7VB 1S7AA 2ELHA 3KLOA 5ICGA 1T98A 1MD0A 3GUDA 2JRTA 1G3TA 5HDGA 5K1YA 5DEQA 4MTEA 1LDKB 3L2CA 3KP6A 4IJAA 4UXNA 1O3TA 1T2KA 4G9YA 3R0JA 1BM9A 5JHUA 1G4DA 4Q4ZF 3HTSB 1WWXA 4M72A 1ZN2A 2F5DA 2M30A 2M87A 5K5QA 1XDUA 2L4AA 3L00A 4XLPF 5J8FA 4IHTA 2HWVA 3PFIA 4KN4X 4P5OA 3ZMZA 4D0PA 3WE3A 3RYPA 4CICA 3HSRA 3FM5A 2RN7A 3I64A 2VN2A 1P2FA 2FBIA 4Y15A 4EMSA 1RI7A 1J0RA 4OIQF 1T6SA 4Q47A 4XSXF 5FD6A 1Z1DA 1TQMA 3PQKA 3JW4A 3QRFF 3HSEA 3ELKA 5HVQC 3TDUC 5L3GA 1G3SA 3T1BA 1R36A 4KIGA 4YG2F 2EV6A 2XAGA 2FSWA 1J9IA 3C18A 5LRSA 2XGXA 4M73A 1UCRA 1Z6TA 3GW2A 2LNBA 3P9IA 1Z9CA 2ACJA 4QWQA 4GCVA 2MH2A 1K6OA 2V9VA 2H27A 2W85A 3V8LA 4MEYF 5A2QK 2VOPA 4JK1X 3FWEA 1O3SA 3I5UA 4HV5A 1B6AA 4MEXF 2IA0A 1XSXA 4HQMA 3T8TA 1U3EM 3L09A 2R7DA 2PQ8A 3FMRA 3HRUA 5CYVA 2O03A 4IPAA 1KU9A 4DQ2A 3M9AA 3JSPA 5DCMA 4P9FA 1FBSA 4HX8A 3TOBA 3MCZA 1OMIA 1DP7P 4EJVA 4LB5A 3LQQA 3J81K 5DCMB 2FXAA 1IXCA 2EV0A 3ZMTA 2YX4A 5F1RA 1U2WA 3SZPA 2FBKA 3ZMDA 5CLSA 1UHWA 3LA3A 3B73A 2DT5A 4LLLA 2ESHA 1O57A 1FBQA 4YFXF 1L0OC 1TBXA 4B8XA 1FC3A 3FXQA 5HDNA 3SXYA 1R5HA 2V1UA 2WC2A 4LK1F 3R4KA 5DDGA 2RDPA 4HX7A 1J75A 4R79A 4EM1A 2H09A 3M7GA 3MFKA 1U8RA 4IF4A 3RIRA 3I54A 2O6GE 3TGNA 1W5SA 1FZPB 4O3MA 2KKOA 3JAMZ 2G7UA 4KMFA 2DPDA 3F8FA 4U7DA 3KETA 2P8TA 1XGSA 4EJWA 1QZZA 1W4MA 1MKMA 2JTVA 4HYEA 2HOEA 3DXJF 1BJAA 4AWXB 1WI9A 1QGPA 1BBYA 4OMYA 2QQAA 2XKOA 4Q5SF 1SD6A 2VBYA 2STTA 4BXUA 5CVUA 3COAC 4N9IA 3ZN1A 1RUNA 4H0EA 3TO7A 2O3FA 2JPCA 4UVCA 3K69A 4RAYA 2BBYA 2EA4A 2LDUA 4L5IA 2EB7A 2CYYA 2K4JA 3TDZC 1D3YA 2P6TA 2XASA 3Q9VA 5HS8A 3RPUA 1O3QA 3DP7A 1ZARA 4R1HA 1ODDA 4HLYA 1ZRDA 1RIOH 1O7FA 2AS5F 1FSEA 3H92A 1F1ZA 2A69F 2RNJA 4MGRA 3T0YA 1IZ1A 4WXDA 1JXSA 5EEGA 3WE2A 3GYHX 2G9WA 4G94A 1B9MA 2DQLA 4M71A 2FOKA 2L4MA 2J5PA 1A04A 2Z3YA 1AWCA 3LSTA 2P5LC 1BI0A 3IHUA 2EJRA 2PN6A 2C6YA 5LGTA 3CTAA 4O5VA 2ISZA 2ZNZA 4R8HA 2MC3A 2KIUA 2D2WA 5TJJA 1ONVA 3W6KB 2HTJA 2M1BA 3WTZA 3I58A 1O7LA 1U5TC 4F7ZA 2ZBKA 4UVBA 3C1DA 2L02A 1YYVA 3SZTA 2QBYA 3TO6A 1WKMA 2B0LA 1RUOA 3HYIA 1OKRA 1ZG5A 2UZKA 1XB4A 2ESNA 3GFMA 1XMAA 2CG4A 4CHUA 2QBYB 2HS5A 1R1UA 3U1DA 3KP2A 2RV8A 3ROUA 1Q1HA 3QAHA 4GO1A 1W5TA 3HOTA 2KIFA 2OQGA 4HLXA 2Z99A 1OYWA 1NHAA 2DK5A 1Z6RA 1X3UA 3DPTA 1ULYA 3JAMK 1LEAA 1QPMA 4KICA 1O3RA 2IPQX 5FB2A 3JTGA 3I71A 3BY6A 2V6CA 2KRFA 4CO8A 2GA2A 3M8EA 3TQNA 4EV0A 3WTXC 3QPHA 2O0YA 4BQAA 1S8NA 4YIFA 5L3EA 5DUIA 2DTRA 1SMTA 1TTYA 2DK8A 5CJ9A 2XRNA 3EETA 3M1EA 1T0FA 4A0YA 4WF2A 3RI4A 1T38A 4NQWA 1MJBA 2FRHA 4AIJA 4OMZA 1ZYRF 4BHBA 2PFBA 1MGTA 2P5VA 2LSOA 5FGMA 3TO9A 4UNOA 2FA5A 3GO5A 1MJAA 2VODA 1CGPA 3BDDA 4PGHA 1USSA 5A2QZ 1G3YA 4P55A 2HR3A 5AIQA 1S6LA 1YG2A 2Z5UA 5CVRA 2ZCWA 2OAZA 1H0MA 5LGNA 4I2OA 4UUVA 1IF1A 2QVOA 4U7BA 2QLZA 5HLHA 2HDCA 2CFXA 3OOPA 1HKTA 2RGVA 1GVJA 3RJPA 3J7AO 3ECOA 2WTEA 4MHGA 3K9TA 1I1SA 2QM3A 4Z2YA 3DF8A 2FMLA 3O6BB 4CYDA 4ETSA 3F8NA 1R7JA 3H3ZA 1F9NA 3MQ0A 3J81Z 4L0YB 3ZQ7A 3E97A 2HYFA 1BI2A 4EVIA 2QQBA 2P5KA 2VC1A 5JFRA 1GXQA 4UVAA 3KEOA 4BHCA 1B4AA 4DNCA 1FP1D 4K2EA 2IVMA 4ENJA 3CUOA 4AD9A 1P92A 2GAUA 1HW2A 3BPXA 1E17A 4ENNA 1S3JA 3T8RA 2TDXA 4WK8F 3E6BA 3MAJA 4BNCA 1YW9A 2OU2A 2UXNA 1KU2A 3P7NA 4LFUA 2QQ9A 4MTDA 1UFMA 2NYXA 3K1MA 4KDPA 2P7CB 1W7PA 2FF4A 2MA3A 4YIIA 3N4MA 2HKOA 1KQ0A 3L7WA 2P4WA 2Q0OA 5K5OA 3QP6A 2VBXA 4CGZA 1W7PB 3FF5A 2M5WA 5HS9A 1ZRFA 4ZZLA 3EUHA 2OQRA 1YW7A 3VFZA 3E6DA 2A5YB 1C0WA 4S04A 5ILSA 4XRFA 2ZNYA 3FX3A 3WGGA 3MZHA 4IRGA 1MZBA 2MBFA 3VODA 3Q5FA 2R7FA 2H6CA 1WQ2A 2K27A 3O2PE 4BH9A 3ML6A 2FBHA 4KN7X 1R1TA 4TV7A 2AXLA 2ZMEA 3HRTA 1FSHA 2STWA 1LDJA 1EH6A 4N9HA 4IXAA 1IW7F 4HV6A 2EFPA 2VE8A 2BV6A 1HXDA 3MWMA 3CUQA 5E17F 4RB1A 2ZMEB 3KFWX 4KUMA 5H6RA 4EJTA 1FP2A 4U0VA 5DCFA 3RYRA 2E1CA 1ZAOA 1SD4A 3CUQB 3U9GA 2CGPA 1XSDA 3WTSC 2D45A 1YQAA 1J59A 3CJNA 1XD7A 4HBLA 1ZRCA 2A68F 3RTRA 2JPBA 1FYKA 2Z33A 3EQLF 2VBZA 2ISYA 3WTVC 5E1ZB 5JI6A 3ZMUA 4P9UA 1LNWA 2PMUA 4LG0A 3O3KA 5E20A 1YO5C 3GFJA 4U88A 1E2XA 5KK1A 4ZH4F 2JSCA 3K1NA 1GXPA 4CZZA 5FLXK 3HUGA 4HF2A 1XMKA 4M9SA 2VBWA 5IT3A 4M6XA 3ISPA 4RS8A 1KU7A 4LG0B 1S29A 2QENA 1TLHB 5LRRA 5LEJA 1IXRC 2E1NA 5J6XA 4EGYA 2XVCA 1TQIA 5HLGA 1QBJA 2O61A 2XAJA 2FNPA 1HW1A 4FT8A 2DBBA 5LHHA 1SMYF 2V1XA 4L9JA 1ZREA 1PP8F 4IRHA 4LLGF 1I5ZA 2K86A 3F6OA 3S2WA 3BJAA 1JGSA 2XAFA 4PCQA 3BOQA 1B59A 5LHGA 1JHHA 3F8BA 2CWEA 3WTUC 2PEXA 2H94A 4IHSA 4ZYEA 2YR2A 3IRRA 1IXSB 3R61A 3WG9A 5ED4A 5CVJA 5ICCA 4CDGA 3I53A 1EV7A 1UHMA 5D6FA 4E70A 3HIFA 2RC4A 1P4WA 2F5EA 2ETHA 1AOYA 1CF7A 4PZJA 4MQVA 5D6EA 4A0ZA 5LLQA 4G7HF 3QP5A 1ON2A 2K7LA 3F23A 3MZYA 3E5UA 1CF7B 3E5XA 5CVVA 1G6NA 1KYWA 4BYYA 2JZYA 3ERED 4KA4A 1QO0D 4GXOA 3GZ5A 2Q2EA 3CLOA 3G3ZA 3QOPA 2YU3A 3QPTA 4NB5A 4HQEA 1J2XA 3EDPA 1GHCA 4A5NA 4U0YA 2H6BA 4Y17A 1FWZA 1ZGJA 1YLFA 4RB3C 3P9KA 2A07F 2P6SA 4KYWA 4A6DA 2PG4A 3FM3A 2QYOA 5L3BA 3KZZA 2DO7A 2DI3A 4KNYA 5E1XA 2MD5A 1TQPA 4LJZF 5BQTA 4A12A 2Q8KA 2NAZA 4I0BA 2OZ6A 3T5XA 5D4SA 1QNTA 4L5JA 3RDIA 4L18B 3RPQA 1IN6A 2NRAC 3GFLA 2E7WA 2DFIA 3RKYA 2EWNA 1SAXA 3KE2A 5FD5A 2IP2A 1KA8A 3SQNA 1EH8A 1TNTA 3GX4X 2HQRA 5HLIA 3F6VA 4LMYA 3BROA 5DV5A 4RGSA 1R5GA 3V8JA 4EJOA 1BN5A 2MLGA 3D0SA 2NNNA 1LQ1A 4G8XA 3E5QA 3BZ6A 5L3FA 3REOA 1P4XA 1KGSA 2VE9A 3BPVA 1HW5A 4M9ZA 3WGIA 2XIGA 5FFXA 1UB9A 1BI3A 1LB2A 3IL2A 4BHPA 1YS6A 1QQIA 1SFUA 3K2ZA 1J7KA 2QZ8A 4GGGA 4KIBA 4KT5C 5H6QA 3ULQB 2EFWA 2OD5A 2YSRA 1YW8A 4ZYDA 2O8XA 1OPCA 2BE5F 1ON1A 3C3WA 5J8CA 2L54A 1XCBA 3K0LA 3TOAA 4OU0A 1BC7C 3IWFA 4WXHA 2COMA 1Z05A 3LAPA 4WWCA 4OOIA 4UV9A 1K78A 4HOBA 3E6MA 2IW5A 3OV8A 2NS0A 1REPC 1R58A 3KLNA 5L3DA 1IAWA 1K78B 2W24A 5D5WB 5ERIA 1YS7A 4FX0A 3VOEA 3WU0A 1S7OA 2HEOA 3LQRA 2BGCA 2XAHA 1Z7UA 2Z9OA 1IN4A 1DPUA 4HA8A 3WGHA 2Y75A 2UWMA 1H9TA 2VOOA 1IRGA 2R3SA 2EV5A 2GA1A 1B9NA 1XN7A 4EM2A 3J80K 3C7JA 4LLNA 4AVPA 4Y13A 2K02A 3LA7A 3HHGA 4FHTA 2OBPA 3EYYA 3FZVA 1D8KA 2M45A 2IA2A 1YTYA 1SD7A 3JSOA 1FBUA 1K7AA 1FNNA 4KIFA 4L0ZB 2FEZA 3GXOA 2L3DA 2HZTA 2L01A 2ZFWA 2DAOA 4HX4A 3AAFA 5FLXZ 2PLYA 4NHJA 2GXGA 5HDKA 4ESFA 3BWGA 2Y48A 1RNLA 2GWRA 2DPUA 4RB2C 3F8MA 4WXCA 4UV8A 2M8EA 2PI0A 1XCVA 1XDSA 2VXZA 5DYMA 3V7SA 1V4RA 1P4AA 4ENMA 3ABUA 4IRIA 3B02A 5LBQA 2XUBA 3HRMA 2EFNA 5BPDA 5D5XB 1L3LA 1R1VA 2EA2A 3IRQA 4YFKF 2DQRA 4ASNA 3V7CA 3HSFA 4HF0A 2UXXA 1MJ9A 3LAJA 5F6FA 2LF8A 2WWYA 2PJPA 1U78A 3P9CA 4G7OF 5ICEA 1OYIA 3M8FA 1SFXA 4RAZA 3GFIA 3CO7C 5DD8A 2DLLA 3HRSA 2ZO4A 5IT9Z 2PBIA 2IT0A 5ILUA 2RVCA 3NRVA 4ZZDA 5HS7A 2A6HF 3Q9SA 4I02A 3R60A 1I27A 3LFKA 4RGXA 5ICFA 4RGUA 4G7ZF 2ADUA 3QU3A 3RKXA 1XSVA 3BP8A 1BI1A 3WTWC 4XBFA 3SHFA 2FU4A 2JT1A 1FOKA 4PGGA 4I98B 1XGMA 5E18F 1LEBA 3NEUA 2XV4S 4YFNF 4U0WA 3CO6C 3CDHA 2LKPA 2KIMA 4B09A 4OIRF 2GQQA 4JBAA 3U2RA 2NNYA 4JQFA 1R22A 1HKSA 5LGUA 5D4RA 1BC8C 2DW4A 2IJLA 5BOXA 2V79A 1TW2A 1V3FA 2W25A 1U5TA 3NQOA 3E3VA 3ZN0A 4KFCA 3QU6A 4ON0A 5H20A 1IN7A 3BJ6A 4G6DA 2KJCA 1IRFA 1U5TB 2W84A 1PDNC 4LK0F 2PMHA 4G6QA 3DFGA 5AONA 5FFZA 5D5UB 1PP7U 2CO5A 1J5YA 2F5CA 3ECHA 1QZYA 2XKPA 1WRJA 2X0LA 3WTYC 1ZLKA 2HTSA 2CSOA 3PQJA 3GLXA 2MH9A 2FNAA 5L3CA 3DEUA 3F72A 3DV8A 1HKQA 3LWFA 5BMZA 4M6YA 2A3SA 2F5FA 1STZA 3DKWA 1FY7A 1F5TA 1ZH5A 2ZXJA 5IT9K 4O6JA 4EJUA 3IKVA 2CW0F 5AIPA 2LF7A 3F3XA 3RKWA 2ZJ2A 4OIPF 3JTHA 1R00A 2V1DA 3F8CA 4WCGA 1IN8A 4A6EA 1ZG3A 5DD4A 3BJOA 4LGWA 3DQVC 2VT3A 1HBXG 2D1VA 1OR7A 3V8KA 4I09A 5HOOA 4HAMA 4ENKA 4KMUX 5E8IA 1FX7A 4HDVA 5JR3A 3FHZA 1BIAA 3HHHA 3FXRA 4IVNA 3I59A 5ILVA 4EM0B 2YPRA 4M74A 2WV0A 4A0XA 5JVTA 3GEZA 4GYIA 2GIVA 2BEOA 3KP4A 4LD5A 3I0TA 1LVAA 3V4GA 3F22A 3I59B 5F64A 1MDMA 2XROA 1I1GA 1TNSA 1H9GA 3GVAA 5TRDA 4I7HA 1FPQA 4RB0A 5K5RA 4HDUA
chains in the Genus database with same CATH superfamily
3VB2A 4GYGA 3TP3A 4F93B 3NWSA 2ZKZA 4JX5A 2IS2A 4C30A 2EFOA 1WFXA 4RGRA 1MDMB 4E7SA 3BTIA 2QA4I 1YITI 1F4KA 1B8IB 1YRNB 1EA3A 1ZLJA 1PUEE 4QSHA 3RZOJ 3K7AJ 3FMSA 1USTA 3B6CA 3ZMSA 4I0AA 2K4BA 1FOWA 1HQCA 1P9QC 2J5OA 4XLNF 4B48A 1FT9A 2QUFA 4L9TA 1WSUA 1FYLA 1YFHA 2VKVA 2O9LA 2AO9A 1N25A 2CQQA 3KPHA 3LL7A 1JTXA 2I10A 4UUTA 3J80Z 3JRFA 1ZG1A 4BACA 1VZ0A 2KP6A 5KNLA 1FEXA 3ZP5A 4ESJA 2K3PA 2E1MB 1FMWA 1ZGAA 4B4CA 3CCLI 1XGNA 4CXFA 4N0BA 4UHTA 2W57A 2VJ4A 4GDFA 1LFBA 2XB0X 5LEKA 1VF9A 3BG7A 2WAEA 3TKYA 1SVOA 5D5VB 3L9FA 3FMQA 2HFHA 4XSZF 4CCMA 5D8KB 3WU1B 3H3UA 2ZMEC 1U6GA 1W1WE 3G1MA 3NWTA 2XF7A 4RMNA 4QLCU 3BT9A 4XKCA 3MEXA 4WX9A 5GAEJ 3BR6A 3SFZA 3VDXA 3JRGA 4FE4A 2A5WA 2DN0A 1XC5A 1IUYA 4M3FA 1HSTA 3CUQC 2WADA 3R0AA 1JUMA 4E6KG 1D5VA 3EUKL 4CCJA 2G7HA 1I6XA 3K1PA 5E3MA 1SD5A 2EZIA 5F04A 2YX7A 3BR2A 3G73A 4HZFA 1D8JA 1BIBA 1HSJA 3FKJA 5KVRA 4AYBA 3ZQQA 2JVGA 2WAQA 3R6SA 1LJ9A 2CW7A 1G3WA 3TW6A 3WODF 3PJRA 2E7XA 3A0HC 2AHQA 2IGOA 2XAQA 3ZMVA 1FYMA 1MNMC 2V9KA 3KCCA 2IEKA 1RRJA 2HKXA 2M4KA 4OIOF 3BZCA 2JA6J 4I01A 4CSWA 2IRFG 4BY1J 5FKKA 3EYIA 1WCMJ 2DDBA 2M0CA 3FKIJ 1XMXA 1KYZA 1HA8A 1BOAA 4ESBA 2VT2A 3LA2A 4LB6B 3I4PA 2EPFA 1XGOA 1JI8A 4ZYGA 3KP5A 2VJIA 2KJBA 3SYTA 4P96A 3WHCA 2R7UA 4F3QA 1K79A 3JRDA 1DPRA 2IA1A 4Q48A 1VI0A 1KQ9A 3CC7I 1IN5A 1TW3A 2LP0A 2XSJC 2VPRA 3ZPLA 2CQKA 5J4YA 5IYCJ 1U9OA 2A61A 1U8BA 3E0JB 4L9NA 4BAYA 1X3WB 5BPIA 3CC2I 1MH4A 3KIOA 1X1PA 2OJED 3S3MA 4XRMA 2MG4A 5IP9J 3FBNB 4EGZA 4AIKA 1XX5A 2VKDA 4S0HB 5IOYA 1W0UA 5J4VA 3HGYA 4BUPA 4EQQA 2VC0A 2NS7A 2Y0MA 3FXUA 2QWWA 2FQ3A 3VEPA 5GAHJ 1IJWC 1FLIA 1T39A 1IDYA 2V9PA 2XRLA 1OYYA 1LFUP 2RQPA 2M3AA 5EEHA 6PAXA 3N97A 1Y0UA 4A93J 1A31A 3DU5A 3KP7A 1EH7A 2FMYA 2RKHA 5FRMA 1RZ4A 5CVIA 3S8PA 5M5XJ 3DPLC 1I39A 1LDDA 3GWZA 2HYJA 3K70C 1N78A 1YIOA 2A6EF 4FQGA 4AYBN 1KQ8A 3E7LA 5E8GA 1JHFA 2DOEA 2LVSA 1E0EA 1B1BA 2D1HA 4A5MA 3LSGA 2DA7A 1MBEA 3BG9A 1DUXC 4S05A 2HYGD 5D8LB 3CF2A 2VXDA 1Z91A 5C3EJ 1DDNA 1W0TA 3IC7A 3IWZA 4PDKA 2F2EA 2BOLA 2BYVE 4CCKA 2DU9A 3M8JA 1SFOJ 1OJLA 2H1KA 5HNHA 1G59A 1ITYA 2OA4A 4KT6A 3O8HA 4BJTA 1OCTC 2LOOA 3HC7A 4XN0A 2X6YA 2HQNA 4HSTA 4L9VA 2DCEA 4LOCA 3D5LA 1ZHFA 2OZUA 2LG4A 3BG6A 2GZWA 1LKXA 2XHKA 1UHSA 2FE3A 4E7LA 2MGQA 4QPQA 3KEQA 5FO5A 2JVHA 5BS6A 3HTUA 4D7MA 1X19A 4MNUA 4OINF 5FKNA 4M3GA 4AUXA 4AIHA 4ZDOA 1P6RA 1JE8A 3DKYA 5HLTA 3S32A 3KP3A 4M3EA 1TWFJ 3IH4A 4M9XA 2HVSA 4A2UA 4FX4A 5EEAA 3GZ6A 3F21A 4HEA2 2VONA 2HGCA 4ZYHA 1S9HA 1BR2A 3V7RA 4QPOA 4ZYAA 3S1QJ 2GXBA 4HW0A 3A01A 1SFEA 1DGWY 2LMDA 3GF2A 4CYCA 2JN6A 5DUKA 2GOMA 3BG5A 3L2RA 2FJ1A 3ZQIA 4IQJA 4MQ9F 3ZRGA 5K7ZA 3WTTC 2MLKA 1R23A 3KZYA 5E1WA 3S14J 1R71A 3E6CC 3HOSA 1G2HA 1WHUA 3KX2A 4HF1A 3GTPJ 4CYCB 1VTNC 4C2UA 2BY1A 1ZQ3P 1QVUA 3AG2H 2DT7B 2X4HA 2TCTA 2DDAA 2ID6A 3ABTA 4ANJA 3DPUA 1V54H 2EK5A 3W6JB 4BJ6C 3AKZA 2HU9A 4E7HA 5LHIA 4AC0A 4CCOA 4QIWN 3IKTA 1KU3A 1W7PD 2VKHA 5FKLA 4M6VA 3KZIC 2EFQA 2P7VB 2BVLA 4BXFA 3JREA 1GUUA 3J7ZI 1S7AA 1OCOH 2ELHA 1WJEA 3KLOA 5ICGA 1VQNI 1AHDP 1T98A 3H0GJ 1MD0A 2HDDA 3GUDA 2JRTA 1NG7A 1G3TA 1VQ4I 5HDGA 4FASD 5K1YA 5DEQA 4MTEA 3HDDA 4UUSA 1LDKB 3L2CA 3KP6A 2VQHA 4IJAA 4UXNA 1O3TA 1T2KA 1R4MB 2JWTA 3ZQLA 1M1EB 4G9YA 4B47A 2FX0A 3R0JA 1BM9A 3CMYA 5JHUA 2BHYA 1D0XA 4UUSB 2X85A 3OYCA 1G4DA 2WY8Q 4Q4ZF 3HTSB 1WWXA 1BR4A 4M72A 4HPQA 1WI3A 1ZN2A 4G12A 2F5DA 2M30A 2M87A 5K5QA 2HXIA 1XDUA 3SJMA 2Z16A 1Z7LA 2L4AA 3L00A 4NNJA 4XLPF 5J8FA 4IHTA 4YIRX 4PJ0C 4FCYA 2HWVA 2EILH 3RCOA 3PFIA 1JKPC 2ZJQF 4KN4X 2NOJB 4GRIA 5GAGJ 4RDUA 1Z0XA 2ZC2A 5EZHA 4P5OA 2X48A 3ZMZA 2CRGA 2KRHA 1ZGWA 2E1OA 4D0PA 1APLC 3WE3A 3RYPA 3H5NA 4CICA 3HSRA 3OIQA 4Y52J 3FM5A 2QF7A 3E1SA 1HDDC 3FDYA 3W6VA 1ETKA 2RN7A 3I64A 4ZDPA 2ICWG 2VN2A 3OYDA 1P2FA 2L9VA 2FBIA 4Y15A 1FTTA 4EMSA 2IGNA 2EH3A 1RI7A 1J0RA 4OIQF 1UAAA 1T6SA 4Q47A 3ZR8X 2P81A 4XSXF 3S15J 4IO9F 5FD6A 3LNQA 3HJEA 4V2GA 4RLFA 5F27A 3TL4X 1VQ7I 1Z1DA 1TQMA 2UUZA 3PQKA 4UB6C 2GXAA 3JW4A 1PJRA 2EZKA 1LVKA 3QRFF 1FOYA 3HSEA 3ELKA 4V19K 2CQ7A 5EF6A 5HVQC 3DTEA 2XPWA 1Y1VJ 2XPVA 4ZTFA 5C4XJ 1T56A 4BQNA 1MMDA 3OYBA 3TDUC 5L3GA 1G3SA 3DU6A 3L2VA 3RSNA 1DU6A 3T1BA 4BL0B 2EINH 1R36A 4BBSJ 4KIGA 4B3AA 4YG2F 2BXYA 2EV6A 2JUCA 2XDVA 2XAGA 2FSWA 2XAUA 3I9V2 1P7JA 1J9IA 3C18A 3CCMI 5LRSA 2XGXA 4Y33A 2OTLI 5IYDJ 2L7ZA 4M73A 1UCRA 1K6YA 1Z6TA 3GZNB 1DGRM 3GW2A 2LNBA 3S1NJ 1X2MA 3P9IA 1Z9CA 2ACJA 4QWQA 3D1NI 4GCVA 5FLMJ 2MH2A 1GT0C 2V9VA 2M0MA 1K6OA 2H27A 2W85A 3V8LA 4MEYF 5A2QK 2VOPA 4JK1X 1MBFA 3H0DA 2O5RA 5E3NA 3FWEA 1O3SA 1R6RA 3I5UA 4HV5A 1W36D 2HPMA 1Y0NA 4MO7A 1B6AA 4XOPA 3PUBA 4MEXF 2IA0A 1NTCA 1ETQA 2KDOA 1XSXA 4HQMA 3T8TA 1U3EM 3L09A 2R7DA 1OLTA 1V5GA 4XLCA 2PQ8A 2VASA 3CCEI 4E7ZA 3FMRA 2R4GA 3QOEA 3DWLE 3HRUA 5CYVA 4DYQA 2O03A 2M4GA 4IPAA 3Q3SA 2CQXA 5DS9A 1KU9A 1LPQA 2F6CA 3BC8A 2HNHA 2GIZA 4DQ2A 1CQTA 2E2JJ 2B7EA 2RAEA 3A02A 1WJ5A 3M9AA 3JSPA 5DCMA 4P9FA 4NBQA 1FBSA 5GTHC 4IHWA 2BZTA 4HX8A 3TOBA 3MCZA 1OMIA 1DP7P 4EJVA 1Q1VA 1H89C 2K9QA 1RKWA 4B1RA 2LKXA 3JCUC 4LB5A 4NC8A 3LQQA 3J81K 5DCMB 2FXAA 3BR1A 1IXCA 2EV0A 4XNFA 3ZMTA 2YX4A 2W82A 3GBGA 5F1RA 1U2WA 2I5UA 3GMEA 3SZPA 2FBKA 3IV5A 2R92J 3ZMDA 1ETOA 5CLSA 1UHWA 3ZQCA 3LA3A 3B73A 3I3LA 2DT5A 4LLLA 4BS9A 4IOCF 2ESHA 1O57A 4CCLA 4XQFA 1FBQA 3A0BC 1RETA 4YFXF 5GADJ 3K4BA 1L0OC 1TBXA 4B8XA 4RAFA 1FC3A 3FXQA 5HDNA 3SXYA 2HQAA 4MFDA 2H8RA 1R5HA 2V1UA 3FHNA 1S7EA 2WC2A 2XGCA 3DLAA 4LK1F 1J09A 3R4KA 3FXMA 5DDGA 2RDPA 3HM5A 5GP9A 3M4OJ 2BVMA 4HX7A 1ZELA 3W3CA 3AG1H 1J75A 4R79A 1YI2I 4EM1A 2H09A 2HZDA 3M7GA 1R49A 3N05A 3MFKA 2OV7A 2OUMA 2Y69H 4OWRB 1U8RA 2KQRA 4IF4A 3RIRA 2EIMH 3I54A 5JVGF 4V2FA 2DMTA 2O6GE 3TGNA 3JRCA 1MMNA 2Y0SN 1YHQI 1W5SA 5IY5H 3MD2A 4RM2A 2MW8A 5TGTA 3HB9A 1FZPB 4IL6C 4O3MA 2KKOA 3JAMZ 2IBDA 5JLWA 4GFBA 2E34A 2G7UA 2QSFX 4KMFA 2DPDA 2HOSA 5E3OA 3F8FA 4U7DA 3OS1A 1A5JA 3KETA 2P8TA 1XGSA 4EJWA 3G2BA 1RR8C 2HPIA 5JLXA 1JT0A 1QZZA 1W4MA 3L1PA 1MKMA 3FXOA 2JTVA 5IP6A 1P7IA 4DBQA 4HYEA 2HOEA 3DXJF 1K4TA 1Z3XA 2IS1A 1BJAA 3PNYA 3LSKA 4AWXB 3OYHA 1WI9A 1QGPA 3VSLA 4IX7A 1BBYA 4OMYA 2PX9A 1YX3A 2KZGA 3G1LA 2VKEA 2QQAA 4N4OB 1POGA 2DXIA 4LG3A 4BKXA 2JRMA 2XPUA 2XKOA 4Q5SF 1SD6A 2VBYA 3HPGA 2STTA 2E60A 1TC3C 4BXUA 5CVUA 3COAC 3W2WA 4N9IA 3FXLA 3ZN1A 1RUNA 4H0EA 3TO7A 2O3FA 5F0HA 1QZEA 2JPCA 1HDPA 4RLQA 1EKEA 4G6TB 1B72A 4UVCA 4A3CJ 3K69A 4RAYA 2BBYA 2EA4A 2LDUA 2BW3A 4L5IA 2VUMJ 2EB7A 2K9LA 5E79C 2MABA 2LRDA 2CYYA 2K4JA 3Q0VA 3TDZC 1D3YA 2P6TA 2XASA 3EUHC 2HQ5A 3Q9VA 5HS8A 2V7FA 3OSGA 1B72B 3H5AA 5CPRB 2WAFA 3RPUA 1O3QA 3DP7A 4B43A 1ZARA 3CESA 4R1HA 1ODDA 2ECCA 4HLYA 1ZRDA 1RIOH 3FIWA 3FK6A 1R9TJ 1O7FA 2ME0A 2AS5F 5F0CA 1FSEA 2E5ZA 1FTZA 2KRCA 2OCEA 2R7OA 2DJIA 1ZK8A 2VQLA 3ZQHA 2DFEA 5EDNA 3H92A 1F1ZA 4M3BA 2L9RA 2A69F 4PFOA 4D7NA 2RNJA 4MGRA 2JA7J 3T0YA 1IZ1A 4WXDA 4IKFA 3S2DJ 1JXSA 4I76A 4AIDA 5EEGA 3MKYB 3WE2A 2CH0A 3GYHX 2X6OA 2G9WA 3S1MJ 3OIPA 4G94A 1B9MA 2DQLA 4M71A 2FOKA 4H4KC 2CQNA 2L4MA 1NG6A 1A04A 2J5PA 5K7FA 2Z3YA 1AWCA 3LSTA 4JP0A 2P5LC 3A2KA 1BI0A 1GV5A 3IHUA 3NARA 5F08A 2EJRA 1SVLA 2PN6A 2C6YA 4PUSA 5LGTA 3CTAA 4O5VA 2ISZA 2ZNZA 4R8HA 4PFPA 2MC3A 3PUFA 2KIUA 2BY3A 1PYVA 2D2WA 5TJJA 3BR3A 1ONVA 2DMUA 3W6KB 2HTJA 2M1BA 1Y6IA 3WTZA 3BLYA 3I58A 2LC2A 1ETXA 5KAFC 4E7JA 1O7LA 1IDZA 1U5TC 4F7ZA 2JJ7A 2ZBKA 2R7TA 4F92B 3H3VK 5BNGA 1IUFA 4UVBA 3C1DA 2L02A 1YYVA 3SZTA 4NDLA 3TBIA 2IAIA 2OC6A 2QBYA 4X6AJ 3TO6A 1WKMA 2B0LA 3OYJA 2WA0A 5C44J 2OF7A 1RUOA 3HYIA 1OKRA 2KIQA 3CCYA 1ZG5A 4BY7J 5HODA 3OYKA 1JKRC 2UZKA 1XB4A 2E5NA 2ESNA 3BTJA 3GFMA 3SEZA 1BR1A 4PJNA 3J7YJ 1XMAA 1NK2P 4PJLA 2CG4A 4CHUA 2VLAA 2HOAA 2QBYB 1TWGJ 2VL8A 3S16J 2HS5A 4AVZA 1R1UA 3U1DA 3KP2A 3ABLH 4LITA 3BG3A 2X1EA 5IYBJ 2RV8A 4XLAA 5GTIC 2ZJRF 3ROUA 3BQZA 1MBKA 1Q1HA 3H5RA 3QAHA 4GO1A 1W5TA 1X1BA 3HOTA 2KIFA 2OQGA 3PNTA 4HLXA 1ZTRA 3PO2J 3CJQB 2Z99A 2V1NA 3H9JA 3WG7H 1OYWA 1NHAA 1Z6RA 2DK5A 2HOTA 1X3UA 3DPTA 5F0FA 1ULYA 1VFCA 5H2FC 1HOMA 1WJDA 2Q1ZB 3JAMK 3CDIA 5M5YJ 3HOUJ 1LEAA 1QPMA 3C2HA 4KICA 3S3NA 1ORKA 1O3RA 2IPQX 5FB2A 3G71I 3JTGA 3I71A 1W36C 3BY6A 2V6CA 2MFZA 2KRFA 4CO8A 2GA2A 3M8EA 1YIJI 3TQNA 4EV0A 3WTXC 2LREA 3QPHA 2O0YA 3SEQA 3HBLA 4BQAA 1S8NA 2WAQN 1VNDA 4YIFA 2OCCH 5L3EA 5DUIA 2DTRA 1IC8A 1SMTA 2DMNA 1PVEA 3F9KA 3C2BA 1TTYA 2DK8A 3CCQI 1RC9A 1GVDA 3HOXJ 5CJ9A 3HPHA 2XRNA 2AXTC 5EZGA 3OYAA 3EETA 3M1EA 1H8AC 1T0FA 1OCZH 2R7RA 4A0YA 2M34A 4WF2A 4OAYA 1I6HJ 4BDZA 3RI4A 2QQ8A 2RNGA 3CCJI 4XRSA 1T38A 4NQWA 1MJBA 2FRHA 4AIJA 2LY9A 2R5ZA 4CZCA 2XGEA 2R7VA 3PIPF 4OMZA 1ZYRF 3ZXSA 4BHBA 2PFBA 1MGTA 3OYMA 4XRSG 2P5VA 1T33A 2LSOA 5FGMA 3ZQFA 3OYGA 3TO9A 4UNOA 3I4NJ 5B66C 2VPLA 2R5ZB 2FA5A 3GO5A 3CD6I 1YOVB 2DA6A 3AG3H 4CCNA 1MJAA 1D1CA 1X3ZB 3GTMJ 2VODA 1OR7C 1CGPA 1ENHA 1YX5A 1IV8A 3BDDA 3CCVI 4PGHA 1USSA 2R7WA 1RKTA 4BQQA 1G3YA 5A2QZ 1A36A 9ANTA 4P55A 1WH5A 2HR3A 4PSXA 2NVUB 5AIQA 2E36A 2B63J 4XLEA 1S6LA 1YG2A 1Y8QB 1U0JA 2Z5UA 5CVRA 2ZCWA 2OAZA 2DOAA 4BU2A 1H0MA 5LGNA 4I2OA 1VQ5I 4UUVA 3A01B 4XLFA 1IF1A 2QVOA 1UG2A 3BQYA 4U7BA 3I55I 2LBFA 2QLZA 5HLHA 2E2IJ 4BE0A 1ZR2A 2HDCA 2CFXA 3OOPA 1HKTA 2RGVA 1GVJA 5JHFA 2F4IA 3RJPA 3J7AO 4RM3A 3ECOA 1IV6A 2WTEA 1V55H 1TZLA 4DZJA 3G6EI 2LBFB 3GTQJ 1Y8RB 4MHGA 1TWAJ 4C3JJ 3K9TA 1VQLI 1I1SA 3FBIB 2QM3A 2F5VA 4Z2YA 4XICA 3DF8A 2FMLA 3HOVJ 3GTJJ 3O6BB 3CCUI 3FK7A 1BL0A 4CYDA 4ETSA 3F8NA 2EQRA 2KZVA 1R7JA 2M7BA 3H3ZA 1F9NA 3MQ0A 4RBOA 3J81Z 2LFBA 4L0YB 5FRNA 3ZQ7A 3AG4H 2HYFA 3E97A 1IRXA 2HVRA 1BI2A 1MSEC 3KYCB 4C2MJ 3H9GA 4ITVA 4EVIA 1MIJA 2QQBA 1ZKGA 2P5KA 2VC1A 4Z6YA 5M3FJ 5J1UA 5M5WJ 5JFRA 1GXQA 5J3LA 4UVAA 3OMYA 4ZC3A 2IS4A 3KEOA 4BHCA 2L5QA 5J40A 1B4AA 4QTRA 4DNCA 1ETVA 2VIXA 2OPTA 1FP1D 1KONA 2FUG2 4LIUA 4K2EA 3G4SI 2ME6A 3AL0B 2IVMA 1MW7A 5CQEA 4ENJA 1F43A 3IAM2 3CUOA 4AD9A 1P92A 2GAUA 4J19A 1UZCA 1HW2A 3BPXA 1E17A 4ENNA 1S3JA 3T8RA 3OYNA 2TDXA 1A6QA 2EBIA 4WK8F 3KYLA 3CMEI 4A3DJ 1MSFC 1QU3A 3E6BA 3MAJA 4BNCA 1YW9A 2OU2A 3M3YJ 2LR8A 1MH3A 5HNFA 2UXNA 1KU2A 1YE9A 3ONQA 3P7NA 4LFUA 2DMPA 2QQ9A 4Y7NJ 4MTDA 2DTZA 1UFMA 5E3LA 2LY1A 2ELJA 2NYXA 3K1MA 4KDPA 2P7CB 1W7PA 2FF4A 3MMYB 3K4JA 2I8DA 2E2HJ 2CUJA 2MA3A 4YIIA 3N4MA 2ID3A 2HKOA 1KQ0A 4ZTJA 1TL8A 2DFHA 2XF6A 1A6IA 3RQIA 3L7WA 1IRZA 2JA5J 5FKMA 2P4WA 2CV0A 2Q0OA 5K5OA 3QP6A 5FJ8J 2VBXA 3DKXA 3LSMA 1N77A 4CGZA 1W7PB 1AKHA 2YU9J 3FF5A 2M5WA 5HS9A 1ZRFA 2O8KA 4ZZLA 3EUHA 2OQRA 3ASOH 1YJNI 1YW7A 3IAS2 3VFZA 3JRBA 3H35A 1IG7A 4II2A 3E6DA 2A5YB 1G8XA 1C0WA 1A35A 3W2AA 4S04A 5ILSA 4XRFA 3LSPA 2ZNYA 1AKHB 3RZDJ 2E71A 3FX3A 2LY2A 3WGGA 3MZHA 4IRGA 1MZBA 1FMVA 2MBFA 3VODA 2K9MA 1OISA 2R7FA 3Q5FA 2H6CA 1WQ2A 3MKLA 2K27A 2VB6A 3O2PE 3L2WA 2DYRH 4BH9A 3ML6A 2FBHA 4KN7X 2XC7A 2M9HA 1R1TA 4TV7A 2JSPA 2AXLA 1X1AA 4A3MJ 2ZMEA 1S72I 3HRTA 1FSHA 2STWA 1LDJA 1EH6A 4N9HA 4IXAA 1IW7F 4HV6A 2EFPA 2VE8A 2BV6A 1HXDA 3QPLA 3HL2A 3S3OA 3MWMA 3OYFA 3LSJA 3K4CA 1UELB 3CUQA 3M1CA 2GM4A 5E17F 3F0CA 4RB1A 2ZMEB 3KFWX 2HI3A 3VYUB 4KUMA 4E4HA 1F36A 1JJ6C 5H6RA 4EJTA 1FP2A 3I4MJ 1X4OA 4U0VA 5FLVA 2AQEA 5DCFA 2X6XA 3RYRA 3V42A 2E1CA 4BJ5C 1ZAOA 3WHBA 1SD4A 1WGXA 3CUQB 3U9GA 1XG1A 2CGPA 1XSDA 4A3KJ 2NXNB 3WTSC 3DTIA 2ZXWH 1X58A 2D45A 3OS0A 1YQAA 1J59A 3LFUA 2TRTA 3CJNA 1XD7A 1WH7A 4HBLA 2E35A 3DCFA 1ZRCA 2A68F 1ETWA 3RTRA 2EZLA 2JPBA 1FYKA 2K9NA 2X51A 5J1YA 2Z33A 1JTYA 2MYSA 2VBZA 3EQLF 2ISYA 4HNVA 3WTVC 5E1ZB 5JI6A 3ZMUA 5K7HA 2B9SA 1HC8A 4P9UA 1LNWA 2PMUA 3O3KA 2CMPA 5E20A 4LG0A 3MKWB 1YO5C 3GFJA 2RQQA 2QEXI 4U88A 1E2XA 2V26A 3QQAA 1OCCH 3AFHA 3OR1C 4XONA 5KK1A 4ZH4F 2JSCA 3K1NA 1GXPA 4CZZA 5FLXK 3HUGA 4HF2A 1XMKA 4M9SA 2F4OB 3OOUA 4JX6A 1Y56A 2VBWA 5IT3A 4BBRJ 4M6XA 3ISPA 4IOAF 4RS8A 1KU7A 4LG0B 1S29A 2QENA 4MFEA 1TLHB 1JKQC 2VQCA 2RREA 3HUGB 3H1CA 5LRRA 1ETYA 1K83J 3HG9A 3A03A 4XORA 4D5FA 5LEJA 2EZHA 1IXRC 2E1NA 4IHXA 5J6XA 3S17J 4EGYA 2IS6A 2XVCA 5KAIC 1TQIA 4XN3A 3VYTB 5HLGA 1QBJA 4A3JJ 2O61A 1BW5A 2MC4A 4A3GJ 2CV1A 2XAJA 3GCMA 2FNPA 1HW1A 4FT8A 4HNTA 2DBBA 1LUJB 4NUBA 5LHHA 1SMYF 2V1XA 4L9JA 1ZREA 5J47A 1PP8F 3OY9A 4IRHA 4LLGF 1I5ZA 2K86A 2E19A 3D5SC 3F6OA 3S2WA 5B1AH 4Y4RA 3BJAA 1JGSA 2XAFA 3GTGJ 4PCQA 3BOQA 1Z77A 3ABMH 1D0ZA 2K5CA 1B59A 4PJJA 5LHGA 5C4JJ 1JHHA 3F8BA 2X6WA 2CWEA 3WTUC 4D9JA 2PEXA 2H94A 3ZQGA 4IHSA 4XKWA 1OFCX 2Y31A 4ZYEA 1ZR4A 2YR2A 3IRRA 2QSHX 1IXSB 3R61A 3WG9A 2W48A 5ED4A 5CVJA 3CCRI 5ICCA 3CLQA 4CDGA 3I53A 3ASNH 1EV7A 2H8WA 2BY2A 2QGUA 3RPUD 3UKGA 1UHMA 1MMAA 5D6FA 4E70A 3HIFA 2Y2ZA 2RC4A 3MKZA 1P4WA 2F5EA 2ETHA 2NVXJ 1AOYA 1CF7A 4PZJA 3QODA 4HRIA 4MQVA 5D6EA 4A0ZA 5LLQA 3U21A 3CCSI 4G7HF 3QP5A 1ON2A 2WB1A 1QRYA 2K7LA 3F23A 3MZYA 2R5YA 2AQFA 3HKZA 3E5UA 1CF7B 3E5XA 5CVVA 1G6NA 3BTCA 3PL8A 3HOYJ 1KYWA 4BYYA 2JZYA 3RQ4A 3ERED 4KA4A 1QO0D 3K4MA 2JQ7A 3FXJA 1BW6A 4GXOA 1EF4A 3CC4I 2R5YB 4DYRA 3GZ5A 2Q2EA 1I50J 3CLOA 3G3ZA 1SVMA 3QOPA 2YU3A 2L7KA 2FQ4A 3MVPA 4B3XA 4DYCA 4F52A 4EATA 4IHVA 3QPTA 2Z1DA 1VQMI 2BW3B 2Q2EB 4NB5A 4HQEA 1J2XA 1QA6A 4IHYA 4KISA 2YUSA 1MNEA 1ACIA 1SFKA 3EDPA 1GHCA 4A5NA 4U0YA 2H6BA 4Y17A 1SC7A 1FWZA 4BXXJ 1ZGJA 4M3DA 3VYRB 1XPXA 2MSYA 4B44A 2A6TA 2V6EA 1YLFA 4RB3C 3P9KA 2A07F 1X2NA 4DGWB 2P6SA 4XK4A 4KYWA 4A6DA 2PG4A 2K3FA 3DBRB 2VQGA 1WPKA 3FM3A 1WJBA 1I3AA 2QYOA 5L3BA 3KZZA 2DO7A 2DI3A 2QCOA 1VQKI 3CQZJ 3O8GA 5E1XA 4KNYA 2JMWA 2MD5A 4C2TA 5F1JA 2YS9A 3A1YA 3FISA 4A3FJ 4BE1A 1TQPA 5B3SH 2A05A 2WB1N 1WJAA 2DA5A 4LJZF 3EPZA 1TT5B 5BQTA 3QWLA 3HKZN 4A12A 1MBJA 4JOMA 2Q8KA 2NAZA 1Y1WJ 4FETA 1OCRH 4I0BA 2OZ6A 3T5XA 5D4SA 1QNTA 4L5JA 3BTLA 4J01A 3RDIA 4L18B 2LTPA 3OS2A 3RPQA 2GBYA 1FOXA 1IN6A 1JT6A 1TWHJ 3CJTB 3HZJA 1DQUA 3IP4B 2NRAC 2KHMA 1AA7A 3GFLA 3H9QA 1Z3YA 1V5EA 2E7WA 2DFIA 3HEFA 3RKYA 2EWNA 3ABKH 4W1UA 3KE2A 3C2GA 1SAXA 5FD5A 1X4PA 3U1KA 2IP2A 1KA8A 2W1OA 3ESWB 3SQNA 1EH8A 1TNTA 1MMGA 4D1QA 3GX4X 2HQRA 5HLIA 3F6VA 3WU2C 4LMYA 3BROA 1BOBA 3ZCOA 1K4SA 5DV5A 3TEDA 4YRVA 2KDZA 2R7SA 4RGSA 1WJFA 1R5GA 3V8JA 3OSFA 4EJOA 4I99C 2P0WA 4XMYA 5J1RA 3PFYA 1YJ9I 1NH3A 1BN5A 2MLGA 2KMUA 4II3A 4PSWA 3D0SA 2NNNA 4CH7A 3FXKA 1LQ1A 4G8XA 3E5QA 4X1EA 3BZ6A 3JRHA 5L3FA 4RAGA 3REOA 4W97A 1P4XA 1KGSA 2VE9A 2CS3A 2DFFA 3BPVA 1HW5A 2M8GX 4M9ZA 1O4XA 4E7KA 3GTLJ 3WGIA 2XIGA 5FFXA 1HCRA 3Q0UA 2KFDA 2QSGX 1UB9A 4RA2A 3IUOA 1BI3A 4F55A 1H88C 1LB2A 3UR3C 2KISA 3IL2A 1SEUA 4BHPA 4DW6A 1YS6A 2K9SA 2KLOA 2CUZA 1FIAA 1U9NA 3NAUA 1QQIA 1SFUA 3K2ZA 1J7KA 2QZ8A 4U87A 4GGGA 4KIBA 4KT5C 5H6QA 3ULQB 4LIVA 2NVTJ 2QKLB 2EFWA 2OD5A 2YSRA 4J00A 1YW8A 4ZYDA 3S1RJ 2QKMB 1Z67A 1OPCA 2BE5F 1ON1A 2O8XA 4HSRA 1SANA 1WZ2A 3C3WA 5J8CA 3SFIA 2L9NA 2HVQA 1XCBA 2L54A 2CW8A 3K0LA 3TOAA 4OU0A 1FJLA 1BC7C 3IWFA 4KJZA 4WXHA 2COMA 1Z05A 3LAPA 4WWCA 4OOIA 4UV9A 3GLLA 2LLKA 2DA1A 4UY8I 2PJRA 1K78A 2VI6A 1DP3A 3G1OA 4HOBA 2NS8A 3K6GA 3E6MA 2M2EA 2IW5A 3OV8A 1UG0A 4BE2A 2NS0A 1HLVA 1REPC 1R58A 4A3IJ 3KLNA 5L3DA 2PJRB 1IAWA 2K85A 1K78B 2W24A 2ECBA 5D5WB 5ERIA 1YS7A 4FX0A 3VOEA 5LD2C 1V5FA 4MLOA 4YEJA 3WU0A 3RKQA 1VQPI 2JUGA 1S7OA 3HGGA 3BZKA 2HEOA 3LQRA 3QYBA 3Q0WA 4NQWB 2BGCA 2XAHA 1Z7UA 1IO2A 2COBA 1IN4A 4XL9A 2Z9OA 4HA8A 3J7AY 1YJWI 3WGHA 1DPUA 2Y75A 2DT6A 2ZXIA 2UWMA 4IZZA 1H9TA 2VOOA 1T8IA 1MBHA 1IRGA 2R3SA 3UNGC 3SZGA 2EV5A 3L2QA 4FISA 2GA1A 2F48A 4BGDA 3BR5A 4FE7A 1Y39A 3DEWA 1B9NA 1XN7A 4XKBA 4EM2A 3J80K 1DU0A 3C7JA 3BCAA 4P1WA 3K10A 4LLNA 4PK4A 2ZSHB 4AVPA 4Y13A 2K02A 3LA7A 1UJ8A 2W4SA 3HHGA 4FHTA 4XOTA 2WBMA 2FD5A 3HOZJ 2DJNA 3P5JA 2OBPA 2K40A 3VPRA 4AU7A 4IQ4A 3ZGKA 3B6AA 3EYYA 3VYSB 3FZVA 1D8KA 4C3HJ 4XKVA 4C9YA 2DA2A 3VWBA 2M45A 2IA2A 2XF5A 2ZJPF 3OL3A 1YTYA 2XB5A 1JUSA 1SD7A 3JSOA 1FBUA 2ZXHA 1S5LC 4FTHA 1K7AA 1FNNA 4KIFA 4L0ZB 2FEZA 3GXOA 1X1DA 2L3DA 2HZTA 3LOCA 2MD0A 2CV2A 3KYDB 3IH2A 2L01A 2ZFWA 2BHZA 4MIMA 5EJCA 2DAOA 4HX4A 1E3PA 2V4JC 2E1MC 3AAFA 5FLXZ 1LE8A 3HOWJ 1OQYA 2PLYA 2IGKA 4NHJA 2GXGA 5HDKA 4NC7A 4CA0A 3BWGA 2Y48A 4ESFA 1VQOI 2W7NA 1RNLA 2GWRA 2DPUA 2H1LA 4RB2C 2O7OA 3F8MA 4WXCA 4UV8A 1FIPA 1XS9A 2M8EA 2PI0A 1XCVA 1XDSA 2VXZA 5DYMA 1T95A 3LSRA 1LE8B 3V7SA 4CUGA 1V4RA 1XTAA 1P4AA 4ENMA 3ABUA 2L7FP 4IRIA 2OTJI 1N75A 3TP0A 2D5VA 3DBHB 1WJCA 3I56I 3B02A 5LBQA 5KHDA 2VJ5A 4D5CA 5M3MJ 2XUBA 1NK3P 1T08B 5LFAA 3HRMA 5IPAA 2EFNA 5BPDA 4A3BJ 1ERDA 3CMMA 5D5XB 1L3LA 1R1VA 1MMSA 5EYRA 2EA2A 5CKTA 3IRQA 4YFKF 3GTOJ 2NVYJ 2XGDA 2DQRA 4ASNA 3V7CA 4DJAA 3HSFA 3MZ8A 4HF0A 2UXXA 3DBLB 1MJ9A 4L5EA 3OYIA 2JK3A 2KPMA 3LAJA 5F6FA 5CQGA 2LF8A 2WWYA 5DM7F 2PJPA 2PMZA 4UB8C 1U78A 3P9CA 4G7OF 3LSIA 5ICEA 1OYIA 3M8FA 4F91B 1SFXA 4RAZA 4A69C 1SAUA 3GFIA 3QYFA 3LSHA 3CO7C 5DD8A 2IXSA 3OYLA 2X9DA 3CZ6A 2DLLA 3HRSA 4EEFG 5FROA 2ZO4A 5IT9Z 2PBIA 1JJ8C 2R93J 4ZJZA 2NVQJ 3EUAA 2W00A 3PNVA 2IT0A 5ILUA 4DIQA 2RVCA 3NRVA 3PSFA 4ZZDA 1JUPA 5HS7A 2G0EA 3HXLA 3DEEA 2R0QC 2A6HF 1AU7A 4AM3A 5GPAA 2DYSH 3Q9SA 4I02A 5DTDA 3R60A 1I27A 5EG0A 3LFKA 4RGXA 5ICFA 4RGUA 1JGGA 3CJRB 4G7ZF 2ADUA 3QU3A 3RKXA 1XSVA 3BP8A 2WY7Q 1BI1A 3WTWC 4BDYA 3SDBA 4XBFA 5EG0B 3S2HJ 3PO3J 4I6ZA 3SHFA 2FU4A 2JT1A 4KITB 1FOKA 4PGGA 1EJ9A 1BA5A 4I98B 5IOZA 1VQ9I 1XGMA 2CUFA 1GV2A 5E18F 1LEBA 3NEUA 3LMMA 2XV4S 1Z21A 1KZHA 5TISC 4YFNF 4X0GA 3GTKJ 4U0WA 3CO6C 3OWTA 3CDHA 3PSIA 1WVRA 2M7AA 2LKPA 2CJJA 3TMOA 2KIMA 2L7MP 4B09A 2DODA 4OIRF 1JKOC 2GQQA 1E3OC 4JBAA 2L0KA 1D1AA 2PMZN 1QHHD 3U2RA 2NNYA 4JQFA 1R22A 1HKSA 5LGUA 5D4RA 1BC8C 1D5YA 2DMQA 2VJJA 3K4LA 2DW4A 2JA2A 2IJLA 5BOXA 4A3LJ 5GPCA 1RESA 2LK2A 2V79A 3S93A 3ERMA 1RPWA 1TW2A 1V3FA 3BR0A 3QYEA 2W25A 3K2AA 1U5TA 2ZB9A 2UV1A 3NQOA 3E3VA 3ZN0A 4KFCA 3MN2A 3K4NA 3QU6A 1T0FC 3D5RC 4ON0A 5H20A 1IN7A 1I3QJ 3BJ6A 4G6DA 3H36A 3CDLA 2KJCA 1VQ8I 1IRFA 2HDWA 3K70D 1U5TB 2BXZA 2CUEA 2W84A 2GLOA 2CFOA 5IP7J 1PDNC 4LK0F 2FOWA 2PMHA 4G6QA 2R7XA 3DFGA 3BCBA 4YELA 3PIOF 5AONA 2BY0A 2Y9YA 5FFZA 3OR2C 2DA4A 2KT0A 2R7QA 1D1BA 5D5UB 4DOZA 1PP7U 2Z2SB 2GOXB 2CO5A 2DOFA 1J5YA 2F5CA 3ECHA 2X1DA 3ZOBA 4JYKA 2Y0SA 3W2VA 1QZYA 2XKPA 1WRJA 3K4KA 2X0LA 1TT0A 3WTYC 1GLNA 1ZLKA 2HTSA 2CSOA 3VSKA 3PQJA 3GLXA 2L9SA 1OCPA 2R7ZJ 1D0YA 4A3EJ 5DM6F 2MH9A 4XLHA 1RR7A 1HF0A 2FNAA 4HNUA 3JR9A 1VQ6I 1R5ID 3OL4A 5B1BH 5L3CA 4NC6A 3DEUA 1K61A 3F72A 3CP8A 2CU7A 3DV8A 2N8GA 1MNDA 1GDTA 1HKQA 2XSDC 1R4NB 2L2OA 3LWFA 5BMZA 4DBRA 5KCMA 4M6YA 2A3SA 2F5FA 1STZA 2KL4A 2IGMA 3DKWA 1FY7A 4C3IJ 4ABZA 1F5TA 4HG2A 3SDGA 3CF5F 2JA8J 2ELKA 3OIOA 1ZH5A 2ZXJA 1PUFA 4E7IA 5IT9K 3OYEA 4O6JA 1IGNA 2ZSIB 4Y3OA 3CP2A 4EJUA 1QVTA 3IKVA 3JRIA 4BEHA 2CW0F 5AIPA 2LF7A 3JRAA 1W5CC 3F3XA 3RKWA 4XIDA 2Y9ZA 3L2UA 2ZJ2A 1PUFB 3QPSA 1X1CA 4OIPF 2F4MB 3JTHA 2X1CA 1R00A 4JX4A 2V1DA 5EGOA 3F8CA 4WCGA 1IN8A 4BEHB 4N4NB 4A6EA 3AL0C 1ZG3A 5DD4A 3BJOA 4XM3A 5B5EC 2Y30A 4LGWA 3DQVC 3PM1A 2VT3A 1HBXG 2D1VA 1OR7A 1TWCJ 1TP4A 1MBGA 3V8KA 3KEYA 3DTKA 4I09A 4PJMA 3IH3A 5HOOA 1QPIA 4HAMA 5EGOB 4ENKA 4KMUX 5E8IA 1FX7A 3A4CA 3X2QH 5JR3A 4HDVA 2LKSA 3FHZA 1BIAA 1UMQA 3HHHA 3FXRA 3M07A 4IVNA 1BJZA 3I59A 5ILVA 4EM0B 4ZDLA 2YPRA 4M74A 2ZFUA 2WV0A 2EIJH 4A0XA 5JVTA 3CMAI 2NOGA 2WV1A 3GEZA 4GYIA 2GIVA 2BEOA 2LD5A 3KP4A 4IEJA 4LD5A 3I0TA 1LVAA 2LYCA 3V4GA 3DLLF 4OAZA 3TW7A 2HXOA 3F22A 1LFPA 2DA3A 3I59B 5F64A 1MDMA 2XROA 2LH9A 2EIKH 1I1GA 4XR6A 5FKOA 1TNSA 1H9GA 1QHGA 3GVAA 4BQOA 4I7HA 1FPQA 5TRDA 4RB0A 1B8IA 4DZPA 1YRNA 1E3HA 5K5RA 4HDUA
chains in the Genus database with same CATH topology
3VB2A 4GYGA 2ZKZA 2EFOA 1MDMB 4RGRA 1F4KA 1ZLJA 1PUEE 3FMSA 1USTA 3ZMSA 4I0AA 2K4BA 1HQCA 2J5OA 4XLNF 1FT9A 2QUFA 4L9TA 1WSUA 1FYLA 1YFHA 3J80Z 1ZG1A 3ZP5A 4ESJA 1ZGAA 1XGNA 4CXFA 4N0BA 4UHTA 2W57A 5LEKA 3TKYA 5D5VB 3L9FA 3FMQA 2HFHA 4XSZF 3WU1B 5D8KB 3H3UA 1U6GA 4QLCU 3MEXA 4WX9A 3SFZA 1IUYA 1HSTA 3CUQC 3R0AA 1D5VA 2G7HA 1I6XA 3K1PA 1SD5A 2YX7A 3G73A 4HZFA 1D8JA 1BIBA 1HSJA 5KVRA 3R6SA 1LJ9A 1G3WA 3WODF 2E7XA 2XAQA 3ZMVA 1FYMA 3KCCA 2HKXA 4OIOF 4I01A 2IRFG 3EYIA 1KYZA 1BOAA 4ESBA 2VT2A 3LA2A 4LB6B 3I4PA 1XGOA 4ZYGA 3KP5A 2KJBA 4P96A 1K79A 1DPRA 2IA1A 4Q48A 1KQ9A 1IN5A 1TW3A 3ZPLA 2CQKA 2A61A 4L9NA 4BAYA 5BPIA 4EGZA 4AIKA 4EQQA 2VC0A 2Y0MA 3FXUA 2QWWA 2FQ3A 3VEPA 1FLIA 1T39A 1OYYA 2RQPA 5EEHA 6PAXA 3N97A 1Y0UA 3KP7A 1EH7A 2FMYA 2RKHA 1RZ4A 5CVIA 3DPLC 1LDDA 3GWZA 1YIOA 2A6EF 1KQ8A 5E8GA 1JHFA 1B1BA 2D1HA 4A5MA 1DUXC 4S05A 2HYGD 5D8LB 1Z91A 1DDNA 3IC7A 3IWZA 4PDKA 2F2EA 2BYVE 2DU9A 2OA4A 4L9VA 2HQNA 3D5LA 1ZHFA 2OZUA 2GZWA 2XHKA 2FE3A 3KEQA 5FO5A 5BS6A 3HTUA 4MNUA 4OINF 4AIHA 1P6RA 1JE8A 3KP3A 4M9XA 4A2UA 4FX4A 3GZ6A 3F21A 2VONA 2HGCA 4ZYHA 3V7RA 2GXBA 4HW0A 1SFEA 3GF2A 5DUKA 4MQ9F 3WTTC 2MLKA 1R23A 3KZYA 5E1WA 3E6CC 3HOSA 4HF1A 1VTNC 2X4HA 3ABTA 2EK5A 3W6JB 5LHIA 3IKTA 1KU3A 1W7PD 2EFQA 2P7VB 1S7AA 2ELHA 3KLOA 5ICGA 1T98A 1MD0A 3GUDA 2JRTA 1G3TA 5HDGA 5K1YA 5DEQA 4MTEA 1LDKB 3L2CA 3KP6A 4IJAA 4UXNA 1O3TA 1T2KA 4G9YA 3R0JA 1BM9A 5JHUA 1G4DA 4Q4ZF 3HTSB 1WWXA 4M72A 1ZN2A 2F5DA 2M30A 2M87A 5K5QA 1XDUA 2L4AA 3L00A 4XLPF 5J8FA 4IHTA 2HWVA 3PFIA 4KN4X 4P5OA 3ZMZA 4D0PA 3WE3A 3RYPA 4CICA 3HSRA 3FM5A 2RN7A 3I64A 2VN2A 1P2FA 2FBIA 4Y15A 4EMSA 1RI7A 1J0RA 4OIQF 1T6SA 4Q47A 4XSXF 5FD6A 1Z1DA 1TQMA 3PQKA 3JW4A 3QRFF 3HSEA 3ELKA 5HVQC 3TDUC 5L3GA 1G3SA 3T1BA 1R36A 4KIGA 4YG2F 2EV6A 2XAGA 2FSWA 1J9IA 3C18A 5LRSA 2XGXA 4M73A 1UCRA 1Z6TA 3GW2A 2LNBA 3P9IA 1Z9CA 2ACJA 4QWQA 4GCVA 2MH2A 1K6OA 2V9VA 2H27A 2W85A 3V8LA 4MEYF 5A2QK 2VOPA 4JK1X 3FWEA 1O3SA 3I5UA 4HV5A 1B6AA 4MEXF 2IA0A 1XSXA 4HQMA 3T8TA 1U3EM 3L09A 2R7DA 2PQ8A 3FMRA 3HRUA 5CYVA 2O03A 4IPAA 1KU9A 4DQ2A 3M9AA 3JSPA 5DCMA 4P9FA 1FBSA 4HX8A 3TOBA 3MCZA 1OMIA 1DP7P 4EJVA 4LB5A 3LQQA 3J81K 5DCMB 2FXAA 1IXCA 2EV0A 3ZMTA 2YX4A 5F1RA 1U2WA 3SZPA 2FBKA 3ZMDA 5CLSA 1UHWA 3LA3A 3B73A 2DT5A 4LLLA 2ESHA 1O57A 1FBQA 4YFXF 1L0OC 1TBXA 4B8XA 1FC3A 3FXQA 5HDNA 3SXYA 1R5HA 2V1UA 2WC2A 4LK1F 3R4KA 5DDGA 2RDPA 4HX7A 1J75A 4R79A 4EM1A 2H09A 3M7GA 3MFKA 1U8RA 4IF4A 3RIRA 3I54A 2O6GE 3TGNA 1W5SA 1FZPB 4O3MA 2KKOA 3JAMZ 2G7UA 4KMFA 2DPDA 3F8FA 4U7DA 3KETA 2P8TA 1XGSA 4EJWA 1QZZA 1W4MA 1MKMA 2JTVA 4HYEA 2HOEA 3DXJF 1BJAA 4AWXB 1WI9A 1QGPA 1BBYA 4OMYA 2QQAA 2XKOA 4Q5SF 1SD6A 2VBYA 2STTA 4BXUA 5CVUA 3COAC 4N9IA 3ZN1A 1RUNA 4H0EA 3TO7A 2O3FA 2JPCA 4UVCA 3K69A 4RAYA 2BBYA 2EA4A 2LDUA 4L5IA 2EB7A 2CYYA 2K4JA 3TDZC 1D3YA 2P6TA 2XASA 3Q9VA 5HS8A 3RPUA 1O3QA 3DP7A 1ZARA 4R1HA 1ODDA 4HLYA 1ZRDA 1RIOH 1O7FA 2AS5F 1FSEA 3H92A 1F1ZA 2A69F 2RNJA 4MGRA 3T0YA 1IZ1A 4WXDA 1JXSA 5EEGA 3WE2A 3GYHX 2G9WA 4G94A 1B9MA 2DQLA 4M71A 2FOKA 2L4MA 2J5PA 1A04A 2Z3YA 1AWCA 3LSTA 2P5LC 1BI0A 3IHUA 2EJRA 2PN6A 2C6YA 5LGTA 3CTAA 4O5VA 2ISZA 2ZNZA 4R8HA 2MC3A 2KIUA 2D2WA 5TJJA 1ONVA 3W6KB 2HTJA 2M1BA 3WTZA 3I58A 1O7LA 1U5TC 4F7ZA 2ZBKA 4UVBA 3C1DA 2L02A 1YYVA 3SZTA 2QBYA 3TO6A 1WKMA 2B0LA 1RUOA 3HYIA 1OKRA 1ZG5A 2UZKA 1XB4A 2ESNA 3GFMA 1XMAA 2CG4A 4CHUA 2QBYB 2HS5A 1R1UA 3U1DA 3KP2A 2RV8A 3ROUA 1Q1HA 3QAHA 4GO1A 1W5TA 3HOTA 2KIFA 2OQGA 4HLXA 2Z99A 1OYWA 1NHAA 2DK5A 1Z6RA 1X3UA 3DPTA 1ULYA 3JAMK 1LEAA 1QPMA 4KICA 1O3RA 2IPQX 5FB2A 3JTGA 3I71A 3BY6A 2V6CA 2KRFA 4CO8A 2GA2A 3M8EA 3TQNA 4EV0A 3WTXC 3QPHA 2O0YA 4BQAA 1S8NA 4YIFA 5L3EA 5DUIA 2DTRA 1SMTA 1TTYA 2DK8A 5CJ9A 2XRNA 3EETA 3M1EA 1T0FA 4A0YA 4WF2A 3RI4A 1T38A 4NQWA 1MJBA 2FRHA 4AIJA 4OMZA 1ZYRF 4BHBA 2PFBA 1MGTA 2P5VA 2LSOA 5FGMA 3TO9A 4UNOA 2FA5A 3GO5A 1MJAA 2VODA 1CGPA 3BDDA 4PGHA 1USSA 5A2QZ 1G3YA 4P55A 2HR3A 5AIQA 1S6LA 1YG2A 2Z5UA 5CVRA 2ZCWA 2OAZA 1H0MA 5LGNA 4I2OA 4UUVA 1IF1A 2QVOA 4U7BA 2QLZA 5HLHA 2HDCA 2CFXA 3OOPA 1HKTA 2RGVA 1GVJA 3RJPA 3J7AO 3ECOA 2WTEA 4MHGA 3K9TA 1I1SA 2QM3A 4Z2YA 3DF8A 2FMLA 3O6BB 4CYDA 4ETSA 3F8NA 1R7JA 3H3ZA 1F9NA 3MQ0A 3J81Z 4L0YB 3ZQ7A 3E97A 2HYFA 1BI2A 4EVIA 2QQBA 2P5KA 2VC1A 5JFRA 1GXQA 4UVAA 3KEOA 4BHCA 1B4AA 4DNCA 1FP1D 4K2EA 2IVMA 4ENJA 3CUOA 4AD9A 1P92A 2GAUA 1HW2A 3BPXA 1E17A 4ENNA 1S3JA 3T8RA 2TDXA 4WK8F 3E6BA 3MAJA 4BNCA 1YW9A 2OU2A 2UXNA 1KU2A 3P7NA 4LFUA 2QQ9A 4MTDA 1UFMA 2NYXA 3K1MA 4KDPA 2P7CB 1W7PA 2FF4A 2MA3A 4YIIA 3N4MA 2HKOA 1KQ0A 3L7WA 2P4WA 2Q0OA 5K5OA 3QP6A 2VBXA 4CGZA 1W7PB 3FF5A 2M5WA 5HS9A 1ZRFA 4ZZLA 3EUHA 2OQRA 1YW7A 3VFZA 3E6DA 2A5YB 1C0WA 4S04A 5ILSA 4XRFA 2ZNYA 3FX3A 3WGGA 3MZHA 4IRGA 1MZBA 2MBFA 3VODA 3Q5FA 2R7FA 2H6CA 1WQ2A 2K27A 3O2PE 4BH9A 3ML6A 2FBHA 4KN7X 1R1TA 4TV7A 2AXLA 2ZMEA 3HRTA 1FSHA 2STWA 1LDJA 1EH6A 4N9HA 4IXAA 1IW7F 4HV6A 2EFPA 2VE8A 2BV6A 1HXDA 3MWMA 3CUQA 5E17F 4RB1A 2ZMEB 3KFWX 4KUMA 5H6RA 4EJTA 1FP2A 4U0VA 5DCFA 3RYRA 2E1CA 1ZAOA 1SD4A 3CUQB 3U9GA 2CGPA 1XSDA 3WTSC 2D45A 1YQAA 1J59A 3CJNA 1XD7A 4HBLA 1ZRCA 2A68F 3RTRA 2JPBA 1FYKA 2Z33A 3EQLF 2VBZA 2ISYA 3WTVC 5E1ZB 5JI6A 3ZMUA 4P9UA 1LNWA 2PMUA 4LG0A 3O3KA 5E20A 1YO5C 3GFJA 4U88A 1E2XA 5KK1A 4ZH4F 2JSCA 3K1NA 1GXPA 4CZZA 5FLXK 3HUGA 4HF2A 1XMKA 4M9SA 2VBWA 5IT3A 4M6XA 3ISPA 4RS8A 1KU7A 4LG0B 1S29A 2QENA 1TLHB 5LRRA 5LEJA 1IXRC 2E1NA 5J6XA 4EGYA 2XVCA 1TQIA 5HLGA 1QBJA 2O61A 2XAJA 2FNPA 1HW1A 4FT8A 2DBBA 5LHHA 1SMYF 2V1XA 4L9JA 1ZREA 1PP8F 4IRHA 4LLGF 1I5ZA 2K86A 3F6OA 3S2WA 3BJAA 1JGSA 2XAFA 4PCQA 3BOQA 1B59A 5LHGA 1JHHA 3F8BA 2CWEA 3WTUC 2PEXA 2H94A 4IHSA 4ZYEA 2YR2A 3IRRA 1IXSB 3R61A 3WG9A 5ED4A 5CVJA 5ICCA 4CDGA 3I53A 1EV7A 1UHMA 5D6FA 4E70A 3HIFA 2RC4A 1P4WA 2F5EA 2ETHA 1AOYA 1CF7A 4PZJA 4MQVA 5D6EA 4A0ZA 5LLQA 4G7HF 3QP5A 1ON2A 2K7LA 3F23A 3MZYA 3E5UA 1CF7B 3E5XA 5CVVA 1G6NA 1KYWA 4BYYA 2JZYA 3ERED 4KA4A 1QO0D 4GXOA 3GZ5A 2Q2EA 3CLOA 3G3ZA 3QOPA 2YU3A 3QPTA 4NB5A 4HQEA 1J2XA 3EDPA 1GHCA 4A5NA 4U0YA 2H6BA 4Y17A 1FWZA 1ZGJA 1YLFA 4RB3C 3P9KA 2A07F 2P6SA 4KYWA 4A6DA 2PG4A 3FM3A 2QYOA 5L3BA 3KZZA 2DO7A 2DI3A 4KNYA 5E1XA 2MD5A 1TQPA 4LJZF 5BQTA 4A12A 2Q8KA 2NAZA 4I0BA 2OZ6A 3T5XA 5D4SA 1QNTA 4L5JA 3RDIA 4L18B 3RPQA 1IN6A 2NRAC 3GFLA 2E7WA 2DFIA 3RKYA 2EWNA 1SAXA 3KE2A 5FD5A 2IP2A 1KA8A 3SQNA 1EH8A 1TNTA 3GX4X 2HQRA 5HLIA 3F6VA 4LMYA 3BROA 5DV5A 4RGSA 1R5GA 3V8JA 4EJOA 1BN5A 2MLGA 3D0SA 2NNNA 1LQ1A 4G8XA 3E5QA 3BZ6A 5L3FA 3REOA 1P4XA 1KGSA 2VE9A 3BPVA 1HW5A 4M9ZA 3WGIA 2XIGA 5FFXA 1UB9A 1BI3A 1LB2A 3IL2A 4BHPA 1YS6A 1QQIA 1SFUA 3K2ZA 1J7KA 2QZ8A 4GGGA 4KIBA 4KT5C 5H6QA 3ULQB 2EFWA 2OD5A 2YSRA 1YW8A 4ZYDA 2O8XA 1OPCA 2BE5F 1ON1A 3C3WA 5J8CA 2L54A 1XCBA 3K0LA 3TOAA 4OU0A 1BC7C 3IWFA 4WXHA 2COMA 1Z05A 3LAPA 4WWCA 4OOIA 4UV9A 1K78A 4HOBA 3E6MA 2IW5A 3OV8A 2NS0A 1REPC 1R58A 3KLNA 5L3DA 1IAWA 1K78B 2W24A 5D5WB 5ERIA 1YS7A 4FX0A 3VOEA 3WU0A 1S7OA 2HEOA 3LQRA 2BGCA 2XAHA 1Z7UA 2Z9OA 1IN4A 1DPUA 4HA8A 3WGHA 2Y75A 2UWMA 1H9TA 2VOOA 1IRGA 2R3SA 2EV5A 2GA1A 1B9NA 1XN7A 4EM2A 3J80K 3C7JA 4LLNA 4AVPA 4Y13A 2K02A 3LA7A 3HHGA 4FHTA 2OBPA 3EYYA 3FZVA 1D8KA 2M45A 2IA2A 1YTYA 1SD7A 3JSOA 1FBUA 1K7AA 1FNNA 4KIFA 4L0ZB 2FEZA 3GXOA 2L3DA 2HZTA 2L01A 2ZFWA 2DAOA 4HX4A 3AAFA 5FLXZ 2PLYA 4NHJA 2GXGA 5HDKA 4ESFA 3BWGA 2Y48A 1RNLA 2GWRA 2DPUA 4RB2C 3F8MA 4WXCA 4UV8A 2M8EA 2PI0A 1XCVA 1XDSA 2VXZA 5DYMA 3V7SA 1V4RA 1P4AA 4ENMA 3ABUA 4IRIA 3B02A 5LBQA 2XUBA 3HRMA 2EFNA 5BPDA 5D5XB 1L3LA 1R1VA 2EA2A 3IRQA 4YFKF 2DQRA 4ASNA 3V7CA 3HSFA 4HF0A 2UXXA 1MJ9A 3LAJA 5F6FA 2LF8A 2WWYA 2PJPA 1U78A 3P9CA 4G7OF 5ICEA 1OYIA 3M8FA 1SFXA 4RAZA 3GFIA 3CO7C 5DD8A 2DLLA 3HRSA 2ZO4A 5IT9Z 2PBIA 2IT0A 5ILUA 2RVCA 3NRVA 4ZZDA 5HS7A 2A6HF 3Q9SA 4I02A 3R60A 1I27A 3LFKA 4RGXA 5ICFA 4RGUA 4G7ZF 2ADUA 3QU3A 3RKXA 1XSVA 3BP8A 1BI1A 3WTWC 4XBFA 3SHFA 2FU4A 2JT1A 1FOKA 4PGGA 4I98B 1XGMA 5E18F 1LEBA 3NEUA 2XV4S 4YFNF 4U0WA 3CO6C 3CDHA 2LKPA 2KIMA 4B09A 4OIRF 2GQQA 4JBAA 3U2RA 2NNYA 4JQFA 1R22A 1HKSA 5LGUA 5D4RA 1BC8C 2DW4A 2IJLA 5BOXA 2V79A 1TW2A 1V3FA 2W25A 1U5TA 3NQOA 3E3VA 3ZN0A 4KFCA 3QU6A 4ON0A 5H20A 1IN7A 3BJ6A 4G6DA 2KJCA 1IRFA 1U5TB 2W84A 1PDNC 4LK0F 2PMHA 4G6QA 3DFGA 5AONA 5FFZA 5D5UB 1PP7U 2CO5A 1J5YA 2F5CA 3ECHA 1QZYA 2XKPA 1WRJA 2X0LA 3WTYC 1ZLKA 2HTSA 2CSOA 3PQJA 3GLXA 2MH9A 2FNAA 5L3CA 3DEUA 3F72A 3DV8A 1HKQA 3LWFA 5BMZA 4M6YA 2A3SA 2F5FA 1STZA 3DKWA 1FY7A 1F5TA 1ZH5A 2ZXJA 5IT9K 4O6JA 4EJUA 3IKVA 2CW0F 5AIPA 2LF7A 3F3XA 3RKWA 2ZJ2A 4OIPF 3JTHA 1R00A 2V1DA 3F8CA 4WCGA 1IN8A 4A6EA 1ZG3A 5DD4A 3BJOA 4LGWA 3DQVC 2VT3A 1HBXG 2D1VA 1OR7A 3V8KA 4I09A 5HOOA 4HAMA 4ENKA 4KMUX 5E8IA 1FX7A 4HDVA 5JR3A 3FHZA 1BIAA 3HHHA 3FXRA 4IVNA 3I59A 5ILVA 4EM0B 2YPRA 4M74A 2WV0A 4A0XA 5JVTA 3GEZA 4GYIA 2GIVA 2BEOA 3KP4A 4LD5A 3I0TA 1LVAA 3V4GA 3F22A 3I59B 5F64A 1MDMA 2XROA 1I1GA 1TNSA 1H9GA 3GVAA 5TRDA 4I7HA 1FPQA 4RB0A 5K5RA 4HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VB2 A;  4GYG A;  2ZKZ A;  2EFO A;  1MDM B;  4RGR A;  1F4K A;  1ZLJ A;  1PUE E;  3FMS A;  1UST A;  3ZMS A;  4I0A A;  2K4B A;  1HQC A;  2J5O A;  4XLN F;  1FT9 A;  2QUF A;  4L9T A;  1WSU A;  1FYL A;  1YFH A;  3J80 Z;  1ZG1 A;  3ZP5 A;  4ESJ A;  1ZGA A;  1XGN A;  4CXF A;  4N0B A;  4UHT A;  2W57 A;  5LEK A;  3TKY A;  5D5V B;  3L9F A;  3FMQ A;  2HFH A;  4XSZ F;  3WU1 B;  5D8K B;  3H3U A;  1U6G A;  4QLC U;  3MEX A;  4WX9 A;  3SFZ A;  1IUY A;  1HST A;  3CUQ C;  3R0A A;  1D5V A;  2G7H A;  1I6X A;  3K1P A;  1SD5 A;  2YX7 A;  3G73 A;  4HZF A;  1D8J A;  1BIB A;  1HSJ A;  5KVR A;  3R6S A;  1LJ9 A;  1G3W A;  3WOD F;  2E7X A;  2XAQ A;  3ZMV A;  1FYM A;  3KCC A;  2HKX A;  4OIO F;  4I01 A;  2IRF G;  3EYI A;  1KYZ A;  1BOA A;  4ESB A;  2VT2 A;  3LA2 A;  4LB6 B;  3I4P A;  1XGO A;  4ZYG A;  3KP5 A;  2KJB A;  4P96 A;  1K79 A;  1DPR A;  2IA1 A;  4Q48 A;  1KQ9 A;  1IN5 A;  1TW3 A;  3ZPL A;  2CQK A;  2A61 A;  4L9N A;  4BAY A;  5BPI A;  4EGZ A;  4AIK A;  4EQQ A;  2VC0 A;  2Y0M A;  3FXU A;  2QWW A;  2FQ3 A;  3VEP A;  1FLI A;  1T39 A;  1OYY A;  2RQP A;  5EEH A;  6PAX A;  3N97 A;  1Y0U A;  3KP7 A;  1EH7 A;  2FMY A;  2RKH A;  1RZ4 A;  5CVI A;  3DPL C;  1LDD A;  3GWZ A;  1YIO A;  2A6E F;  1KQ8 A;  5E8G A;  1JHF A;  1B1B A;  2D1H A;  4A5M A;  1DUX C;  4S05 A;  2HYG D;  5D8L B;  1Z91 A;  1DDN A;  3IC7 A;  3IWZ A;  4PDK A;  2F2E A;  2BYV E;  2DU9 A;  2OA4 A;  4L9V A;  2HQN A;  3D5L A;  1ZHF A;  2OZU A;  2GZW A;  2XHK A;  2FE3 A;  3KEQ A;  5FO5 A;  5BS6 A;  3HTU A;  4MNU A;  4OIN F;  4AIH A;  1P6R A;  1JE8 A;  3KP3 A;  4M9X A;  4A2U A;  4FX4 A;  3GZ6 A;  3F21 A;  2VON A;  2HGC A;  4ZYH A;  3V7R A;  2GXB A;  4HW0 A;  1SFE A;  3GF2 A;  5DUK A;  4MQ9 F;  3WTT C;  2MLK A;  1R23 A;  3KZY A;  5E1W A;  3E6C C;  3HOS A;  4HF1 A;  1VTN C;  2X4H A;  3ABT A;  2EK5 A;  3W6J B;  5LHI A;  3IKT A;  1KU3 A;  1W7P D;  2EFQ A;  2P7V B;  1S7A A;  2ELH A;  3KLO A;  5ICG A;  1T98 A;  1MD0 A;  3GUD A;  2JRT A;  1G3T A;  5HDG A;  5K1Y A;  5DEQ A;  4MTE A;  1LDK B;  3L2C A;  3KP6 A;  4IJA A;  4UXN A;  1O3T A;  1T2K A;  4G9Y A;  3R0J A;  1BM9 A;  5JHU A;  1G4D A;  4Q4Z F;  3HTS B;  1WWX A;  4M72 A;  1ZN2 A;  2F5D A;  2M30 A;  2M87 A;  5K5Q A;  1XDU A;  2L4A A;  3L00 A;  4XLP F;  5J8F A;  4IHT A;  2HWV A;  3PFI A;  4KN4 X;  4P5O A;  3ZMZ A;  4D0P A;  3WE3 A;  3RYP A;  4CIC A;  3HSR A;  3FM5 A;  2RN7 A;  3I64 A;  2VN2 A;  1P2F A;  2FBI A;  4Y15 A;  4EMS A;  1RI7 A;  1J0R A;  4OIQ F;  1T6S A;  4Q47 A;  4XSX F;  5FD6 A;  1Z1D A;  1TQM A;  3PQK A;  3JW4 A;  3QRF F;  3HSE A;  3ELK A;  5HVQ C;  3TDU C;  5L3G A;  1G3S A;  3T1B A;  1R36 A;  4KIG A;  4YG2 F;  2EV6 A;  2XAG A;  2FSW A;  1J9I A;  3C18 A;  5LRS A;  2XGX A;  4M73 A;  1UCR A;  1Z6T A;  3GW2 A;  2LNB A;  3P9I A;  1Z9C A;  2ACJ A;  4QWQ A;  4GCV A;  2MH2 A;  1K6O A;  2V9V A;  2H27 A;  2W85 A;  3V8L A;  4MEY F;  5A2Q K;  2VOP A;  4JK1 X;  3FWE A;  1O3S A;  3I5U A;  4HV5 A;  1B6A A;  4MEX F;  2IA0 A;  1XSX A;  4HQM A;  3T8T A;  1U3E M;  3L09 A;  2R7D A;  2PQ8 A;  3FMR A;  3HRU A;  5CYV A;  2O03 A;  4IPA A;  1KU9 A;  4DQ2 A;  3M9A A;  3JSP A;  5DCM A;  4P9F A;  1FBS A;  4HX8 A;  3TOB A;  3MCZ A;  1OMI A;  1DP7 P;  4EJV A;  4LB5 A;  3LQQ A;  3J81 K;  5DCM B;  2FXA A;  1IXC A;  2EV0 A;  3ZMT A;  2YX4 A;  5F1R A;  1U2W A;  3SZP A;  2FBK A;  3ZMD A;  5CLS A;  1UHW A;  3LA3 A;  3B73 A;  2DT5 A;  4LLL A;  2ESH A;  1O57 A;  1FBQ A;  4YFX F;  1L0O C;  1TBX A;  4B8X A;  1FC3 A;  3FXQ A;  5HDN A;  3SXY A;  1R5H A;  2V1U A;  2WC2 A;  4LK1 F;  3R4K A;  5DDG A;  2RDP A;  4HX7 A;  1J75 A;  4R79 A;  4EM1 A;  2H09 A;  3M7G A;  3MFK A;  1U8R A;  4IF4 A;  3RIR A;  3I54 A;  2O6G E;  3TGN A;  1W5S A;  1FZP B;  4O3M A;  2KKO A;  3JAM Z;  2G7U A;  4KMF A;  2DPD A;  3F8F A;  4U7D A;  3KET A;  2P8T A;  1XGS A;  4EJW A;  1QZZ A;  1W4M A;  1MKM A;  2JTV A;  4HYE A;  2HOE A;  3DXJ F;  1BJA A;  4AWX B;  1WI9 A;  1QGP A;  1BBY A;  4OMY A;  2QQA A;  2XKO A;  4Q5S F;  1SD6 A;  2VBY A;  2STT A;  4BXU A;  5CVU A;  3COA C;  4N9I A;  3ZN1 A;  1RUN A;  4H0E A;  3TO7 A;  2O3F A;  2JPC A;  4UVC A;  3K69 A;  4RAY A;  2BBY A;  2EA4 A;  2LDU A;  4L5I A;  2EB7 A;  2CYY A;  2K4J A;  3TDZ C;  1D3Y A;  2P6T A;  2XAS A;  3Q9V A;  5HS8 A;  3RPU A;  1O3Q A;  3DP7 A;  1ZAR A;  4R1H A;  1ODD A;  4HLY A;  1ZRD A;  1RIO H;  1O7F A;  2AS5 F;  1FSE A;  3H92 A;  1F1Z A;  2A69 F;  2RNJ A;  4MGR A;  3T0Y A;  1IZ1 A;  4WXD A;  1JXS A;  5EEG A;  3WE2 A;  3GYH X;  2G9W A;  4G94 A;  1B9M A;  2DQL A;  4M71 A;  2FOK A;  2L4M A;  2J5P A;  1A04 A;  2Z3Y A;  1AWC A;  3LST A;  2P5L C;  1BI0 A;  3IHU A;  2EJR A;  2PN6 A;  2C6Y A;  5LGT A;  3CTA A;  4O5V A;  2ISZ A;  2ZNZ A;  4R8H A;  2MC3 A;  2KIU A;  2D2W A;  5TJJ A;  1ONV A;  3W6K B;  2HTJ A;  2M1B A;  3WTZ A;  3I58 A;  1O7L A;  1U5T C;  4F7Z A;  2ZBK A;  4UVB A;  3C1D A;  2L02 A;  1YYV A;  3SZT A;  2QBY A;  3TO6 A;  1WKM A;  2B0L A;  1RUO A;  3HYI A;  1OKR A;  1ZG5 A;  2UZK A;  1XB4 A;  2ESN A;  3GFM A;  1XMA A;  2CG4 A;  4CHU A;  2QBY B;  2HS5 A;  1R1U A;  3U1D A;  3KP2 A;  2RV8 A;  3ROU A;  1Q1H A;  3QAH A;  4GO1 A;  1W5T A;  3HOT A;  2KIF A;  2OQG A;  4HLX A;  2Z99 A;  1OYW A;  1NHA A;  2DK5 A;  1Z6R A;  1X3U A;  3DPT A;  1ULY A;  3JAM K;  1LEA A;  1QPM A;  4KIC A;  1O3R A;  2IPQ X;  5FB2 A;  3JTG A;  3I71 A;  3BY6 A;  2V6C A;  2KRF A;  4CO8 A;  2GA2 A;  3M8E A;  3TQN A;  4EV0 A;  3WTX C;  3QPH A;  2O0Y A;  4BQA A;  1S8N A;  4YIF A;  5L3E A;  5DUI A;  2DTR A;  1SMT A;  1TTY A;  2DK8 A;  5CJ9 A;  2XRN A;  3EET A;  3M1E A;  1T0F A;  4A0Y A;  4WF2 A;  3RI4 A;  1T38 A;  4NQW A;  1MJB A;  2FRH A;  4AIJ A;  4OMZ A;  1ZYR F;  4BHB A;  2PFB A;  1MGT A;  2P5V A;  2LSO A;  5FGM A;  3TO9 A;  4UNO A;  2FA5 A;  3GO5 A;  1MJA A;  2VOD A;  1CGP A;  3BDD A;  4PGH A;  1USS A;  5A2Q Z;  1G3Y A;  4P55 A;  2HR3 A;  5AIQ A;  1S6L A;  1YG2 A;  2Z5U A;  5CVR A;  2ZCW A;  2OAZ A;  1H0M A;  5LGN A;  4I2O A;  4UUV A;  1IF1 A;  2QVO A;  4U7B A;  2QLZ A;  5HLH A;  2HDC A;  2CFX A;  3OOP A;  1HKT A;  2RGV A;  1GVJ A;  3RJP A;  3J7A O;  3ECO A;  2WTE A;  4MHG A;  3K9T A;  1I1S A;  2QM3 A;  4Z2Y A;  3DF8 A;  2FML A;  3O6B B;  4CYD A;  4ETS A;  3F8N A;  1R7J A;  3H3Z A;  1F9N A;  3MQ0 A;  3J81 Z;  4L0Y B;  3ZQ7 A;  3E97 A;  2HYF A;  1BI2 A;  4EVI A;  2QQB A;  2P5K A;  2VC1 A;  5JFR A;  1GXQ A;  4UVA A;  3KEO A;  4BHC A;  1B4A A;  4DNC A;  1FP1 D;  4K2E A;  2IVM A;  4ENJ A;  3CUO A;  4AD9 A;  1P92 A;  2GAU A;  1HW2 A;  3BPX A;  1E17 A;  4ENN A;  1S3J A;  3T8R A;  2TDX A;  4WK8 F;  3E6B A;  3MAJ A;  4BNC A;  1YW9 A;  2OU2 A;  2UXN A;  1KU2 A;  3P7N A;  4LFU A;  2QQ9 A;  4MTD A;  1UFM A;  2NYX A;  3K1M A;  4KDP A;  2P7C B;  1W7P A;  2FF4 A;  2MA3 A;  4YII A;  3N4M A;  2HKO A;  1KQ0 A;  3L7W A;  2P4W A;  2Q0O A;  5K5O A;  3QP6 A;  2VBX A;  4CGZ A;  1W7P B;  3FF5 A;  2M5W A;  5HS9 A;  1ZRF A;  4ZZL A;  3EUH A;  2OQR A;  1YW7 A;  3VFZ A;  3E6D A;  2A5Y B;  1C0W A;  4S04 A;  5ILS A;  4XRF A;  2ZNY A;  3FX3 A;  3WGG A;  3MZH A;  4IRG A;  1MZB A;  2MBF A;  3VOD A;  3Q5F A;  2R7F A;  2H6C A;  1WQ2 A;  2K27 A;  3O2P E;  4BH9 A;  3ML6 A;  2FBH A;  4KN7 X;  1R1T A;  4TV7 A;  2AXL A;  2ZME A;  3HRT A;  1FSH A;  2STW A;  1LDJ A;  1EH6 A;  4N9H A;  4IXA A;  1IW7 F;  4HV6 A;  2EFP A;  2VE8 A;  2BV6 A;  1HXD A;  3MWM A;  3CUQ A;  5E17 F;  4RB1 A;  2ZME B;  3KFW X;  4KUM A;  5H6R A;  4EJT A;  1FP2 A;  4U0V A;  5DCF A;  3RYR A;  2E1C A;  1ZAO A;  1SD4 A;  3CUQ B;  3U9G A;  2CGP A;  1XSD A;  3WTS C;  2D45 A;  1YQA A;  1J59 A;  3CJN A;  1XD7 A;  4HBL A;  1ZRC A;  2A68 F;  3RTR A;  2JPB A;  1FYK A;  2Z33 A;  3EQL F;  2VBZ A;  2ISY A;  3WTV C;  5E1Z B;  5JI6 A;  3ZMU A;  4P9U A;  1LNW A;  2PMU A;  4LG0 A;  3O3K A;  5E20 A;  1YO5 C;  3GFJ A;  4U88 A;  1E2X A;  5KK1 A;  4ZH4 F;  2JSC A;  3K1N A;  1GXP A;  4CZZ A;  5FLX K;  3HUG A;  4HF2 A;  1XMK A;  4M9S A;  2VBW A;  5IT3 A;  4M6X A;  3ISP A;  4RS8 A;  1KU7 A;  4LG0 B;  1S29 A;  2QEN A;  1TLH B;  5LRR A;  5LEJ A;  1IXR C;  2E1N A;  5J6X A;  4EGY A;  2XVC A;  1TQI A;  5HLG A;  1QBJ A;  2O61 A;  2XAJ A;  2FNP A;  1HW1 A;  4FT8 A;  2DBB A;  5LHH A;  1SMY F;  2V1X A;  4L9J A;  1ZRE A;  1PP8 F;  4IRH A;  4LLG F;  1I5Z A;  2K86 A;  3F6O A;  3S2W A;  3BJA A;  1JGS A;  2XAF A;  4PCQ A;  3BOQ A;  1B59 A;  5LHG A;  1JHH A;  3F8B A;  2CWE A;  3WTU C;  2PEX A;  2H94 A;  4IHS A;  4ZYE A;  2YR2 A;  3IRR A;  1IXS B;  3R61 A;  3WG9 A;  5ED4 A;  5CVJ A;  5ICC A;  4CDG A;  3I53 A;  1EV7 A;  1UHM A;  5D6F A;  4E70 A;  3HIF A;  2RC4 A;  1P4W A;  2F5E A;  2ETH A;  1AOY A;  1CF7 A;  4PZJ A;  4MQV A;  5D6E A;  4A0Z A;  5LLQ A;  4G7H F;  3QP5 A;  1ON2 A;  2K7L A;  3F23 A;  3MZY A;  3E5U A;  1CF7 B;  3E5X A;  5CVV A;  1G6N A;  1KYW A;  4BYY A;  2JZY A;  3ERE D;  4KA4 A;  1QO0 D;  4GXO A;  3GZ5 A;  2Q2E A;  3CLO A;  3G3Z A;  3QOP A;  2YU3 A;  3QPT A;  4NB5 A;  4HQE A;  1J2X A;  3EDP A;  1GHC A;  4A5N A;  4U0Y A;  2H6B A;  4Y17 A;  1FWZ A;  1ZGJ A;  1YLF A;  4RB3 C;  3P9K A;  2A07 F;  2P6S A;  4KYW A;  4A6D A;  2PG4 A;  3FM3 A;  2QYO A;  5L3B A;  3KZZ A;  2DO7 A;  2DI3 A;  4KNY A;  5E1X A;  2MD5 A;  1TQP A;  4LJZ F;  5BQT A;  4A12 A;  2Q8K A;  2NAZ A;  4I0B A;  2OZ6 A;  3T5X A;  5D4S A;  1QNT A;  4L5J A;  3RDI A;  4L18 B;  3RPQ A;  1IN6 A;  2NRA C;  3GFL A;  2E7W A;  2DFI A;  3RKY A;  2EWN A;  1SAX A;  3KE2 A;  5FD5 A;  2IP2 A;  1KA8 A;  3SQN A;  1EH8 A;  1TNT A;  3GX4 X;  2HQR A;  5HLI A;  3F6V A;  4LMY A;  3BRO A;  5DV5 A;  4RGS A;  1R5G A;  3V8J A;  4EJO A;  1BN5 A;  2MLG A;  3D0S A;  2NNN A;  1LQ1 A;  4G8X A;  3E5Q A;  3BZ6 A;  5L3F A;  3REO A;  1P4X A;  1KGS A;  2VE9 A;  3BPV A;  1HW5 A;  4M9Z A;  3WGI A;  2XIG A;  5FFX A;  1UB9 A;  1BI3 A;  1LB2 A;  3IL2 A;  4BHP A;  1YS6 A;  1QQI A;  1SFU A;  3K2Z A;  1J7K A;  2QZ8 A;  4GGG A;  4KIB A;  4KT5 C;  5H6Q A;  3ULQ B;  2EFW A;  2OD5 A;  2YSR A;  1YW8 A;  4ZYD A;  2O8X A;  1OPC A;  2BE5 F;  1ON1 A;  3C3W A;  5J8C A;  2L54 A;  1XCB A;  3K0L A;  3TOA A;  4OU0 A;  1BC7 C;  3IWF A;  4WXH A;  2COM A;  1Z05 A;  3LAP A;  4WWC A;  4OOI A;  4UV9 A;  1K78 A;  4HOB A;  3E6M A;  2IW5 A;  3OV8 A;  2NS0 A;  1REP C;  1R58 A;  3KLN A;  5L3D A;  1IAW A;  1K78 B;  2W24 A;  5D5W B;  5ERI A;  1YS7 A;  4FX0 A;  3VOE A;  3WU0 A;  1S7O A;  2HEO A;  3LQR A;  2BGC A;  2XAH A;  1Z7U A;  2Z9O A;  1IN4 A;  1DPU A;  4HA8 A;  3WGH A;  2Y75 A;  2UWM A;  1H9T A;  2VOO A;  1IRG A;  2R3S A;  2EV5 A;  2GA1 A;  1B9N A;  1XN7 A;  4EM2 A;  3J80 K;  3C7J A;  4LLN A;  4AVP A;  4Y13 A;  2K02 A;  3LA7 A;  3HHG A;  4FHT A;  2OBP A;  3EYY A;  3FZV A;  1D8K A;  2M45 A;  2IA2 A;  1YTY A;  1SD7 A;  3JSO A;  1FBU A;  1K7A A;  1FNN A;  4KIF A;  4L0Z B;  2FEZ A;  3GXO A;  2L3D A;  2HZT A;  2L01 A;  2ZFW A;  2DAO A;  4HX4 A;  3AAF A;  5FLX Z;  2PLY A;  4NHJ A;  2GXG A;  5HDK A;  4ESF A;  3BWG A;  2Y48 A;  1RNL A;  2GWR A;  2DPU A;  4RB2 C;  3F8M A;  4WXC A;  4UV8 A;  2M8E A;  2PI0 A;  1XCV A;  1XDS A;  2VXZ A;  5DYM A;  3V7S A;  1V4R A;  1P4A A;  4ENM A;  3ABU A;  4IRI A;  3B02 A;  5LBQ A;  2XUB A;  3HRM A;  2EFN A;  5BPD A;  5D5X B;  1L3L A;  1R1V A;  2EA2 A;  3IRQ A;  4YFK F;  2DQR A;  4ASN A;  3V7C A;  3HSF A;  4HF0 A;  2UXX A;  1MJ9 A;  3LAJ A;  5F6F A;  2LF8 A;  2WWY A;  2PJP A;  1U78 A;  3P9C A;  4G7O F;  5ICE A;  1OYI A;  3M8F A;  1SFX A;  4RAZ A;  3GFI A;  3CO7 C;  5DD8 A;  2DLL A;  3HRS A;  2ZO4 A;  5IT9 Z;  2PBI A;  2IT0 A;  5ILU A;  2RVC A;  3NRV A;  4ZZD A;  5HS7 A;  2A6H F;  3Q9S A;  4I02 A;  3R60 A;  1I27 A;  3LFK A;  4RGX A;  5ICF A;  4RGU A;  4G7Z F;  2ADU A;  3QU3 A;  3RKX A;  1XSV A;  3BP8 A;  1BI1 A;  3WTW C;  4XBF A;  3SHF A;  2FU4 A;  2JT1 A;  1FOK A;  4PGG A;  4I98 B;  1XGM A;  5E18 F;  1LEB A;  3NEU A;  2XV4 S;  4YFN F;  4U0W A;  3CO6 C;  3CDH A;  2LKP A;  2KIM A;  4B09 A;  4OIR F;  2GQQ A;  4JBA A;  3U2R A;  2NNY A;  4JQF A;  1R22 A;  1HKS A;  5LGU A;  5D4R A;  1BC8 C;  2DW4 A;  2IJL A;  5BOX A;  2V79 A;  1TW2 A;  1V3F A;  2W25 A;  1U5T A;  3NQO A;  3E3V A;  3ZN0 A;  4KFC A;  3QU6 A;  4ON0 A;  5H20 A;  1IN7 A;  3BJ6 A;  4G6D A;  2KJC A;  1IRF A;  1U5T B;  2W84 A;  1PDN C;  4LK0 F;  2PMH A;  4G6Q A;  3DFG A;  5AON A;  5FFZ A;  5D5U B;  1PP7 U;  2CO5 A;  1J5Y A;  2F5C A;  3ECH A;  1QZY A;  2XKP A;  1WRJ A;  2X0L A;  3WTY C;  1ZLK A;  2HTS A;  2CSO A;  3PQJ A;  3GLX A;  2MH9 A;  2FNA A;  5L3C A;  3DEU A;  3F72 A;  3DV8 A;  1HKQ A;  3LWF A;  5BMZ A;  4M6Y A;  2A3S A;  2F5F A;  1STZ A;  3DKW A;  1FY7 A;  1F5T A;  1ZH5 A;  2ZXJ A;  5IT9 K;  4O6J A;  4EJU A;  3IKV A;  2CW0 F;  5AIP A;  2LF7 A;  3F3X A;  3RKW A;  2ZJ2 A;  4OIP F;  3JTH A;  1R00 A;  2V1D A;  3F8C A;  4WCG A;  1IN8 A;  4A6E A;  1ZG3 A;  5DD4 A;  3BJO A;  4LGW A;  3DQV C;  2VT3 A;  1HBX G;  2D1V A;  1OR7 A;  3V8K A;  4I09 A;  5HOO A;  4HAM A;  4ENK A;  4KMU X;  5E8I A;  1FX7 A;  4HDV A;  5JR3 A;  3FHZ A;  1BIA A;  3HHH A;  3FXR A;  4IVN A;  3I59 A;  5ILV A;  4EM0 B;  2YPR A;  4M74 A;  2WV0 A;  4A0X A;  5JVT A;  3GEZ A;  4GYI A;  2GIV A;  2BEO A;  3KP4 A;  4LD5 A;  3I0T A;  1LVA A;  3V4G A;  3F22 A;  3I59 B;  5F64 A;  1MDM A;  2XRO A;  1I1G A;  1TNS A;  1H9G A;  3GVA A;  5TRD A;  4I7H A;  1FPQ A;  4RB0 A;  5K5R A;  4HDU A; 
#chains in the Genus database with same CATH topology
 3VB2 A;  4GYG A;  3TP3 A;  4F93 B;  3NWS A;  2ZKZ A;  4JX5 A;  2IS2 A;  4C30 A;  2EFO A;  1WFX A;  4RGR A;  1MDM B;  4E7S A;  3BTI A;  2QA4 I;  1YIT I;  1F4K A;  1B8I B;  1YRN B;  1EA3 A;  1ZLJ A;  1PUE E;  4QSH A;  3RZO J;  3K7A J;  3FMS A;  1UST A;  3B6C A;  3ZMS A;  4I0A A;  2K4B A;  1FOW A;  1HQC A;  1P9Q C;  2J5O A;  4XLN F;  4B48 A;  1FT9 A;  2QUF A;  4L9T A;  1WSU A;  1FYL A;  1YFH A;  2VKV A;  2O9L A;  2AO9 A;  1N25 A;  2CQQ A;  3KPH A;  3LL7 A;  1JTX A;  2I10 A;  4UUT A;  3J80 Z;  3JRF A;  1ZG1 A;  4BAC A;  1VZ0 A;  2KP6 A;  5KNL A;  1FEX A;  3ZP5 A;  4ESJ A;  2K3P A;  2E1M B;  1FMW A;  1ZGA A;  4B4C A;  3CCL I;  1XGN A;  4CXF A;  4N0B A;  4UHT A;  2W57 A;  2VJ4 A;  4GDF A;  1LFB A;  2XB0 X;  5LEK A;  1VF9 A;  3BG7 A;  2WAE A;  3TKY A;  1SVO A;  5D5V B;  3L9F A;  3FMQ A;  2HFH A;  4XSZ F;  4CCM A;  5D8K B;  3WU1 B;  3H3U A;  2ZME C;  1U6G A;  1W1W E;  3G1M A;  3NWT A;  2XF7 A;  4RMN A;  4QLC U;  3BT9 A;  4XKC A;  3MEX A;  4WX9 A;  5GAE J;  3BR6 A;  3SFZ A;  3VDX A;  3JRG A;  4FE4 A;  2A5W A;  2DN0 A;  1XC5 A;  1IUY A;  4M3F A;  1HST A;  3CUQ C;  2WAD A;  3R0A A;  1JUM A;  4E6K G;  1D5V A;  3EUK L;  4CCJ A;  2G7H A;  1I6X A;  3K1P A;  5E3M A;  1SD5 A;  2EZI A;  5F04 A;  2YX7 A;  3BR2 A;  3G73 A;  4HZF A;  1D8J A;  1BIB A;  1HSJ A;  3FKJ A;  5KVR A;  4AYB A;  3ZQQ A;  2JVG A;  2WAQ A;  3R6S A;  1LJ9 A;  2CW7 A;  1G3W A;  3TW6 A;  3WOD F;  3PJR A;  2E7X A;  3A0H C;  2AHQ A;  2IGO A;  2XAQ A;  3ZMV A;  1FYM A;  1MNM C;  2V9K A;  3KCC A;  2IEK A;  1RRJ A;  2HKX A;  2M4K A;  4OIO F;  3BZC A;  2JA6 J;  4I01 A;  4CSW A;  2IRF G;  4BY1 J;  5FKK A;  3EYI A;  1WCM J;  2DDB A;  2M0C A;  3FKI J;  1XMX A;  1KYZ A;  1HA8 A;  1BOA A;  4ESB A;  2VT2 A;  3LA2 A;  4LB6 B;  3I4P A;  2EPF A;  1XGO A;  1JI8 A;  4ZYG A;  3KP5 A;  2VJI A;  2KJB A;  3SYT A;  4P96 A;  3WHC A;  2R7U A;  4F3Q A;  1K79 A;  3JRD A;  1DPR A;  2IA1 A;  4Q48 A;  1VI0 A;  1KQ9 A;  3CC7 I;  1IN5 A;  1TW3 A;  2LP0 A;  2XSJ C;  2VPR A;  3ZPL A;  2CQK A;  5J4Y A;  5IYC J;  1U9O A;  2A61 A;  1U8B A;  3E0J B;  4L9N A;  4BAY A;  1X3W B;  5BPI A;  3CC2 I;  1MH4 A;  3KIO A;  1X1P A;  2OJE D;  3S3M A;  4XRM A;  2MG4 A;  5IP9 J;  3FBN B;  4EGZ A;  4AIK A;  1XX5 A;  2VKD A;  4S0H B;  5IOY A;  1W0U A;  5J4V A;  3HGY A;  4BUP A;  4EQQ A;  2VC0 A;  2NS7 A;  2Y0M A;  3FXU A;  2QWW A;  2FQ3 A;  3VEP A;  5GAH J;  1IJW C;  1FLI A;  1T39 A;  1IDY A;  2V9P A;  2XRL A;  1OYY A;  1LFU P;  2RQP A;  2M3A A;  5EEH A;  6PAX A;  3N97 A;  1Y0U A;  4A93 J;  1A31 A;  3DU5 A;  3KP7 A;  1EH7 A;  2FMY A;  2RKH A;  5FRM A;  1RZ4 A;  5CVI A;  3S8P A;  5M5X J;  3DPL C;  1I39 A;  1LDD A;  3GWZ A;  2HYJ A;  3K70 C;  1N78 A;  1YIO A;  2A6E F;  4FQG A;  4AYB N;  1KQ8 A;  3E7L A;  5E8G A;  1JHF A;  2DOE A;  2LVS A;  1E0E A;  1B1B A;  2D1H A;  4A5M A;  3LSG A;  2DA7 A;  1MBE A;  3BG9 A;  1DUX C;  4S05 A;  2HYG D;  5D8L B;  3CF2 A;  2VXD A;  1Z91 A;  5C3E J;  1DDN A;  1W0T A;  3IC7 A;  3IWZ A;  4PDK A;  2F2E A;  2BOL A;  2BYV E;  4CCK A;  2DU9 A;  3M8J A;  1SFO J;  1OJL A;  2H1K A;  5HNH A;  1G59 A;  1ITY A;  2OA4 A;  4KT6 A;  3O8H A;  4BJT A;  1OCT C;  2LOO A;  3HC7 A;  4XN0 A;  2X6Y A;  2HQN A;  4HST A;  4L9V A;  2DCE A;  4LOC A;  3D5L A;  1ZHF A;  2OZU A;  2LG4 A;  3BG6 A;  2GZW A;  1LKX A;  2XHK A;  1UHS A;  2FE3 A;  4E7L A;  2MGQ A;  4QPQ A;  3KEQ A;  5FO5 A;  2JVH A;  5BS6 A;  3HTU A;  4D7M A;  1X19 A;  4MNU A;  4OIN F;  5FKN A;  4M3G A;  4AUX A;  4AIH A;  4ZDO A;  1P6R A;  1JE8 A;  3DKY A;  5HLT A;  3S32 A;  3KP3 A;  4M3E A;  1TWF J;  3IH4 A;  4M9X A;  2HVS A;  4A2U A;  4FX4 A;  5EEA A;  3GZ6 A;  3F21 A;  4HEA 2;  2VON A;  2HGC A;  4ZYH A;  1S9H A;  1BR2 A;  3V7R A;  4QPO A;  4ZYA A;  3S1Q J;  2GXB A;  4HW0 A;  3A01 A;  1SFE A;  1DGW Y;  2LMD A;  3GF2 A;  4CYC A;  2JN6 A;  5DUK A;  2GOM A;  3BG5 A;  3L2R A;  2FJ1 A;  3ZQI A;  4IQJ A;  4MQ9 F;  3ZRG A;  5K7Z A;  3WTT C;  2MLK A;  1R23 A;  3KZY A;  5E1W A;  3S14 J;  1R71 A;  3E6C C;  3HOS A;  1G2H A;  1WHU A;  3KX2 A;  4HF1 A;  3GTP J;  4CYC B;  1VTN C;  4C2U A;  2BY1 A;  1ZQ3 P;  1QVU A;  3AG2 H;  2DT7 B;  2X4H A;  2TCT A;  2DDA A;  2ID6 A;  3ABT A;  4ANJ A;  3DPU A;  1V54 H;  2EK5 A;  3W6J B;  4BJ6 C;  3AKZ A;  2HU9 A;  4E7H A;  5LHI A;  4AC0 A;  4CCO A;  4QIW N;  3IKT A;  1KU3 A;  1W7P D;  2VKH A;  5FKL A;  4M6V A;  3KZI C;  2EFQ A;  2P7V B;  2BVL A;  4BXF A;  3JRE A;  1GUU A;  3J7Z I;  1S7A A;  1OCO H;  2ELH A;  1WJE A;  3KLO A;  5ICG A;  1VQN I;  1AHD P;  1T98 A;  3H0G J;  1MD0 A;  2HDD A;  3GUD A;  2JRT A;  1NG7 A;  1G3T A;  1VQ4 I;  5HDG A;  4FAS D;  5K1Y A;  5DEQ A;  4MTE A;  3HDD A;  4UUS A;  1LDK B;  3L2C A;  3KP6 A;  2VQH A;  4IJA A;  4UXN A;  1O3T A;  1T2K A;  1R4M B;  2JWT A;  3ZQL A;  1M1E B;  4G9Y A;  4B47 A;  2FX0 A;  3R0J A;  1BM9 A;  3CMY A;  5JHU A;  2BHY A;  1D0X A;  4UUS B;  2X85 A;  3OYC A;  1G4D A;  2WY8 Q;  4Q4Z F;  3HTS B;  1WWX A;  1BR4 A;  4M72 A;  4HPQ A;  1WI3 A;  1ZN2 A;  4G12 A;  2F5D A;  2M30 A;  2M87 A;  5K5Q A;  2HXI A;  1XDU A;  3SJM A;  2Z16 A;  1Z7L A;  2L4A A;  3L00 A;  4NNJ A;  4XLP F;  5J8F A;  4IHT A;  4YIR X;  4PJ0 C;  4FCY A;  2HWV A;  2EIL H;  3RCO A;  3PFI A;  1JKP C;  2ZJQ F;  4KN4 X;  2NOJ B;  4GRI A;  5GAG J;  4RDU A;  1Z0X A;  2ZC2 A;  5EZH A;  4P5O A;  2X48 A;  3ZMZ A;  2CRG A;  2KRH A;  1ZGW A;  2E1O A;  4D0P A;  1APL C;  3WE3 A;  3RYP A;  3H5N A;  4CIC A;  3HSR A;  3OIQ A;  4Y52 J;  3FM5 A;  2QF7 A;  3E1S A;  1HDD C;  3FDY A;  3W6V A;  1ETK A;  2RN7 A;  3I64 A;  4ZDP A;  2ICW G;  2VN2 A;  3OYD A;  1P2F A;  2L9V A;  2FBI A;  4Y15 A;  1FTT A;  4EMS A;  2IGN A;  2EH3 A;  1RI7 A;  1J0R A;  4OIQ F;  1UAA A;  1T6S A;  4Q47 A;  3ZR8 X;  2P81 A;  4XSX F;  3S15 J;  4IO9 F;  5FD6 A;  3LNQ A;  3HJE A;  4V2G A;  4RLF A;  5F27 A;  3TL4 X;  1VQ7 I;  1Z1D A;  1TQM A;  2UUZ A;  3PQK A;  4UB6 C;  2GXA A;  3JW4 A;  1PJR A;  2EZK A;  1LVK A;  3QRF F;  1FOY A;  3HSE A;  3ELK A;  4V19 K;  2CQ7 A;  5EF6 A;  5HVQ C;  3DTE A;  2XPW A;  1Y1V J;  2XPV A;  4ZTF A;  5C4X J;  1T56 A;  4BQN A;  1MMD A;  3OYB A;  3TDU C;  5L3G A;  1G3S A;  3DU6 A;  3L2V A;  3RSN A;  1DU6 A;  3T1B A;  4BL0 B;  2EIN H;  1R36 A;  4BBS J;  4KIG A;  4B3A A;  4YG2 F;  2BXY A;  2EV6 A;  2JUC A;  2XDV A;  2XAG A;  2FSW A;  2XAU A;  3I9V 2;  1P7J A;  1J9I A;  3C18 A;  3CCM I;  5LRS A;  2XGX A;  4Y33 A;  2OTL I;  5IYD J;  2L7Z A;  4M73 A;  1UCR A;  1K6Y A;  1Z6T A;  3GZN B;  1DGR M;  3GW2 A;  2LNB A;  3S1N J;  1X2M A;  3P9I A;  1Z9C A;  2ACJ A;  4QWQ A;  3D1N I;  4GCV A;  5FLM J;  2MH2 A;  1GT0 C;  2V9V A;  2M0M A;  1K6O A;  2H27 A;  2W85 A;  3V8L A;  4MEY F;  5A2Q K;  2VOP A;  4JK1 X;  1MBF A;  3H0D A;  2O5R A;  5E3N A;  3FWE A;  1O3S A;  1R6R A;  3I5U A;  4HV5 A;  1W36 D;  2HPM A;  1Y0N A;  4MO7 A;  1B6A A;  4XOP A;  3PUB A;  4MEX F;  2IA0 A;  1NTC A;  1ETQ A;  2KDO A;  1XSX A;  4HQM A;  3T8T A;  1U3E M;  3L09 A;  2R7D A;  1OLT A;  1V5G A;  4XLC A;  2PQ8 A;  2VAS A;  3CCE I;  4E7Z A;  3FMR A;  2R4G A;  3QOE A;  3DWL E;  3HRU A;  5CYV A;  4DYQ A;  2O03 A;  2M4G A;  4IPA A;  3Q3S A;  2CQX A;  5DS9 A;  1KU9 A;  1LPQ A;  2F6C A;  3BC8 A;  2HNH A;  2GIZ A;  4DQ2 A;  1CQT A;  2E2J J;  2B7E A;  2RAE A;  3A02 A;  1WJ5 A;  3M9A A;  3JSP A;  5DCM A;  4P9F A;  4NBQ A;  1FBS A;  5GTH C;  4IHW A;  2BZT A;  4HX8 A;  3TOB A;  3MCZ A;  1OMI A;  1DP7 P;  4EJV A;  1Q1V A;  1H89 C;  2K9Q A;  1RKW A;  4B1R A;  2LKX A;  3JCU C;  4LB5 A;  4NC8 A;  3LQQ A;  3J81 K;  5DCM B;  2FXA A;  3BR1 A;  1IXC A;  2EV0 A;  4XNF A;  3ZMT A;  2YX4 A;  2W82 A;  3GBG A;  5F1R A;  1U2W A;  2I5U A;  3GME A;  3SZP A;  2FBK A;  3IV5 A;  2R92 J;  3ZMD A;  1ETO A;  5CLS A;  1UHW A;  3ZQC A;  3LA3 A;  3B73 A;  3I3L A;  2DT5 A;  4LLL A;  4BS9 A;  4IOC F;  2ESH A;  1O57 A;  4CCL A;  4XQF A;  1FBQ A;  3A0B C;  1RET A;  4YFX F;  5GAD J;  3K4B A;  1L0O C;  1TBX A;  4B8X A;  4RAF A;  1FC3 A;  3FXQ A;  5HDN A;  3SXY A;  2HQA A;  4MFD A;  2H8R A;  1R5H A;  2V1U A;  3FHN A;  1S7E A;  2WC2 A;  2XGC A;  3DLA A;  4LK1 F;  1J09 A;  3R4K A;  3FXM A;  5DDG A;  2RDP A;  3HM5 A;  5GP9 A;  3M4O J;  2BVM A;  4HX7 A;  1ZEL A;  3W3C A;  3AG1 H;  1J75 A;  4R79 A;  1YI2 I;  4EM1 A;  2H09 A;  2HZD A;  3M7G A;  1R49 A;  3N05 A;  3MFK A;  2OV7 A;  2OUM A;  2Y69 H;  4OWR B;  1U8R A;  2KQR A;  4IF4 A;  3RIR A;  2EIM H;  3I54 A;  5JVG F;  4V2F A;  2DMT A;  2O6G E;  3TGN A;  3JRC A;  1MMN A;  2Y0S N;  1YHQ I;  1W5S A;  5IY5 H;  3MD2 A;  4RM2 A;  2MW8 A;  5TGT A;  3HB9 A;  1FZP B;  4IL6 C;  4O3M A;  2KKO A;  3JAM Z;  2IBD A;  5JLW A;  4GFB A;  2E34 A;  2G7U A;  2QSF X;  4KMF A;  2DPD A;  2HOS A;  5E3O A;  3F8F A;  4U7D A;  3OS1 A;  1A5J A;  3KET A;  2P8T A;  1XGS A;  4EJW A;  3G2B A;  1RR8 C;  2HPI A;  5JLX A;  1JT0 A;  1QZZ A;  1W4M A;  3L1P A;  1MKM A;  3FXO A;  2JTV A;  5IP6 A;  1P7I A;  4DBQ A;  4HYE A;  2HOE A;  3DXJ F;  1K4T A;  1Z3X A;  2IS1 A;  1BJA A;  3PNY A;  3LSK A;  4AWX B;  3OYH A;  1WI9 A;  1QGP A;  3VSL A;  4IX7 A;  1BBY A;  4OMY A;  2PX9 A;  1YX3 A;  2KZG A;  3G1L A;  2VKE A;  2QQA A;  4N4O B;  1POG A;  2DXI A;  4LG3 A;  4BKX A;  2JRM A;  2XPU A;  2XKO A;  4Q5S F;  1SD6 A;  2VBY A;  3HPG A;  2STT A;  2E60 A;  1TC3 C;  4BXU A;  5CVU A;  3COA C;  3W2W A;  4N9I A;  3FXL A;  3ZN1 A;  1RUN A;  4H0E A;  3TO7 A;  2O3F A;  5F0H A;  1QZE A;  2JPC A;  1HDP A;  4RLQ A;  1EKE A;  4G6T B;  1B72 A;  4UVC A;  4A3C J;  3K69 A;  4RAY A;  2BBY A;  2EA4 A;  2LDU A;  2BW3 A;  4L5I A;  2VUM J;  2EB7 A;  2K9L A;  5E79 C;  2MAB A;  2LRD A;  2CYY A;  2K4J A;  3Q0V A;  3TDZ C;  1D3Y A;  2P6T A;  2XAS A;  3EUH C;  2HQ5 A;  3Q9V A;  5HS8 A;  2V7F A;  3OSG A;  1B72 B;  3H5A A;  5CPR B;  2WAF A;  3RPU A;  1O3Q A;  3DP7 A;  4B43 A;  1ZAR A;  3CES A;  4R1H A;  1ODD A;  2ECC A;  4HLY A;  1ZRD A;  1RIO H;  3FIW A;  3FK6 A;  1R9T J;  1O7F A;  2ME0 A;  2AS5 F;  5F0C A;  1FSE A;  2E5Z A;  1FTZ A;  2KRC A;  2OCE A;  2R7O A;  2DJI A;  1ZK8 A;  2VQL A;  3ZQH A;  2DFE A;  5EDN A;  3H92 A;  1F1Z A;  4M3B A;  2L9R A;  2A69 F;  4PFO A;  4D7N A;  2RNJ A;  4MGR A;  2JA7 J;  3T0Y A;  1IZ1 A;  4WXD A;  4IKF A;  3S2D J;  1JXS A;  4I76 A;  4AID A;  5EEG A;  3MKY B;  3WE2 A;  2CH0 A;  3GYH X;  2X6O A;  2G9W A;  3S1M J;  3OIP A;  4G94 A;  1B9M A;  2DQL A;  4M71 A;  2FOK A;  4H4K C;  2CQN A;  2L4M A;  1NG6 A;  1A04 A;  2J5P A;  5K7F A;  2Z3Y A;  1AWC A;  3LST A;  4JP0 A;  2P5L C;  3A2K A;  1BI0 A;  1GV5 A;  3IHU A;  3NAR A;  5F08 A;  2EJR A;  1SVL A;  2PN6 A;  2C6Y A;  4PUS A;  5LGT A;  3CTA A;  4O5V A;  2ISZ A;  2ZNZ A;  4R8H A;  4PFP A;  2MC3 A;  3PUF A;  2KIU A;  2BY3 A;  1PYV A;  2D2W A;  5TJJ A;  3BR3 A;  1ONV A;  2DMU A;  3W6K B;  2HTJ A;  2M1B A;  1Y6I A;  3WTZ A;  3BLY A;  3I58 A;  2LC2 A;  1ETX A;  5KAF C;  4E7J A;  1O7L A;  1IDZ A;  1U5T C;  4F7Z A;  2JJ7 A;  2ZBK A;  2R7T A;  4F92 B;  3H3V K;  5BNG A;  1IUF A;  4UVB A;  3C1D A;  2L02 A;  1YYV A;  3SZT A;  4NDL A;  3TBI A;  2IAI A;  2OC6 A;  2QBY A;  4X6A J;  3TO6 A;  1WKM A;  2B0L A;  3OYJ A;  2WA0 A;  5C44 J;  2OF7 A;  1RUO A;  3HYI A;  1OKR A;  2KIQ A;  3CCY A;  1ZG5 A;  4BY7 J;  5HOD A;  3OYK A;  1JKR C;  2UZK A;  1XB4 A;  2E5N A;  2ESN A;  3BTJ A;  3GFM A;  3SEZ A;  1BR1 A;  4PJN A;  3J7Y J;  1XMA A;  1NK2 P;  4PJL A;  2CG4 A;  4CHU A;  2VLA A;  2HOA A;  2QBY B;  1TWG J;  2VL8 A;  3S16 J;  2HS5 A;  4AVZ A;  1R1U A;  3U1D A;  3KP2 A;  3ABL H;  4LIT A;  3BG3 A;  2X1E A;  5IYB J;  2RV8 A;  4XLA A;  5GTI C;  2ZJR F;  3ROU A;  3BQZ A;  1MBK A;  1Q1H A;  3H5R A;  3QAH A;  4GO1 A;  1W5T A;  1X1B A;  3HOT A;  2KIF A;  2OQG A;  3PNT A;  4HLX A;  1ZTR A;  3PO2 J;  3CJQ B;  2Z99 A;  2V1N A;  3H9J A;  3WG7 H;  1OYW A;  1NHA A;  1Z6R A;  2DK5 A;  2HOT A;  1X3U A;  3DPT A;  5F0F A;  1ULY A;  1VFC A;  5H2F C;  1HOM A;  1WJD A;  2Q1Z B;  3JAM K;  3CDI A;  5M5Y J;  3HOU J;  1LEA A;  1QPM A;  3C2H A;  4KIC A;  3S3N A;  1ORK A;  1O3R A;  2IPQ X;  5FB2 A;  3G71 I;  3JTG A;  3I71 A;  1W36 C;  3BY6 A;  2V6C A;  2MFZ A;  2KRF A;  4CO8 A;  2GA2 A;  3M8E A;  1YIJ I;  3TQN A;  4EV0 A;  3WTX C;  2LRE A;  3QPH A;  2O0Y A;  3SEQ A;  3HBL A;  4BQA A;  1S8N A;  2WAQ N;  1VND A;  4YIF A;  2OCC H;  5L3E A;  5DUI A;  2DTR A;  1IC8 A;  1SMT A;  2DMN A;  1PVE A;  3F9K A;  3C2B A;  1TTY A;  2DK8 A;  3CCQ I;  1RC9 A;  1GVD A;  3HOX J;  5CJ9 A;  3HPH A;  2XRN A;  2AXT C;  5EZG A;  3OYA A;  3EET A;  3M1E A;  1H8A C;  1T0F A;  1OCZ H;  2R7R A;  4A0Y A;  2M34 A;  4WF2 A;  4OAY A;  1I6H J;  4BDZ A;  3RI4 A;  2QQ8 A;  2RNG A;  3CCJ I;  4XRS A;  1T38 A;  4NQW A;  1MJB A;  2FRH A;  4AIJ A;  2LY9 A;  2R5Z A;  4CZC A;  2XGE A;  2R7V A;  3PIP F;  4OMZ A;  1ZYR F;  3ZXS A;  4BHB A;  2PFB A;  1MGT A;  3OYM A;  4XRS G;  2P5V A;  1T33 A;  2LSO A;  5FGM A;  3ZQF A;  3OYG A;  3TO9 A;  4UNO A;  3I4N J;  5B66 C;  2VPL A;  2R5Z B;  2FA5 A;  3GO5 A;  3CD6 I;  1YOV B;  2DA6 A;  3AG3 H;  4CCN A;  1MJA A;  1D1C A;  1X3Z B;  3GTM J;  2VOD A;  1OR7 C;  1CGP A;  1ENH A;  1YX5 A;  1IV8 A;  3BDD A;  3CCV I;  4PGH A;  1USS A;  2R7W A;  1RKT A;  4BQQ A;  1G3Y A;  5A2Q Z;  1A36 A;  9ANT A;  4P55 A;  1WH5 A;  2HR3 A;  4PSX A;  2NVU B;  5AIQ A;  2E36 A;  2B63 J;  4XLE A;  1S6L A;  1YG2 A;  1Y8Q B;  1U0J A;  2Z5U A;  5CVR A;  2ZCW A;  2OAZ A;  2DOA A;  4BU2 A;  1H0M A;  5LGN A;  4I2O A;  1VQ5 I;  4UUV A;  3A01 B;  4XLF A;  1IF1 A;  2QVO A;  1UG2 A;  3BQY A;  4U7B A;  3I55 I;  2LBF A;  2QLZ A;  5HLH A;  2E2I J;  4BE0 A;  1ZR2 A;  2HDC A;  2CFX A;  3OOP A;  1HKT A;  2RGV A;  1GVJ A;  5JHF A;  2F4I A;  3RJP A;  3J7A O;  4RM3 A;  3ECO A;  1IV6 A;  2WTE A;  1V55 H;  1TZL A;  4DZJ A;  3G6E I;  2LBF B;  3GTQ J;  1Y8R B;  4MHG A;  1TWA J;  4C3J J;  3K9T A;  1VQL I;  1I1S A;  3FBI B;  2QM3 A;  2F5V A;  4Z2Y A;  4XIC A;  3DF8 A;  2FML A;  3HOV J;  3GTJ J;  3O6B B;  3CCU I;  3FK7 A;  1BL0 A;  4CYD A;  4ETS A;  3F8N A;  2EQR A;  2KZV A;  1R7J A;  2M7B A;  3H3Z A;  1F9N A;  3MQ0 A;  4RBO A;  3J81 Z;  2LFB A;  4L0Y B;  5FRN A;  3ZQ7 A;  3AG4 H;  2HYF A;  3E97 A;  1IRX A;  2HVR A;  1BI2 A;  1MSE C;  3KYC B;  4C2M J;  3H9G A;  4ITV A;  4EVI A;  1MIJ A;  2QQB A;  1ZKG A;  2P5K A;  2VC1 A;  4Z6Y A;  5M3F J;  5J1U A;  5M5W J;  5JFR A;  1GXQ A;  5J3L A;  4UVA A;  3OMY A;  4ZC3 A;  2IS4 A;  3KEO A;  4BHC A;  2L5Q A;  5J40 A;  1B4A A;  4QTR A;  4DNC A;  1ETV A;  2VIX A;  2OPT A;  1FP1 D;  1KON A;  2FUG 2;  4LIU A;  4K2E A;  3G4S I;  2ME6 A;  3AL0 B;  2IVM A;  1MW7 A;  5CQE A;  4ENJ A;  1F43 A;  3IAM 2;  3CUO A;  4AD9 A;  1P92 A;  2GAU A;  4J19 A;  1UZC A;  1HW2 A;  3BPX A;  1E17 A;  4ENN A;  1S3J A;  3T8R A;  3OYN A;  2TDX A;  1A6Q A;  2EBI A;  4WK8 F;  3KYL A;  3CME I;  4A3D J;  1MSF C;  1QU3 A;  3E6B A;  3MAJ A;  4BNC A;  1YW9 A;  2OU2 A;  3M3Y J;  2LR8 A;  1MH3 A;  5HNF A;  2UXN A;  1KU2 A;  1YE9 A;  3ONQ A;  3P7N A;  4LFU A;  2DMP A;  2QQ9 A;  4Y7N J;  4MTD A;  2DTZ A;  1UFM A;  5E3L A;  2LY1 A;  2ELJ A;  2NYX A;  3K1M A;  4KDP A;  2P7C B;  1W7P A;  2FF4 A;  3MMY B;  3K4J A;  2I8D A;  2E2H J;  2CUJ A;  2MA3 A;  4YII A;  3N4M A;  2ID3 A;  2HKO A;  1KQ0 A;  4ZTJ A;  1TL8 A;  2DFH A;  2XF6 A;  1A6I A;  3RQI A;  3L7W A;  1IRZ A;  2JA5 J;  5FKM A;  2P4W A;  2CV0 A;  2Q0O A;  5K5O A;  3QP6 A;  5FJ8 J;  2VBX A;  3DKX A;  3LSM A;  1N77 A;  4CGZ A;  1W7P B;  1AKH A;  2YU9 J;  3FF5 A;  2M5W A;  5HS9 A;  1ZRF A;  2O8K A;  4ZZL A;  3EUH A;  2OQR A;  3ASO H;  1YJN I;  1YW7 A;  3IAS 2;  3VFZ A;  3JRB A;  3H35 A;  1IG7 A;  4II2 A;  3E6D A;  2A5Y B;  1G8X A;  1C0W A;  1A35 A;  3W2A A;  4S04 A;  5ILS A;  4XRF A;  3LSP A;  2ZNY A;  1AKH B;  3RZD J;  2E71 A;  3FX3 A;  2LY2 A;  3WGG A;  3MZH A;  4IRG A;  1MZB A;  1FMV A;  2MBF A;  3VOD A;  2K9M A;  1OIS A;  2R7F A;  3Q5F A;  2H6C A;  1WQ2 A;  3MKL A;  2K27 A;  2VB6 A;  3O2P E;  3L2W A;  2DYR H;  4BH9 A;  3ML6 A;  2FBH A;  4KN7 X;  2XC7 A;  2M9H A;  1R1T A;  4TV7 A;  2JSP A;  2AXL A;  1X1A A;  4A3M J;  2ZME A;  1S72 I;  3HRT A;  1FSH A;  2STW A;  1LDJ A;  1EH6 A;  4N9H A;  4IXA A;  1IW7 F;  4HV6 A;  2EFP A;  2VE8 A;  2BV6 A;  1HXD A;  3QPL A;  3HL2 A;  3S3O A;  3MWM A;  3OYF A;  3LSJ A;  3K4C A;  1UEL B;  3CUQ A;  3M1C A;  2GM4 A;  5E17 F;  3F0C A;  4RB1 A;  2ZME B;  3KFW X;  2HI3 A;  3VYU B;  4KUM A;  4E4H A;  1F36 A;  1JJ6 C;  5H6R A;  4EJT A;  1FP2 A;  3I4M J;  1X4O A;  4U0V A;  5FLV A;  2AQE A;  5DCF A;  2X6X A;  3RYR A;  3V42 A;  2E1C A;  4BJ5 C;  1ZAO A;  3WHB A;  1SD4 A;  1WGX A;  3CUQ B;  3U9G A;  1XG1 A;  2CGP A;  1XSD A;  4A3K J;  2NXN B;  3WTS C;  3DTI A;  2ZXW H;  1X58 A;  2D45 A;  3OS0 A;  1YQA A;  1J59 A;  3LFU A;  2TRT A;  3CJN A;  1XD7 A;  1WH7 A;  4HBL A;  2E35 A;  3DCF A;  1ZRC A;  2A68 F;  1ETW A;  3RTR A;  2EZL A;  2JPB A;  1FYK A;  2K9N A;  2X51 A;  5J1Y A;  2Z33 A;  1JTY A;  2MYS A;  2VBZ A;  3EQL F;  2ISY A;  4HNV A;  3WTV C;  5E1Z B;  5JI6 A;  3ZMU A;  5K7H A;  2B9S A;  1HC8 A;  4P9U A;  1LNW A;  2PMU A;  3O3K A;  2CMP A;  5E20 A;  4LG0 A;  3MKW B;  1YO5 C;  3GFJ A;  2RQQ A;  2QEX I;  4U88 A;  1E2X A;  2V26 A;  3QQA A;  1OCC H;  3AFH A;  3OR1 C;  4XON A;  5KK1 A;  4ZH4 F;  2JSC A;  3K1N A;  1GXP A;  4CZZ A;  5FLX K;  3HUG A;  4HF2 A;  1XMK A;  4M9S A;  2F4O B;  3OOU A;  4JX6 A;  1Y56 A;  2VBW A;  5IT3 A;  4BBR J;  4M6X A;  3ISP A;  4IOA F;  4RS8 A;  1KU7 A;  4LG0 B;  1S29 A;  2QEN A;  4MFE A;  1TLH B;  1JKQ C;  2VQC A;  2RRE A;  3HUG B;  3H1C A;  5LRR A;  1ETY A;  1K83 J;  3HG9 A;  3A03 A;  4XOR A;  4D5F A;  5LEJ A;  2EZH A;  1IXR C;  2E1N A;  4IHX A;  5J6X A;  3S17 J;  4EGY A;  2IS6 A;  2XVC A;  5KAI C;  1TQI A;  4XN3 A;  3VYT B;  5HLG A;  1QBJ A;  4A3J J;  2O61 A;  1BW5 A;  2MC4 A;  4A3G J;  2CV1 A;  2XAJ A;  3GCM A;  2FNP A;  1HW1 A;  4FT8 A;  4HNT A;  2DBB A;  1LUJ B;  4NUB A;  5LHH A;  1SMY F;  2V1X A;  4L9J A;  1ZRE A;  5J47 A;  1PP8 F;  3OY9 A;  4IRH A;  4LLG F;  1I5Z A;  2K86 A;  2E19 A;  3D5S C;  3F6O A;  3S2W A;  5B1A H;  4Y4R A;  3BJA A;  1JGS A;  2XAF A;  3GTG J;  4PCQ A;  3BOQ A;  1Z77 A;  3ABM H;  1D0Z A;  2K5C A;  1B59 A;  4PJJ A;  5LHG A;  5C4J J;  1JHH A;  3F8B A;  2X6W A;  2CWE A;  3WTU C;  4D9J A;  2PEX A;  2H94 A;  3ZQG A;  4IHS A;  4XKW A;  1OFC X;  2Y31 A;  4ZYE A;  1ZR4 A;  2YR2 A;  3IRR A;  2QSH X;  1IXS B;  3R61 A;  3WG9 A;  2W48 A;  5ED4 A;  5CVJ A;  3CCR I;  5ICC A;  3CLQ A;  4CDG A;  3I53 A;  3ASN H;  1EV7 A;  2H8W A;  2BY2 A;  2QGU A;  3RPU D;  3UKG A;  1UHM A;  1MMA A;  5D6F A;  4E70 A;  3HIF A;  2Y2Z A;  2RC4 A;  3MKZ A;  1P4W A;  2F5E A;  2ETH A;  2NVX J;  1AOY A;  1CF7 A;  4PZJ A;  3QOD A;  4HRI A;  4MQV A;  5D6E A;  4A0Z A;  5LLQ A;  3U21 A;  3CCS I;  4G7H F;  3QP5 A;  1ON2 A;  2WB1 A;  1QRY A;  2K7L A;  3F23 A;  3MZY A;  2R5Y A;  2AQF A;  3HKZ A;  3E5U A;  1CF7 B;  3E5X A;  5CVV A;  1G6N A;  3BTC A;  3PL8 A;  3HOY J;  1KYW A;  4BYY A;  2JZY A;  3RQ4 A;  3ERE D;  4KA4 A;  1QO0 D;  3K4M A;  2JQ7 A;  3FXJ A;  1BW6 A;  4GXO A;  1EF4 A;  3CC4 I;  2R5Y B;  4DYR A;  3GZ5 A;  2Q2E A;  1I50 J;  3CLO A;  3G3Z A;  1SVM A;  3QOP A;  2YU3 A;  2L7K A;  2FQ4 A;  3MVP A;  4B3X A;  4DYC A;  4F52 A;  4EAT A;  4IHV A;  3QPT A;  2Z1D A;  1VQM I;  2BW3 B;  2Q2E B;  4NB5 A;  4HQE A;  1J2X A;  1QA6 A;  4IHY A;  4KIS A;  2YUS A;  1MNE A;  1ACI A;  1SFK A;  3EDP A;  1GHC A;  4A5N A;  4U0Y A;  2H6B A;  4Y17 A;  1SC7 A;  1FWZ A;  4BXX J;  1ZGJ A;  4M3D A;  3VYR B;  1XPX A;  2MSY A;  4B44 A;  2A6T A;  2V6E A;  1YLF A;  4RB3 C;  3P9K A;  2A07 F;  1X2N A;  4DGW B;  2P6S A;  4XK4 A;  4KYW A;  4A6D A;  2PG4 A;  2K3F A;  3DBR B;  2VQG A;  1WPK A;  3FM3 A;  1WJB A;  1I3A A;  2QYO A;  5L3B A;  3KZZ A;  2DO7 A;  2DI3 A;  2QCO A;  1VQK I;  3CQZ J;  3O8G A;  5E1X A;  4KNY A;  2JMW A;  2MD5 A;  4C2T A;  5F1J A;  2YS9 A;  3A1Y A;  3FIS A;  4A3F J;  4BE1 A;  1TQP A;  5B3S H;  2A05 A;  2WB1 N;  1WJA A;  2DA5 A;  4LJZ F;  3EPZ A;  1TT5 B;  5BQT A;  3QWL A;  3HKZ N;  4A12 A;  1MBJ A;  4JOM A;  2Q8K A;  2NAZ A;  1Y1W J;  4FET A;  1OCR H;  4I0B A;  2OZ6 A;  3T5X A;  5D4S A;  1QNT A;  4L5J A;  3BTL A;  4J01 A;  3RDI A;  4L18 B;  2LTP A;  3OS2 A;  3RPQ A;  2GBY A;  1FOX A;  1IN6 A;  1JT6 A;  1TWH J;  3CJT B;  3HZJ A;  1DQU A;  3IP4 B;  2NRA C;  2KHM A;  1AA7 A;  3GFL A;  3H9Q A;  1Z3Y A;  1V5E A;  2E7W A;  2DFI A;  3HEF A;  3RKY A;  2EWN A;  3ABK H;  4W1U A;  3KE2 A;  3C2G A;  1SAX A;  5FD5 A;  1X4P A;  3U1K A;  2IP2 A;  1KA8 A;  2W1O A;  3ESW B;  3SQN A;  1EH8 A;  1TNT A;  1MMG A;  4D1Q A;  3GX4 X;  2HQR A;  5HLI A;  3F6V A;  3WU2 C;  4LMY A;  3BRO A;  1BOB A;  3ZCO A;  1K4S A;  5DV5 A;  3TED A;  4YRV A;  2KDZ A;  2R7S A;  4RGS A;  1WJF A;  1R5G A;  3V8J A;  3OSF A;  4EJO A;  4I99 C;  2P0W A;  4XMY A;  5J1R A;  3PFY A;  1YJ9 I;  1NH3 A;  1BN5 A;  2MLG A;  2KMU A;  4II3 A;  4PSW A;  3D0S A;  2NNN A;  4CH7 A;  3FXK A;  1LQ1 A;  4G8X A;  3E5Q A;  4X1E A;  3BZ6 A;  3JRH A;  5L3F A;  4RAG A;  3REO A;  4W97 A;  1P4X A;  1KGS A;  2VE9 A;  2CS3 A;  2DFF A;  3BPV A;  1HW5 A;  2M8G X;  4M9Z A;  1O4X A;  4E7K A;  3GTL J;  3WGI A;  2XIG A;  5FFX A;  1HCR A;  3Q0U A;  2KFD A;  2QSG X;  1UB9 A;  4RA2 A;  3IUO A;  1BI3 A;  4F55 A;  1H88 C;  1LB2 A;  3UR3 C;  2KIS A;  3IL2 A;  1SEU A;  4BHP A;  4DW6 A;  1YS6 A;  2K9S A;  2KLO A;  2CUZ A;  1FIA A;  1U9N A;  3NAU A;  1QQI A;  1SFU A;  3K2Z A;  1J7K A;  2QZ8 A;  4U87 A;  4GGG A;  4KIB A;  4KT5 C;  5H6Q A;  3ULQ B;  4LIV A;  2NVT J;  2QKL B;  2EFW A;  2OD5 A;  2YSR A;  4J00 A;  1YW8 A;  4ZYD A;  3S1R J;  2QKM B;  1Z67 A;  1OPC A;  2BE5 F;  1ON1 A;  2O8X A;  4HSR A;  1SAN A;  1WZ2 A;  3C3W A;  5J8C A;  3SFI A;  2L9N A;  2HVQ A;  1XCB A;  2L54 A;  2CW8 A;  3K0L A;  3TOA A;  4OU0 A;  1FJL A;  1BC7 C;  3IWF A;  4KJZ A;  4WXH A;  2COM A;  1Z05 A;  3LAP A;  4WWC A;  4OOI A;  4UV9 A;  3GLL A;  2LLK A;  2DA1 A;  4UY8 I;  2PJR A;  1K78 A;  2VI6 A;  1DP3 A;  3G1O A;  4HOB A;  2NS8 A;  3K6G A;  3E6M A;  2M2E A;  2IW5 A;  3OV8 A;  1UG0 A;  4BE2 A;  2NS0 A;  1HLV A;  1REP C;  1R58 A;  4A3I J;  3KLN A;  5L3D A;  2PJR B;  1IAW A;  2K85 A;  1K78 B;  2W24 A;  2ECB A;  5D5W B;  5ERI A;  1YS7 A;  4FX0 A;  3VOE A;  5LD2 C;  1V5F A;  4MLO A;  4YEJ A;  3WU0 A;  3RKQ A;  1VQP I;  2JUG A;  1S7O A;  3HGG A;  3BZK A;  2HEO A;  3LQR A;  3QYB A;  3Q0W A;  4NQW B;  2BGC A;  2XAH A;  1Z7U A;  1IO2 A;  2COB A;  1IN4 A;  4XL9 A;  2Z9O A;  4HA8 A;  3J7A Y;  1YJW I;  3WGH A;  1DPU A;  2Y75 A;  2DT6 A;  2ZXI A;  2UWM A;  4IZZ A;  1H9T A;  2VOO A;  1T8I A;  1MBH A;  1IRG A;  2R3S A;  3UNG C;  3SZG A;  2EV5 A;  3L2Q A;  4FIS A;  2GA1 A;  2F48 A;  4BGD A;  3BR5 A;  4FE7 A;  1Y39 A;  3DEW A;  1B9N A;  1XN7 A;  4XKB A;  4EM2 A;  3J80 K;  1DU0 A;  3C7J A;  3BCA A;  4P1W A;  3K10 A;  4LLN A;  4PK4 A;  2ZSH B;  4AVP A;  4Y13 A;  2K02 A;  3LA7 A;  1UJ8 A;  2W4S A;  3HHG A;  4FHT A;  4XOT A;  2WBM A;  2FD5 A;  3HOZ J;  2DJN A;  3P5J A;  2OBP A;  2K40 A;  3VPR A;  4AU7 A;  4IQ4 A;  3ZGK A;  3B6A A;  3EYY A;  3VYS B;  3FZV A;  1D8K A;  4C3H J;  4XKV A;  4C9Y A;  2DA2 A;  3VWB A;  2M45 A;  2IA2 A;  2XF5 A;  2ZJP F;  3OL3 A;  1YTY A;  2XB5 A;  1JUS A;  1SD7 A;  3JSO A;  1FBU A;  2ZXH A;  1S5L C;  4FTH A;  1K7A A;  1FNN A;  4KIF A;  4L0Z B;  2FEZ A;  3GXO A;  1X1D A;  2L3D A;  2HZT A;  3LOC A;  2MD0 A;  2CV2 A;  3KYD B;  3IH2 A;  2L01 A;  2ZFW A;  2BHZ A;  4MIM A;  5EJC A;  2DAO A;  4HX4 A;  1E3P A;  2V4J C;  2E1M C;  3AAF A;  5FLX Z;  1LE8 A;  3HOW J;  1OQY A;  2PLY A;  2IGK A;  4NHJ A;  2GXG A;  5HDK A;  4NC7 A;  4CA0 A;  3BWG A;  2Y48 A;  4ESF A;  1VQO I;  2W7N A;  1RNL A;  2GWR A;  2DPU A;  2H1L A;  4RB2 C;  2O7O A;  3F8M A;  4WXC A;  4UV8 A;  1FIP A;  1XS9 A;  2M8E A;  2PI0 A;  1XCV A;  1XDS A;  2VXZ A;  5DYM A;  1T95 A;  3LSR A;  1LE8 B;  3V7S A;  4CUG A;  1V4R A;  1XTA A;  1P4A A;  4ENM A;  3ABU A;  2L7F P;  4IRI A;  2OTJ I;  1N75 A;  3TP0 A;  2D5V A;  3DBH B;  1WJC A;  3I56 I;  3B02 A;  5LBQ A;  5KHD A;  2VJ5 A;  4D5C A;  5M3M J;  2XUB A;  1NK3 P;  1T08 B;  5LFA A;  3HRM A;  5IPA A;  2EFN A;  5BPD A;  4A3B J;  1ERD A;  3CMM A;  5D5X B;  1L3L A;  1R1V A;  1MMS A;  5EYR A;  2EA2 A;  5CKT A;  3IRQ A;  4YFK F;  3GTO J;  2NVY J;  2XGD A;  2DQR A;  4ASN A;  3V7C A;  4DJA A;  3HSF A;  3MZ8 A;  4HF0 A;  2UXX A;  3DBL B;  1MJ9 A;  4L5E A;  3OYI A;  2JK3 A;  2KPM A;  3LAJ A;  5F6F A;  5CQG A;  2LF8 A;  2WWY A;  5DM7 F;  2PJP A;  2PMZ A;  4UB8 C;  1U78 A;  3P9C A;  4G7O F;  3LSI A;  5ICE A;  1OYI A;  3M8F A;  4F91 B;  1SFX A;  4RAZ A;  4A69 C;  1SAU A;  3GFI A;  3QYF A;  3LSH A;  3CO7 C;  5DD8 A;  2IXS A;  3OYL A;  2X9D A;  3CZ6 A;  2DLL A;  3HRS A;  4EEF G;  5FRO A;  2ZO4 A;  5IT9 Z;  2PBI A;  1JJ8 C;  2R93 J;  4ZJZ A;  2NVQ J;  3EUA A;  2W00 A;  3PNV A;  2IT0 A;  5ILU A;  4DIQ A;  2RVC A;  3NRV A;  3PSF A;  4ZZD A;  1JUP A;  5HS7 A;  2G0E A;  3HXL A;  3DEE A;  2R0Q C;  2A6H F;  1AU7 A;  4AM3 A;  5GPA A;  2DYS H;  3Q9S A;  4I02 A;  5DTD A;  3R60 A;  1I27 A;  5EG0 A;  3LFK A;  4RGX A;  5ICF A;  4RGU A;  1JGG A;  3CJR B;  4G7Z F;  2ADU A;  3QU3 A;  3RKX A;  1XSV A;  3BP8 A;  2WY7 Q;  1BI1 A;  3WTW C;  4BDY A;  3SDB A;  4XBF A;  5EG0 B;  3S2H J;  3PO3 J;  4I6Z A;  3SHF A;  2FU4 A;  2JT1 A;  4KIT B;  1FOK A;  4PGG A;  1EJ9 A;  1BA5 A;  4I98 B;  5IOZ A;  1VQ9 I;  1XGM A;  2CUF A;  1GV2 A;  5E18 F;  1LEB A;  3NEU A;  3LMM A;  2XV4 S;  1Z21 A;  1KZH A;  5TIS C;  4YFN F;  4X0G A;  3GTK J;  4U0W A;  3CO6 C;  3OWT A;  3CDH A;  3PSI A;  1WVR A;  2M7A A;  2LKP A;  2CJJ A;  3TMO A;  2KIM A;  2L7M P;  4B09 A;  2DOD A;  4OIR F;  1JKO C;  2GQQ A;  1E3O C;  4JBA A;  2L0K A;  1D1A A;  2PMZ N;  1QHH D;  3U2R A;  2NNY A;  4JQF A;  1R22 A;  1HKS A;  5LGU A;  5D4R A;  1BC8 C;  1D5Y A;  2DMQ A;  2VJJ A;  3K4L A;  2DW4 A;  2JA2 A;  2IJL A;  5BOX A;  4A3L J;  5GPC A;  1RES A;  2LK2 A;  2V79 A;  3S93 A;  3ERM A;  1RPW A;  1TW2 A;  1V3F A;  3BR0 A;  3QYE A;  2W25 A;  3K2A A;  1U5T A;  2ZB9 A;  2UV1 A;  3NQO A;  3E3V A;  3ZN0 A;  4KFC A;  3MN2 A;  3K4N A;  3QU6 A;  1T0F C;  3D5R C;  4ON0 A;  5H20 A;  1IN7 A;  1I3Q J;  3BJ6 A;  4G6D A;  3H36 A;  3CDL A;  2KJC A;  1VQ8 I;  1IRF A;  2HDW A;  3K70 D;  1U5T B;  2BXZ A;  2CUE A;  2W84 A;  2GLO A;  2CFO A;  5IP7 J;  1PDN C;  4LK0 F;  2FOW A;  2PMH A;  4G6Q A;  2R7X A;  3DFG A;  3BCB A;  4YEL A;  3PIO F;  5AON A;  2BY0 A;  2Y9Y A;  5FFZ A;  3OR2 C;  2DA4 A;  2KT0 A;  2R7Q A;  1D1B A;  5D5U B;  4DOZ A;  1PP7 U;  2Z2S B;  2GOX B;  2CO5 A;  2DOF A;  1J5Y A;  2F5C A;  3ECH A;  2X1D A;  3ZOB A;  4JYK A;  2Y0S A;  3W2V A;  1QZY A;  2XKP A;  1WRJ A;  3K4K A;  2X0L A;  1TT0 A;  3WTY C;  1GLN A;  1ZLK A;  2HTS A;  2CSO A;  3VSK A;  3PQJ A;  3GLX A;  2L9S A;  1OCP A;  2R7Z J;  1D0Y A;  4A3E J;  5DM6 F;  2MH9 A;  4XLH A;  1RR7 A;  1HF0 A;  2FNA A;  4HNU A;  3JR9 A;  1VQ6 I;  1R5I D;  3OL4 A;  5B1B H;  5L3C A;  4NC6 A;  3DEU A;  1K61 A;  3F72 A;  3CP8 A;  2CU7 A;  3DV8 A;  2N8G A;  1MND A;  1GDT A;  1HKQ A;  2XSD C;  1R4N B;  2L2O A;  3LWF A;  5BMZ A;  4DBR A;  5KCM A;  4M6Y A;  2A3S A;  2F5F A;  1STZ A;  2KL4 A;  2IGM A;  3DKW A;  1FY7 A;  4C3I J;  4ABZ A;  1F5T A;  4HG2 A;  3SDG A;  3CF5 F;  2JA8 J;  2ELK A;  3OIO A;  1ZH5 A;  2ZXJ A;  1PUF A;  4E7I A;  5IT9 K;  3OYE A;  4O6J A;  1IGN A;  2ZSI B;  4Y3O A;  3CP2 A;  4EJU A;  1QVT A;  3IKV A;  3JRI A;  4BEH A;  2CW0 F;  5AIP A;  2LF7 A;  3JRA A;  1W5C C;  3F3X A;  3RKW A;  4XID A;  2Y9Z A;  3L2U A;  2ZJ2 A;  1PUF B;  3QPS A;  1X1C A;  4OIP F;  2F4M B;  3JTH A;  2X1C A;  1R00 A;  4JX4 A;  2V1D A;  5EGO A;  3F8C A;  4WCG A;  1IN8 A;  4BEH B;  4N4N B;  4A6E A;  3AL0 C;  1ZG3 A;  5DD4 A;  3BJO A;  4XM3 A;  5B5E C;  2Y30 A;  4LGW A;  3DQV C;  3PM1 A;  2VT3 A;  1HBX G;  2D1V A;  1OR7 A;  1TWC J;  1TP4 A;  1MBG A;  3V8K A;  3KEY A;  3DTK A;  4I09 A;  4PJM A;  3IH3 A;  5HOO A;  1QPI A;  4HAM A;  5EGO B;  4ENK A;  4KMU X;  5E8I A;  1FX7 A;  3A4C A;  3X2Q H;  5JR3 A;  4HDV A;  2LKS A;  3FHZ A;  1BIA A;  1UMQ A;  3HHH A;  3FXR A;  3M07 A;  4IVN A;  1BJZ A;  3I59 A;  5ILV A;  4EM0 B;  4ZDL A;  2YPR A;  4M74 A;  2ZFU A;  2WV0 A;  2EIJ H;  4A0X A;  5JVT A;  3CMA I;  2NOG A;  2WV1 A;  3GEZ A;  4GYI A;  2GIV A;  2BEO A;  2LD5 A;  3KP4 A;  4IEJ A;  4LD5 A;  3I0T A;  1LVA A;  2LYC A;  3V4G A;  3DLL F;  4OAZ A;  3TW7 A;  2HXO A;  3F22 A;  1LFP A;  2DA3 A;  3I59 B;  5F64 A;  1MDM A;  2XRO A;  2LH9 A;  2EIK H;  1I1G A;  4XR6 A;  5FKO A;  1TNS A;  1H9G A;  1QHG A;  3GVA A;  4BQO A;  4I7H A;  1FPQ A;  5TRD A;  4RB0 A;  1B8I A;  4DZP A;  1YRN A;  1E3H A;  5K5R A;  4HDU A; 
#chains in the Genus database with same CATH homology
 3VB2 A;  4GYG A;  2ZKZ A;  2EFO A;  1MDM B;  4RGR A;  1F4K A;  1ZLJ A;  1PUE E;  3FMS A;  1UST A;  3ZMS A;  4I0A A;  2K4B A;  1HQC A;  2J5O A;  4XLN F;  1FT9 A;  2QUF A;  4L9T A;  1WSU A;  1FYL A;  1YFH A;  3J80 Z;  1ZG1 A;  3ZP5 A;  4ESJ A;  1ZGA A;  1XGN A;  4CXF A;  4N0B A;  4UHT A;  2W57 A;  5LEK A;  3TKY A;  5D5V B;  3L9F A;  3FMQ A;  2HFH A;  4XSZ F;  3WU1 B;  5D8K B;  3H3U A;  1U6G A;  4QLC U;  3MEX A;  4WX9 A;  3SFZ A;  1IUY A;  1HST A;  3CUQ C;  3R0A A;  1D5V A;  2G7H A;  1I6X A;  3K1P A;  1SD5 A;  2YX7 A;  3G73 A;  4HZF A;  1D8J A;  1BIB A;  1HSJ A;  5KVR A;  3R6S A;  1LJ9 A;  1G3W A;  3WOD F;  2E7X A;  2XAQ A;  3ZMV A;  1FYM A;  3KCC A;  2HKX A;  4OIO F;  4I01 A;  2IRF G;  3EYI A;  1KYZ A;  1BOA A;  4ESB A;  2VT2 A;  3LA2 A;  4LB6 B;  3I4P A;  1XGO A;  4ZYG A;  3KP5 A;  2KJB A;  4P96 A;  1K79 A;  1DPR A;  2IA1 A;  4Q48 A;  1KQ9 A;  1IN5 A;  1TW3 A;  3ZPL A;  2CQK A;  2A61 A;  4L9N A;  4BAY A;  5BPI A;  4EGZ A;  4AIK A;  4EQQ A;  2VC0 A;  2Y0M A;  3FXU A;  2QWW A;  2FQ3 A;  3VEP A;  1FLI A;  1T39 A;  1OYY A;  2RQP A;  5EEH A;  6PAX A;  3N97 A;  1Y0U A;  3KP7 A;  1EH7 A;  2FMY A;  2RKH A;  1RZ4 A;  5CVI A;  3DPL C;  1LDD A;  3GWZ A;  1YIO A;  2A6E F;  1KQ8 A;  5E8G A;  1JHF A;  1B1B A;  2D1H A;  4A5M A;  1DUX C;  4S05 A;  2HYG D;  5D8L B;  1Z91 A;  1DDN A;  3IC7 A;  3IWZ A;  4PDK A;  2F2E A;  2BYV E;  2DU9 A;  2OA4 A;  4L9V A;  2HQN A;  3D5L A;  1ZHF A;  2OZU A;  2GZW A;  2XHK A;  2FE3 A;  3KEQ A;  5FO5 A;  5BS6 A;  3HTU A;  4MNU A;  4OIN F;  4AIH A;  1P6R A;  1JE8 A;  3KP3 A;  4M9X A;  4A2U A;  4FX4 A;  3GZ6 A;  3F21 A;  2VON A;  2HGC A;  4ZYH A;  3V7R A;  2GXB A;  4HW0 A;  1SFE A;  3GF2 A;  5DUK A;  4MQ9 F;  3WTT C;  2MLK A;  1R23 A;  3KZY A;  5E1W A;  3E6C C;  3HOS A;  4HF1 A;  1VTN C;  2X4H A;  3ABT A;  2EK5 A;  3W6J B;  5LHI A;  3IKT A;  1KU3 A;  1W7P D;  2EFQ A;  2P7V B;  1S7A A;  2ELH A;  3KLO A;  5ICG A;  1T98 A;  1MD0 A;  3GUD A;  2JRT A;  1G3T A;  5HDG A;  5K1Y A;  5DEQ A;  4MTE A;  1LDK B;  3L2C A;  3KP6 A;  4IJA A;  4UXN A;  1O3T A;  1T2K A;  4G9Y A;  3R0J A;  1BM9 A;  5JHU A;  1G4D A;  4Q4Z F;  3HTS B;  1WWX A;  4M72 A;  1ZN2 A;  2F5D A;  2M30 A;  2M87 A;  5K5Q A;  1XDU A;  2L4A A;  3L00 A;  4XLP F;  5J8F A;  4IHT A;  2HWV A;  3PFI A;  4KN4 X;  4P5O A;  3ZMZ A;  4D0P A;  3WE3 A;  3RYP A;  4CIC A;  3HSR A;  3FM5 A;  2RN7 A;  3I64 A;  2VN2 A;  1P2F A;  2FBI A;  4Y15 A;  4EMS A;  1RI7 A;  1J0R A;  4OIQ F;  1T6S A;  4Q47 A;  4XSX F;  5FD6 A;  1Z1D A;  1TQM A;  3PQK A;  3JW4 A;  3QRF F;  3HSE A;  3ELK A;  5HVQ C;  3TDU C;  5L3G A;  1G3S A;  3T1B A;  1R36 A;  4KIG A;  4YG2 F;  2EV6 A;  2XAG A;  2FSW A;  1J9I A;  3C18 A;  5LRS A;  2XGX A;  4M73 A;  1UCR A;  1Z6T A;  3GW2 A;  2LNB A;  3P9I A;  1Z9C A;  2ACJ A;  4QWQ A;  4GCV A;  2MH2 A;  1K6O A;  2V9V A;  2H27 A;  2W85 A;  3V8L A;  4MEY F;  5A2Q K;  2VOP A;  4JK1 X;  3FWE A;  1O3S A;  3I5U A;  4HV5 A;  1B6A A;  4MEX F;  2IA0 A;  1XSX A;  4HQM A;  3T8T A;  1U3E M;  3L09 A;  2R7D A;  2PQ8 A;  3FMR A;  3HRU A;  5CYV A;  2O03 A;  4IPA A;  1KU9 A;  4DQ2 A;  3M9A A;  3JSP A;  5DCM A;  4P9F A;  1FBS A;  4HX8 A;  3TOB A;  3MCZ A;  1OMI A;  1DP7 P;  4EJV A;  4LB5 A;  3LQQ A;  3J81 K;  5DCM B;  2FXA A;  1IXC A;  2EV0 A;  3ZMT A;  2YX4 A;  5F1R A;  1U2W A;  3SZP A;  2FBK A;  3ZMD A;  5CLS A;  1UHW A;  3LA3 A;  3B73 A;  2DT5 A;  4LLL A;  2ESH A;  1O57 A;  1FBQ A;  4YFX F;  1L0O C;  1TBX A;  4B8X A;  1FC3 A;  3FXQ A;  5HDN A;  3SXY A;  1R5H A;  2V1U A;  2WC2 A;  4LK1 F;  3R4K A;  5DDG A;  2RDP A;  4HX7 A;  1J75 A;  4R79 A;  4EM1 A;  2H09 A;  3M7G A;  3MFK A;  1U8R A;  4IF4 A;  3RIR A;  3I54 A;  2O6G E;  3TGN A;  1W5S A;  1FZP B;  4O3M A;  2KKO A;  3JAM Z;  2G7U A;  4KMF A;  2DPD A;  3F8F A;  4U7D A;  3KET A;  2P8T A;  1XGS A;  4EJW A;  1QZZ A;  1W4M A;  1MKM A;  2JTV A;  4HYE A;  2HOE A;  3DXJ F;  1BJA A;  4AWX B;  1WI9 A;  1QGP A;  1BBY A;  4OMY A;  2QQA A;  2XKO A;  4Q5S F;  1SD6 A;  2VBY A;  2STT A;  4BXU A;  5CVU A;  3COA C;  4N9I A;  3ZN1 A;  1RUN A;  4H0E A;  3TO7 A;  2O3F A;  2JPC A;  4UVC A;  3K69 A;  4RAY A;  2BBY A;  2EA4 A;  2LDU A;  4L5I A;  2EB7 A;  2CYY A;  2K4J A;  3TDZ C;  1D3Y A;  2P6T A;  2XAS A;  3Q9V A;  5HS8 A;  3RPU A;  1O3Q A;  3DP7 A;  1ZAR A;  4R1H A;  1ODD A;  4HLY A;  1ZRD A;  1RIO H;  1O7F A;  2AS5 F;  1FSE A;  3H92 A;  1F1Z A;  2A69 F;  2RNJ A;  4MGR A;  3T0Y A;  1IZ1 A;  4WXD A;  1JXS A;  5EEG A;  3WE2 A;  3GYH X;  2G9W A;  4G94 A;  1B9M A;  2DQL A;  4M71 A;  2FOK A;  2L4M A;  2J5P A;  1A04 A;  2Z3Y A;  1AWC A;  3LST A;  2P5L C;  1BI0 A;  3IHU A;  2EJR A;  2PN6 A;  2C6Y A;  5LGT A;  3CTA A;  4O5V A;  2ISZ A;  2ZNZ A;  4R8H A;  2MC3 A;  2KIU A;  2D2W A;  5TJJ A;  1ONV A;  3W6K B;  2HTJ A;  2M1B A;  3WTZ A;  3I58 A;  1O7L A;  1U5T C;  4F7Z A;  2ZBK A;  4UVB A;  3C1D A;  2L02 A;  1YYV A;  3SZT A;  2QBY A;  3TO6 A;  1WKM A;  2B0L A;  1RUO A;  3HYI A;  1OKR A;  1ZG5 A;  2UZK A;  1XB4 A;  2ESN A;  3GFM A;  1XMA A;  2CG4 A;  4CHU A;  2QBY B;  2HS5 A;  1R1U A;  3U1D A;  3KP2 A;  2RV8 A;  3ROU A;  1Q1H A;  3QAH A;  4GO1 A;  1W5T A;  3HOT A;  2KIF A;  2OQG A;  4HLX A;  2Z99 A;  1OYW A;  1NHA A;  2DK5 A;  1Z6R A;  1X3U A;  3DPT A;  1ULY A;  3JAM K;  1LEA A;  1QPM A;  4KIC A;  1O3R A;  2IPQ X;  5FB2 A;  3JTG A;  3I71 A;  3BY6 A;  2V6C A;  2KRF A;  4CO8 A;  2GA2 A;  3M8E A;  3TQN A;  4EV0 A;  3WTX C;  3QPH A;  2O0Y A;  4BQA A;  1S8N A;  4YIF A;  5L3E A;  5DUI A;  2DTR A;  1SMT A;  1TTY A;  2DK8 A;  5CJ9 A;  2XRN A;  3EET A;  3M1E A;  1T0F A;  4A0Y A;  4WF2 A;  3RI4 A;  1T38 A;  4NQW A;  1MJB A;  2FRH A;  4AIJ A;  4OMZ A;  1ZYR F;  4BHB A;  2PFB A;  1MGT A;  2P5V A;  2LSO A;  5FGM A;  3TO9 A;  4UNO A;  2FA5 A;  3GO5 A;  1MJA A;  2VOD A;  1CGP A;  3BDD A;  4PGH A;  1USS A;  5A2Q Z;  1G3Y A;  4P55 A;  2HR3 A;  5AIQ A;  1S6L A;  1YG2 A;  2Z5U A;  5CVR A;  2ZCW A;  2OAZ A;  1H0M A;  5LGN A;  4I2O A;  4UUV A;  1IF1 A;  2QVO A;  4U7B A;  2QLZ A;  5HLH A;  2HDC A;  2CFX A;  3OOP A;  1HKT A;  2RGV A;  1GVJ A;  3RJP A;  3J7A O;  3ECO A;  2WTE A;  4MHG A;  3K9T A;  1I1S A;  2QM3 A;  4Z2Y A;  3DF8 A;  2FML A;  3O6B B;  4CYD A;  4ETS A;  3F8N A;  1R7J A;  3H3Z A;  1F9N A;  3MQ0 A;  3J81 Z;  4L0Y B;  3ZQ7 A;  3E97 A;  2HYF A;  1BI2 A;  4EVI A;  2QQB A;  2P5K A;  2VC1 A;  5JFR A;  1GXQ A;  4UVA A;  3KEO A;  4BHC A;  1B4A A;  4DNC A;  1FP1 D;  4K2E A;  2IVM A;  4ENJ A;  3CUO A;  4AD9 A;  1P92 A;  2GAU A;  1HW2 A;  3BPX A;  1E17 A;  4ENN A;  1S3J A;  3T8R A;  2TDX A;  4WK8 F;  3E6B A;  3MAJ A;  4BNC A;  1YW9 A;  2OU2 A;  2UXN A;  1KU2 A;  3P7N A;  4LFU A;  2QQ9 A;  4MTD A;  1UFM A;  2NYX A;  3K1M A;  4KDP A;  2P7C B;  1W7P A;  2FF4 A;  2MA3 A;  4YII A;  3N4M A;  2HKO A;  1KQ0 A;  3L7W A;  2P4W A;  2Q0O A;  5K5O A;  3QP6 A;  2VBX A;  4CGZ A;  1W7P B;  3FF5 A;  2M5W A;  5HS9 A;  1ZRF A;  4ZZL A;  3EUH A;  2OQR A;  1YW7 A;  3VFZ A;  3E6D A;  2A5Y B;  1C0W A;  4S04 A;  5ILS A;  4XRF A;  2ZNY A;  3FX3 A;  3WGG A;  3MZH A;  4IRG A;  1MZB A;  2MBF A;  3VOD A;  3Q5F A;  2R7F A;  2H6C A;  1WQ2 A;  2K27 A;  3O2P E;  4BH9 A;  3ML6 A;  2FBH A;  4KN7 X;  1R1T A;  4TV7 A;  2AXL A;  2ZME A;  3HRT A;  1FSH A;  2STW A;  1LDJ A;  1EH6 A;  4N9H A;  4IXA A;  1IW7 F;  4HV6 A;  2EFP A;  2VE8 A;  2BV6 A;  1HXD A;  3MWM A;  3CUQ A;  5E17 F;  4RB1 A;  2ZME B;  3KFW X;  4KUM A;  5H6R A;  4EJT A;  1FP2 A;  4U0V A;  5DCF A;  3RYR A;  2E1C A;  1ZAO A;  1SD4 A;  3CUQ B;  3U9G A;  2CGP A;  1XSD A;  3WTS C;  2D45 A;  1YQA A;  1J59 A;  3CJN A;  1XD7 A;  4HBL A;  1ZRC A;  2A68 F;  3RTR A;  2JPB A;  1FYK A;  2Z33 A;  3EQL F;  2VBZ A;  2ISY A;  3WTV C;  5E1Z B;  5JI6 A;  3ZMU A;  4P9U A;  1LNW A;  2PMU A;  4LG0 A;  3O3K A;  5E20 A;  1YO5 C;  3GFJ A;  4U88 A;  1E2X A;  5KK1 A;  4ZH4 F;  2JSC A;  3K1N A;  1GXP A;  4CZZ A;  5FLX K;  3HUG A;  4HF2 A;  1XMK A;  4M9S A;  2VBW A;  5IT3 A;  4M6X A;  3ISP A;  4RS8 A;  1KU7 A;  4LG0 B;  1S29 A;  2QEN A;  1TLH B;  5LRR A;  5LEJ A;  1IXR C;  2E1N A;  5J6X A;  4EGY A;  2XVC A;  1TQI A;  5HLG A;  1QBJ A;  2O61 A;  2XAJ A;  2FNP A;  1HW1 A;  4FT8 A;  2DBB A;  5LHH A;  1SMY F;  2V1X A;  4L9J A;  1ZRE A;  1PP8 F;  4IRH A;  4LLG F;  1I5Z A;  2K86 A;  3F6O A;  3S2W A;  3BJA A;  1JGS A;  2XAF A;  4PCQ A;  3BOQ A;  1B59 A;  5LHG A;  1JHH A;  3F8B A;  2CWE A;  3WTU C;  2PEX A;  2H94 A;  4IHS A;  4ZYE A;  2YR2 A;  3IRR A;  1IXS B;  3R61 A;  3WG9 A;  5ED4 A;  5CVJ A;  5ICC A;  4CDG A;  3I53 A;  1EV7 A;  1UHM A;  5D6F A;  4E70 A;  3HIF A;  2RC4 A;  1P4W A;  2F5E A;  2ETH A;  1AOY A;  1CF7 A;  4PZJ A;  4MQV A;  5D6E A;  4A0Z A;  5LLQ A;  4G7H F;  3QP5 A;  1ON2 A;  2K7L A;  3F23 A;  3MZY A;  3E5U A;  1CF7 B;  3E5X A;  5CVV A;  1G6N A;  1KYW A;  4BYY A;  2JZY A;  3ERE D;  4KA4 A;  1QO0 D;  4GXO A;  3GZ5 A;  2Q2E A;  3CLO A;  3G3Z A;  3QOP A;  2YU3 A;  3QPT A;  4NB5 A;  4HQE A;  1J2X A;  3EDP A;  1GHC A;  4A5N A;  4U0Y A;  2H6B A;  4Y17 A;  1FWZ A;  1ZGJ A;  1YLF A;  4RB3 C;  3P9K A;  2A07 F;  2P6S A;  4KYW A;  4A6D A;  2PG4 A;  3FM3 A;  2QYO A;  5L3B A;  3KZZ A;  2DO7 A;  2DI3 A;  4KNY A;  5E1X A;  2MD5 A;  1TQP A;  4LJZ F;  5BQT A;  4A12 A;  2Q8K A;  2NAZ A;  4I0B A;  2OZ6 A;  3T5X A;  5D4S A;  1QNT A;  4L5J A;  3RDI A;  4L18 B;  3RPQ A;  1IN6 A;  2NRA C;  3GFL A;  2E7W A;  2DFI A;  3RKY A;  2EWN A;  1SAX A;  3KE2 A;  5FD5 A;  2IP2 A;  1KA8 A;  3SQN A;  1EH8 A;  1TNT A;  3GX4 X;  2HQR A;  5HLI A;  3F6V A;  4LMY A;  3BRO A;  5DV5 A;  4RGS A;  1R5G A;  3V8J A;  4EJO A;  1BN5 A;  2MLG A;  3D0S A;  2NNN A;  1LQ1 A;  4G8X A;  3E5Q A;  3BZ6 A;  5L3F A;  3REO A;  1P4X A;  1KGS A;  2VE9 A;  3BPV A;  1HW5 A;  4M9Z A;  3WGI A;  2XIG A;  5FFX A;  1UB9 A;  1BI3 A;  1LB2 A;  3IL2 A;  4BHP A;  1YS6 A;  1QQI A;  1SFU A;  3K2Z A;  1J7K A;  2QZ8 A;  4GGG A;  4KIB A;  4KT5 C;  5H6Q A;  3ULQ B;  2EFW A;  2OD5 A;  2YSR A;  1YW8 A;  4ZYD A;  2O8X A;  1OPC A;  2BE5 F;  1ON1 A;  3C3W A;  5J8C A;  2L54 A;  1XCB A;  3K0L A;  3TOA A;  4OU0 A;  1BC7 C;  3IWF A;  4WXH A;  2COM A;  1Z05 A;  3LAP A;  4WWC A;  4OOI A;  4UV9 A;  1K78 A;  4HOB A;  3E6M A;  2IW5 A;  3OV8 A;  2NS0 A;  1REP C;  1R58 A;  3KLN A;  5L3D A;  1IAW A;  1K78 B;  2W24 A;  5D5W B;  5ERI A;  1YS7 A;  4FX0 A;  3VOE A;  3WU0 A;  1S7O A;  2HEO A;  3LQR A;  2BGC A;  2XAH A;  1Z7U A;  2Z9O A;  1IN4 A;  1DPU A;  4HA8 A;  3WGH A;  2Y75 A;  2UWM A;  1H9T A;  2VOO A;  1IRG A;  2R3S A;  2EV5 A;  2GA1 A;  1B9N A;  1XN7 A;  4EM2 A;  3J80 K;  3C7J A;  4LLN A;  4AVP A;  4Y13 A;  2K02 A;  3LA7 A;  3HHG A;  4FHT A;  2OBP A;  3EYY A;  3FZV A;  1D8K A;  2M45 A;  2IA2 A;  1YTY A;  1SD7 A;  3JSO A;  1FBU A;  1K7A A;  1FNN A;  4KIF A;  4L0Z B;  2FEZ A;  3GXO A;  2L3D A;  2HZT A;  2L01 A;  2ZFW A;  2DAO A;  4HX4 A;  3AAF A;  5FLX Z;  2PLY A;  4NHJ A;  2GXG A;  5HDK A;  4ESF A;  3BWG A;  2Y48 A;  1RNL A;  2GWR A;  2DPU A;  4RB2 C;  3F8M A;  4WXC A;  4UV8 A;  2M8E A;  2PI0 A;  1XCV A;  1XDS A;  2VXZ A;  5DYM A;  3V7S A;  1V4R A;  1P4A A;  4ENM A;  3ABU A;  4IRI A;  3B02 A;  5LBQ A;  2XUB A;  3HRM A;  2EFN A;  5BPD A;  5D5X B;  1L3L A;  1R1V A;  2EA2 A;  3IRQ A;  4YFK F;  2DQR A;  4ASN A;  3V7C A;  3HSF A;  4HF0 A;  2UXX A;  1MJ9 A;  3LAJ A;  5F6F A;  2LF8 A;  2WWY A;  2PJP A;  1U78 A;  3P9C A;  4G7O F;  5ICE A;  1OYI A;  3M8F A;  1SFX A;  4RAZ A;  3GFI A;  3CO7 C;  5DD8 A;  2DLL A;  3HRS A;  2ZO4 A;  5IT9 Z;  2PBI A;  2IT0 A;  5ILU A;  2RVC A;  3NRV A;  4ZZD A;  5HS7 A;  2A6H F;  3Q9S A;  4I02 A;  3R60 A;  1I27 A;  3LFK A;  4RGX A;  5ICF A;  4RGU A;  4G7Z F;  2ADU A;  3QU3 A;  3RKX A;  1XSV A;  3BP8 A;  1BI1 A;  3WTW C;  4XBF A;  3SHF A;  2FU4 A;  2JT1 A;  1FOK A;  4PGG A;  4I98 B;  1XGM A;  5E18 F;  1LEB A;  3NEU A;  2XV4 S;  4YFN F;  4U0W A;  3CO6 C;  3CDH A;  2LKP A;  2KIM A;  4B09 A;  4OIR F;  2GQQ A;  4JBA A;  3U2R A;  2NNY A;  4JQF A;  1R22 A;  1HKS A;  5LGU A;  5D4R A;  1BC8 C;  2DW4 A;  2IJL A;  5BOX A;  2V79 A;  1TW2 A;  1V3F A;  2W25 A;  1U5T A;  3NQO A;  3E3V A;  3ZN0 A;  4KFC A;  3QU6 A;  4ON0 A;  5H20 A;  1IN7 A;  3BJ6 A;  4G6D A;  2KJC A;  1IRF A;  1U5T B;  2W84 A;  1PDN C;  4LK0 F;  2PMH A;  4G6Q A;  3DFG A;  5AON A;  5FFZ A;  5D5U B;  1PP7 U;  2CO5 A;  1J5Y A;  2F5C A;  3ECH A;  1QZY A;  2XKP A;  1WRJ A;  2X0L A;  3WTY C;  1ZLK A;  2HTS A;  2CSO A;  3PQJ A;  3GLX A;  2MH9 A;  2FNA A;  5L3C A;  3DEU A;  3F72 A;  3DV8 A;  1HKQ A;  3LWF A;  5BMZ A;  4M6Y A;  2A3S A;  2F5F A;  1STZ A;  3DKW A;  1FY7 A;  1F5T A;  1ZH5 A;  2ZXJ A;  5IT9 K;  4O6J A;  4EJU A;  3IKV A;  2CW0 F;  5AIP A;  2LF7 A;  3F3X A;  3RKW A;  2ZJ2 A;  4OIP F;  3JTH A;  1R00 A;  2V1D A;  3F8C A;  4WCG A;  1IN8 A;  4A6E A;  1ZG3 A;  5DD4 A;  3BJO A;  4LGW A;  3DQV C;  2VT3 A;  1HBX G;  2D1V A;  1OR7 A;  3V8K A;  4I09 A;  5HOO A;  4HAM A;  4ENK A;  4KMU X;  5E8I A;  1FX7 A;  4HDV A;  5JR3 A;  3FHZ A;  1BIA A;  3HHH A;  3FXR A;  4IVN A;  3I59 A;  5ILV A;  4EM0 B;  2YPR A;  4M74 A;  2WV0 A;  4A0X A;  5JVT A;  3GEZ A;  4GYI A;  2GIV A;  2BEO A;  3KP4 A;  4LD5 A;  3I0T A;  1LVA A;  3V4G A;  3F22 A;  3I59 B;  5F64 A;  1MDM A;  2XRO A;  1I1G A;  1TNS A;  1H9G A;  3GVA A;  5TRD A;  4I7H A;  1FPQ A;  4RB0 A;  5K5R A;  4HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...