4RS8A

Apo structure of novel pnob8 plasmid centromere binding protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
84
structure length
84
Chain Sequence
YIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQMATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Dna binding protein
total genus 30
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rs8A00
2H27A 2M8EA 4M9XA 3F8CA 3E6CC 1IZ1A 1REPC 4AIHA 2ESHA 4UVBA 1XSVA 4A12A 2V9VA 3LQQA 2V79A 4CZZA 3WTXC 1UHWA 3I59B 2EFQA 1BI1A 2Z9OA 5TRDA 1S3JA 3LQRA 3ISPA 4ZH4F 1OKRA 3F8FA 3LAJA 1L0OC 5FFXA 1JHFA 4DQ2A 4YFXF 2UZKA 1IXRC 4HLXA 2XIGA 3FZVA 5E20A 2DLLA 3OV8A 1LB2A 3O2PE 4UVAA 3F8MA 2P5LC 1BOAA 1TNSA 3E6MA 3EUHA 2XRNA 2L02A 4KDPA 5CVIA 1FYLA 4M6YA 3Q9VA 4EJVA 2G7UA 1BIBA 1QNTA 5E1WA 5ILUA 3COAC 2OZ6A 5HLHA 1Z05A 1KQ0A 3AAFA 3VODA 1IRGA 2IJLA 3WGIA 1J5YA 2WC2A 3BZ6A 4LMYA 2IVMA 1EH8A 1T38A 1XSDA 4UUVA 3ABUA 2HYFA 2YU3A 2CFXA 1I6XA 2VE9A 5D5WB 1ZRCA 4I0AA 1R5GA 2DTRA 4LG0A 3ROUA 1QQIA 3IC7A 3IRQA 4NB5A 1EV7A 2PBIA 3P9IA 1O3QA 5D4RA 4BNCA 2ZFWA 2W84A 2GA2A 4EV0A 1Z1DA 4HF2A 3DP7A 4Y17A 4CYDA 2M1BA 2ESNA 2FF4A 3JAMK 4LB5A 2CSOA 3GUDA 4RGXA 3WTWC 5D8LB 3RKXA 1KU9A 3V7CA 1ZH5A 3I5UA 1HQCA 4G8XA 5KK1A 4YIIA 3ERED 4ESFA 5HDKA 1U8RA 2HEOA 1S7AA 2FA5A 4KICA 1BI3A 2GQQA 1TNTA 3QP6A 3HHGA 2YX4A 5A2QK 1DDNA 3IWZA 4HV6A 1G3YA 4RAYA 1BIAA 3REOA 3L00A 5LLQA 4A2UA 4PZJA 3KFWX 3O3KA 2HTJA 3L9FA 1V4RA 2VBWA 1HSJA 1FSEA 2EFWA 1R1UA 1T0FA 3KEQA 2PFBA 3KCCA 2K02A 3ML6A 1FZPB 3KP7A 1AOYA 2ZMEB 1OMIA 2FNPA 2Z33A 3U2RA 1MJ9A 3K1PA 3CJNA 3CLOA 1W4MA 2EV6A 3PQKA 1AWCA 1ZGAA 3MZYA 3F22A 1YW7A 4KA4A 3DFGA 5IT9Z 5ERIA 1ZYRF 3Q9SA 4FT8A 1ZN2A 2Q0OA 2P5KA 1RUOA 2DT5A 3KETA 1MDMB 1LNWA 5CJ9A 3MZHA 2XV4S 5L3CA 1A04A 1SFXA 4IXAA 1XGOA 4Q48A 1XGSA 3F6OA 2ZNYA 2JT1A 5D8KB 2DFIA 3MWMA 1MZBA 3GFJA 1G6NA 3KLNA 3V7SA 4EM0B 5TJJA 2JPBA 4EGYA 3I59A 2P7VB 3QU6A 4G7HF 1KYZA 4LGWA 4AIJA 5L3GA 4UV8A 2EWNA 5HS9A 2CG4A 2GXGA 3CO6C 1H9GA 2HKOA 1FLIA 3IL2A 4S04A 1O3RA 1B9NA 4ZYHA 1Z91A 2ISZA 1D8KA 3FX3A 2O6GE 3MCZA 4G6DA 3CUQC 5ICFA 2DO7A 3WGHA 3BY6A 5JVTA 2Y75A 3E97A 2CYYA 5J6XA 2EV5A 2JTVA 4M71A 3FMQA 5K5RA 3ELKA 5FD5A 1Z7UA 5ILSA 5DCFA 3ZMVA 3CUOA 4IRHA 1XGMA 2ZJ2A 3DPLC 3QU3A 2RVCA 3I0TA 1CF7B 3M8EA 2X0LA 2X4HA 4MEYF 3MEXA 2FBIA 2P4WA 3JW4A 4ON0A 3SZPA 4K2EA 5AIPA 3HRMA 4RB3C 2Q2EA 3I54A 5ED4A 1FT9A 2KJBA 2G7HA 3WU1B 1YFHA 2PG4A 2HDCA 1W5SA 2KRFA 3F6VA 3FMRA 1HKQA 2MA3A 1FBUA 3RI4A 1ZHFA 2L01A 5HS8A 1LVAA 2E1NA 2P6TA 4OIRF 4HDVA 3C3WA 1XSXA 4P5OA 4LFUA 2FEZA 1SMTA 6PAXA 5E8IA 2VC0A 1D8JA 4OU0A 2A6EF 4KT5C 4RGSA 2ZCWA 3HRTA 5DCMA 1USTA 3SFZA 3TO9A 1IXSB 3CDHA 5BS6A 1P92A 2WTEA 3I58A 2HOEA 3HHHA 3K1NA 1OPCA 2ZNZA 4O6JA 3W6KB 1UFMA 3S2WA 1Q1HA 3SQNA 3E5XA 1GXPA 3IHUA 4OOIA 2ZMEA 2XAHA 1W7PD 3QRFF 2VN2A 5E8GA 2ZBKA 2R7DA 3IRRA 1GHCA 4P55A 5D5XB 2W85A 2JZYA 1TW3A 1F9NA 1ZGJA 4L0ZB 4WF2A 2OZUA 2PN6A 5CVRA 2RGVA 1B59A 3HUGA 2O8XA 1F5TA 1XDUA 2FBHA 2LF8A 3G3ZA 3GO5A 3FXRA 1MDMA 1XMKA 1I1GA 1UHMA 2WWYA 2D1HA 2F2EA 2HKXA 2YPRA 3GWZA 5CVVA 1ZG1A 4L18B 1U6GA 2W25A 3RJPA 2OU2A 1IN8A 2RC4A 3DQVC 1J0RA 1S6LA 4OMYA 1XB4A 3BWGA 2B0LA 2K4JA 2BGCA 1WRJA 1PUEE 5LRSA 2VBXA 3C7JA 2D1VA 4Q4ZF 4JK1X 3G73A 3E6DA 2OBPA 2PEXA 3Q5FA 4KUMA 2UXNA 2O61A 2PJPA 3E3VA 3U9GA 1TTYA 3R0JA 4KN4X 3WTVC 1BN5A 3GX4X 1DPUA 3TKYA 3LWFA 5J8CA 4PDKA 4Y15A 1SD4A 5HOOA 2XAQA 1XN7A 5AIQA 1IAWA 1H0MA 1I27A 1BC7C 2OQGA 2BE5F 1G4DA 5IT3A 3M8FA 1Y0UA 3M9AA 3TGNA 1CF7A 2ZKZA 2FRHA 5L3EA 4EM2A 3BOQA 2FSWA 1E17A 2A61A 3IWFA 4KFCA 3ZMTA 1FP2A 3BPVA 4BH9A 2A5YB 2GZWA 1R22A 2LDUA 1R58A 1QZZA 2HYGD 2A6HF 2QQBA 1HKTA 3ZMSA 5CVUA 4OMZA 3BP8A 5AONA 1STZA 4O3MA 5K5QA 4Q5SF 2FOKA 1LDDA 2LNBA 4L5JA 4WX9A 5LHHA 2CW0F 2O03A 1OR7A 4B8XA 3M7GA 1IW7F 5DD4A 2VBYA 4S05A 3BPXA 4DNCA 4LLLA 4G9YA 3KP3A 1T6SA 2RNJA 1IN7A 3OOPA 1YLFA 1GXQA 2QQAA 3RPQA 1TQIA 5LGTA 4N0BA 2DI3A 2DQLA 1XDSA 4I01A 1R00A 5D6EA 3V8LA 2F5FA 2ISYA 2NYXA 5BQTA 2DAOA 4IHSA 2IA1A 4QWQA 3LA7A 5F6FA 1PP7U 1U5TA 2DQRA 2NS0A 4R8HA 5JR3A 3GEZA 2J5PA 3E5UA 3FXQA 2FNAA 3HIFA 1FBQA 4BHCA 4WCGA 1KQ9A 2BYVE 4HZFA 2QUFA 1EH7A 3ZMZA 4U0WA 3TDUC 2VOPA 4EMSA 2Z5UA 3IKTA 5ILVA 1HBXG 2QENA 4A0XA 2LF7A 4EJTA 2AXLA 3GLXA 5ICCA 1F1ZA 5FLXZ 2FU4A 3C18A 4KYWA 1RI7A 1YS7A 4MHGA 2XASA 1OYYA 2EFOA 5D5UB 4LB6B 4XLNF 4ENNA 3J81K 4EJWA 2JSCA 2E1CA 3ZQ7A 4U88A 3RKYA 2XKOA 1G3SA 4MEXF 5EEHA 2L4AA 1R1VA 3HOSA 1R7JA 4WK8F 2K7LA 3C1DA 2H09A 2NNYA 1YO5C 4XSXF 2QQ9A 3ZN1A 3J7AO 1ULYA 2EA2A 4N9HA 2EFPA 5D4SA 1XMAA 3H3ZA 2FBKA 1SD7A 1U5TC 3F3XA 1MKMA 4D0PA 3BJOA 4OIQF 3BDDA 4OIOF 2ADUA 3L2CA 5DUKA 2XVCA 5FB2A 3CTAA 4R79A 4M73A 4ENJA 3WU0A 5DEQA 2QVOA 3E6BA 1G3TA 1ZRDA 3LFKA 2FQ3A 4HF0A 4GXOA 5CYVA 1USSA 2Z99A 2L3DA 3V8KA 2K4BA 2UXXA 4A6DA 3QPTA 1HSTA 2DK8A 3IKVA 4RB2C 2HTSA 4M9ZA 3T8RA 2OA4A 4P96A 3WODF 5BMZA 1T98A 2TDXA 3LA2A 1YW8A 2CWEA 3HRSA 2KIMA 2KJCA 1SMYF 2K86A 4KNYA 1LDKB 2OAZA 5ICEA 2HFHA 2Y48A 4G94A 1V3FA 1DPRA 3L09A 2P8TA 3RTRA 2VE8A 5LGUA 4M6XA 5DDGA 2Y0MA 3K2ZA 2VC1A 2ZXJA 4L9VA 4KMUX 5K1YA 3LAPA 1WI9A 2NNNA 1P2FA 3JTHA 1WKMA 3WGGA 1IN6A 2EFNA 2ELHA 4I0BA 4MQ9F 1SAXA 2F5EA 3DXJF 3JTGA 4JQFA 1K79A 2CQKA 1ZLKA 3BJ6A 5LBQA 3FM5A 3TOAA 1ZRFA 1HW5A 4FHTA 4LLGF 1QO0D 1I1SA 4IF4A 1IRFA 2FMYA 4WWCA 1YTYA 4LJZF 2MH2A 4ZZDA 4OIPF 4YIFA 3WE2A 1FNNA 4ZYDA 3D5LA 4CXFA 4XBFA 3FM3A 1ODDA 4IPAA 4AWXB 2A3SA 1S7OA 5D6FA 4GGGA 4I02A 1QZYA 5LHIA 3V7RA 1VTNC 4HLYA 3KP2A 2UWMA 1FSHA 2STWA 2E7XA 4IHTA 2V6CA 2XAJA 4KIBA 2D45A 1S8NA 2MLKA 2V1UA 4HQMA 1LQ1A 1RZ4A 4E70A 4Y13A 5LRRA 2QM3A 3GZ6A 1EH6A 3I4PA 3FMSA 1D3YA 3R0AA 4HAMA 4FX0A 1FPQA 5J8FA 1XCBA 1QGPA 1FYMA 1HW1A 4ENMA 1ZG5A 5LEKA 2QZ8A 3K1MA 3B02A 1D5VA 5HLIA 4NQWA 2PQ8A 3LSTA 1BBYA 2XKPA 3L7WA 3JAMZ 5FLXK 2OD5A 1O3TA 2M45A 1NHAA 4CHUA 2VONA 2EK5A 1FP1D 1X3UA 4BYYA 4O5VA 3DPTA 1YS6A 1ON1A 5EEGA 5A2QZ 5D5VB 4LG0B 4ETSA 2CGPA 1JGSA 3T8TA 2XAFA 1LDJA 1E2XA 3V8JA 3ULQB 4A5MA 1WWXA 4M74A 2IP2A 1TW2A 5DV5A 1MD0A 2LKPA 4KIGA 4EJOA 2R7FA 5HVQC 3WTYC 2QBYB 4QLCU 5E1XA 3HTSB 5H6QA 4RB0A 1FX7A 4LD5A 2MLGA 3NEUA 5LGNA 3GF2A 4PGHA 5IT9K 2KKOA 2P7CB 2VT2A 2IA0A 2VXZA 3E5QA 4A6EA 1ZG3A 3T0YA 1KQ8A 1G3WA 4I98B 1QBJA 1YIOA 4EM1A 2HQRA 3KEOA 4Q47A 3WTSC 1U2WA 2VT3A 1DP7P 5DUIA 2VODA 5E17F 4IJAA 4GYIA 2XGXA 1T2KA 4BHPA 5BPDA 4KIFA 2ETHA 5E18F 5E1ZB 3CUQB 3R4KA 2QLZA 3JSOA 4HW0A 1SD6A 3K0LA 1R36A 1K78B 4B09A 2H94A 4ZYGA 4HX8A 3HOTA 1OYWA 2C6YA 1R23A 1DUXC 2JRTA 2R3SA 5FGMA 3RYRA 2V1XA 1J9IA 1IN5A 3SHFA 4KMFA 3EDPA 2BEOA 1KYWA 3FF5A 1P4XA 3SXYA 3GXOA 2J5OA 5BPIA 2W57A 1HXDA 3TDZC 2IA2A 4NHJA 5FFZA 2MC3A 5FD6A 4HF1A 3TQNA 5JHUA 5LHGA 5ICGA 1S29A 2NRAC 2STTA 3ZN0A 4G6QA 1U3EM 1Z6TA 1P4AA 2PMHA 1SFUA 1Z9CA 1U78A 1P4WA 3JSPA 4HV5A 1KU3A 3QOPA 1C0WA 2EA4A 2M5WA 1IXCA 3U1DA 3DV8A 2H6BA 1LEBA 2HZTA 1ON2A 2XUBA 1ZAOA 3RPUA 2PMUA 4LK0F 4IVNA 1SFEA 1B9MA 5HS7A 3N97A 1WSUA 2F5DA 4G7ZF 4U0YA 1CGPA 3TOBA 3I53A 3QAHA 4AVPA 4F7ZA 2GIVA 2GWRA 3KZZA 4HBLA 4I7HA 1L3LA 3I64A 3QP5A 2KIUA 1O3SA 1TQMA 2PLYA 1B4AA 5FO5A 2HWVA 4XLPF 4HX7A 3SZTA 3MFKA 2JPCA 3GFIA 2M30A 3GW2A 3FHZA 4FX4A 1IN4A 3DEUA 5K5OA 4KN7X 4LLNA 1RUNA 1QPMA 1RIOH 4WXHA 5JFRA 1KA8A 3GZ5A 4XRFA 2YSRA 1RNLA 2RKHA 3GFMA 4G7OF 4L0YB 2QBYA 1J75A 3P7NA 4MGRA 4Z2YA 1Z6RA 2IT0A 2MH9A 3ZP5A 2BV6A 5DCMB 2HGCA 1UCRA 3GVAA 3MQ0A 1SD5A 4M72A 4PCQA 4EGZA 2W24A 2QYOA 4ESJA 3H92A 2YX7A 1B1BA 3P9KA 3KE2A 4GCVA 5L3BA 3QPHA 4CDGA 5LEJA 1J7KA 3D0SA 3H3UA 2FMLA 3I71A 4WXCA 1ZREA 2VBZA 4GO1A 4L9NA 1YYVA 4XSZF 3M1EA 3N4MA 4EJUA 3J80Z 4RGRA 1GVJA 1OYIA 2K27A 4OINF 2A07F 4MTDA 2CO5A 2RDPA 3CUQA 3HRUA 1IF1A 3EYYA 3F23A 2ZO4A 2EJRA 1JE8A 4ENKA 1MJAA 2L4MA 1FYKA 2KIFA 4M9SA 1BI2A 2GA1A 1LEAA 1K6OA 3T1BA 2DW4A 5HDGA 5H20A 1MJBA 1K78A 4RB1A 3W6JB 3KZYA 2O3FA 3WTZA 2G9WA 5H6RA 4RAZA 3LA3A 1YG2A 4BHBA 3GYHX 1XGNA 1TBXA 3T5XA 2P6SA 5DD8A 4P9UA 5CLSA 4ASNA 3EYIA 3WTUC 1P6RA 1O7FA 3DKWA 5F1RA 3O6BB 1FC3A 1W7PB 1KGSA 4H0EA 3EETA 1BJAA 5BOXA 5DYMA 3KP5A 4AD9A 2DPDA 4RS8A 1FOKA 2V1DA 1FBSA 4ZYEA 4A5NA 5CVJA 3P9CA 4BAYA 4I2OA 2Q8KA 4EVIA 4I09A 1ONVA 2VOOA 3F8NA 1HW2A 1XD7A 2LSOA 4MQVA 4YFNF 1LJ9A 4ZZLA 4HQEA 4CICA 3CO7C 1KU7A 2IPQX 2IRFG 1F4KA 1KU2A 3ZMUA 2O0YA 2WV0A 3HSRA 3NQOA 3F8BA 1J59A 2BBYA 3EQLF 4YG2F 4JBAA 1R5HA 1WQ2A 1FWZA 4HX4A 5JI6A 1PP8F 2COMA 2E7WA 5KVRA 4ESBA 3WTTC 3HTUA 4CO8A 1BM9A 3RYPA 1T39A 3GFLA 4MTEA 3R61A 2A69F 2FE3A 2M87A 4CGZA 1R1TA 4UHTA 2HS5A 1FY7A 4L5IA 5L3FA 2P5VA 1MGTA 2QWWA 2XAGA 3V4GA 4UVCA 2OQRA 2IW5A 1I5ZA 3VOEA 1H9TA 2MBFA 4R1HA 2GAUA 4U7DA 4U0VA 4IRIA 3NRVA 3DF8A 4BQAA 3HSFA 4WXDA 2MD5A 2DBBA 3VB2A 3F72A 3ECOA 2YR2A 1JHHA 3HSEA 3PQJA 4GYGA 1U5TB 1TQPA 3PFIA 3BROA 1K7AA 3KP6A 3J81Z 3FXUA 2Z3YA 1O7LA 2HR3A 4A0ZA 3KP4A 3FWEA 4P9FA 2RV8A 4L9JA 2H6CA 1YQAA 3RKWA 2A68F 1BC8C 4RGUA 3BJAA 4BXUA 1W5TA 3ZPLA 2RN7A 2EV0A 2AS5F 1YW9A 3KLOA 2F5CA 2XROA 4U7BA 1ZLJA 3TO7A 4HOBA 4HYEA 3VFZA 2D2WA 2ACJA 2NAZA 3ABTA 3K9TA 5HDNA 4HA8A 3HYIA 1IUYA 2L54A 2DU9A 3R6SA 4N9IA 4A0YA 3F21A 4UV9A 3RIRA 4HDUA 1HKSA 1ZARA 4MNUA 5F64A 1O57A 3J80K 1PDNC 5HLGA 3R60A 2HQNA 3VEPA 1TLHB 4YFKF 1B6AA 3K69A 3MAJA 2PI0A 2XHKA 1J2XA 3RDIA 4AIKA 1XCVA 3B73A 3ECHA 1BI0A 1W7PA 1JXSA 4L9TA 4TV7A 1UB9A 2EB7A 2FXAA 3TO6A 5L3DA 2DPUA 4UXNA 2DK5A 4UNOA 4PGGA 4IRGA 4LK1F 2GXBA 2RQPA 4EQQA 3WE3A 3WG9A 3ZMDA
chains in the Genus database with same CATH superfamily
2H27A 3AG1H 2M8EA 2GM4A 1VQ6I 2JA2A 2WB1A 4M9XA 3S17J 2QCOA 2XF5A 3F8CA 3E6CC 1IZ1A 2WY8Q 1REPC 1SC7A 1JKOC 2PJRB 2BZTA 4AIHA 1G59A 2ESHA 4UVBA 1AKHB 1XSVA 4A12A 2V9VA 2LLKA 3EUKL 3LQQA 2AQEA 2V79A 4CZZA 2ICWG 3WTXC 3OYMA 4II2A 1UHWA 3OYNA 4XRSG 4QPQA 4M6VA 3I59B 2EFQA 1BI1A 4G6TB 3RSNA 1YOVB 2Z9OA 2NS7A 5TRDA 1S3JA 3LQRA 3ISPA 4ZH4F 2BY1A 3A01A 3K4KA 1OKRA 3F8FA 3LAJA 1L0OC 4FE7A 1RETA 5FFXA 3GBGA 3FIWA 1ZQ3P 1JHFA 4OAZA 4DQ2A 1MMAA 1WJCA 2L9VA 4YFXF 2UZKA 1IXRC 4HLXA 2XIGA 2VKVA 4C3HJ 4I6ZA 3FZVA 5E20A 2DLLA 2KHMA 3OV8A 1LB2A 3O2PE 1SVLA 2EQRA 4UVAA 3F8MA 2RREA 1EKEA 2P5LC 2KISA 3W6VA 1BOAA 1TNSA 2V7FA 3K70D 3E6MA 3EUHA 2XRNA 3PIPF 5CQEA 2L02A 4KDPA 5CVIA 1FYLA 4M6YA 2HXOA 3Q9VA 3K4JA 2E35A 1WGXA 4EJVA 4XLAA 3D5RC 1I3AA 3TP0A 4A3JJ 2G7UA 2R7RA 1BIBA 1YE9A 1QNTA 5E1WA 2F5VA 5ILUA 3COAC 2HVRA 9ANTA 2OZ6A 5HLHA 5KNLA 1Z05A 4DGWB 2V6EA 1KQ0A 5HLTA 3AAFA 3VODA 1M1EB 1IRGA 2IJLA 3KZIC 3WGIA 3W2WA 1J5YA 3W2AA 2WC2A 4LIUA 3BZ6A 2MABA 4LMYA 4DOZA 1X1CA 2IVMA 4PSXA 3WU2C 3S1MJ 1D0ZA 3W3CA 2JJ7A 1EH8A 1WH5A 1T38A 3MN2A 1ETXA 2IGNA 5FKNA 5GAHJ 1XSDA 1A5JA 1K6YA 4UUVA 4BACA 3ABUA 2E19A 1FIPA 2HYFA 2X51A 2YU3A 5B3SH 2QA4I 2CFXA 1I6XA 2CQQA 3BR2A 2VE9A 5J4VA 2K3FA 5F0HA 5D5WB 1QHHD 1ZRCA 3G1LA 4I0AA 1R5GA 2DTRA 2IAIA 1IRZA 4LG0A 1HLVA 3G1OA 3ROUA 4CZCA 1QQIA 3IC7A 3IRQA 4NB5A 1EV7A 1SAUA 2PBIA 2E1MC 3P9IA 4XKCA 2F48A 1O3QA 2Y31A 1WJFA 2L5QA 5D4RA 4BNCA 2ZFWA 2W84A 3M1CA 2GA2A 3LSHA 4EV0A 1Z1DA 4HF2A 2R7XA 3DP7A 4Y17A 3NAUA 4CYDA 1BOBA 2DMQA 2M1BA 1MNMC 2ESNA 4A3IJ 3S3NA 1ERDA 2FF4A 3JAMK 4LB5A 2CSOA 3GUDA 4RGXA 3WTWC 5D8LB 3RKXA 1KU9A 5FRMA 1U0JA 3V7CA 1GVDA 1ZH5A 2X9DA 3PNYA 3I5UA 3M8JA 1HQCA 4G8XA 5KK1A 1Y8QB 4YIIA 3ERED 1JKPC 4BJTA 4ESFA 5HDKA 1U8RA 2HEOA 4CCJA 1S7AA 2FA5A 4KICA 4C30A 1BI3A 2GQQA 1TNTA 3QP6A 1D1AA 3I3LA 3HHGA 2YX4A 5A2QK 1DDNA 3IWZA 2JWTA 4HV6A 1G3YA 4RAYA 3ZQLA 1BIAA 3REOA 1IJWC 3L00A 2PX9A 5LLQA 4A2UA 4PZJA 3KFWX 3KPHA 3O3KA 4PJJA 2HTJA 3L9FA 1V4RA 2VBWA 3K7AJ 3Q0WA 1HSJA 1VQNI 2KDZA 1FSEA 3BR5A 5DS9A 2EFWA 1TWCJ 4RM2A 1R1UA 1T0FA 4XMYA 3SEQA 3KEQA 2ME0A 2PFBA 3OS0A 3KCCA 2JUCA 2K02A 3K4NA 4E7IA 3ML6A 3OYBA 3GTQJ 1Z3XA 2XF6A 1FZPB 3KP7A 1AOYA 1HOMA 2L2OA 4V2GA 4NBQA 2ZMEB 3D1NI 1RR8C 3H36A 3FKJA 1OMIA 2FNPA 1ETYA 2Z33A 3U2RA 1NG7A 3V42A 1VQ8I 1MJ9A 3K1PA 3OOUA 2R7WA 1QA6A 4NC7A 3CJNA 3CLOA 1APLC 5JVGF 2JVHA 2QGUA 4HNTA 1W4MA 2EV6A 3PQKA 4Y4RA 1AWCA 3DCFA 1ZGAA 1RKTA 3MZYA 3F22A 3L2UA 1DQUA 1HDDC 1YW7A 4B48A 4HNUA 4KA4A 3DFGA 5IT9Z 5ERIA 1ZYRF 3Q9SA 1X1DA 3K70C 3HUGB 3BG9A 4AU7A 2BXYA 3AKZA 4FT8A 1ZN2A 3M3YJ 3LOCA 1HDPA 2M4GA 2Q0OA 3BG6A 2P5KA 1RUOA 2DT5A 4ABZA 3KETA 1IRXA 1MDMB 3H3VK 2HVQA 1LNWA 4ZTFA 5LD2C 1BW5A 4H4KC 5CJ9A 3ZGKA 3MZHA 2LTPA 2XV4S 2R92J 5L3CA 3HPGA 1A04A 1MSEC 1SFXA 4IXAA 1XGOA 1TWFJ 1OCPA 4Q48A 3A02A 3LSGA 4ANJA 3SJMA 3HL2A 1PYVA 1XGSA 3F6OA 2PJRA 1AKHA 2ZNYA 2I8DA 3VYUB 2JT1A 1NK3P 4Y3OA 5D8KB 5M3MJ 2DFIA 2LVSA 3HEFA 3BR0A 3MWMA 1MZBA 2L7FP 4W97A 1VFCA 2HPMA 3GFJA 1G6NA 2K9SA 5EZHA 3KLNA 3V7SA 3OYDA 2O7OA 1ZR4A 4DYRA 3MKWB 1HC8A 4EM0B 4E7ZA 5TJJA 4I99C 2JPBA 4EGYA 3I59A 2AHQA 2P7VB 3ZCOA 3GTPJ 3QU6A 1Y0NA 3MKZA 4G7HF 3BTIA 1KYZA 2Y2ZA 3OMYA 4LGWA 4AIJA 2KT0A 3H5RA 2ELJA 5L3GA 3H0DA 3K4MA 3JRIA 4UV8A 2EWNA 5HS9A 5GTIC 2CG4A 2GXGA 3CO6C 1H9GA 3LSPA 2HKOA 2HXIA 3H5AA 1FLIA 1TT0A 3IL2A 4BE2A 4S04A 1TL8A 1O3RA 1B9NA 3OL4A 2R5YB 4ZYHA 1Z91A 2ISZA 1D8KA 1X2NA 2TRTA 2ZJQF 4OAYA 3FX3A 2O6GE 2DMPA 3VDXA 3MCZA 4G6DA 2VI6A 3TBIA 4JX5A 4A69C 3CUQC 1ORKA 5ICFA 4BDZA 2DO7A 3WGHA 3BY6A 5JVTA 4I76A 2Y75A 3E97A 4GRIA 4XIDA 2CYYA 5J6XA 3PL8A 3VYTB 2EV5A 2JTVA 4M71A 2XF7A 3FMQA 5K5RA 3AG4H 3CCLI 2V4JC 4CSWA 1JUMA 3ELKA 1ETKA 1Z7UA 5FD5A 4F3QA 1H89C 1N77A 2PMZN 5ILSA 5DCFA 1T08B 3BLYA 3ZMVA 2M9HA 3K6GA 3CUOA 4IRHA 4HSRA 1XGMA 2ZJ2A 3CCRI 3DPLC 4D9JA 1VQ5I 3QU3A 1T95A 1JUSA 4HEA2 3DLAA 2DXIA 2RVCA 3I0TA 1CF7B 4IHXA 2V26A 4D7MA 3M8EA 2VKDA 3ERMA 2X0LA 2X4HA 4MEYF 5F27A 4DIQA 1YHQI 3MEXA 1DGWY 1FMVA 2LOOA 2AQFA 2AXTC 2FBIA 2M8GX 1ZK8A 3AL0C 2P4WA 1XC5A 1D0YA 3JW4A 2A5WA 3WHCA 4ON0A 3SZPA 4K2EA 3OS2A 5AIPA 3HRMA 2JQ7A 1MH3A 4RB3C 2Q2EA 4BGDA 3I54A 2DA6A 4A3EJ 3DTIA 2DDBA 5ED4A 1FT9A 1EJ9A 1G8XA 4JOMA 2KJBA 1ETQA 2G7HA 2BOLA 4HNVA 5J1RA 3HOWJ 4BUPA 1S9HA 2XSDC 3WU1B 1P7IA 1YFHA 2LREA 2JN6A 2PG4A 2XPWA 1W5SA 2HDCA 2JMWA 2KRFA 3NARA 3QWLA 3F6VA 3ZR8X 2KQRA 3FMRA 2JA5J 1HKQA 2MA3A 2JA6J 1FBUA 3ABLH 1ZHFA 2L01A 3RI4A 1ZKGA 3S93A 5HS8A 2E2IJ 3S8PA 1LVAA 3JRDA 2E1NA 1MNEA 3JRBA 5F0FA 3CZ6A 2P6TA 4OIRF 3SZGA 4HDVA 3C3WA 3FBIB 4PJMA 1XSXA 4P5OA 5TISC 2V9KA 1JKRC 4LFUA 2FEZA 1SMTA 1KZHA 2HYJA 6PAXA 4FISA 2Y0SA 5E8IA 4BS9A 3OYKA 2VC0A 1D8JA 4OU0A 2A6EF 4KT5C 4RGSA 2ZCWA 3QOEA 2XB0X 3HRTA 5DCMA 3A2KA 1USTA 3SFZA 3CP8A 3TO9A 1IXSB 3CDHA 3EUAA 4BJ5C 5BS6A 1P92A 2WTEA 3I58A 2HOEA 3HHHA 3TEDA 3K1NA 3PIOF 4C9YA 1OPCA 1R5ID 4PFPA 2ZNZA 1V5GA 4O6JA 1YRNB 3CMAI 3CCSI 5IOZA 1D5YA 3W6KB 1JUPA 3E0JB 1UFMA 3S2WA 1Q1HA 3SQNA 3E5XA 4IL6C 1GXPA 3IHUA 3IH3A 4OOIA 3NWSA 5EEAA 2ZMEA 1Z0XA 2Z2SB 2DFHA 2XAHA 1W7PD 5HODA 3QRFF 2VN2A 3BR1A 3HOZJ 3BT9A 2DA3A 2JVGA 3CQZJ 5E8GA 2ZBKA 4DBRA 2R7DA 3IRRA 1GHCA 4P55A 1IV6A 5D5XB 3FDYA 2W85A 1X4OA 1FOXA 2JZYA 1TWHJ 1TW3A 1F9NA 1ZGJA 4XORA 4ZC3A 3C2GA 2WA0A 5CQGA 4L0ZB 2WAQN 2OZUA 4WF2A 2EINH 2PN6A 4XQFA 5CVRA 2RGVA 1B59A 3HUGA 2OCCH 3GMEA 4UUSB 3LSMA 5B1BH 2I10A 2O8XA 2VXDA 1XDUA 5IP9J 1F5TA 2FBHA 4B1RA 2LF8A 3G3ZA 3GO5A 3FXRA 4IO9F 3IV5A 1POGA 1MDMA 3P5JA 2E5NA 2VJ5A 3QYBA 3VYRB 2M4KA 1XMKA 1I1GA 2L7ZA 4XOTA 1UHMA 2WWYA 2D1HA 1JT0A 1F36A 2F2EA 2R7UA 2HKXA 3PJRA 2YPRA 3GWZA 5CVVA 2UUZA 1ZG1A 1WI3A 4L18B 2F6CA 3FXJA 3PNTA 1MBKA 1U6GA 2W25A 4UB8C 4Y33A 3RJPA 1U8BA 1VQPI 2OU2A 1IN8A 2RC4A 2E1OA 2BHZA 3DQVC 1J0RA 1WJEA 1S6LA 4B44A 4E4HA 1ZR2A 3L2VA 3KX2A 4OMYA 1XB4A 3L2RA 3BWGA 2NVXJ 3CMYA 2B0LA 2K4JA 3OYCA 2BGCA 1Z3YA 1WRJA 1PUEE 4BU2A 2K3PA 3KYCB 5LRSA 2F4OB 4DBQA 2KL4A 3IP4B 2VBXA 1WJBA 3C7JA 2D1VA 4YELA 3OYIA 2WADA 4Q4ZF 3DBRB 2Q1ZB 2ZC2A 3AFHA 4JK1X 3G73A 5EJCA 4ZYAA 3LFUA 3QYEA 5M5YJ 1X58A 1R6RA 3E6DA 3S14J 1R4MB 3QQAA 1S7EA 5JHFA 2R5YA 1X19A 1IC8A 2CUFA 2OBPA 2PEXA 4KUMA 3Q5FA 2UXNA 2O61A 2PJPA 2CRGA 3E3VA 3U9GA 3CJTB 1TTYA 4E7SA 1PVEA 3R0JA 4KN4X 4B47A 3A03A 3WTVC 4BXXJ 1BN5A 1LFUP 1Z7LA 3GX4X 3TKYA 1DPUA 4AIDA 3LWFA 1JJ8C 5J8CA 4PDKA 2CW7A 4Y15A 1SD4A 3HOXJ 3MVPA 2XAQA 5HOOA 1XN7A 5AIQA 4X1EA 1IAWA 1H0MA 3DTEA 1I27A 2EILH 4PJ0C 3OYEA 1BC7C 2E60A 3RQ4A 1VNDA 2OQGA 4CCLA 2BE5F 3OY9A 2QSFX 1G4DA 5IT3A 1X1AA 4F92B 2MFZA 3M8FA 4F93B 3HKZN 1Y0UA 3M9AA 1GV2A 3TGNA 1CF7A 5FJ8J 2ZKZA 2FRHA 3CCYA 5L3EA 4EM2A 3BOQA 1IO2A 2FSWA 4RAFA 1E17A 1Y8RB 2LBFB 2A61A 2X1EA 4AYBN 5HNFA 3J7AY 3ZQQA 3S3OA 3IWFA 4BEHB 1R4NB 4P1WA 4KFCA 3ZMTA 3JRCA 2IS4A 4IX7A 1FP2A 1A35A 1W0UA 3BPVA 5GAGJ 5F08A 4BH9A 2VJIA 2A5YB 3FXOA 2GZWA 1R22A 2LDUA 3GZNB 1LUJB 1R58A 1QZZA 2HYGD 2A6HF 2H8RA 2QQBA 3OYFA 1HKTA 3ZMSA 2LR8A 3PO2J 1TP4A 5CVUA 4OMZA 3Q0UA 2JA8J 1LFBA 3BP8A 1HCRA 5CPRB 5AONA 1STZA 4XLCA 2CMPA 4O3MA 5K5QA 2ZJPF 1V54H 1TC3C 3PO3J 4Q5SF 1SANA 2FOKA 1LDDA 2LNBA 4QSHA 3GLLA 4L5JA 4WX9A 3ZRGA 3LSRA 5LHHA 2CW0F 4A3LJ 2O03A 3F0CA 1OR7A 4B8XA 3M7GA 1IW7F 2FJ1A 3QPLA 2VBYA 5DD4A 2KRCA 4S05A 2DYSH 2W1OA 3OSGA 1X1PA 3BPXA 2DOFA 1A31A 4DNCA 4LLLA 3H9GA 4M3FA 4G9YA 4OWRB 3KP3A 3M4OJ 2R5ZB 1T6SA 2RNJA 2ECCA 1IN7A 2R0QC 1WJAA 3OOPA 5K7HA 4B3XA 4NUBA 1YLFA 4KITB 3OYHA 1NK2P 1GXQA 2OTLI 2QQAA 3RPQA 1TQIA 5LGTA 3PUBA 4AM3A 4N0BA 2DI3A 2DQLA 4PK4A 1VQKI 1XDSA 4I01A 1R00A 1FOYA 3BCBA 4IEJA 5D6EA 3V8LA 5EDNA 3RKQA 1BL0A 3CCUI 4XLFA 3TP3A 2F5FA 2ISYA 2NYXA 2WV1A 3CCVI 5BQTA 2DAOA 4AVZA 4IHSA 2IA1A 3ZQCA 2COBA 4QWQA 3LA7A 4U87A 5F6FA 1PP7U 1G2HA 1U5TA 2XSJC 3H5NA 4M3DA 2DQRA 2I5UA 2NS0A 1YRNA 4R8HA 4D5CA 5JR3A 3GEZA 2DOEA 2J5PA 2P0WA 3E5UA 3FXQA 2FNAA 5IOYA 3HIFA 3H1CA 1FBQA 4BHCA 2IS1A 4XN3A 4WCGA 1KQ9A 2BYVE 1BR1A 2X6OA 4HZFA 3BG7A 2QUFA 2R93J 1EH7A 2FX0A 3ZMZA 3C2BA 3Q0VA 4II3A 4U0WA 1D0XA 3TDUC 2ZFUA 2VOPA 4EMSA 2Z5UA 3IKTA 5ILVA 3HB9A 1HBXG 2QENA 4A0XA 2LF7A 4EJTA 4JP0A 2AXLA 3EUHC 3GLXA 5ICCA 1F1ZA 1MBEA 2B63J 5FLXZ 2VIXA 2FU4A 3DWLE 2X1DA 3C18A 4B43A 4UUTA 4UUSA 4KYWA 1W36C 1RI7A 2RNGA 1YS7A 2CU7A 4MHGA 2XASA 1OYYA 2EFOA 4LB6B 5D5UB 5DM7F 3ASOH 4XLNF 5JLWA 4RMNA 2XPUA 3HOYJ 4ENNA 3ABMH 1S72I 4NDLA 3J81K 4EJWA 2X6XA 2JSCA 3S3MA 2E1CA 2E71A 1VI0A 1Z67A 3ZQ7A 4U88A 3RKYA 2XKOA 1G3SA 4MEXF 4NQWB 1ITYA 1E3OC 3JCUC 5EEHA 1N78A 2L4AA 3TL4X 2VKHA 1R1VA 1R7JA 3HOSA 4UY8I 4WK8F 3C1DA 2K7LA 3BTJA 3Q3SA 5EGOB 3B6CA 2H09A 2NNYA 1YO5C 4XSXF 3TW7A 2QQ9A 3ZN1A 3J7AO 1NTCA 1DGRM 1ZELA 1ULYA 4DYQA 3IAS2 5K7ZA 2EA2A 4N9HA 2EFPA 5D4SA 4B3AA 1XMAA 3H3ZA 3OYLA 2FBKA 1SD7A 1U5TC 2HDDA 5DTDA 3F3XA 1MKMA 2EIKH 5FLMJ 4IHWA 4D0PA 3BJOA 4OIQF 3BDDA 4F55A 4GFBA 4OIOF 2ADUA 2M0MA 1Y1WJ 5E3MA 2CUJA 3L2CA 5GPAA 4BY1J 5DUKA 2XVCA 2CUEA 5FB2A 3GTLJ 4A93J 3CTAA 4CYCB 4R79A 4M73A 4LG3A 5B5EC 3ZQIA 2MYSA 1IG7A 4ENJA 3HOUJ 2LY2A 5LFAA 3WU0A 1ACIA 4XM3A 5DEQA 2QVOA 3E6BA 5F0CA 1G3TA 2GIZA 1ZRDA 3LFKA 2FQ3A 4HF0A 4B4CA 2ZXHA 4GXOA 5CYVA 5JLXA 1USSA 2Z99A 2L3DA 3V8KA 2DJIA 2DOAA 2K4BA 2UXXA 3E1SA 3QPTA 1HSTA 4A6DA 5J1YA 3SEZA 2HVSA 2X48A 1SVOA 2R7ZJ 2DK8A 3IKVA 5C4XJ 3MKYB 4RB2C 2HTSA 4A3CJ 4M9ZA 3T8RA 1OCZH 2N8GA 3ZQGA 4E7KA 2LP0A 3KIOA 4XKWA 3HDDA 2OA4A 2HZDA 1R49A 4LOCA 4P96A 3WODF 3ASNH 2A6TA 5BMZA 1H8AC 1N25A 1T98A 2TDXA 3LA2A 2R7QA 1WJ5A 2EH3A 1YW8A 2CWEA 2MD0A 1VQ9I 3HRSA 3DKXA 3G71I 2AO9A 4BEHA 3E7LA 2KIMA 1V5EA 2KJCA 1JT6A 1SMYF 1T0FC 4F91B 3W2VA 1VQ7I 2K86A 4KNYA 1LDKB 2OAZA 2OJED 5ICEA 2HFHA 4DYCA 2Y48A 4G94A 1V3FA 1DPRA 3L09A 2P8TA 4RLQA 3RTRA 2VE8A 4M3BA 2ZB9A 4DW6A 4XKBA 5LGUA 1A36A 4M6XA 3J7YJ 4XRMA 1MMGA 1AHDP 1JI8A 5FKMA 5DDGA 3G4SI 3ZOBA 2Y0MA 3K2ZA 2VC1A 5E79C 3HPHA 2ZXJA 1ENHA 1LE8B 4L9VA 1BR2A 4KMUX 5K1YA 3LAPA 1WI9A 2NNNA 3HBLA 2H8WA 1FIAA 1FMWA 1T56A 1P2FA 2EPFA 3PNVA 4NNJA 3JTHA 1WKMA 3WGGA 1IN6A 2EFNA 2O8KA 2ELHA 2NXNB 1DP3A 1I39A 2LKXA 2LG4A 4I0BA 4MQ9F 3VWBA 4Z6YA 1SAXA 2F5EA 3DXJF 4JYKA 3JTGA 1GUUA 1B8IB 1SFKA 4A3GJ 5HNHA 4JQFA 2R5ZA 1K79A 2CQKA 3S2DJ 1ZLKA 3CESA 3BJ6A 5LBQA 3FM5A 3TOAA 1ZRFA 1HW5A 1QVTA 4V19K 4FHTA 4XLEA 4LLGF 2XDVA 1QO0D 2L9RA 4IF4A 5J47A 1I1SA 1IRFA 2FMYA 3RZOJ 4WWCA 2CH0A 4DJAA 1YTYA 4LJZF 2MH2A 4N4OB 4C2UA 4M3EA 4ZZDA 4OIPF 3BCAA 4PJNA 3SDBA 4YIFA 3S16J 3WE2A 1FNNA 3D5SC 3D5LA 4ZYDA 4CXFA 3I4NJ 3LNQA 4XBFA 3FM3A 1ODDA 3KYDB 2KZVA 4IPAA 4AWXB 2A3SA 2NOJB 1S7OA 2KZGA 5IYCJ 5KCMA 5IY5H 4FCYA 5D6FA 4GGGA 4I02A 1QZYA 2DFFA 4CCMA 2VJ4A 4UB6C 3V7RA 5LHIA 2BY0A 1VTNC 2PMZA 4HLYA 3KP2A 2UWMA 1FSHA 5GTHC 3KYLA 5F1JA 2STWA 2E7XA 1YITI 3OL3A 4IHTA 4IHVA 2V6CA 2IXSA 2XAJA 4KIBA 2D45A 5BNGA 1S8NA 2E1MB 2MLKA 2V1UA 4HQMA 5E3OA 2Y30A 1Z77A 5J3LA 1LQ1A 1RZ4A 4E70A 2Y9ZA 4Y13A 3JRGA 5LRRA 1WFXA 5J4YA 2QM3A 3AG3H 3GZ6A 1EH6A 3GTOJ 3I4PA 3FMSA 1D3YA 3R0AA 4XKVA 4HAMA 4FX0A 1FPQA 1UJ8A 3DU6A 5J8FA 1WPKA 1XCBA 1QGPA 1FYMA 2VPLA 2DT6A 1HW1A 2EZHA 4ENMA 1ZG5A 1MBGA 2BHYA 4MLOA 2LY1A 5LEKA 2QZ8A 3K1MA 3B02A 3QPSA 1D5VA 5HLIA 2MC4A 4NQWA 2HU9A 4F52A 2PQ8A 3LSTA 5EGOA 2O5RA 1BBYA 3CCJI 3MMYB 1XTAA 1TZLA 2K9NA 2XKPA 4D5FA 4RBOA 3BR6A 2ZSIB 3K4LA 3L7WA 4ZTJA 3JAMZ 3S15J 4FQGA 1K61A 5FLXK 2L7KA 2OD5A 1O3TA 2CV0A 2M45A 1NHAA 4CHUA 5EG0B 3HJEA 2VONA 2MW8A 2EK5A 1W5CC 1FP1D 2FUG2 4AC0A 1X3UA 2M34A 5H2FC 4BYYA 1RKWA 4O5VA 1B72B 1NH3A 2F4MB 1ETWA 3DPTA 2WY7Q 1YS6A 1ON1A 2XRLA 5EEGA 5A2QZ 5D5VB 3L2WA 4LG0B 1Y1VJ 3JRAA 4ETSA 4FTHA 3UKGA 2CV2A 5M5WJ 1J09A 5M5XJ 4CYCA 1V55H 5IPAA 1JJ6C 4MIMA 1UHSA 1GT0C 3GTJJ 2X1CA 3PFYA 2CGPA 1JGSA 3T8TA 2XAFA 4NC8A 1N75A 1LDJA 2DMNA 2KPMA 4HSTA 1E2XA 3PM1A 4XNFA 1EF4A 3V8JA 3ULQB 4A5MA 1WWXA 4M74A 5EYRA 4BY7J 2ID6A 2IP2A 1E0EA 2VL8A 1TW2A 3OR1C 5DV5A 1QHGA 4C3IJ 3L2QA 1MD0A 2LKPA 3FXKA 4KIGA 4EJOA 3K2AA 2R7FA 1XX5A 5HVQC 4BE1A 3WTYC 2QBYB 1S5LC 2K85A 2VQGA 4QLCU 5E1XA 2NS8A 3HTSB 4PUSA 1IDYA 5H6QA 4RB0A 1FX7A 4PSWA 4LD5A 2MLGA 2WAQA 3NEUA 3QYFA 3GF2A 5LGNA 1QU3A 4PGHA 5IT9K 2KKOA 2D5VA 2P7CB 2VLAA 2JK3A 3HC7A 3RQIA 2VT2A 2IA0A 1LFPA 2VXZA 3E5QA 4A6EA 1WJDA 1ZG3A 3T0YA 1JKQC 1KQ8A 1G3WA 3GTGJ 4I98B 1I50J 4GDFA 3S2HJ 2HI3A 1QBJA 2M7AA 1YIOA 2HPIA 1IUFA 2ZMEC 1XMXA 4ZDOA 4EM1A 2IS6A 2HQRA 3CDIA 3CCEI 3GCMA 3KEOA 5FROA 4Q47A 2V9PA 3WTSC 1U2WA 2DYRH 2RAEA 3K10A 1WCMJ 2Y69H 4BQQA 1Z21A 1OLTA 2VT3A 5FKLA 5DUIA 1DP7P 2VODA 2VQLA 2WB1N 5E17F 4IQ4A 4IJAA 4GYIA 2XGXA 1T2KA 4BHPA 5BPDA 1DU0A 3C2HA 5GP9A 4KIFA 3ABKH 2ETHA 1XG1A 1UAAA 5IP6A 2R4GA 5E18F 5E1ZB 1LE8A 3CUQB 3R4KA 2QLZA 3OIQA 3CD6I 3ZXSA 1MH4A 4E7HA 3JSOA 4HW0A 1SD6A 4FASD 2GBYA 3S1NJ 2NVUB 3K0LA 4YEJA 1TWGJ 1R36A 1K78B 2XC7A 5GADJ 4DZPA 2VQHA 4B09A 2H94A 1QVUA 2ZSHB 4ZYGA 4HX8A 3FHNA 4ZDLA 4QTRA 1O4XA 4C2TA 2W7NA 3HOTA 3RPUD 1OYWA 1ZTRA 1W0TA 1BJZA 2C6YA 1LVKA 1R23A 3S1RJ 1DUXC 4Y52J 2JRTA 2R3SA 5FGMA 4RM3A 3RYRA 1IGNA 2V1XA 1J9IA 1K4TA 3X2QH 1IN5A 2LKSA 3ONQA 3HG9A 3OR2C 1OJLA 3SHFA 4KMFA 2H1KA 2KLOA 3EDPA 4MFEA 2ELKA 2BEOA 3AL0B 1KYWA 3FF5A 3CLQA 3G2BA 2DCEA 4BDYA 1BA5A 1P4XA 2OV7A 3SXYA 3GXOA 4X0GA 1TT5B 1OCCH 2J5OA 5BPIA 2W57A 1HXDA 2OC6A 3TDZC 3TMOA 3CCQI 2Z16A 3I56I 3GTKJ 2KIQA 2XGDA 4EATA 3RCOA 2IA2A 4NHJA 5FFZA 2MC3A 5FD6A 3CCMI 4HF1A 3K4BA 3TQNA 1V5FA 5JHUA 3DU5A 3HKZA 5LHGA 5ICGA 1S29A 2NRAC 1OFCX 4FE4A 2R7TA 3BQZA 2STTA 4IQJA 3O8HA 3ZN0A 4G6QA 3VYSB 1U3EM 3FK7A 1Z6TA 2K40A 4AYBA 1X2MA 3RZDJ 3A1YA 1P4AA 2PMHA 2XB5A 2EIJH 2DA4A 3LSJA 1EA3A 2B9SA 1SFUA 4KISA 1Z9CA 1U78A 1P4WA 2BXZA 3DTKA 3JSPA 4HV5A 3CP2A 1KU3A 4XL9A 4D1QA 3ESWB 2V1NA 2DMUA 2L0KA 3FK6A 2HOAA 3QOPA 4CH7A 2EA4A 1C0WA 4JX6A 2M5WA 1IXCA 2K9QA 3LMMA 3U1DA 3DV8A 3MZ8A 2H6BA 3HGYA 5TGTA 1RRJA 3OYGA 1LEBA 3QODA 2HZTA 3UR3C 1ON2A 2GXAA 4S0HB 2XUBA 1ZAOA 2DMTA 3RPUA 2PMUA 4LK0F 3H9QA 4L5EA 1XPXA 4IVNA 1SFEA 1Y56A 3U21A 2NOGA 2YU9J 1B9MA 1X1BA 2W00A 2LC2A 5HS7A 3N97A 1WSUA 2F5DA 4G7ZF 4U0YA 1CGPA 3TOBA 3I53A 3QAHA 4AVPA 4F7ZA 2GIVA 3B6AA 2GWRA 4A3BJ 4BQOA 3KZZA 4HBLA 1LPQA 2HQAA 3OIOA 2R7SA 1QZEA 5FRNA 5EG0A 3O8GA 4I7HA 5FLVA 1L3LA 1YX5A 2B7EA 2VB6A 2Q2EB 3CJRB 3I64A 1E3HA 3QP5A 2KIUA 3IAM2 5KAFC 1O3SA 4E6KG 1B72A 4HPQA 2IEKA 1TQMA 5B66C 4RLFA 2PLYA 2NVYJ 1B4AA 2LYCA 1D1BA 3LSKA 4X6AJ 5FO5A 2HWVA 4XLPF 4HX7A 2LK2A 4DZJA 4PFOA 1R71A 3SZTA 3MFKA 2JPCA 1JTXA 2W82A 1X4PA 2CS3A 2L7MP 4XN0A 3GFIA 2M30A 4N4NB 3GW2A 3FHZA 4FX4A 1OR7C 1ZGWA 4YRVA 1IN4A 3DEUA 5K5OA 3DEWA 3SDGA 3G1MA 4KN7X 4LLNA 1RUNA 1QPMA 1RIOH 1LKXA 3U1KA 4WXHA 2E2JJ 5JFRA 1KA8A 2E34A 3GZ5A 4XRFA 2MG4A 2YSRA 1RNLA 4LITA 3UNGC 2RKHA 3S1QJ 3GFMA 3G6EI 3DBLB 4J00A 5KAIC 1FTTA 1U9OA 4CA0A 4BQNA 4G7OF 2M3AA 4L0YB 2M2EA 2QBYA 2FOWA 1J75A 2R7OA 1UELB 3P7NA 4MGRA 1RPWA 4Z2YA 1Z6RA 2IT0A 1YX3A 2MH9A 4C2MJ 2G0EA 3ZP5A 2BV6A 5DCMB 1VF9A 2HGCA 3CF2A 1UCRA 3GVAA 5C4JJ 1MW7A 4J01A 1X3ZB 3MQ0A 1VQOI 1SD5A 4M72A 4PCQA 4EGZA 2BY3A 2W24A 5FKOA 2X6YA 4XONA 2F4IA 2XGCA 2QYOA 4ESJA 3H92A 2YX7A 5C3EJ 1B1BA 1U9NA 3CF5F 2NVTJ 2ZJRF 2YUSA 2KMUA 3P9KA 3KE2A 3BZCA 2CV1A 1OCTC 2HOTA 4GCVA 5L3BA 4LIVA 2W48A 3QPHA 4CDGA 5LEJA 1J7KA 3D0SA 1RESA 1YJ9I 4M3GA 4V2FA 3H3UA 2DODA 2FMLA 3I71A 4WXCA 1ZREA 1YI2I 3WG7H 2VBZA 2WBMA 1FTZA 4GO1A 4L9NA 1YYVA 4XSZF 3M1EA 3N4MA 4XR6A 3VSLA 4EJUA 3J80Z 4RGRA 4W1UA 1GVJA 3JRHA 1OYIA 2K27A 4OINF 1BW6A 2A07F 2LY9A 4BJ6C 4MTDA 2CO5A 4BXFA 2HDWA 2ECBA 2CQ7A 2IBDA 2RDPA 3CUQA 3HRUA 2FQ4A 3I9V2 1IF1A 3EYYA 1X3WB 3BC8A 1GDTA 3F23A 2A05A 2ZO4A 2EJRA 2VJJA 1JE8A 2YS9A 1F43A 3CDLA 4ENKA 1MJAA 2L4MA 3EPZA 1FYKA 2KIFA 1UG2A 1FJLA 4M9SA 1BI2A 2GA1A 5E3LA 2WAFA 1LEAA 4A3FJ 1Y39A 1PUFB 1K6OA 3F9KA 4RA2A 1WVRA 2DT7B 4A3KJ 1MMNA 2EZLA 3T1BA 3S32A 3N05A 2CQNA 2DW4A 2HQ5A 2KRHA 1MJBA 2CW8A 5H20A 5HDGA 3ZQHA 1K78A 2QSHX 4RB1A 1K4SA 3W6JB 2ZXWH 3KZYA 2NVQJ 1P7JA 2O3FA 3WTZA 2G9WA 5H6RA 4RDUA 2DTZA 4RAZA 3LA3A 2LMDA 5KHDA 2LBFA 3CC4I 1YG2A 3OSFA 4XOPA 4MO7A 3IH2A 4BHBA 1A6QA 2LH9A 1WH7A 1VQ4I 1CQTA 5IP7J 1FEXA 2QSGX 2K9LA 3DBHB 5EF6A 3GYHX 1XGNA 1A6IA 1TBXA 4BL0B 4IOAF 3T5XA 2P6SA 5M3FJ 5DD8A 4P9UA 5C44J 5CLSA 4ASNA 4XK4A 3EYIA 3WTUC 3HOVJ 1MBHA 2KP6A 3CMEI 2DFEA 1P6RA 1H88C 1O7FA 1OCOH 4BKXA 3DKWA 2BW3B 4MFDA 5F1RA 4IOCF 2O9LA 1HF0A 4IHYA 4BE0A 3O6BB 1FC3A 1NG6A 1W7PB 2DN0A 2XPVA 3BG3A 2JSPA 1KGSA 4H0EA 3EETA 1BJAA 2H1LA 3ZQFA 5BOXA 2E36A 1QPIA 3CMMA 5DYMA 1JTYA 2IGMA 3KP5A 4AD9A 4HRIA 4CCKA 2TCTA 3AG2H 3JREA 5K7FA 3FXMA 2VASA 2DPDA 3A4CA 4RS8A 2EZIA 2BY2A 2X6WA 3JRFA 1FOKA 2V1DA 1FOWA 4HG2A 2HNHA 1FBSA 2L9NA 3BQYA 4ZYEA 4G12A 1VZ0A 4A5NA 5CVJA 1ETOA 3P9CA 1VQMI 2E2HJ 4BAYA 4I2OA 4C3JJ 2XGEA 4QPOA 5F04A 2Q8KA 1K83J 4EVIA 1GV5A 2HOSA 4I09A 1ONVA 2VOOA 3F8NA 1HW2A 1XD7A 3GTMJ 2LSOA 2UV1A 4MQVA 1WZ2A 4E7LA 4YFNF 1LJ9A 5J40A 4ZZLA 4CICA 4HQEA 4A3DJ 2VKEA 2R7VA 3CO7C 3LL7A 2P81A 5FKKA 1KU7A 5IYDJ 3A0HC 2BVLA 2IPQX 2RQQA 2IRFG 1PJRA 2ID3A 1MMDA 1F4KA 3J7ZI 4BBRJ 1KU2A 2K9MA 3I4MJ 3ZMUA 3SYTA 1SEUA 4XRSA 5E3NA 1IV8A 3BZKA 1E3PA 3MKLA 2O0YA 3A01B 2WV0A 3HSRA 1BR4A 3NQOA 3F8BA 1J59A 4FETA 2BBYA 3EQLF 1IDZA 3OYAA 4J19A 3DLLF 4Y7NJ 4YG2F 1SFOJ 4A3MJ 4JBAA 3H0GJ 1R5HA 2Y0SN 2QQ8A 1WQ2A 2JA7J 1FWZA 1MBJA 1TWAJ 4HX4A 1YIJI 5JI6A 1PP8F 1MIJA 2LD5A 2COMA 3CJQB 2E7WA 5KVRA 1W1WE 3MD2A 4ESBA 3KEYA 2MSYA 3HTUA 3WTTC 2K5CA 4CO8A 1BM9A 4CUGA 3RYPA 3WHBA 1T39A 3GFLA 4MTEA 3R61A 3CC2I 3BG5A 2A69F 5CKTA 2DA5A 2FE3A 4ZJZA 2M87A 4CGZA 1R1TA 4UHTA 2OCEA 2HS5A 1WHUA 5GPCA 1FY7A 1AU7A 2QEXI 2QKMB 4L5IA 5L3FA 2P5VA 3BTLA 1YJNI 1MGTA 2QWWA 2Z1DA 2QF7A 2XAGA 4ITVA 3V4GA 3HM5A 4UVCA 4D7NA 2L9SA 2OQRA 5EZGA 4ZDPA 2IW5A 3A0BC 3PSIA 2Y9YA 3FBNB 4IZZA 2CFOA 5B1AH 2CQXA 2IS2A 1I5ZA 3VOEA 4AUXA 1H9TA 3HXLA 2MBFA 1T8IA 4R1HA 2VQCA 2GAUA 2JUGA 3BTCA 4U7DA 2IGOA 4U0VA 1I6HJ 2OTJI 4KJZA 4IRIA 1UZCA 1R9TJ 3NRVA 3DF8A 3OIPA 4BQAA 2M0CA 3HSFA 1RR7A 2VPRA 5J1UA 2DA2A 4WXDA 2MD5A 3DKYA 3HGGA 1UG0A 2DBBA 1SVMA 3VB2A 4IKFA 3F72A 1VQLI 2W4SA 1JGGA 4RAGA 1GLNA 3ECOA 1YJWI 3PSFA 2YR2A 3BR3A 1JHHA 3HSEA 3PQJA 4GYGA 2E5ZA 4PJLA 3FXLA 1AA7A 1U5TB 4XLHA 1D1CA 1TQPA 3PFIA 3BROA 1K7AA 3KP6A 3J81Z 1MBFA 2EIMH 3FXUA 2Z3YA 1O7LA 5GAEJ 2HR3A 4A0ZA 1T33A 2CJJA 2DDAA 3KP4A 3FWEA 4P9FA 2RV8A 3OYJA 4L9JA 2H6CA 1YQAA 3RKWA 2DJNA 2A68F 2ZXIA 1BC8C 4RGUA 3BJAA 4BXUA 2VUMJ 2DA1A 1W5TA 3ZPLA 2RN7A 2XAUA 1HA8A 2EV0A 2AS5F 1YW9A 3KLOA 1QRYA 2F5CA 3VSKA 2OUMA 3DPUA 2XROA 4U7BA 4XICA 2M7BA 1MNDA 3OS1A 3IUOA 1I3QJ 2OF7A 3H35A 1ZLJA 2JRMA 3SFIA 2GOXB 2BVMA 3LSIA 3TO7A 1PUFA 2KFDA 4HOBA 3H9JA 2WAEA 4HYEA 4BBSJ 3VFZA 2D2WA 2ACJA 3K4CA 2QKLB 2NAZA 2GOMA 4CCOA 4EEFG 3M07A 3ABTA 2LFBA 3K9TA 5HDNA 4HA8A 3HYIA 1IUYA 2L54A 2KDOA 3NWTA 2DU9A 3R6SA 4N9IA 4A0YA 3F21A 4UV9A 3RIRA 4HDUA 1HKSA 1ZARA 4MNUA 2LRDA 5F64A 4JX4A 1O57A 3J80K 1PDNC 5HLGA 5IYBJ 3R60A 2HQNA 1ETVA 1DU6A 2EBIA 3VEPA 1TLHB 4E7JA 4YFKF 1B6AA 3K69A 3MAJA 2GLOA 1KONA 2PI0A 3CC7I 2XHKA 2OPTA 4KT6A 2IGKA 3L1PA 1J2XA 2FD5A 3RDIA 3I55I 3OWTA 3TW6A 1XS9A 1OISA 1MSFC 2BW3A 3FKIJ 2ME6A 3VPRA 3FISA 4AIKA 1XCVA 3PUFA 3B73A 3ECHA 3IH4A 2DA7A 1BI0A 1W7PA 1P9QC 3DEEA 1JXSA 1UMQA 4L9TA 4TV7A 1UB9A 1RC9A 2EB7A 5DM6F 1OCRH 2FXAA 3HZJA 3TO6A 2X85A 5L3DA 2DPUA 4QIWN 1OQYA 4UXNA 2DK5A 4UNOA 4PGGA 4IRGA 1B8IA 3JR9A 2EZKA 2MGQA 4LK1F 1W36D 1Q1VA 4CCNA 2GXBA 2CUZA 2RQPA 4EQQA 3WE3A 3WG9A 3ZMDA 4NC6A 1MMSA 1Y6IA 4YIRX
chains in the Genus database with same CATH topology
2H27A 2M8EA 4M9XA 3F8CA 3E6CC 1IZ1A 1REPC 4AIHA 2ESHA 4UVBA 1XSVA 4A12A 2V9VA 3LQQA 2V79A 4CZZA 3WTXC 1UHWA 3I59B 2EFQA 1BI1A 2Z9OA 5TRDA 1S3JA 3LQRA 3ISPA 4ZH4F 1OKRA 3F8FA 3LAJA 1L0OC 5FFXA 1JHFA 4DQ2A 4YFXF 2UZKA 1IXRC 4HLXA 2XIGA 3FZVA 5E20A 2DLLA 3OV8A 1LB2A 3O2PE 4UVAA 3F8MA 2P5LC 1BOAA 1TNSA 3E6MA 3EUHA 2XRNA 2L02A 4KDPA 5CVIA 1FYLA 4M6YA 3Q9VA 4EJVA 2G7UA 1BIBA 1QNTA 5E1WA 5ILUA 3COAC 2OZ6A 5HLHA 1Z05A 1KQ0A 3AAFA 3VODA 1IRGA 2IJLA 3WGIA 1J5YA 2WC2A 3BZ6A 4LMYA 2IVMA 1EH8A 1T38A 1XSDA 4UUVA 3ABUA 2HYFA 2YU3A 2CFXA 1I6XA 2VE9A 5D5WB 1ZRCA 4I0AA 1R5GA 2DTRA 4LG0A 3ROUA 1QQIA 3IC7A 3IRQA 4NB5A 1EV7A 2PBIA 3P9IA 1O3QA 5D4RA 4BNCA 2ZFWA 2W84A 2GA2A 4EV0A 1Z1DA 4HF2A 3DP7A 4Y17A 4CYDA 2M1BA 2ESNA 2FF4A 3JAMK 4LB5A 2CSOA 3GUDA 4RGXA 3WTWC 5D8LB 3RKXA 1KU9A 3V7CA 1ZH5A 3I5UA 1HQCA 4G8XA 5KK1A 4YIIA 3ERED 4ESFA 5HDKA 1U8RA 2HEOA 1S7AA 2FA5A 4KICA 1BI3A 2GQQA 1TNTA 3QP6A 3HHGA 2YX4A 5A2QK 1DDNA 3IWZA 4HV6A 1G3YA 4RAYA 1BIAA 3REOA 3L00A 5LLQA 4A2UA 4PZJA 3KFWX 3O3KA 2HTJA 3L9FA 1V4RA 2VBWA 1HSJA 1FSEA 2EFWA 1R1UA 1T0FA 3KEQA 2PFBA 3KCCA 2K02A 3ML6A 1FZPB 3KP7A 1AOYA 2ZMEB 1OMIA 2FNPA 2Z33A 3U2RA 1MJ9A 3K1PA 3CJNA 3CLOA 1W4MA 2EV6A 3PQKA 1AWCA 1ZGAA 3MZYA 3F22A 1YW7A 4KA4A 3DFGA 5IT9Z 5ERIA 1ZYRF 3Q9SA 4FT8A 1ZN2A 2Q0OA 2P5KA 1RUOA 2DT5A 3KETA 1MDMB 1LNWA 5CJ9A 3MZHA 2XV4S 5L3CA 1A04A 1SFXA 4IXAA 1XGOA 4Q48A 1XGSA 3F6OA 2ZNYA 2JT1A 5D8KB 2DFIA 3MWMA 1MZBA 3GFJA 1G6NA 3KLNA 3V7SA 4EM0B 5TJJA 2JPBA 4EGYA 3I59A 2P7VB 3QU6A 4G7HF 1KYZA 4LGWA 4AIJA 5L3GA 4UV8A 2EWNA 5HS9A 2CG4A 2GXGA 3CO6C 1H9GA 2HKOA 1FLIA 3IL2A 4S04A 1O3RA 1B9NA 4ZYHA 1Z91A 2ISZA 1D8KA 3FX3A 2O6GE 3MCZA 4G6DA 3CUQC 5ICFA 2DO7A 3WGHA 3BY6A 5JVTA 2Y75A 3E97A 2CYYA 5J6XA 2EV5A 2JTVA 4M71A 3FMQA 5K5RA 3ELKA 5FD5A 1Z7UA 5ILSA 5DCFA 3ZMVA 3CUOA 4IRHA 1XGMA 2ZJ2A 3DPLC 3QU3A 2RVCA 3I0TA 1CF7B 3M8EA 2X0LA 2X4HA 4MEYF 3MEXA 2FBIA 2P4WA 3JW4A 4ON0A 3SZPA 4K2EA 5AIPA 3HRMA 4RB3C 2Q2EA 3I54A 5ED4A 1FT9A 2KJBA 2G7HA 3WU1B 1YFHA 2PG4A 2HDCA 1W5SA 2KRFA 3F6VA 3FMRA 1HKQA 2MA3A 1FBUA 3RI4A 1ZHFA 2L01A 5HS8A 1LVAA 2E1NA 2P6TA 4OIRF 4HDVA 3C3WA 1XSXA 4P5OA 4LFUA 2FEZA 1SMTA 6PAXA 5E8IA 2VC0A 1D8JA 4OU0A 2A6EF 4KT5C 4RGSA 2ZCWA 3HRTA 5DCMA 1USTA 3SFZA 3TO9A 1IXSB 3CDHA 5BS6A 1P92A 2WTEA 3I58A 2HOEA 3HHHA 3K1NA 1OPCA 2ZNZA 4O6JA 3W6KB 1UFMA 3S2WA 1Q1HA 3SQNA 3E5XA 1GXPA 3IHUA 4OOIA 2ZMEA 2XAHA 1W7PD 3QRFF 2VN2A 5E8GA 2ZBKA 2R7DA 3IRRA 1GHCA 4P55A 5D5XB 2W85A 2JZYA 1TW3A 1F9NA 1ZGJA 4L0ZB 4WF2A 2OZUA 2PN6A 5CVRA 2RGVA 1B59A 3HUGA 2O8XA 1F5TA 1XDUA 2FBHA 2LF8A 3G3ZA 3GO5A 3FXRA 1MDMA 1XMKA 1I1GA 1UHMA 2WWYA 2D1HA 2F2EA 2HKXA 2YPRA 3GWZA 5CVVA 1ZG1A 4L18B 1U6GA 2W25A 3RJPA 2OU2A 1IN8A 2RC4A 3DQVC 1J0RA 1S6LA 4OMYA 1XB4A 3BWGA 2B0LA 2K4JA 2BGCA 1WRJA 1PUEE 5LRSA 2VBXA 3C7JA 2D1VA 4Q4ZF 4JK1X 3G73A 3E6DA 2OBPA 2PEXA 3Q5FA 4KUMA 2UXNA 2O61A 2PJPA 3E3VA 3U9GA 1TTYA 3R0JA 4KN4X 3WTVC 1BN5A 3GX4X 1DPUA 3TKYA 3LWFA 5J8CA 4PDKA 4Y15A 1SD4A 5HOOA 2XAQA 1XN7A 5AIQA 1IAWA 1H0MA 1I27A 1BC7C 2OQGA 2BE5F 1G4DA 5IT3A 3M8FA 1Y0UA 3M9AA 3TGNA 1CF7A 2ZKZA 2FRHA 5L3EA 4EM2A 3BOQA 2FSWA 1E17A 2A61A 3IWFA 4KFCA 3ZMTA 1FP2A 3BPVA 4BH9A 2A5YB 2GZWA 1R22A 2LDUA 1R58A 1QZZA 2HYGD 2A6HF 2QQBA 1HKTA 3ZMSA 5CVUA 4OMZA 3BP8A 5AONA 1STZA 4O3MA 5K5QA 4Q5SF 2FOKA 1LDDA 2LNBA 4L5JA 4WX9A 5LHHA 2CW0F 2O03A 1OR7A 4B8XA 3M7GA 1IW7F 5DD4A 2VBYA 4S05A 3BPXA 4DNCA 4LLLA 4G9YA 3KP3A 1T6SA 2RNJA 1IN7A 3OOPA 1YLFA 1GXQA 2QQAA 3RPQA 1TQIA 5LGTA 4N0BA 2DI3A 2DQLA 1XDSA 4I01A 1R00A 5D6EA 3V8LA 2F5FA 2ISYA 2NYXA 5BQTA 2DAOA 4IHSA 2IA1A 4QWQA 3LA7A 5F6FA 1PP7U 1U5TA 2DQRA 2NS0A 4R8HA 5JR3A 3GEZA 2J5PA 3E5UA 3FXQA 2FNAA 3HIFA 1FBQA 4BHCA 4WCGA 1KQ9A 2BYVE 4HZFA 2QUFA 1EH7A 3ZMZA 4U0WA 3TDUC 2VOPA 4EMSA 2Z5UA 3IKTA 5ILVA 1HBXG 2QENA 4A0XA 2LF7A 4EJTA 2AXLA 3GLXA 5ICCA 1F1ZA 5FLXZ 2FU4A 3C18A 4KYWA 1RI7A 1YS7A 4MHGA 2XASA 1OYYA 2EFOA 5D5UB 4LB6B 4XLNF 4ENNA 3J81K 4EJWA 2JSCA 2E1CA 3ZQ7A 4U88A 3RKYA 2XKOA 1G3SA 4MEXF 5EEHA 2L4AA 1R1VA 3HOSA 1R7JA 4WK8F 2K7LA 3C1DA 2H09A 2NNYA 1YO5C 4XSXF 2QQ9A 3ZN1A 3J7AO 1ULYA 2EA2A 4N9HA 2EFPA 5D4SA 1XMAA 3H3ZA 2FBKA 1SD7A 1U5TC 3F3XA 1MKMA 4D0PA 3BJOA 4OIQF 3BDDA 4OIOF 2ADUA 3L2CA 5DUKA 2XVCA 5FB2A 3CTAA 4R79A 4M73A 4ENJA 3WU0A 5DEQA 2QVOA 3E6BA 1G3TA 1ZRDA 3LFKA 2FQ3A 4HF0A 4GXOA 5CYVA 1USSA 2Z99A 2L3DA 3V8KA 2K4BA 2UXXA 4A6DA 3QPTA 1HSTA 2DK8A 3IKVA 4RB2C 2HTSA 4M9ZA 3T8RA 2OA4A 4P96A 3WODF 5BMZA 1T98A 2TDXA 3LA2A 1YW8A 2CWEA 3HRSA 2KIMA 2KJCA 1SMYF 2K86A 4KNYA 1LDKB 2OAZA 5ICEA 2HFHA 2Y48A 4G94A 1V3FA 1DPRA 3L09A 2P8TA 3RTRA 2VE8A 5LGUA 4M6XA 5DDGA 2Y0MA 3K2ZA 2VC1A 2ZXJA 4L9VA 4KMUX 5K1YA 3LAPA 1WI9A 2NNNA 1P2FA 3JTHA 1WKMA 3WGGA 1IN6A 2EFNA 2ELHA 4I0BA 4MQ9F 1SAXA 2F5EA 3DXJF 3JTGA 4JQFA 1K79A 2CQKA 1ZLKA 3BJ6A 5LBQA 3FM5A 3TOAA 1ZRFA 1HW5A 4FHTA 4LLGF 1QO0D 1I1SA 4IF4A 1IRFA 2FMYA 4WWCA 1YTYA 4LJZF 2MH2A 4ZZDA 4OIPF 4YIFA 3WE2A 1FNNA 4ZYDA 3D5LA 4CXFA 4XBFA 3FM3A 1ODDA 4IPAA 4AWXB 2A3SA 1S7OA 5D6FA 4GGGA 4I02A 1QZYA 5LHIA 3V7RA 1VTNC 4HLYA 3KP2A 2UWMA 1FSHA 2STWA 2E7XA 4IHTA 2V6CA 2XAJA 4KIBA 2D45A 1S8NA 2MLKA 2V1UA 4HQMA 1LQ1A 1RZ4A 4E70A 4Y13A 5LRRA 2QM3A 3GZ6A 1EH6A 3I4PA 3FMSA 1D3YA 3R0AA 4HAMA 4FX0A 1FPQA 5J8FA 1XCBA 1QGPA 1FYMA 1HW1A 4ENMA 1ZG5A 5LEKA 2QZ8A 3K1MA 3B02A 1D5VA 5HLIA 4NQWA 2PQ8A 3LSTA 1BBYA 2XKPA 3L7WA 3JAMZ 5FLXK 2OD5A 1O3TA 2M45A 1NHAA 4CHUA 2VONA 2EK5A 1FP1D 1X3UA 4BYYA 4O5VA 3DPTA 1YS6A 1ON1A 5EEGA 5A2QZ 5D5VB 4LG0B 4ETSA 2CGPA 1JGSA 3T8TA 2XAFA 1LDJA 1E2XA 3V8JA 3ULQB 4A5MA 1WWXA 4M74A 2IP2A 1TW2A 5DV5A 1MD0A 2LKPA 4KIGA 4EJOA 2R7FA 5HVQC 3WTYC 2QBYB 4QLCU 5E1XA 3HTSB 5H6QA 4RB0A 1FX7A 4LD5A 2MLGA 3NEUA 5LGNA 3GF2A 4PGHA 5IT9K 2KKOA 2P7CB 2VT2A 2IA0A 2VXZA 3E5QA 4A6EA 1ZG3A 3T0YA 1KQ8A 1G3WA 4I98B 1QBJA 1YIOA 4EM1A 2HQRA 3KEOA 4Q47A 3WTSC 1U2WA 2VT3A 1DP7P 5DUIA 2VODA 5E17F 4IJAA 4GYIA 2XGXA 1T2KA 4BHPA 5BPDA 4KIFA 2ETHA 5E18F 5E1ZB 3CUQB 3R4KA 2QLZA 3JSOA 4HW0A 1SD6A 3K0LA 1R36A 1K78B 4B09A 2H94A 4ZYGA 4HX8A 3HOTA 1OYWA 2C6YA 1R23A 1DUXC 2JRTA 2R3SA 5FGMA 3RYRA 2V1XA 1J9IA 1IN5A 3SHFA 4KMFA 3EDPA 2BEOA 1KYWA 3FF5A 1P4XA 3SXYA 3GXOA 2J5OA 5BPIA 2W57A 1HXDA 3TDZC 2IA2A 4NHJA 5FFZA 2MC3A 5FD6A 4HF1A 3TQNA 5JHUA 5LHGA 5ICGA 1S29A 2NRAC 2STTA 3ZN0A 4G6QA 1U3EM 1Z6TA 1P4AA 2PMHA 1SFUA 1Z9CA 1U78A 1P4WA 3JSPA 4HV5A 1KU3A 3QOPA 1C0WA 2EA4A 2M5WA 1IXCA 3U1DA 3DV8A 2H6BA 1LEBA 2HZTA 1ON2A 2XUBA 1ZAOA 3RPUA 2PMUA 4LK0F 4IVNA 1SFEA 1B9MA 5HS7A 3N97A 1WSUA 2F5DA 4G7ZF 4U0YA 1CGPA 3TOBA 3I53A 3QAHA 4AVPA 4F7ZA 2GIVA 2GWRA 3KZZA 4HBLA 4I7HA 1L3LA 3I64A 3QP5A 2KIUA 1O3SA 1TQMA 2PLYA 1B4AA 5FO5A 2HWVA 4XLPF 4HX7A 3SZTA 3MFKA 2JPCA 3GFIA 2M30A 3GW2A 3FHZA 4FX4A 1IN4A 3DEUA 5K5OA 4KN7X 4LLNA 1RUNA 1QPMA 1RIOH 4WXHA 5JFRA 1KA8A 3GZ5A 4XRFA 2YSRA 1RNLA 2RKHA 3GFMA 4G7OF 4L0YB 2QBYA 1J75A 3P7NA 4MGRA 4Z2YA 1Z6RA 2IT0A 2MH9A 3ZP5A 2BV6A 5DCMB 2HGCA 1UCRA 3GVAA 3MQ0A 1SD5A 4M72A 4PCQA 4EGZA 2W24A 2QYOA 4ESJA 3H92A 2YX7A 1B1BA 3P9KA 3KE2A 4GCVA 5L3BA 3QPHA 4CDGA 5LEJA 1J7KA 3D0SA 3H3UA 2FMLA 3I71A 4WXCA 1ZREA 2VBZA 4GO1A 4L9NA 1YYVA 4XSZF 3M1EA 3N4MA 4EJUA 3J80Z 4RGRA 1GVJA 1OYIA 2K27A 4OINF 2A07F 4MTDA 2CO5A 2RDPA 3CUQA 3HRUA 1IF1A 3EYYA 3F23A 2ZO4A 2EJRA 1JE8A 4ENKA 1MJAA 2L4MA 1FYKA 2KIFA 4M9SA 1BI2A 2GA1A 1LEAA 1K6OA 3T1BA 2DW4A 5HDGA 5H20A 1MJBA 1K78A 4RB1A 3W6JB 3KZYA 2O3FA 3WTZA 2G9WA 5H6RA 4RAZA 3LA3A 1YG2A 4BHBA 3GYHX 1XGNA 1TBXA 3T5XA 2P6SA 5DD8A 4P9UA 5CLSA 4ASNA 3EYIA 3WTUC 1P6RA 1O7FA 3DKWA 5F1RA 3O6BB 1FC3A 1W7PB 1KGSA 4H0EA 3EETA 1BJAA 5BOXA 5DYMA 3KP5A 4AD9A 2DPDA 4RS8A 1FOKA 2V1DA 1FBSA 4ZYEA 4A5NA 5CVJA 3P9CA 4BAYA 4I2OA 2Q8KA 4EVIA 4I09A 1ONVA 2VOOA 3F8NA 1HW2A 1XD7A 2LSOA 4MQVA 4YFNF 1LJ9A 4ZZLA 4HQEA 4CICA 3CO7C 1KU7A 2IPQX 2IRFG 1F4KA 1KU2A 3ZMUA 2O0YA 2WV0A 3HSRA 3NQOA 3F8BA 1J59A 2BBYA 3EQLF 4YG2F 4JBAA 1R5HA 1WQ2A 1FWZA 4HX4A 5JI6A 1PP8F 2COMA 2E7WA 5KVRA 4ESBA 3WTTC 3HTUA 4CO8A 1BM9A 3RYPA 1T39A 3GFLA 4MTEA 3R61A 2A69F 2FE3A 2M87A 4CGZA 1R1TA 4UHTA 2HS5A 1FY7A 4L5IA 5L3FA 2P5VA 1MGTA 2QWWA 2XAGA 3V4GA 4UVCA 2OQRA 2IW5A 1I5ZA 3VOEA 1H9TA 2MBFA 4R1HA 2GAUA 4U7DA 4U0VA 4IRIA 3NRVA 3DF8A 4BQAA 3HSFA 4WXDA 2MD5A 2DBBA 3VB2A 3F72A 3ECOA 2YR2A 1JHHA 3HSEA 3PQJA 4GYGA 1U5TB 1TQPA 3PFIA 3BROA 1K7AA 3KP6A 3J81Z 3FXUA 2Z3YA 1O7LA 2HR3A 4A0ZA 3KP4A 3FWEA 4P9FA 2RV8A 4L9JA 2H6CA 1YQAA 3RKWA 2A68F 1BC8C 4RGUA 3BJAA 4BXUA 1W5TA 3ZPLA 2RN7A 2EV0A 2AS5F 1YW9A 3KLOA 2F5CA 2XROA 4U7BA 1ZLJA 3TO7A 4HOBA 4HYEA 3VFZA 2D2WA 2ACJA 2NAZA 3ABTA 3K9TA 5HDNA 4HA8A 3HYIA 1IUYA 2L54A 2DU9A 3R6SA 4N9IA 4A0YA 3F21A 4UV9A 3RIRA 4HDUA 1HKSA 1ZARA 4MNUA 5F64A 1O57A 3J80K 1PDNC 5HLGA 3R60A 2HQNA 3VEPA 1TLHB 4YFKF 1B6AA 3K69A 3MAJA 2PI0A 2XHKA 1J2XA 3RDIA 4AIKA 1XCVA 3B73A 3ECHA 1BI0A 1W7PA 1JXSA 4L9TA 4TV7A 1UB9A 2EB7A 2FXAA 3TO6A 5L3DA 2DPUA 4UXNA 2DK5A 4UNOA 4PGGA 4IRGA 4LK1F 2GXBA 2RQPA 4EQQA 3WE3A 3WG9A 3ZMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H27 A;  2M8E A;  4M9X A;  3F8C A;  3E6C C;  1IZ1 A;  1REP C;  4AIH A;  2ESH A;  4UVB A;  1XSV A;  4A12 A;  2V9V A;  3LQQ A;  2V79 A;  4CZZ A;  3WTX C;  1UHW A;  3I59 B;  2EFQ A;  1BI1 A;  2Z9O A;  5TRD A;  1S3J A;  3LQR A;  3ISP A;  4ZH4 F;  1OKR A;  3F8F A;  3LAJ A;  1L0O C;  5FFX A;  1JHF A;  4DQ2 A;  4YFX F;  2UZK A;  1IXR C;  4HLX A;  2XIG A;  3FZV A;  5E20 A;  2DLL A;  3OV8 A;  1LB2 A;  3O2P E;  4UVA A;  3F8M A;  2P5L C;  1BOA A;  1TNS A;  3E6M A;  3EUH A;  2XRN A;  2L02 A;  4KDP A;  5CVI A;  1FYL A;  4M6Y A;  3Q9V A;  4EJV A;  2G7U A;  1BIB A;  1QNT A;  5E1W A;  5ILU A;  3COA C;  2OZ6 A;  5HLH A;  1Z05 A;  1KQ0 A;  3AAF A;  3VOD A;  1IRG A;  2IJL A;  3WGI A;  1J5Y A;  2WC2 A;  3BZ6 A;  4LMY A;  2IVM A;  1EH8 A;  1T38 A;  1XSD A;  4UUV A;  3ABU A;  2HYF A;  2YU3 A;  2CFX A;  1I6X A;  2VE9 A;  5D5W B;  1ZRC A;  4I0A A;  1R5G A;  2DTR A;  4LG0 A;  3ROU A;  1QQI A;  3IC7 A;  3IRQ A;  4NB5 A;  1EV7 A;  2PBI A;  3P9I A;  1O3Q A;  5D4R A;  4BNC A;  2ZFW A;  2W84 A;  2GA2 A;  4EV0 A;  1Z1D A;  4HF2 A;  3DP7 A;  4Y17 A;  4CYD A;  2M1B A;  2ESN A;  2FF4 A;  3JAM K;  4LB5 A;  2CSO A;  3GUD A;  4RGX A;  3WTW C;  5D8L B;  3RKX A;  1KU9 A;  3V7C A;  1ZH5 A;  3I5U A;  1HQC A;  4G8X A;  5KK1 A;  4YII A;  3ERE D;  4ESF A;  5HDK A;  1U8R A;  2HEO A;  1S7A A;  2FA5 A;  4KIC A;  1BI3 A;  2GQQ A;  1TNT A;  3QP6 A;  3HHG A;  2YX4 A;  5A2Q K;  1DDN A;  3IWZ A;  4HV6 A;  1G3Y A;  4RAY A;  1BIA A;  3REO A;  3L00 A;  5LLQ A;  4A2U A;  4PZJ A;  3KFW X;  3O3K A;  2HTJ A;  3L9F A;  1V4R A;  2VBW A;  1HSJ A;  1FSE A;  2EFW A;  1R1U A;  1T0F A;  3KEQ A;  2PFB A;  3KCC A;  2K02 A;  3ML6 A;  1FZP B;  3KP7 A;  1AOY A;  2ZME B;  1OMI A;  2FNP A;  2Z33 A;  3U2R A;  1MJ9 A;  3K1P A;  3CJN A;  3CLO A;  1W4M A;  2EV6 A;  3PQK A;  1AWC A;  1ZGA A;  3MZY A;  3F22 A;  1YW7 A;  4KA4 A;  3DFG A;  5IT9 Z;  5ERI A;  1ZYR F;  3Q9S A;  4FT8 A;  1ZN2 A;  2Q0O A;  2P5K A;  1RUO A;  2DT5 A;  3KET A;  1MDM B;  1LNW A;  5CJ9 A;  3MZH A;  2XV4 S;  5L3C A;  1A04 A;  1SFX A;  4IXA A;  1XGO A;  4Q48 A;  1XGS A;  3F6O A;  2ZNY A;  2JT1 A;  5D8K B;  2DFI A;  3MWM A;  1MZB A;  3GFJ A;  1G6N A;  3KLN A;  3V7S A;  4EM0 B;  5TJJ A;  2JPB A;  4EGY A;  3I59 A;  2P7V B;  3QU6 A;  4G7H F;  1KYZ A;  4LGW A;  4AIJ A;  5L3G A;  4UV8 A;  2EWN A;  5HS9 A;  2CG4 A;  2GXG A;  3CO6 C;  1H9G A;  2HKO A;  1FLI A;  3IL2 A;  4S04 A;  1O3R A;  1B9N A;  4ZYH A;  1Z91 A;  2ISZ A;  1D8K A;  3FX3 A;  2O6G E;  3MCZ A;  4G6D A;  3CUQ C;  5ICF A;  2DO7 A;  3WGH A;  3BY6 A;  5JVT A;  2Y75 A;  3E97 A;  2CYY A;  5J6X A;  2EV5 A;  2JTV A;  4M71 A;  3FMQ A;  5K5R A;  3ELK A;  5FD5 A;  1Z7U A;  5ILS A;  5DCF A;  3ZMV A;  3CUO A;  4IRH A;  1XGM A;  2ZJ2 A;  3DPL C;  3QU3 A;  2RVC A;  3I0T A;  1CF7 B;  3M8E A;  2X0L A;  2X4H A;  4MEY F;  3MEX A;  2FBI A;  2P4W A;  3JW4 A;  4ON0 A;  3SZP A;  4K2E A;  5AIP A;  3HRM A;  4RB3 C;  2Q2E A;  3I54 A;  5ED4 A;  1FT9 A;  2KJB A;  2G7H A;  3WU1 B;  1YFH A;  2PG4 A;  2HDC A;  1W5S A;  2KRF A;  3F6V A;  3FMR A;  1HKQ A;  2MA3 A;  1FBU A;  3RI4 A;  1ZHF A;  2L01 A;  5HS8 A;  1LVA A;  2E1N A;  2P6T A;  4OIR F;  4HDV A;  3C3W A;  1XSX A;  4P5O A;  4LFU A;  2FEZ A;  1SMT A;  6PAX A;  5E8I A;  2VC0 A;  1D8J A;  4OU0 A;  2A6E F;  4KT5 C;  4RGS A;  2ZCW A;  3HRT A;  5DCM A;  1UST A;  3SFZ A;  3TO9 A;  1IXS B;  3CDH A;  5BS6 A;  1P92 A;  2WTE A;  3I58 A;  2HOE A;  3HHH A;  3K1N A;  1OPC A;  2ZNZ A;  4O6J A;  3W6K B;  1UFM A;  3S2W A;  1Q1H A;  3SQN A;  3E5X A;  1GXP A;  3IHU A;  4OOI A;  2ZME A;  2XAH A;  1W7P D;  3QRF F;  2VN2 A;  5E8G A;  2ZBK A;  2R7D A;  3IRR A;  1GHC A;  4P55 A;  5D5X B;  2W85 A;  2JZY A;  1TW3 A;  1F9N A;  1ZGJ A;  4L0Z B;  4WF2 A;  2OZU A;  2PN6 A;  5CVR A;  2RGV A;  1B59 A;  3HUG A;  2O8X A;  1F5T A;  1XDU A;  2FBH A;  2LF8 A;  3G3Z A;  3GO5 A;  3FXR A;  1MDM A;  1XMK A;  1I1G A;  1UHM A;  2WWY A;  2D1H A;  2F2E A;  2HKX A;  2YPR A;  3GWZ A;  5CVV A;  1ZG1 A;  4L18 B;  1U6G A;  2W25 A;  3RJP A;  2OU2 A;  1IN8 A;  2RC4 A;  3DQV C;  1J0R A;  1S6L A;  4OMY A;  1XB4 A;  3BWG A;  2B0L A;  2K4J A;  2BGC A;  1WRJ A;  1PUE E;  5LRS A;  2VBX A;  3C7J A;  2D1V A;  4Q4Z F;  4JK1 X;  3G73 A;  3E6D A;  2OBP A;  2PEX A;  3Q5F A;  4KUM A;  2UXN A;  2O61 A;  2PJP A;  3E3V A;  3U9G A;  1TTY A;  3R0J A;  4KN4 X;  3WTV C;  1BN5 A;  3GX4 X;  1DPU A;  3TKY A;  3LWF A;  5J8C A;  4PDK A;  4Y15 A;  1SD4 A;  5HOO A;  2XAQ A;  1XN7 A;  5AIQ A;  1IAW A;  1H0M A;  1I27 A;  1BC7 C;  2OQG A;  2BE5 F;  1G4D A;  5IT3 A;  3M8F A;  1Y0U A;  3M9A A;  3TGN A;  1CF7 A;  2ZKZ A;  2FRH A;  5L3E A;  4EM2 A;  3BOQ A;  2FSW A;  1E17 A;  2A61 A;  3IWF A;  4KFC A;  3ZMT A;  1FP2 A;  3BPV A;  4BH9 A;  2A5Y B;  2GZW A;  1R22 A;  2LDU A;  1R58 A;  1QZZ A;  2HYG D;  2A6H F;  2QQB A;  1HKT A;  3ZMS A;  5CVU A;  4OMZ A;  3BP8 A;  5AON A;  1STZ A;  4O3M A;  5K5Q A;  4Q5S F;  2FOK A;  1LDD A;  2LNB A;  4L5J A;  4WX9 A;  5LHH A;  2CW0 F;  2O03 A;  1OR7 A;  4B8X A;  3M7G A;  1IW7 F;  5DD4 A;  2VBY A;  4S05 A;  3BPX A;  4DNC A;  4LLL A;  4G9Y A;  3KP3 A;  1T6S A;  2RNJ A;  1IN7 A;  3OOP A;  1YLF A;  1GXQ A;  2QQA A;  3RPQ A;  1TQI A;  5LGT A;  4N0B A;  2DI3 A;  2DQL A;  1XDS A;  4I01 A;  1R00 A;  5D6E A;  3V8L A;  2F5F A;  2ISY A;  2NYX A;  5BQT A;  2DAO A;  4IHS A;  2IA1 A;  4QWQ A;  3LA7 A;  5F6F A;  1PP7 U;  1U5T A;  2DQR A;  2NS0 A;  4R8H A;  5JR3 A;  3GEZ A;  2J5P A;  3E5U A;  3FXQ A;  2FNA A;  3HIF A;  1FBQ A;  4BHC A;  4WCG A;  1KQ9 A;  2BYV E;  4HZF A;  2QUF A;  1EH7 A;  3ZMZ A;  4U0W A;  3TDU C;  2VOP A;  4EMS A;  2Z5U A;  3IKT A;  5ILV A;  1HBX G;  2QEN A;  4A0X A;  2LF7 A;  4EJT A;  2AXL A;  3GLX A;  5ICC A;  1F1Z A;  5FLX Z;  2FU4 A;  3C18 A;  4KYW A;  1RI7 A;  1YS7 A;  4MHG A;  2XAS A;  1OYY A;  2EFO A;  5D5U B;  4LB6 B;  4XLN F;  4ENN A;  3J81 K;  4EJW A;  2JSC A;  2E1C A;  3ZQ7 A;  4U88 A;  3RKY A;  2XKO A;  1G3S A;  4MEX F;  5EEH A;  2L4A A;  1R1V A;  3HOS A;  1R7J A;  4WK8 F;  2K7L A;  3C1D A;  2H09 A;  2NNY A;  1YO5 C;  4XSX F;  2QQ9 A;  3ZN1 A;  3J7A O;  1ULY A;  2EA2 A;  4N9H A;  2EFP A;  5D4S A;  1XMA A;  3H3Z A;  2FBK A;  1SD7 A;  1U5T C;  3F3X A;  1MKM A;  4D0P A;  3BJO A;  4OIQ F;  3BDD A;  4OIO F;  2ADU A;  3L2C A;  5DUK A;  2XVC A;  5FB2 A;  3CTA A;  4R79 A;  4M73 A;  4ENJ A;  3WU0 A;  5DEQ A;  2QVO A;  3E6B A;  1G3T A;  1ZRD A;  3LFK A;  2FQ3 A;  4HF0 A;  4GXO A;  5CYV A;  1USS A;  2Z99 A;  2L3D A;  3V8K A;  2K4B A;  2UXX A;  4A6D A;  3QPT A;  1HST A;  2DK8 A;  3IKV A;  4RB2 C;  2HTS A;  4M9Z A;  3T8R A;  2OA4 A;  4P96 A;  3WOD F;  5BMZ A;  1T98 A;  2TDX A;  3LA2 A;  1YW8 A;  2CWE A;  3HRS A;  2KIM A;  2KJC A;  1SMY F;  2K86 A;  4KNY A;  1LDK B;  2OAZ A;  5ICE A;  2HFH A;  2Y48 A;  4G94 A;  1V3F A;  1DPR A;  3L09 A;  2P8T A;  3RTR A;  2VE8 A;  5LGU A;  4M6X A;  5DDG A;  2Y0M A;  3K2Z A;  2VC1 A;  2ZXJ A;  4L9V A;  4KMU X;  5K1Y A;  3LAP A;  1WI9 A;  2NNN A;  1P2F A;  3JTH A;  1WKM A;  3WGG A;  1IN6 A;  2EFN A;  2ELH A;  4I0B A;  4MQ9 F;  1SAX A;  2F5E A;  3DXJ F;  3JTG A;  4JQF A;  1K79 A;  2CQK A;  1ZLK A;  3BJ6 A;  5LBQ A;  3FM5 A;  3TOA A;  1ZRF A;  1HW5 A;  4FHT A;  4LLG F;  1QO0 D;  1I1S A;  4IF4 A;  1IRF A;  2FMY A;  4WWC A;  1YTY A;  4LJZ F;  2MH2 A;  4ZZD A;  4OIP F;  4YIF A;  3WE2 A;  1FNN A;  4ZYD A;  3D5L A;  4CXF A;  4XBF A;  3FM3 A;  1ODD A;  4IPA A;  4AWX B;  2A3S A;  1S7O A;  5D6F A;  4GGG A;  4I02 A;  1QZY A;  5LHI A;  3V7R A;  1VTN C;  4HLY A;  3KP2 A;  2UWM A;  1FSH A;  2STW A;  2E7X A;  4IHT A;  2V6C A;  2XAJ A;  4KIB A;  2D45 A;  1S8N A;  2MLK A;  2V1U A;  4HQM A;  1LQ1 A;  1RZ4 A;  4E70 A;  4Y13 A;  5LRR A;  2QM3 A;  3GZ6 A;  1EH6 A;  3I4P A;  3FMS A;  1D3Y A;  3R0A A;  4HAM A;  4FX0 A;  1FPQ A;  5J8F A;  1XCB A;  1QGP A;  1FYM A;  1HW1 A;  4ENM A;  1ZG5 A;  5LEK A;  2QZ8 A;  3K1M A;  3B02 A;  1D5V A;  5HLI A;  4NQW A;  2PQ8 A;  3LST A;  1BBY A;  2XKP A;  3L7W A;  3JAM Z;  5FLX K;  2OD5 A;  1O3T A;  2M45 A;  1NHA A;  4CHU A;  2VON A;  2EK5 A;  1FP1 D;  1X3U A;  4BYY A;  4O5V A;  3DPT A;  1YS6 A;  1ON1 A;  5EEG A;  5A2Q Z;  5D5V B;  4LG0 B;  4ETS A;  2CGP A;  1JGS A;  3T8T A;  2XAF A;  1LDJ A;  1E2X A;  3V8J A;  3ULQ B;  4A5M A;  1WWX A;  4M74 A;  2IP2 A;  1TW2 A;  5DV5 A;  1MD0 A;  2LKP A;  4KIG A;  4EJO A;  2R7F A;  5HVQ C;  3WTY C;  2QBY B;  4QLC U;  5E1X A;  3HTS B;  5H6Q A;  4RB0 A;  1FX7 A;  4LD5 A;  2MLG A;  3NEU A;  5LGN A;  3GF2 A;  4PGH A;  5IT9 K;  2KKO A;  2P7C B;  2VT2 A;  2IA0 A;  2VXZ A;  3E5Q A;  4A6E A;  1ZG3 A;  3T0Y A;  1KQ8 A;  1G3W A;  4I98 B;  1QBJ A;  1YIO A;  4EM1 A;  2HQR A;  3KEO A;  4Q47 A;  3WTS C;  1U2W A;  2VT3 A;  1DP7 P;  5DUI A;  2VOD A;  5E17 F;  4IJA A;  4GYI A;  2XGX A;  1T2K A;  4BHP A;  5BPD A;  4KIF A;  2ETH A;  5E18 F;  5E1Z B;  3CUQ B;  3R4K A;  2QLZ A;  3JSO A;  4HW0 A;  1SD6 A;  3K0L A;  1R36 A;  1K78 B;  4B09 A;  2H94 A;  4ZYG A;  4HX8 A;  3HOT A;  1OYW A;  2C6Y A;  1R23 A;  1DUX C;  2JRT A;  2R3S A;  5FGM A;  3RYR A;  2V1X A;  1J9I A;  1IN5 A;  3SHF A;  4KMF A;  3EDP A;  2BEO A;  1KYW A;  3FF5 A;  1P4X A;  3SXY A;  3GXO A;  2J5O A;  5BPI A;  2W57 A;  1HXD A;  3TDZ C;  2IA2 A;  4NHJ A;  5FFZ A;  2MC3 A;  5FD6 A;  4HF1 A;  3TQN A;  5JHU A;  5LHG A;  5ICG A;  1S29 A;  2NRA C;  2STT A;  3ZN0 A;  4G6Q A;  1U3E M;  1Z6T A;  1P4A A;  2PMH A;  1SFU A;  1Z9C A;  1U78 A;  1P4W A;  3JSP A;  4HV5 A;  1KU3 A;  3QOP A;  1C0W A;  2EA4 A;  2M5W A;  1IXC A;  3U1D A;  3DV8 A;  2H6B A;  1LEB A;  2HZT A;  1ON2 A;  2XUB A;  1ZAO A;  3RPU A;  2PMU A;  4LK0 F;  4IVN A;  1SFE A;  1B9M A;  5HS7 A;  3N97 A;  1WSU A;  2F5D A;  4G7Z F;  4U0Y A;  1CGP A;  3TOB A;  3I53 A;  3QAH A;  4AVP A;  4F7Z A;  2GIV A;  2GWR A;  3KZZ A;  4HBL A;  4I7H A;  1L3L A;  3I64 A;  3QP5 A;  2KIU A;  1O3S A;  1TQM A;  2PLY A;  1B4A A;  5FO5 A;  2HWV A;  4XLP F;  4HX7 A;  3SZT A;  3MFK A;  2JPC A;  3GFI A;  2M30 A;  3GW2 A;  3FHZ A;  4FX4 A;  1IN4 A;  3DEU A;  5K5O A;  4KN7 X;  4LLN A;  1RUN A;  1QPM A;  1RIO H;  4WXH A;  5JFR A;  1KA8 A;  3GZ5 A;  4XRF A;  2YSR A;  1RNL A;  2RKH A;  3GFM A;  4G7O F;  4L0Y B;  2QBY A;  1J75 A;  3P7N A;  4MGR A;  4Z2Y A;  1Z6R A;  2IT0 A;  2MH9 A;  3ZP5 A;  2BV6 A;  5DCM B;  2HGC A;  1UCR A;  3GVA A;  3MQ0 A;  1SD5 A;  4M72 A;  4PCQ A;  4EGZ A;  2W24 A;  2QYO A;  4ESJ A;  3H92 A;  2YX7 A;  1B1B A;  3P9K A;  3KE2 A;  4GCV A;  5L3B A;  3QPH A;  4CDG A;  5LEJ A;  1J7K A;  3D0S A;  3H3U A;  2FML A;  3I71 A;  4WXC A;  1ZRE A;  2VBZ A;  4GO1 A;  4L9N A;  1YYV A;  4XSZ F;  3M1E A;  3N4M A;  4EJU A;  3J80 Z;  4RGR A;  1GVJ A;  1OYI A;  2K27 A;  4OIN F;  2A07 F;  4MTD A;  2CO5 A;  2RDP A;  3CUQ A;  3HRU A;  1IF1 A;  3EYY A;  3F23 A;  2ZO4 A;  2EJR A;  1JE8 A;  4ENK A;  1MJA A;  2L4M A;  1FYK A;  2KIF A;  4M9S A;  1BI2 A;  2GA1 A;  1LEA A;  1K6O A;  3T1B A;  2DW4 A;  5HDG A;  5H20 A;  1MJB A;  1K78 A;  4RB1 A;  3W6J B;  3KZY A;  2O3F A;  3WTZ A;  2G9W A;  5H6R A;  4RAZ A;  3LA3 A;  1YG2 A;  4BHB A;  3GYH X;  1XGN A;  1TBX A;  3T5X A;  2P6S A;  5DD8 A;  4P9U A;  5CLS A;  4ASN A;  3EYI A;  3WTU C;  1P6R A;  1O7F A;  3DKW A;  5F1R A;  3O6B B;  1FC3 A;  1W7P B;  1KGS A;  4H0E A;  3EET A;  1BJA A;  5BOX A;  5DYM A;  3KP5 A;  4AD9 A;  2DPD A;  4RS8 A;  1FOK A;  2V1D A;  1FBS A;  4ZYE A;  4A5N A;  5CVJ A;  3P9C A;  4BAY A;  4I2O A;  2Q8K A;  4EVI A;  4I09 A;  1ONV A;  2VOO A;  3F8N A;  1HW2 A;  1XD7 A;  2LSO A;  4MQV A;  4YFN F;  1LJ9 A;  4ZZL A;  4HQE A;  4CIC A;  3CO7 C;  1KU7 A;  2IPQ X;  2IRF G;  1F4K A;  1KU2 A;  3ZMU A;  2O0Y A;  2WV0 A;  3HSR A;  3NQO A;  3F8B A;  1J59 A;  2BBY A;  3EQL F;  4YG2 F;  4JBA A;  1R5H A;  1WQ2 A;  1FWZ A;  4HX4 A;  5JI6 A;  1PP8 F;  2COM A;  2E7W A;  5KVR A;  4ESB A;  3WTT C;  3HTU A;  4CO8 A;  1BM9 A;  3RYP A;  1T39 A;  3GFL A;  4MTE A;  3R61 A;  2A69 F;  2FE3 A;  2M87 A;  4CGZ A;  1R1T A;  4UHT A;  2HS5 A;  1FY7 A;  4L5I A;  5L3F A;  2P5V A;  1MGT A;  2QWW A;  2XAG A;  3V4G A;  4UVC A;  2OQR A;  2IW5 A;  1I5Z A;  3VOE A;  1H9T A;  2MBF A;  4R1H A;  2GAU A;  4U7D A;  4U0V A;  4IRI A;  3NRV A;  3DF8 A;  4BQA A;  3HSF A;  4WXD A;  2MD5 A;  2DBB A;  3VB2 A;  3F72 A;  3ECO A;  2YR2 A;  1JHH A;  3HSE A;  3PQJ A;  4GYG A;  1U5T B;  1TQP A;  3PFI A;  3BRO A;  1K7A A;  3KP6 A;  3J81 Z;  3FXU A;  2Z3Y A;  1O7L A;  2HR3 A;  4A0Z A;  3KP4 A;  3FWE A;  4P9F A;  2RV8 A;  4L9J A;  2H6C A;  1YQA A;  3RKW A;  2A68 F;  1BC8 C;  4RGU A;  3BJA A;  4BXU A;  1W5T A;  3ZPL A;  2RN7 A;  2EV0 A;  2AS5 F;  1YW9 A;  3KLO A;  2F5C A;  2XRO A;  4U7B A;  1ZLJ A;  3TO7 A;  4HOB A;  4HYE A;  3VFZ A;  2D2W A;  2ACJ A;  2NAZ A;  3ABT A;  3K9T A;  5HDN A;  4HA8 A;  3HYI A;  1IUY A;  2L54 A;  2DU9 A;  3R6S A;  4N9I A;  4A0Y A;  3F21 A;  4UV9 A;  3RIR A;  4HDU A;  1HKS A;  1ZAR A;  4MNU A;  5F64 A;  1O57 A;  3J80 K;  1PDN C;  5HLG A;  3R60 A;  2HQN A;  3VEP A;  1TLH B;  4YFK F;  1B6A A;  3K69 A;  3MAJ A;  2PI0 A;  2XHK A;  1J2X A;  3RDI A;  4AIK A;  1XCV A;  3B73 A;  3ECH A;  1BI0 A;  1W7P A;  1JXS A;  4L9T A;  4TV7 A;  1UB9 A;  2EB7 A;  2FXA A;  3TO6 A;  5L3D A;  2DPU A;  4UXN A;  2DK5 A;  4UNO A;  4PGG A;  4IRG A;  4LK1 F;  2GXB A;  2RQP A;  4EQQ A;  3WE3 A;  3WG9 A;  3ZMD A; 
#chains in the Genus database with same CATH topology
 2H27 A;  3AG1 H;  2M8E A;  2GM4 A;  1VQ6 I;  2JA2 A;  2WB1 A;  4M9X A;  3S17 J;  2QCO A;  2XF5 A;  3F8C A;  3E6C C;  1IZ1 A;  2WY8 Q;  1REP C;  1SC7 A;  1JKO C;  2PJR B;  2BZT A;  4AIH A;  1G59 A;  2ESH A;  4UVB A;  1AKH B;  1XSV A;  4A12 A;  2V9V A;  2LLK A;  3EUK L;  3LQQ A;  2AQE A;  2V79 A;  4CZZ A;  2ICW G;  3WTX C;  3OYM A;  4II2 A;  1UHW A;  3OYN A;  4XRS G;  4QPQ A;  4M6V A;  3I59 B;  2EFQ A;  1BI1 A;  4G6T B;  3RSN A;  1YOV B;  2Z9O A;  2NS7 A;  5TRD A;  1S3J A;  3LQR A;  3ISP A;  4ZH4 F;  2BY1 A;  3A01 A;  3K4K A;  1OKR A;  3F8F A;  3LAJ A;  1L0O C;  4FE7 A;  1RET A;  5FFX A;  3GBG A;  3FIW A;  1ZQ3 P;  1JHF A;  4OAZ A;  4DQ2 A;  1MMA A;  1WJC A;  2L9V A;  4YFX F;  2UZK A;  1IXR C;  4HLX A;  2XIG A;  2VKV A;  4C3H J;  4I6Z A;  3FZV A;  5E20 A;  2DLL A;  2KHM A;  3OV8 A;  1LB2 A;  3O2P E;  1SVL A;  2EQR A;  4UVA A;  3F8M A;  2RRE A;  1EKE A;  2P5L C;  2KIS A;  3W6V A;  1BOA A;  1TNS A;  2V7F A;  3K70 D;  3E6M A;  3EUH A;  2XRN A;  3PIP F;  5CQE A;  2L02 A;  4KDP A;  5CVI A;  1FYL A;  4M6Y A;  2HXO A;  3Q9V A;  3K4J A;  2E35 A;  1WGX A;  4EJV A;  4XLA A;  3D5R C;  1I3A A;  3TP0 A;  4A3J J;  2G7U A;  2R7R A;  1BIB A;  1YE9 A;  1QNT A;  5E1W A;  2F5V A;  5ILU A;  3COA C;  2HVR A;  9ANT A;  2OZ6 A;  5HLH A;  5KNL A;  1Z05 A;  4DGW B;  2V6E A;  1KQ0 A;  5HLT A;  3AAF A;  3VOD A;  1M1E B;  1IRG A;  2IJL A;  3KZI C;  3WGI A;  3W2W A;  1J5Y A;  3W2A A;  2WC2 A;  4LIU A;  3BZ6 A;  2MAB A;  4LMY A;  4DOZ A;  1X1C A;  2IVM A;  4PSX A;  3WU2 C;  3S1M J;  1D0Z A;  3W3C A;  2JJ7 A;  1EH8 A;  1WH5 A;  1T38 A;  3MN2 A;  1ETX A;  2IGN A;  5FKN A;  5GAH J;  1XSD A;  1A5J A;  1K6Y A;  4UUV A;  4BAC A;  3ABU A;  2E19 A;  1FIP A;  2HYF A;  2X51 A;  2YU3 A;  5B3S H;  2QA4 I;  2CFX A;  1I6X A;  2CQQ A;  3BR2 A;  2VE9 A;  5J4V A;  2K3F A;  5F0H A;  5D5W B;  1QHH D;  1ZRC A;  3G1L A;  4I0A A;  1R5G A;  2DTR A;  2IAI A;  1IRZ A;  4LG0 A;  1HLV A;  3G1O A;  3ROU A;  4CZC A;  1QQI A;  3IC7 A;  3IRQ A;  4NB5 A;  1EV7 A;  1SAU A;  2PBI A;  2E1M C;  3P9I A;  4XKC A;  2F48 A;  1O3Q A;  2Y31 A;  1WJF A;  2L5Q A;  5D4R A;  4BNC A;  2ZFW A;  2W84 A;  3M1C A;  2GA2 A;  3LSH A;  4EV0 A;  1Z1D A;  4HF2 A;  2R7X A;  3DP7 A;  4Y17 A;  3NAU A;  4CYD A;  1BOB A;  2DMQ A;  2M1B A;  1MNM C;  2ESN A;  4A3I J;  3S3N A;  1ERD A;  2FF4 A;  3JAM K;  4LB5 A;  2CSO A;  3GUD A;  4RGX A;  3WTW C;  5D8L B;  3RKX A;  1KU9 A;  5FRM A;  1U0J A;  3V7C A;  1GVD A;  1ZH5 A;  2X9D A;  3PNY A;  3I5U A;  3M8J A;  1HQC A;  4G8X A;  5KK1 A;  1Y8Q B;  4YII A;  3ERE D;  1JKP C;  4BJT A;  4ESF A;  5HDK A;  1U8R A;  2HEO A;  4CCJ A;  1S7A A;  2FA5 A;  4KIC A;  4C30 A;  1BI3 A;  2GQQ A;  1TNT A;  3QP6 A;  1D1A A;  3I3L A;  3HHG A;  2YX4 A;  5A2Q K;  1DDN A;  3IWZ A;  2JWT A;  4HV6 A;  1G3Y A;  4RAY A;  3ZQL A;  1BIA A;  3REO A;  1IJW C;  3L00 A;  2PX9 A;  5LLQ A;  4A2U A;  4PZJ A;  3KFW X;  3KPH A;  3O3K A;  4PJJ A;  2HTJ A;  3L9F A;  1V4R A;  2VBW A;  3K7A J;  3Q0W A;  1HSJ A;  1VQN I;  2KDZ A;  1FSE A;  3BR5 A;  5DS9 A;  2EFW A;  1TWC J;  4RM2 A;  1R1U A;  1T0F A;  4XMY A;  3SEQ A;  3KEQ A;  2ME0 A;  2PFB A;  3OS0 A;  3KCC A;  2JUC A;  2K02 A;  3K4N A;  4E7I A;  3ML6 A;  3OYB A;  3GTQ J;  1Z3X A;  2XF6 A;  1FZP B;  3KP7 A;  1AOY A;  1HOM A;  2L2O A;  4V2G A;  4NBQ A;  2ZME B;  3D1N I;  1RR8 C;  3H36 A;  3FKJ A;  1OMI A;  2FNP A;  1ETY A;  2Z33 A;  3U2R A;  1NG7 A;  3V42 A;  1VQ8 I;  1MJ9 A;  3K1P A;  3OOU A;  2R7W A;  1QA6 A;  4NC7 A;  3CJN A;  3CLO A;  1APL C;  5JVG F;  2JVH A;  2QGU A;  4HNT A;  1W4M A;  2EV6 A;  3PQK A;  4Y4R A;  1AWC A;  3DCF A;  1ZGA A;  1RKT A;  3MZY A;  3F22 A;  3L2U A;  1DQU A;  1HDD C;  1YW7 A;  4B48 A;  4HNU A;  4KA4 A;  3DFG A;  5IT9 Z;  5ERI A;  1ZYR F;  3Q9S A;  1X1D A;  3K70 C;  3HUG B;  3BG9 A;  4AU7 A;  2BXY A;  3AKZ A;  4FT8 A;  1ZN2 A;  3M3Y J;  3LOC A;  1HDP A;  2M4G A;  2Q0O A;  3BG6 A;  2P5K A;  1RUO A;  2DT5 A;  4ABZ A;  3KET A;  1IRX A;  1MDM B;  3H3V K;  2HVQ A;  1LNW A;  4ZTF A;  5LD2 C;  1BW5 A;  4H4K C;  5CJ9 A;  3ZGK A;  3MZH A;  2LTP A;  2XV4 S;  2R92 J;  5L3C A;  3HPG A;  1A04 A;  1MSE C;  1SFX A;  4IXA A;  1XGO A;  1TWF J;  1OCP A;  4Q48 A;  3A02 A;  3LSG A;  4ANJ A;  3SJM A;  3HL2 A;  1PYV A;  1XGS A;  3F6O A;  2PJR A;  1AKH A;  2ZNY A;  2I8D A;  3VYU B;  2JT1 A;  1NK3 P;  4Y3O A;  5D8K B;  5M3M J;  2DFI A;  2LVS A;  3HEF A;  3BR0 A;  3MWM A;  1MZB A;  2L7F P;  4W97 A;  1VFC A;  2HPM A;  3GFJ A;  1G6N A;  2K9S A;  5EZH A;  3KLN A;  3V7S A;  3OYD A;  2O7O A;  1ZR4 A;  4DYR A;  3MKW B;  1HC8 A;  4EM0 B;  4E7Z A;  5TJJ A;  4I99 C;  2JPB A;  4EGY A;  3I59 A;  2AHQ A;  2P7V B;  3ZCO A;  3GTP J;  3QU6 A;  1Y0N A;  3MKZ A;  4G7H F;  3BTI A;  1KYZ A;  2Y2Z A;  3OMY A;  4LGW A;  4AIJ A;  2KT0 A;  3H5R A;  2ELJ A;  5L3G A;  3H0D A;  3K4M A;  3JRI A;  4UV8 A;  2EWN A;  5HS9 A;  5GTI C;  2CG4 A;  2GXG A;  3CO6 C;  1H9G A;  3LSP A;  2HKO A;  2HXI A;  3H5A A;  1FLI A;  1TT0 A;  3IL2 A;  4BE2 A;  4S04 A;  1TL8 A;  1O3R A;  1B9N A;  3OL4 A;  2R5Y B;  4ZYH A;  1Z91 A;  2ISZ A;  1D8K A;  1X2N A;  2TRT A;  2ZJQ F;  4OAY A;  3FX3 A;  2O6G E;  2DMP A;  3VDX A;  3MCZ A;  4G6D A;  2VI6 A;  3TBI A;  4JX5 A;  4A69 C;  3CUQ C;  1ORK A;  5ICF A;  4BDZ A;  2DO7 A;  3WGH A;  3BY6 A;  5JVT A;  4I76 A;  2Y75 A;  3E97 A;  4GRI A;  4XID A;  2CYY A;  5J6X A;  3PL8 A;  3VYT B;  2EV5 A;  2JTV A;  4M71 A;  2XF7 A;  3FMQ A;  5K5R A;  3AG4 H;  3CCL I;  2V4J C;  4CSW A;  1JUM A;  3ELK A;  1ETK A;  1Z7U A;  5FD5 A;  4F3Q A;  1H89 C;  1N77 A;  2PMZ N;  5ILS A;  5DCF A;  1T08 B;  3BLY A;  3ZMV A;  2M9H A;  3K6G A;  3CUO A;  4IRH A;  4HSR A;  1XGM A;  2ZJ2 A;  3CCR I;  3DPL C;  4D9J A;  1VQ5 I;  3QU3 A;  1T95 A;  1JUS A;  4HEA 2;  3DLA A;  2DXI A;  2RVC A;  3I0T A;  1CF7 B;  4IHX A;  2V26 A;  4D7M A;  3M8E A;  2VKD A;  3ERM A;  2X0L A;  2X4H A;  4MEY F;  5F27 A;  4DIQ A;  1YHQ I;  3MEX A;  1DGW Y;  1FMV A;  2LOO A;  2AQF A;  2AXT C;  2FBI A;  2M8G X;  1ZK8 A;  3AL0 C;  2P4W A;  1XC5 A;  1D0Y A;  3JW4 A;  2A5W A;  3WHC A;  4ON0 A;  3SZP A;  4K2E A;  3OS2 A;  5AIP A;  3HRM A;  2JQ7 A;  1MH3 A;  4RB3 C;  2Q2E A;  4BGD A;  3I54 A;  2DA6 A;  4A3E J;  3DTI A;  2DDB A;  5ED4 A;  1FT9 A;  1EJ9 A;  1G8X A;  4JOM A;  2KJB A;  1ETQ A;  2G7H A;  2BOL A;  4HNV A;  5J1R A;  3HOW J;  4BUP A;  1S9H A;  2XSD C;  3WU1 B;  1P7I A;  1YFH A;  2LRE A;  2JN6 A;  2PG4 A;  2XPW A;  1W5S A;  2HDC A;  2JMW A;  2KRF A;  3NAR A;  3QWL A;  3F6V A;  3ZR8 X;  2KQR A;  3FMR A;  2JA5 J;  1HKQ A;  2MA3 A;  2JA6 J;  1FBU A;  3ABL H;  1ZHF A;  2L01 A;  3RI4 A;  1ZKG A;  3S93 A;  5HS8 A;  2E2I J;  3S8P A;  1LVA A;  3JRD A;  2E1N A;  1MNE A;  3JRB A;  5F0F A;  3CZ6 A;  2P6T A;  4OIR F;  3SZG A;  4HDV A;  3C3W A;  3FBI B;  4PJM A;  1XSX A;  4P5O A;  5TIS C;  2V9K A;  1JKR C;  4LFU A;  2FEZ A;  1SMT A;  1KZH A;  2HYJ A;  6PAX A;  4FIS A;  2Y0S A;  5E8I A;  4BS9 A;  3OYK A;  2VC0 A;  1D8J A;  4OU0 A;  2A6E F;  4KT5 C;  4RGS A;  2ZCW A;  3QOE A;  2XB0 X;  3HRT A;  5DCM A;  3A2K A;  1UST A;  3SFZ A;  3CP8 A;  3TO9 A;  1IXS B;  3CDH A;  3EUA A;  4BJ5 C;  5BS6 A;  1P92 A;  2WTE A;  3I58 A;  2HOE A;  3HHH A;  3TED A;  3K1N A;  3PIO F;  4C9Y A;  1OPC A;  1R5I D;  4PFP A;  2ZNZ A;  1V5G A;  4O6J A;  1YRN B;  3CMA I;  3CCS I;  5IOZ A;  1D5Y A;  3W6K B;  1JUP A;  3E0J B;  1UFM A;  3S2W A;  1Q1H A;  3SQN A;  3E5X A;  4IL6 C;  1GXP A;  3IHU A;  3IH3 A;  4OOI A;  3NWS A;  5EEA A;  2ZME A;  1Z0X A;  2Z2S B;  2DFH A;  2XAH A;  1W7P D;  5HOD A;  3QRF F;  2VN2 A;  3BR1 A;  3HOZ J;  3BT9 A;  2DA3 A;  2JVG A;  3CQZ J;  5E8G A;  2ZBK A;  4DBR A;  2R7D A;  3IRR A;  1GHC A;  4P55 A;  1IV6 A;  5D5X B;  3FDY A;  2W85 A;  1X4O A;  1FOX A;  2JZY A;  1TWH J;  1TW3 A;  1F9N A;  1ZGJ A;  4XOR A;  4ZC3 A;  3C2G A;  2WA0 A;  5CQG A;  4L0Z B;  2WAQ N;  2OZU A;  4WF2 A;  2EIN H;  2PN6 A;  4XQF A;  5CVR A;  2RGV A;  1B59 A;  3HUG A;  2OCC H;  3GME A;  4UUS B;  3LSM A;  5B1B H;  2I10 A;  2O8X A;  2VXD A;  1XDU A;  5IP9 J;  1F5T A;  2FBH A;  4B1R A;  2LF8 A;  3G3Z A;  3GO5 A;  3FXR A;  4IO9 F;  3IV5 A;  1POG A;  1MDM A;  3P5J A;  2E5N A;  2VJ5 A;  3QYB A;  3VYR B;  2M4K A;  1XMK A;  1I1G A;  2L7Z A;  4XOT A;  1UHM A;  2WWY A;  2D1H A;  1JT0 A;  1F36 A;  2F2E A;  2R7U A;  2HKX A;  3PJR A;  2YPR A;  3GWZ A;  5CVV A;  2UUZ A;  1ZG1 A;  1WI3 A;  4L18 B;  2F6C A;  3FXJ A;  3PNT A;  1MBK A;  1U6G A;  2W25 A;  4UB8 C;  4Y33 A;  3RJP A;  1U8B A;  1VQP I;  2OU2 A;  1IN8 A;  2RC4 A;  2E1O A;  2BHZ A;  3DQV C;  1J0R A;  1WJE A;  1S6L A;  4B44 A;  4E4H A;  1ZR2 A;  3L2V A;  3KX2 A;  4OMY A;  1XB4 A;  3L2R A;  3BWG A;  2NVX J;  3CMY A;  2B0L A;  2K4J A;  3OYC A;  2BGC A;  1Z3Y A;  1WRJ A;  1PUE E;  4BU2 A;  2K3P A;  3KYC B;  5LRS A;  2F4O B;  4DBQ A;  2KL4 A;  3IP4 B;  2VBX A;  1WJB A;  3C7J A;  2D1V A;  4YEL A;  3OYI A;  2WAD A;  4Q4Z F;  3DBR B;  2Q1Z B;  2ZC2 A;  3AFH A;  4JK1 X;  3G73 A;  5EJC A;  4ZYA A;  3LFU A;  3QYE A;  5M5Y J;  1X58 A;  1R6R A;  3E6D A;  3S14 J;  1R4M B;  3QQA A;  1S7E A;  5JHF A;  2R5Y A;  1X19 A;  1IC8 A;  2CUF A;  2OBP A;  2PEX A;  4KUM A;  3Q5F A;  2UXN A;  2O61 A;  2PJP A;  2CRG A;  3E3V A;  3U9G A;  3CJT B;  1TTY A;  4E7S A;  1PVE A;  3R0J A;  4KN4 X;  4B47 A;  3A03 A;  3WTV C;  4BXX J;  1BN5 A;  1LFU P;  1Z7L A;  3GX4 X;  3TKY A;  1DPU A;  4AID A;  3LWF A;  1JJ8 C;  5J8C A;  4PDK A;  2CW7 A;  4Y15 A;  1SD4 A;  3HOX J;  3MVP A;  2XAQ A;  5HOO A;  1XN7 A;  5AIQ A;  4X1E A;  1IAW A;  1H0M A;  3DTE A;  1I27 A;  2EIL H;  4PJ0 C;  3OYE A;  1BC7 C;  2E60 A;  3RQ4 A;  1VND A;  2OQG A;  4CCL A;  2BE5 F;  3OY9 A;  2QSF X;  1G4D A;  5IT3 A;  1X1A A;  4F92 B;  2MFZ A;  3M8F A;  4F93 B;  3HKZ N;  1Y0U A;  3M9A A;  1GV2 A;  3TGN A;  1CF7 A;  5FJ8 J;  2ZKZ A;  2FRH A;  3CCY A;  5L3E A;  4EM2 A;  3BOQ A;  1IO2 A;  2FSW A;  4RAF A;  1E17 A;  1Y8R B;  2LBF B;  2A61 A;  2X1E A;  4AYB N;  5HNF A;  3J7A Y;  3ZQQ A;  3S3O A;  3IWF A;  4BEH B;  1R4N B;  4P1W A;  4KFC A;  3ZMT A;  3JRC A;  2IS4 A;  4IX7 A;  1FP2 A;  1A35 A;  1W0U A;  3BPV A;  5GAG J;  5F08 A;  4BH9 A;  2VJI A;  2A5Y B;  3FXO A;  2GZW A;  1R22 A;  2LDU A;  3GZN B;  1LUJ B;  1R58 A;  1QZZ A;  2HYG D;  2A6H F;  2H8R A;  2QQB A;  3OYF A;  1HKT A;  3ZMS A;  2LR8 A;  3PO2 J;  1TP4 A;  5CVU A;  4OMZ A;  3Q0U A;  2JA8 J;  1LFB A;  3BP8 A;  1HCR A;  5CPR B;  5AON A;  1STZ A;  4XLC A;  2CMP A;  4O3M A;  5K5Q A;  2ZJP F;  1V54 H;  1TC3 C;  3PO3 J;  4Q5S F;  1SAN A;  2FOK A;  1LDD A;  2LNB A;  4QSH A;  3GLL A;  4L5J A;  4WX9 A;  3ZRG A;  3LSR A;  5LHH A;  2CW0 F;  4A3L J;  2O03 A;  3F0C A;  1OR7 A;  4B8X A;  3M7G A;  1IW7 F;  2FJ1 A;  3QPL A;  2VBY A;  5DD4 A;  2KRC A;  4S05 A;  2DYS H;  2W1O A;  3OSG A;  1X1P A;  3BPX A;  2DOF A;  1A31 A;  4DNC A;  4LLL A;  3H9G A;  4M3F A;  4G9Y A;  4OWR B;  3KP3 A;  3M4O J;  2R5Z B;  1T6S A;  2RNJ A;  2ECC A;  1IN7 A;  2R0Q C;  1WJA A;  3OOP A;  5K7H A;  4B3X A;  4NUB A;  1YLF A;  4KIT B;  3OYH A;  1NK2 P;  1GXQ A;  2OTL I;  2QQA A;  3RPQ A;  1TQI A;  5LGT A;  3PUB A;  4AM3 A;  4N0B A;  2DI3 A;  2DQL A;  4PK4 A;  1VQK I;  1XDS A;  4I01 A;  1R00 A;  1FOY A;  3BCB A;  4IEJ A;  5D6E A;  3V8L A;  5EDN A;  3RKQ A;  1BL0 A;  3CCU I;  4XLF A;  3TP3 A;  2F5F A;  2ISY A;  2NYX A;  2WV1 A;  3CCV I;  5BQT A;  2DAO A;  4AVZ A;  4IHS A;  2IA1 A;  3ZQC A;  2COB A;  4QWQ A;  3LA7 A;  4U87 A;  5F6F A;  1PP7 U;  1G2H A;  1U5T A;  2XSJ C;  3H5N A;  4M3D A;  2DQR A;  2I5U A;  2NS0 A;  1YRN A;  4R8H A;  4D5C A;  5JR3 A;  3GEZ A;  2DOE A;  2J5P A;  2P0W A;  3E5U A;  3FXQ A;  2FNA A;  5IOY A;  3HIF A;  3H1C A;  1FBQ A;  4BHC A;  2IS1 A;  4XN3 A;  4WCG A;  1KQ9 A;  2BYV E;  1BR1 A;  2X6O A;  4HZF A;  3BG7 A;  2QUF A;  2R93 J;  1EH7 A;  2FX0 A;  3ZMZ A;  3C2B A;  3Q0V A;  4II3 A;  4U0W A;  1D0X A;  3TDU C;  2ZFU A;  2VOP A;  4EMS A;  2Z5U A;  3IKT A;  5ILV A;  3HB9 A;  1HBX G;  2QEN A;  4A0X A;  2LF7 A;  4EJT A;  4JP0 A;  2AXL A;  3EUH C;  3GLX A;  5ICC A;  1F1Z A;  1MBE A;  2B63 J;  5FLX Z;  2VIX A;  2FU4 A;  3DWL E;  2X1D A;  3C18 A;  4B43 A;  4UUT A;  4UUS A;  4KYW A;  1W36 C;  1RI7 A;  2RNG A;  1YS7 A;  2CU7 A;  4MHG A;  2XAS A;  1OYY A;  2EFO A;  4LB6 B;  5D5U B;  5DM7 F;  3ASO H;  4XLN F;  5JLW A;  4RMN A;  2XPU A;  3HOY J;  4ENN A;  3ABM H;  1S72 I;  4NDL A;  3J81 K;  4EJW A;  2X6X A;  2JSC A;  3S3M A;  2E1C A;  2E71 A;  1VI0 A;  1Z67 A;  3ZQ7 A;  4U88 A;  3RKY A;  2XKO A;  1G3S A;  4MEX F;  4NQW B;  1ITY A;  1E3O C;  3JCU C;  5EEH A;  1N78 A;  2L4A A;  3TL4 X;  2VKH A;  1R1V A;  1R7J A;  3HOS A;  4UY8 I;  4WK8 F;  3C1D A;  2K7L A;  3BTJ A;  3Q3S A;  5EGO B;  3B6C A;  2H09 A;  2NNY A;  1YO5 C;  4XSX F;  3TW7 A;  2QQ9 A;  3ZN1 A;  3J7A O;  1NTC A;  1DGR M;  1ZEL A;  1ULY A;  4DYQ A;  3IAS 2;  5K7Z A;  2EA2 A;  4N9H A;  2EFP A;  5D4S A;  4B3A A;  1XMA A;  3H3Z A;  3OYL A;  2FBK A;  1SD7 A;  1U5T C;  2HDD A;  5DTD A;  3F3X A;  1MKM A;  2EIK H;  5FLM J;  4IHW A;  4D0P A;  3BJO A;  4OIQ F;  3BDD A;  4F55 A;  4GFB A;  4OIO F;  2ADU A;  2M0M A;  1Y1W J;  5E3M A;  2CUJ A;  3L2C A;  5GPA A;  4BY1 J;  5DUK A;  2XVC A;  2CUE A;  5FB2 A;  3GTL J;  4A93 J;  3CTA A;  4CYC B;  4R79 A;  4M73 A;  4LG3 A;  5B5E C;  3ZQI A;  2MYS A;  1IG7 A;  4ENJ A;  3HOU J;  2LY2 A;  5LFA A;  3WU0 A;  1ACI A;  4XM3 A;  5DEQ A;  2QVO A;  3E6B A;  5F0C A;  1G3T A;  2GIZ A;  1ZRD A;  3LFK A;  2FQ3 A;  4HF0 A;  4B4C A;  2ZXH A;  4GXO A;  5CYV A;  5JLX A;  1USS A;  2Z99 A;  2L3D A;  3V8K A;  2DJI A;  2DOA A;  2K4B A;  2UXX A;  3E1S A;  3QPT A;  1HST A;  4A6D A;  5J1Y A;  3SEZ A;  2HVS A;  2X48 A;  1SVO A;  2R7Z J;  2DK8 A;  3IKV A;  5C4X J;  3MKY B;  4RB2 C;  2HTS A;  4A3C J;  4M9Z A;  3T8R A;  1OCZ H;  2N8G A;  3ZQG A;  4E7K A;  2LP0 A;  3KIO A;  4XKW A;  3HDD A;  2OA4 A;  2HZD A;  1R49 A;  4LOC A;  4P96 A;  3WOD F;  3ASN H;  2A6T A;  5BMZ A;  1H8A C;  1N25 A;  1T98 A;  2TDX A;  3LA2 A;  2R7Q A;  1WJ5 A;  2EH3 A;  1YW8 A;  2CWE A;  2MD0 A;  1VQ9 I;  3HRS A;  3DKX A;  3G71 I;  2AO9 A;  4BEH A;  3E7L A;  2KIM A;  1V5E A;  2KJC A;  1JT6 A;  1SMY F;  1T0F C;  4F91 B;  3W2V A;  1VQ7 I;  2K86 A;  4KNY A;  1LDK B;  2OAZ A;  2OJE D;  5ICE A;  2HFH A;  4DYC A;  2Y48 A;  4G94 A;  1V3F A;  1DPR A;  3L09 A;  2P8T A;  4RLQ A;  3RTR A;  2VE8 A;  4M3B A;  2ZB9 A;  4DW6 A;  4XKB A;  5LGU A;  1A36 A;  4M6X A;  3J7Y J;  4XRM A;  1MMG A;  1AHD P;  1JI8 A;  5FKM A;  5DDG A;  3G4S I;  3ZOB A;  2Y0M A;  3K2Z A;  2VC1 A;  5E79 C;  3HPH A;  2ZXJ A;  1ENH A;  1LE8 B;  4L9V A;  1BR2 A;  4KMU X;  5K1Y A;  3LAP A;  1WI9 A;  2NNN A;  3HBL A;  2H8W A;  1FIA A;  1FMW A;  1T56 A;  1P2F A;  2EPF A;  3PNV A;  4NNJ A;  3JTH A;  1WKM A;  3WGG A;  1IN6 A;  2EFN A;  2O8K A;  2ELH A;  2NXN B;  1DP3 A;  1I39 A;  2LKX A;  2LG4 A;  4I0B A;  4MQ9 F;  3VWB A;  4Z6Y A;  1SAX A;  2F5E A;  3DXJ F;  4JYK A;  3JTG A;  1GUU A;  1B8I B;  1SFK A;  4A3G J;  5HNH A;  4JQF A;  2R5Z A;  1K79 A;  2CQK A;  3S2D J;  1ZLK A;  3CES A;  3BJ6 A;  5LBQ A;  3FM5 A;  3TOA A;  1ZRF A;  1HW5 A;  1QVT A;  4V19 K;  4FHT A;  4XLE A;  4LLG F;  2XDV A;  1QO0 D;  2L9R A;  4IF4 A;  5J47 A;  1I1S A;  1IRF A;  2FMY A;  3RZO J;  4WWC A;  2CH0 A;  4DJA A;  1YTY A;  4LJZ F;  2MH2 A;  4N4O B;  4C2U A;  4M3E A;  4ZZD A;  4OIP F;  3BCA A;  4PJN A;  3SDB A;  4YIF A;  3S16 J;  3WE2 A;  1FNN A;  3D5S C;  3D5L A;  4ZYD A;  4CXF A;  3I4N J;  3LNQ A;  4XBF A;  3FM3 A;  1ODD A;  3KYD B;  2KZV A;  4IPA A;  4AWX B;  2A3S A;  2NOJ B;  1S7O A;  2KZG A;  5IYC J;  5KCM A;  5IY5 H;  4FCY A;  5D6F A;  4GGG A;  4I02 A;  1QZY A;  2DFF A;  4CCM A;  2VJ4 A;  4UB6 C;  3V7R A;  5LHI A;  2BY0 A;  1VTN C;  2PMZ A;  4HLY A;  3KP2 A;  2UWM A;  1FSH A;  5GTH C;  3KYL A;  5F1J A;  2STW A;  2E7X A;  1YIT I;  3OL3 A;  4IHT A;  4IHV A;  2V6C A;  2IXS A;  2XAJ A;  4KIB A;  2D45 A;  5BNG A;  1S8N A;  2E1M B;  2MLK A;  2V1U A;  4HQM A;  5E3O A;  2Y30 A;  1Z77 A;  5J3L A;  1LQ1 A;  1RZ4 A;  4E70 A;  2Y9Z A;  4Y13 A;  3JRG A;  5LRR A;  1WFX A;  5J4Y A;  2QM3 A;  3AG3 H;  3GZ6 A;  1EH6 A;  3GTO J;  3I4P A;  3FMS A;  1D3Y A;  3R0A A;  4XKV A;  4HAM A;  4FX0 A;  1FPQ A;  1UJ8 A;  3DU6 A;  5J8F A;  1WPK A;  1XCB A;  1QGP A;  1FYM A;  2VPL A;  2DT6 A;  1HW1 A;  2EZH A;  4ENM A;  1ZG5 A;  1MBG A;  2BHY A;  4MLO A;  2LY1 A;  5LEK A;  2QZ8 A;  3K1M A;  3B02 A;  3QPS A;  1D5V A;  5HLI A;  2MC4 A;  4NQW A;  2HU9 A;  4F52 A;  2PQ8 A;  3LST A;  5EGO A;  2O5R A;  1BBY A;  3CCJ I;  3MMY B;  1XTA A;  1TZL A;  2K9N A;  2XKP A;  4D5F A;  4RBO A;  3BR6 A;  2ZSI B;  3K4L A;  3L7W A;  4ZTJ A;  3JAM Z;  3S15 J;  4FQG A;  1K61 A;  5FLX K;  2L7K A;  2OD5 A;  1O3T A;  2CV0 A;  2M45 A;  1NHA A;  4CHU A;  5EG0 B;  3HJE A;  2VON A;  2MW8 A;  2EK5 A;  1W5C C;  1FP1 D;  2FUG 2;  4AC0 A;  1X3U A;  2M34 A;  5H2F C;  4BYY A;  1RKW A;  4O5V A;  1B72 B;  1NH3 A;  2F4M B;  1ETW A;  3DPT A;  2WY7 Q;  1YS6 A;  1ON1 A;  2XRL A;  5EEG A;  5A2Q Z;  5D5V B;  3L2W A;  4LG0 B;  1Y1V J;  3JRA A;  4ETS A;  4FTH A;  3UKG A;  2CV2 A;  5M5W J;  1J09 A;  5M5X J;  4CYC A;  1V55 H;  5IPA A;  1JJ6 C;  4MIM A;  1UHS A;  1GT0 C;  3GTJ J;  2X1C A;  3PFY A;  2CGP A;  1JGS A;  3T8T A;  2XAF A;  4NC8 A;  1N75 A;  1LDJ A;  2DMN A;  2KPM A;  4HST A;  1E2X A;  3PM1 A;  4XNF A;  1EF4 A;  3V8J A;  3ULQ B;  4A5M A;  1WWX A;  4M74 A;  5EYR A;  4BY7 J;  2ID6 A;  2IP2 A;  1E0E A;  2VL8 A;  1TW2 A;  3OR1 C;  5DV5 A;  1QHG A;  4C3I J;  3L2Q A;  1MD0 A;  2LKP A;  3FXK A;  4KIG A;  4EJO A;  3K2A A;  2R7F A;  1XX5 A;  5HVQ C;  4BE1 A;  3WTY C;  2QBY B;  1S5L C;  2K85 A;  2VQG A;  4QLC U;  5E1X A;  2NS8 A;  3HTS B;  4PUS A;  1IDY A;  5H6Q A;  4RB0 A;  1FX7 A;  4PSW A;  4LD5 A;  2MLG A;  2WAQ A;  3NEU A;  3QYF A;  3GF2 A;  5LGN A;  1QU3 A;  4PGH A;  5IT9 K;  2KKO A;  2D5V A;  2P7C B;  2VLA A;  2JK3 A;  3HC7 A;  3RQI A;  2VT2 A;  2IA0 A;  1LFP A;  2VXZ A;  3E5Q A;  4A6E A;  1WJD A;  1ZG3 A;  3T0Y A;  1JKQ C;  1KQ8 A;  1G3W A;  3GTG J;  4I98 B;  1I50 J;  4GDF A;  3S2H J;  2HI3 A;  1QBJ A;  2M7A A;  1YIO A;  2HPI A;  1IUF A;  2ZME C;  1XMX A;  4ZDO A;  4EM1 A;  2IS6 A;  2HQR A;  3CDI A;  3CCE I;  3GCM A;  3KEO A;  5FRO A;  4Q47 A;  2V9P A;  3WTS C;  1U2W A;  2DYR H;  2RAE A;  3K10 A;  1WCM J;  2Y69 H;  4BQQ A;  1Z21 A;  1OLT A;  2VT3 A;  5FKL A;  5DUI A;  1DP7 P;  2VOD A;  2VQL A;  2WB1 N;  5E17 F;  4IQ4 A;  4IJA A;  4GYI A;  2XGX A;  1T2K A;  4BHP A;  5BPD A;  1DU0 A;  3C2H A;  5GP9 A;  4KIF A;  3ABK H;  2ETH A;  1XG1 A;  1UAA A;  5IP6 A;  2R4G A;  5E18 F;  5E1Z B;  1LE8 A;  3CUQ B;  3R4K A;  2QLZ A;  3OIQ A;  3CD6 I;  3ZXS A;  1MH4 A;  4E7H A;  3JSO A;  4HW0 A;  1SD6 A;  4FAS D;  2GBY A;  3S1N J;  2NVU B;  3K0L A;  4YEJ A;  1TWG J;  1R36 A;  1K78 B;  2XC7 A;  5GAD J;  4DZP A;  2VQH A;  4B09 A;  2H94 A;  1QVU A;  2ZSH B;  4ZYG A;  4HX8 A;  3FHN A;  4ZDL A;  4QTR A;  1O4X A;  4C2T A;  2W7N A;  3HOT A;  3RPU D;  1OYW A;  1ZTR A;  1W0T A;  1BJZ A;  2C6Y A;  1LVK A;  1R23 A;  3S1R J;  1DUX C;  4Y52 J;  2JRT A;  2R3S A;  5FGM A;  4RM3 A;  3RYR A;  1IGN A;  2V1X A;  1J9I A;  1K4T A;  3X2Q H;  1IN5 A;  2LKS A;  3ONQ A;  3HG9 A;  3OR2 C;  1OJL A;  3SHF A;  4KMF A;  2H1K A;  2KLO A;  3EDP A;  4MFE A;  2ELK A;  2BEO A;  3AL0 B;  1KYW A;  3FF5 A;  3CLQ A;  3G2B A;  2DCE A;  4BDY A;  1BA5 A;  1P4X A;  2OV7 A;  3SXY A;  3GXO A;  4X0G A;  1TT5 B;  1OCC H;  2J5O A;  5BPI A;  2W57 A;  1HXD A;  2OC6 A;  3TDZ C;  3TMO A;  3CCQ I;  2Z16 A;  3I56 I;  3GTK J;  2KIQ A;  2XGD A;  4EAT A;  3RCO A;  2IA2 A;  4NHJ A;  5FFZ A;  2MC3 A;  5FD6 A;  3CCM I;  4HF1 A;  3K4B A;  3TQN A;  1V5F A;  5JHU A;  3DU5 A;  3HKZ A;  5LHG A;  5ICG A;  1S29 A;  2NRA C;  1OFC X;  4FE4 A;  2R7T A;  3BQZ A;  2STT A;  4IQJ A;  3O8H A;  3ZN0 A;  4G6Q A;  3VYS B;  1U3E M;  3FK7 A;  1Z6T A;  2K40 A;  4AYB A;  1X2M A;  3RZD J;  3A1Y A;  1P4A A;  2PMH A;  2XB5 A;  2EIJ H;  2DA4 A;  3LSJ A;  1EA3 A;  2B9S A;  1SFU A;  4KIS A;  1Z9C A;  1U78 A;  1P4W A;  2BXZ A;  3DTK A;  3JSP A;  4HV5 A;  3CP2 A;  1KU3 A;  4XL9 A;  4D1Q A;  3ESW B;  2V1N A;  2DMU A;  2L0K A;  3FK6 A;  2HOA A;  3QOP A;  4CH7 A;  2EA4 A;  1C0W A;  4JX6 A;  2M5W A;  1IXC A;  2K9Q A;  3LMM A;  3U1D A;  3DV8 A;  3MZ8 A;  2H6B A;  3HGY A;  5TGT A;  1RRJ A;  3OYG A;  1LEB A;  3QOD A;  2HZT A;  3UR3 C;  1ON2 A;  2GXA A;  4S0H B;  2XUB A;  1ZAO A;  2DMT A;  3RPU A;  2PMU A;  4LK0 F;  3H9Q A;  4L5E A;  1XPX A;  4IVN A;  1SFE A;  1Y56 A;  3U21 A;  2NOG A;  2YU9 J;  1B9M A;  1X1B A;  2W00 A;  2LC2 A;  5HS7 A;  3N97 A;  1WSU A;  2F5D A;  4G7Z F;  4U0Y A;  1CGP A;  3TOB A;  3I53 A;  3QAH A;  4AVP A;  4F7Z A;  2GIV A;  3B6A A;  2GWR A;  4A3B J;  4BQO A;  3KZZ A;  4HBL A;  1LPQ A;  2HQA A;  3OIO A;  2R7S A;  1QZE A;  5FRN A;  5EG0 A;  3O8G A;  4I7H A;  5FLV A;  1L3L A;  1YX5 A;  2B7E A;  2VB6 A;  2Q2E B;  3CJR B;  3I64 A;  1E3H A;  3QP5 A;  2KIU A;  3IAM 2;  5KAF C;  1O3S A;  4E6K G;  1B72 A;  4HPQ A;  2IEK A;  1TQM A;  5B66 C;  4RLF A;  2PLY A;  2NVY J;  1B4A A;  2LYC A;  1D1B A;  3LSK A;  4X6A J;  5FO5 A;  2HWV A;  4XLP F;  4HX7 A;  2LK2 A;  4DZJ A;  4PFO A;  1R71 A;  3SZT A;  3MFK A;  2JPC A;  1JTX A;  2W82 A;  1X4P A;  2CS3 A;  2L7M P;  4XN0 A;  3GFI A;  2M30 A;  4N4N B;  3GW2 A;  3FHZ A;  4FX4 A;  1OR7 C;  1ZGW A;  4YRV A;  1IN4 A;  3DEU A;  5K5O A;  3DEW A;  3SDG A;  3G1M A;  4KN7 X;  4LLN A;  1RUN A;  1QPM A;  1RIO H;  1LKX A;  3U1K A;  4WXH A;  2E2J J;  5JFR A;  1KA8 A;  2E34 A;  3GZ5 A;  4XRF A;  2MG4 A;  2YSR A;  1RNL A;  4LIT A;  3UNG C;  2RKH A;  3S1Q J;  3GFM A;  3G6E I;  3DBL B;  4J00 A;  5KAI C;  1FTT A;  1U9O A;  4CA0 A;  4BQN A;  4G7O F;  2M3A A;  4L0Y B;  2M2E A;  2QBY A;  2FOW A;  1J75 A;  2R7O A;  1UEL B;  3P7N A;  4MGR A;  1RPW A;  4Z2Y A;  1Z6R A;  2IT0 A;  1YX3 A;  2MH9 A;  4C2M J;  2G0E A;  3ZP5 A;  2BV6 A;  5DCM B;  1VF9 A;  2HGC A;  3CF2 A;  1UCR A;  3GVA A;  5C4J J;  1MW7 A;  4J01 A;  1X3Z B;  3MQ0 A;  1VQO I;  1SD5 A;  4M72 A;  4PCQ A;  4EGZ A;  2BY3 A;  2W24 A;  5FKO A;  2X6Y A;  4XON A;  2F4I A;  2XGC A;  2QYO A;  4ESJ A;  3H92 A;  2YX7 A;  5C3E J;  1B1B A;  1U9N A;  3CF5 F;  2NVT J;  2ZJR F;  2YUS A;  2KMU A;  3P9K A;  3KE2 A;  3BZC A;  2CV1 A;  1OCT C;  2HOT A;  4GCV A;  5L3B A;  4LIV A;  2W48 A;  3QPH A;  4CDG A;  5LEJ A;  1J7K A;  3D0S A;  1RES A;  1YJ9 I;  4M3G A;  4V2F A;  3H3U A;  2DOD A;  2FML A;  3I71 A;  4WXC A;  1ZRE A;  1YI2 I;  3WG7 H;  2VBZ A;  2WBM A;  1FTZ A;  4GO1 A;  4L9N A;  1YYV A;  4XSZ F;  3M1E A;  3N4M A;  4XR6 A;  3VSL A;  4EJU A;  3J80 Z;  4RGR A;  4W1U A;  1GVJ A;  3JRH A;  1OYI A;  2K27 A;  4OIN F;  1BW6 A;  2A07 F;  2LY9 A;  4BJ6 C;  4MTD A;  2CO5 A;  4BXF A;  2HDW A;  2ECB A;  2CQ7 A;  2IBD A;  2RDP A;  3CUQ A;  3HRU A;  2FQ4 A;  3I9V 2;  1IF1 A;  3EYY A;  1X3W B;  3BC8 A;  1GDT A;  3F23 A;  2A05 A;  2ZO4 A;  2EJR A;  2VJJ A;  1JE8 A;  2YS9 A;  1F43 A;  3CDL A;  4ENK A;  1MJA A;  2L4M A;  3EPZ A;  1FYK A;  2KIF A;  1UG2 A;  1FJL A;  4M9S A;  1BI2 A;  2GA1 A;  5E3L A;  2WAF A;  1LEA A;  4A3F J;  1Y39 A;  1PUF B;  1K6O A;  3F9K A;  4RA2 A;  1WVR A;  2DT7 B;  4A3K J;  1MMN A;  2EZL A;  3T1B A;  3S32 A;  3N05 A;  2CQN A;  2DW4 A;  2HQ5 A;  2KRH A;  1MJB A;  2CW8 A;  5H20 A;  5HDG A;  3ZQH A;  1K78 A;  2QSH X;  4RB1 A;  1K4S A;  3W6J B;  2ZXW H;  3KZY A;  2NVQ J;  1P7J A;  2O3F A;  3WTZ A;  2G9W A;  5H6R A;  4RDU A;  2DTZ A;  4RAZ A;  3LA3 A;  2LMD A;  5KHD A;  2LBF A;  3CC4 I;  1YG2 A;  3OSF A;  4XOP A;  4MO7 A;  3IH2 A;  4BHB A;  1A6Q A;  2LH9 A;  1WH7 A;  1VQ4 I;  1CQT A;  5IP7 J;  1FEX A;  2QSG X;  2K9L A;  3DBH B;  5EF6 A;  3GYH X;  1XGN A;  1A6I A;  1TBX A;  4BL0 B;  4IOA F;  3T5X A;  2P6S A;  5M3F J;  5DD8 A;  4P9U A;  5C44 J;  5CLS A;  4ASN A;  4XK4 A;  3EYI A;  3WTU C;  3HOV J;  1MBH A;  2KP6 A;  3CME I;  2DFE A;  1P6R A;  1H88 C;  1O7F A;  1OCO H;  4BKX A;  3DKW A;  2BW3 B;  4MFD A;  5F1R A;  4IOC F;  2O9L A;  1HF0 A;  4IHY A;  4BE0 A;  3O6B B;  1FC3 A;  1NG6 A;  1W7P B;  2DN0 A;  2XPV A;  3BG3 A;  2JSP A;  1KGS A;  4H0E A;  3EET A;  1BJA A;  2H1L A;  3ZQF A;  5BOX A;  2E36 A;  1QPI A;  3CMM A;  5DYM A;  1JTY A;  2IGM A;  3KP5 A;  4AD9 A;  4HRI A;  4CCK A;  2TCT A;  3AG2 H;  3JRE A;  5K7F A;  3FXM A;  2VAS A;  2DPD A;  3A4C A;  4RS8 A;  2EZI A;  2BY2 A;  2X6W A;  3JRF A;  1FOK A;  2V1D A;  1FOW A;  4HG2 A;  2HNH A;  1FBS A;  2L9N A;  3BQY A;  4ZYE A;  4G12 A;  1VZ0 A;  4A5N A;  5CVJ A;  1ETO A;  3P9C A;  1VQM I;  2E2H J;  4BAY A;  4I2O A;  4C3J J;  2XGE A;  4QPO A;  5F04 A;  2Q8K A;  1K83 J;  4EVI A;  1GV5 A;  2HOS A;  4I09 A;  1ONV A;  2VOO A;  3F8N A;  1HW2 A;  1XD7 A;  3GTM J;  2LSO A;  2UV1 A;  4MQV A;  1WZ2 A;  4E7L A;  4YFN F;  1LJ9 A;  5J40 A;  4ZZL A;  4CIC A;  4HQE A;  4A3D J;  2VKE A;  2R7V A;  3CO7 C;  3LL7 A;  2P81 A;  5FKK A;  1KU7 A;  5IYD J;  3A0H C;  2BVL A;  2IPQ X;  2RQQ A;  2IRF G;  1PJR A;  2ID3 A;  1MMD A;  1F4K A;  3J7Z I;  4BBR J;  1KU2 A;  2K9M A;  3I4M J;  3ZMU A;  3SYT A;  1SEU A;  4XRS A;  5E3N A;  1IV8 A;  3BZK A;  1E3P A;  3MKL A;  2O0Y A;  3A01 B;  2WV0 A;  3HSR A;  1BR4 A;  3NQO A;  3F8B A;  1J59 A;  4FET A;  2BBY A;  3EQL F;  1IDZ A;  3OYA A;  4J19 A;  3DLL F;  4Y7N J;  4YG2 F;  1SFO J;  4A3M J;  4JBA A;  3H0G J;  1R5H A;  2Y0S N;  2QQ8 A;  1WQ2 A;  2JA7 J;  1FWZ A;  1MBJ A;  1TWA J;  4HX4 A;  1YIJ I;  5JI6 A;  1PP8 F;  1MIJ A;  2LD5 A;  2COM A;  3CJQ B;  2E7W A;  5KVR A;  1W1W E;  3MD2 A;  4ESB A;  3KEY A;  2MSY A;  3HTU A;  3WTT C;  2K5C A;  4CO8 A;  1BM9 A;  4CUG A;  3RYP A;  3WHB A;  1T39 A;  3GFL A;  4MTE A;  3R61 A;  3CC2 I;  3BG5 A;  2A69 F;  5CKT A;  2DA5 A;  2FE3 A;  4ZJZ A;  2M87 A;  4CGZ A;  1R1T A;  4UHT A;  2OCE A;  2HS5 A;  1WHU A;  5GPC A;  1FY7 A;  1AU7 A;  2QEX I;  2QKM B;  4L5I A;  5L3F A;  2P5V A;  3BTL A;  1YJN I;  1MGT A;  2QWW A;  2Z1D A;  2QF7 A;  2XAG A;  4ITV A;  3V4G A;  3HM5 A;  4UVC A;  4D7N A;  2L9S A;  2OQR A;  5EZG A;  4ZDP A;  2IW5 A;  3A0B C;  3PSI A;  2Y9Y A;  3FBN B;  4IZZ A;  2CFO A;  5B1A H;  2CQX A;  2IS2 A;  1I5Z A;  3VOE A;  4AUX A;  1H9T A;  3HXL A;  2MBF A;  1T8I A;  4R1H A;  2VQC A;  2GAU A;  2JUG A;  3BTC A;  4U7D A;  2IGO A;  4U0V A;  1I6H J;  2OTJ I;  4KJZ A;  4IRI A;  1UZC A;  1R9T J;  3NRV A;  3DF8 A;  3OIP A;  4BQA A;  2M0C A;  3HSF A;  1RR7 A;  2VPR A;  5J1U A;  2DA2 A;  4WXD A;  2MD5 A;  3DKY A;  3HGG A;  1UG0 A;  2DBB A;  1SVM A;  3VB2 A;  4IKF A;  3F72 A;  1VQL I;  2W4S A;  1JGG A;  4RAG A;  1GLN A;  3ECO A;  1YJW I;  3PSF A;  2YR2 A;  3BR3 A;  1JHH A;  3HSE A;  3PQJ A;  4GYG A;  2E5Z A;  4PJL A;  3FXL A;  1AA7 A;  1U5T B;  4XLH A;  1D1C A;  1TQP A;  3PFI A;  3BRO A;  1K7A A;  3KP6 A;  3J81 Z;  1MBF A;  2EIM H;  3FXU A;  2Z3Y A;  1O7L A;  5GAE J;  2HR3 A;  4A0Z A;  1T33 A;  2CJJ A;  2DDA A;  3KP4 A;  3FWE A;  4P9F A;  2RV8 A;  3OYJ A;  4L9J A;  2H6C A;  1YQA A;  3RKW A;  2DJN A;  2A68 F;  2ZXI A;  1BC8 C;  4RGU A;  3BJA A;  4BXU A;  2VUM J;  2DA1 A;  1W5T A;  3ZPL A;  2RN7 A;  2XAU A;  1HA8 A;  2EV0 A;  2AS5 F;  1YW9 A;  3KLO A;  1QRY A;  2F5C A;  3VSK A;  2OUM A;  3DPU A;  2XRO A;  4U7B A;  4XIC A;  2M7B A;  1MND A;  3OS1 A;  3IUO A;  1I3Q J;  2OF7 A;  3H35 A;  1ZLJ A;  2JRM A;  3SFI A;  2GOX B;  2BVM A;  3LSI A;  3TO7 A;  1PUF A;  2KFD A;  4HOB A;  3H9J A;  2WAE A;  4HYE A;  4BBS J;  3VFZ A;  2D2W A;  2ACJ A;  3K4C A;  2QKL B;  2NAZ A;  2GOM A;  4CCO A;  4EEF G;  3M07 A;  3ABT A;  2LFB A;  3K9T A;  5HDN A;  4HA8 A;  3HYI A;  1IUY A;  2L54 A;  2KDO A;  3NWT A;  2DU9 A;  3R6S A;  4N9I A;  4A0Y A;  3F21 A;  4UV9 A;  3RIR A;  4HDU A;  1HKS A;  1ZAR A;  4MNU A;  2LRD A;  5F64 A;  4JX4 A;  1O57 A;  3J80 K;  1PDN C;  5HLG A;  5IYB J;  3R60 A;  2HQN A;  1ETV A;  1DU6 A;  2EBI A;  3VEP A;  1TLH B;  4E7J A;  4YFK F;  1B6A A;  3K69 A;  3MAJ A;  2GLO A;  1KON A;  2PI0 A;  3CC7 I;  2XHK A;  2OPT A;  4KT6 A;  2IGK A;  3L1P A;  1J2X A;  2FD5 A;  3RDI A;  3I55 I;  3OWT A;  3TW6 A;  1XS9 A;  1OIS A;  1MSF C;  2BW3 A;  3FKI J;  2ME6 A;  3VPR A;  3FIS A;  4AIK A;  1XCV A;  3PUF A;  3B73 A;  3ECH A;  3IH4 A;  2DA7 A;  1BI0 A;  1W7P A;  1P9Q C;  3DEE A;  1JXS A;  1UMQ A;  4L9T A;  4TV7 A;  1UB9 A;  1RC9 A;  2EB7 A;  5DM6 F;  1OCR H;  2FXA A;  3HZJ A;  3TO6 A;  2X85 A;  5L3D A;  2DPU A;  4QIW N;  1OQY A;  4UXN A;  2DK5 A;  4UNO A;  4PGG A;  4IRG A;  1B8I A;  3JR9 A;  2EZK A;  2MGQ A;  4LK1 F;  1W36 D;  1Q1V A;  4CCN A;  2GXB A;  2CUZ A;  2RQP A;  4EQQ A;  3WE3 A;  3WG9 A;  3ZMD A;  4NC6 A;  1MMS A;  1Y6I A;  4YIR X; 
#chains in the Genus database with same CATH homology
 2H27 A;  2M8E A;  4M9X A;  3F8C A;  3E6C C;  1IZ1 A;  1REP C;  4AIH A;  2ESH A;  4UVB A;  1XSV A;  4A12 A;  2V9V A;  3LQQ A;  2V79 A;  4CZZ A;  3WTX C;  1UHW A;  3I59 B;  2EFQ A;  1BI1 A;  2Z9O A;  5TRD A;  1S3J A;  3LQR A;  3ISP A;  4ZH4 F;  1OKR A;  3F8F A;  3LAJ A;  1L0O C;  5FFX A;  1JHF A;  4DQ2 A;  4YFX F;  2UZK A;  1IXR C;  4HLX A;  2XIG A;  3FZV A;  5E20 A;  2DLL A;  3OV8 A;  1LB2 A;  3O2P E;  4UVA A;  3F8M A;  2P5L C;  1BOA A;  1TNS A;  3E6M A;  3EUH A;  2XRN A;  2L02 A;  4KDP A;  5CVI A;  1FYL A;  4M6Y A;  3Q9V A;  4EJV A;  2G7U A;  1BIB A;  1QNT A;  5E1W A;  5ILU A;  3COA C;  2OZ6 A;  5HLH A;  1Z05 A;  1KQ0 A;  3AAF A;  3VOD A;  1IRG A;  2IJL A;  3WGI A;  1J5Y A;  2WC2 A;  3BZ6 A;  4LMY A;  2IVM A;  1EH8 A;  1T38 A;  1XSD A;  4UUV A;  3ABU A;  2HYF A;  2YU3 A;  2CFX A;  1I6X A;  2VE9 A;  5D5W B;  1ZRC A;  4I0A A;  1R5G A;  2DTR A;  4LG0 A;  3ROU A;  1QQI A;  3IC7 A;  3IRQ A;  4NB5 A;  1EV7 A;  2PBI A;  3P9I A;  1O3Q A;  5D4R A;  4BNC A;  2ZFW A;  2W84 A;  2GA2 A;  4EV0 A;  1Z1D A;  4HF2 A;  3DP7 A;  4Y17 A;  4CYD A;  2M1B A;  2ESN A;  2FF4 A;  3JAM K;  4LB5 A;  2CSO A;  3GUD A;  4RGX A;  3WTW C;  5D8L B;  3RKX A;  1KU9 A;  3V7C A;  1ZH5 A;  3I5U A;  1HQC A;  4G8X A;  5KK1 A;  4YII A;  3ERE D;  4ESF A;  5HDK A;  1U8R A;  2HEO A;  1S7A A;  2FA5 A;  4KIC A;  1BI3 A;  2GQQ A;  1TNT A;  3QP6 A;  3HHG A;  2YX4 A;  5A2Q K;  1DDN A;  3IWZ A;  4HV6 A;  1G3Y A;  4RAY A;  1BIA A;  3REO A;  3L00 A;  5LLQ A;  4A2U A;  4PZJ A;  3KFW X;  3O3K A;  2HTJ A;  3L9F A;  1V4R A;  2VBW A;  1HSJ A;  1FSE A;  2EFW A;  1R1U A;  1T0F A;  3KEQ A;  2PFB A;  3KCC A;  2K02 A;  3ML6 A;  1FZP B;  3KP7 A;  1AOY A;  2ZME B;  1OMI A;  2FNP A;  2Z33 A;  3U2R A;  1MJ9 A;  3K1P A;  3CJN A;  3CLO A;  1W4M A;  2EV6 A;  3PQK A;  1AWC A;  1ZGA A;  3MZY A;  3F22 A;  1YW7 A;  4KA4 A;  3DFG A;  5IT9 Z;  5ERI A;  1ZYR F;  3Q9S A;  4FT8 A;  1ZN2 A;  2Q0O A;  2P5K A;  1RUO A;  2DT5 A;  3KET A;  1MDM B;  1LNW A;  5CJ9 A;  3MZH A;  2XV4 S;  5L3C A;  1A04 A;  1SFX A;  4IXA A;  1XGO A;  4Q48 A;  1XGS A;  3F6O A;  2ZNY A;  2JT1 A;  5D8K B;  2DFI A;  3MWM A;  1MZB A;  3GFJ A;  1G6N A;  3KLN A;  3V7S A;  4EM0 B;  5TJJ A;  2JPB A;  4EGY A;  3I59 A;  2P7V B;  3QU6 A;  4G7H F;  1KYZ A;  4LGW A;  4AIJ A;  5L3G A;  4UV8 A;  2EWN A;  5HS9 A;  2CG4 A;  2GXG A;  3CO6 C;  1H9G A;  2HKO A;  1FLI A;  3IL2 A;  4S04 A;  1O3R A;  1B9N A;  4ZYH A;  1Z91 A;  2ISZ A;  1D8K A;  3FX3 A;  2O6G E;  3MCZ A;  4G6D A;  3CUQ C;  5ICF A;  2DO7 A;  3WGH A;  3BY6 A;  5JVT A;  2Y75 A;  3E97 A;  2CYY A;  5J6X A;  2EV5 A;  2JTV A;  4M71 A;  3FMQ A;  5K5R A;  3ELK A;  5FD5 A;  1Z7U A;  5ILS A;  5DCF A;  3ZMV A;  3CUO A;  4IRH A;  1XGM A;  2ZJ2 A;  3DPL C;  3QU3 A;  2RVC A;  3I0T A;  1CF7 B;  3M8E A;  2X0L A;  2X4H A;  4MEY F;  3MEX A;  2FBI A;  2P4W A;  3JW4 A;  4ON0 A;  3SZP A;  4K2E A;  5AIP A;  3HRM A;  4RB3 C;  2Q2E A;  3I54 A;  5ED4 A;  1FT9 A;  2KJB A;  2G7H A;  3WU1 B;  1YFH A;  2PG4 A;  2HDC A;  1W5S A;  2KRF A;  3F6V A;  3FMR A;  1HKQ A;  2MA3 A;  1FBU A;  3RI4 A;  1ZHF A;  2L01 A;  5HS8 A;  1LVA A;  2E1N A;  2P6T A;  4OIR F;  4HDV A;  3C3W A;  1XSX A;  4P5O A;  4LFU A;  2FEZ A;  1SMT A;  6PAX A;  5E8I A;  2VC0 A;  1D8J A;  4OU0 A;  2A6E F;  4KT5 C;  4RGS A;  2ZCW A;  3HRT A;  5DCM A;  1UST A;  3SFZ A;  3TO9 A;  1IXS B;  3CDH A;  5BS6 A;  1P92 A;  2WTE A;  3I58 A;  2HOE A;  3HHH A;  3K1N A;  1OPC A;  2ZNZ A;  4O6J A;  3W6K B;  1UFM A;  3S2W A;  1Q1H A;  3SQN A;  3E5X A;  1GXP A;  3IHU A;  4OOI A;  2ZME A;  2XAH A;  1W7P D;  3QRF F;  2VN2 A;  5E8G A;  2ZBK A;  2R7D A;  3IRR A;  1GHC A;  4P55 A;  5D5X B;  2W85 A;  2JZY A;  1TW3 A;  1F9N A;  1ZGJ A;  4L0Z B;  4WF2 A;  2OZU A;  2PN6 A;  5CVR A;  2RGV A;  1B59 A;  3HUG A;  2O8X A;  1F5T A;  1XDU A;  2FBH A;  2LF8 A;  3G3Z A;  3GO5 A;  3FXR A;  1MDM A;  1XMK A;  1I1G A;  1UHM A;  2WWY A;  2D1H A;  2F2E A;  2HKX A;  2YPR A;  3GWZ A;  5CVV A;  1ZG1 A;  4L18 B;  1U6G A;  2W25 A;  3RJP A;  2OU2 A;  1IN8 A;  2RC4 A;  3DQV C;  1J0R A;  1S6L A;  4OMY A;  1XB4 A;  3BWG A;  2B0L A;  2K4J A;  2BGC A;  1WRJ A;  1PUE E;  5LRS A;  2VBX A;  3C7J A;  2D1V A;  4Q4Z F;  4JK1 X;  3G73 A;  3E6D A;  2OBP A;  2PEX A;  3Q5F A;  4KUM A;  2UXN A;  2O61 A;  2PJP A;  3E3V A;  3U9G A;  1TTY A;  3R0J A;  4KN4 X;  3WTV C;  1BN5 A;  3GX4 X;  1DPU A;  3TKY A;  3LWF A;  5J8C A;  4PDK A;  4Y15 A;  1SD4 A;  5HOO A;  2XAQ A;  1XN7 A;  5AIQ A;  1IAW A;  1H0M A;  1I27 A;  1BC7 C;  2OQG A;  2BE5 F;  1G4D A;  5IT3 A;  3M8F A;  1Y0U A;  3M9A A;  3TGN A;  1CF7 A;  2ZKZ A;  2FRH A;  5L3E A;  4EM2 A;  3BOQ A;  2FSW A;  1E17 A;  2A61 A;  3IWF A;  4KFC A;  3ZMT A;  1FP2 A;  3BPV A;  4BH9 A;  2A5Y B;  2GZW A;  1R22 A;  2LDU A;  1R58 A;  1QZZ A;  2HYG D;  2A6H F;  2QQB A;  1HKT A;  3ZMS A;  5CVU A;  4OMZ A;  3BP8 A;  5AON A;  1STZ A;  4O3M A;  5K5Q A;  4Q5S F;  2FOK A;  1LDD A;  2LNB A;  4L5J A;  4WX9 A;  5LHH A;  2CW0 F;  2O03 A;  1OR7 A;  4B8X A;  3M7G A;  1IW7 F;  5DD4 A;  2VBY A;  4S05 A;  3BPX A;  4DNC A;  4LLL A;  4G9Y A;  3KP3 A;  1T6S A;  2RNJ A;  1IN7 A;  3OOP A;  1YLF A;  1GXQ A;  2QQA A;  3RPQ A;  1TQI A;  5LGT A;  4N0B A;  2DI3 A;  2DQL A;  1XDS A;  4I01 A;  1R00 A;  5D6E A;  3V8L A;  2F5F A;  2ISY A;  2NYX A;  5BQT A;  2DAO A;  4IHS A;  2IA1 A;  4QWQ A;  3LA7 A;  5F6F A;  1PP7 U;  1U5T A;  2DQR A;  2NS0 A;  4R8H A;  5JR3 A;  3GEZ A;  2J5P A;  3E5U A;  3FXQ A;  2FNA A;  3HIF A;  1FBQ A;  4BHC A;  4WCG A;  1KQ9 A;  2BYV E;  4HZF A;  2QUF A;  1EH7 A;  3ZMZ A;  4U0W A;  3TDU C;  2VOP A;  4EMS A;  2Z5U A;  3IKT A;  5ILV A;  1HBX G;  2QEN A;  4A0X A;  2LF7 A;  4EJT A;  2AXL A;  3GLX A;  5ICC A;  1F1Z A;  5FLX Z;  2FU4 A;  3C18 A;  4KYW A;  1RI7 A;  1YS7 A;  4MHG A;  2XAS A;  1OYY A;  2EFO A;  5D5U B;  4LB6 B;  4XLN F;  4ENN A;  3J81 K;  4EJW A;  2JSC A;  2E1C A;  3ZQ7 A;  4U88 A;  3RKY A;  2XKO A;  1G3S A;  4MEX F;  5EEH A;  2L4A A;  1R1V A;  3HOS A;  1R7J A;  4WK8 F;  2K7L A;  3C1D A;  2H09 A;  2NNY A;  1YO5 C;  4XSX F;  2QQ9 A;  3ZN1 A;  3J7A O;  1ULY A;  2EA2 A;  4N9H A;  2EFP A;  5D4S A;  1XMA A;  3H3Z A;  2FBK A;  1SD7 A;  1U5T C;  3F3X A;  1MKM A;  4D0P A;  3BJO A;  4OIQ F;  3BDD A;  4OIO F;  2ADU A;  3L2C A;  5DUK A;  2XVC A;  5FB2 A;  3CTA A;  4R79 A;  4M73 A;  4ENJ A;  3WU0 A;  5DEQ A;  2QVO A;  3E6B A;  1G3T A;  1ZRD A;  3LFK A;  2FQ3 A;  4HF0 A;  4GXO A;  5CYV A;  1USS A;  2Z99 A;  2L3D A;  3V8K A;  2K4B A;  2UXX A;  4A6D A;  3QPT A;  1HST A;  2DK8 A;  3IKV A;  4RB2 C;  2HTS A;  4M9Z A;  3T8R A;  2OA4 A;  4P96 A;  3WOD F;  5BMZ A;  1T98 A;  2TDX A;  3LA2 A;  1YW8 A;  2CWE A;  3HRS A;  2KIM A;  2KJC A;  1SMY F;  2K86 A;  4KNY A;  1LDK B;  2OAZ A;  5ICE A;  2HFH A;  2Y48 A;  4G94 A;  1V3F A;  1DPR A;  3L09 A;  2P8T A;  3RTR A;  2VE8 A;  5LGU A;  4M6X A;  5DDG A;  2Y0M A;  3K2Z A;  2VC1 A;  2ZXJ A;  4L9V A;  4KMU X;  5K1Y A;  3LAP A;  1WI9 A;  2NNN A;  1P2F A;  3JTH A;  1WKM A;  3WGG A;  1IN6 A;  2EFN A;  2ELH A;  4I0B A;  4MQ9 F;  1SAX A;  2F5E A;  3DXJ F;  3JTG A;  4JQF A;  1K79 A;  2CQK A;  1ZLK A;  3BJ6 A;  5LBQ A;  3FM5 A;  3TOA A;  1ZRF A;  1HW5 A;  4FHT A;  4LLG F;  1QO0 D;  1I1S A;  4IF4 A;  1IRF A;  2FMY A;  4WWC A;  1YTY A;  4LJZ F;  2MH2 A;  4ZZD A;  4OIP F;  4YIF A;  3WE2 A;  1FNN A;  4ZYD A;  3D5L A;  4CXF A;  4XBF A;  3FM3 A;  1ODD A;  4IPA A;  4AWX B;  2A3S A;  1S7O A;  5D6F A;  4GGG A;  4I02 A;  1QZY A;  5LHI A;  3V7R A;  1VTN C;  4HLY A;  3KP2 A;  2UWM A;  1FSH A;  2STW A;  2E7X A;  4IHT A;  2V6C A;  2XAJ A;  4KIB A;  2D45 A;  1S8N A;  2MLK A;  2V1U A;  4HQM A;  1LQ1 A;  1RZ4 A;  4E70 A;  4Y13 A;  5LRR A;  2QM3 A;  3GZ6 A;  1EH6 A;  3I4P A;  3FMS A;  1D3Y A;  3R0A A;  4HAM A;  4FX0 A;  1FPQ A;  5J8F A;  1XCB A;  1QGP A;  1FYM A;  1HW1 A;  4ENM A;  1ZG5 A;  5LEK A;  2QZ8 A;  3K1M A;  3B02 A;  1D5V A;  5HLI A;  4NQW A;  2PQ8 A;  3LST A;  1BBY A;  2XKP A;  3L7W A;  3JAM Z;  5FLX K;  2OD5 A;  1O3T A;  2M45 A;  1NHA A;  4CHU A;  2VON A;  2EK5 A;  1FP1 D;  1X3U A;  4BYY A;  4O5V A;  3DPT A;  1YS6 A;  1ON1 A;  5EEG A;  5A2Q Z;  5D5V B;  4LG0 B;  4ETS A;  2CGP A;  1JGS A;  3T8T A;  2XAF A;  1LDJ A;  1E2X A;  3V8J A;  3ULQ B;  4A5M A;  1WWX A;  4M74 A;  2IP2 A;  1TW2 A;  5DV5 A;  1MD0 A;  2LKP A;  4KIG A;  4EJO A;  2R7F A;  5HVQ C;  3WTY C;  2QBY B;  4QLC U;  5E1X A;  3HTS B;  5H6Q A;  4RB0 A;  1FX7 A;  4LD5 A;  2MLG A;  3NEU A;  5LGN A;  3GF2 A;  4PGH A;  5IT9 K;  2KKO A;  2P7C B;  2VT2 A;  2IA0 A;  2VXZ A;  3E5Q A;  4A6E A;  1ZG3 A;  3T0Y A;  1KQ8 A;  1G3W A;  4I98 B;  1QBJ A;  1YIO A;  4EM1 A;  2HQR A;  3KEO A;  4Q47 A;  3WTS C;  1U2W A;  2VT3 A;  1DP7 P;  5DUI A;  2VOD A;  5E17 F;  4IJA A;  4GYI A;  2XGX A;  1T2K A;  4BHP A;  5BPD A;  4KIF A;  2ETH A;  5E18 F;  5E1Z B;  3CUQ B;  3R4K A;  2QLZ A;  3JSO A;  4HW0 A;  1SD6 A;  3K0L A;  1R36 A;  1K78 B;  4B09 A;  2H94 A;  4ZYG A;  4HX8 A;  3HOT A;  1OYW A;  2C6Y A;  1R23 A;  1DUX C;  2JRT A;  2R3S A;  5FGM A;  3RYR A;  2V1X A;  1J9I A;  1IN5 A;  3SHF A;  4KMF A;  3EDP A;  2BEO A;  1KYW A;  3FF5 A;  1P4X A;  3SXY A;  3GXO A;  2J5O A;  5BPI A;  2W57 A;  1HXD A;  3TDZ C;  2IA2 A;  4NHJ A;  5FFZ A;  2MC3 A;  5FD6 A;  4HF1 A;  3TQN A;  5JHU A;  5LHG A;  5ICG A;  1S29 A;  2NRA C;  2STT A;  3ZN0 A;  4G6Q A;  1U3E M;  1Z6T A;  1P4A A;  2PMH A;  1SFU A;  1Z9C A;  1U78 A;  1P4W A;  3JSP A;  4HV5 A;  1KU3 A;  3QOP A;  1C0W A;  2EA4 A;  2M5W A;  1IXC A;  3U1D A;  3DV8 A;  2H6B A;  1LEB A;  2HZT A;  1ON2 A;  2XUB A;  1ZAO A;  3RPU A;  2PMU A;  4LK0 F;  4IVN A;  1SFE A;  1B9M A;  5HS7 A;  3N97 A;  1WSU A;  2F5D A;  4G7Z F;  4U0Y A;  1CGP A;  3TOB A;  3I53 A;  3QAH A;  4AVP A;  4F7Z A;  2GIV A;  2GWR A;  3KZZ A;  4HBL A;  4I7H A;  1L3L A;  3I64 A;  3QP5 A;  2KIU A;  1O3S A;  1TQM A;  2PLY A;  1B4A A;  5FO5 A;  2HWV A;  4XLP F;  4HX7 A;  3SZT A;  3MFK A;  2JPC A;  3GFI A;  2M30 A;  3GW2 A;  3FHZ A;  4FX4 A;  1IN4 A;  3DEU A;  5K5O A;  4KN7 X;  4LLN A;  1RUN A;  1QPM A;  1RIO H;  4WXH A;  5JFR A;  1KA8 A;  3GZ5 A;  4XRF A;  2YSR A;  1RNL A;  2RKH A;  3GFM A;  4G7O F;  4L0Y B;  2QBY A;  1J75 A;  3P7N A;  4MGR A;  4Z2Y A;  1Z6R A;  2IT0 A;  2MH9 A;  3ZP5 A;  2BV6 A;  5DCM B;  2HGC A;  1UCR A;  3GVA A;  3MQ0 A;  1SD5 A;  4M72 A;  4PCQ A;  4EGZ A;  2W24 A;  2QYO A;  4ESJ A;  3H92 A;  2YX7 A;  1B1B A;  3P9K A;  3KE2 A;  4GCV A;  5L3B A;  3QPH A;  4CDG A;  5LEJ A;  1J7K A;  3D0S A;  3H3U A;  2FML A;  3I71 A;  4WXC A;  1ZRE A;  2VBZ A;  4GO1 A;  4L9N A;  1YYV A;  4XSZ F;  3M1E A;  3N4M A;  4EJU A;  3J80 Z;  4RGR A;  1GVJ A;  1OYI A;  2K27 A;  4OIN F;  2A07 F;  4MTD A;  2CO5 A;  2RDP A;  3CUQ A;  3HRU A;  1IF1 A;  3EYY A;  3F23 A;  2ZO4 A;  2EJR A;  1JE8 A;  4ENK A;  1MJA A;  2L4M A;  1FYK A;  2KIF A;  4M9S A;  1BI2 A;  2GA1 A;  1LEA A;  1K6O A;  3T1B A;  2DW4 A;  5HDG A;  5H20 A;  1MJB A;  1K78 A;  4RB1 A;  3W6J B;  3KZY A;  2O3F A;  3WTZ A;  2G9W A;  5H6R A;  4RAZ A;  3LA3 A;  1YG2 A;  4BHB A;  3GYH X;  1XGN A;  1TBX A;  3T5X A;  2P6S A;  5DD8 A;  4P9U A;  5CLS A;  4ASN A;  3EYI A;  3WTU C;  1P6R A;  1O7F A;  3DKW A;  5F1R A;  3O6B B;  1FC3 A;  1W7P B;  1KGS A;  4H0E A;  3EET A;  1BJA A;  5BOX A;  5DYM A;  3KP5 A;  4AD9 A;  2DPD A;  4RS8 A;  1FOK A;  2V1D A;  1FBS A;  4ZYE A;  4A5N A;  5CVJ A;  3P9C A;  4BAY A;  4I2O A;  2Q8K A;  4EVI A;  4I09 A;  1ONV A;  2VOO A;  3F8N A;  1HW2 A;  1XD7 A;  2LSO A;  4MQV A;  4YFN F;  1LJ9 A;  4ZZL A;  4HQE A;  4CIC A;  3CO7 C;  1KU7 A;  2IPQ X;  2IRF G;  1F4K A;  1KU2 A;  3ZMU A;  2O0Y A;  2WV0 A;  3HSR A;  3NQO A;  3F8B A;  1J59 A;  2BBY A;  3EQL F;  4YG2 F;  4JBA A;  1R5H A;  1WQ2 A;  1FWZ A;  4HX4 A;  5JI6 A;  1PP8 F;  2COM A;  2E7W A;  5KVR A;  4ESB A;  3WTT C;  3HTU A;  4CO8 A;  1BM9 A;  3RYP A;  1T39 A;  3GFL A;  4MTE A;  3R61 A;  2A69 F;  2FE3 A;  2M87 A;  4CGZ A;  1R1T A;  4UHT A;  2HS5 A;  1FY7 A;  4L5I A;  5L3F A;  2P5V A;  1MGT A;  2QWW A;  2XAG A;  3V4G A;  4UVC A;  2OQR A;  2IW5 A;  1I5Z A;  3VOE A;  1H9T A;  2MBF A;  4R1H A;  2GAU A;  4U7D A;  4U0V A;  4IRI A;  3NRV A;  3DF8 A;  4BQA A;  3HSF A;  4WXD A;  2MD5 A;  2DBB A;  3VB2 A;  3F72 A;  3ECO A;  2YR2 A;  1JHH A;  3HSE A;  3PQJ A;  4GYG A;  1U5T B;  1TQP A;  3PFI A;  3BRO A;  1K7A A;  3KP6 A;  3J81 Z;  3FXU A;  2Z3Y A;  1O7L A;  2HR3 A;  4A0Z A;  3KP4 A;  3FWE A;  4P9F A;  2RV8 A;  4L9J A;  2H6C A;  1YQA A;  3RKW A;  2A68 F;  1BC8 C;  4RGU A;  3BJA A;  4BXU A;  1W5T A;  3ZPL A;  2RN7 A;  2EV0 A;  2AS5 F;  1YW9 A;  3KLO A;  2F5C A;  2XRO A;  4U7B A;  1ZLJ A;  3TO7 A;  4HOB A;  4HYE A;  3VFZ A;  2D2W A;  2ACJ A;  2NAZ A;  3ABT A;  3K9T A;  5HDN A;  4HA8 A;  3HYI A;  1IUY A;  2L54 A;  2DU9 A;  3R6S A;  4N9I A;  4A0Y A;  3F21 A;  4UV9 A;  3RIR A;  4HDU A;  1HKS A;  1ZAR A;  4MNU A;  5F64 A;  1O57 A;  3J80 K;  1PDN C;  5HLG A;  3R60 A;  2HQN A;  3VEP A;  1TLH B;  4YFK F;  1B6A A;  3K69 A;  3MAJ A;  2PI0 A;  2XHK A;  1J2X A;  3RDI A;  4AIK A;  1XCV A;  3B73 A;  3ECH A;  1BI0 A;  1W7P A;  1JXS A;  4L9T A;  4TV7 A;  1UB9 A;  2EB7 A;  2FXA A;  3TO6 A;  5L3D A;  2DPU A;  4UXN A;  2DK5 A;  4UNO A;  4PGG A;  4IRG A;  4LK1 F;  2GXB A;  2RQP A;  4EQQ A;  3WE3 A;  3WG9 A;  3ZMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...