4RS8A

Apo structure of novel pnob8 plasmid centromere binding protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
84
structure length
84
Chain Sequence
YIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQMATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Dna binding protein
total genus 30
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rs8A00
1TW2A 2EK5A 2Q0OA 4WCGA 4RB0A 4M9SA 2MLKA 1TQIA 3IC7A 3DXJF 1PP7U 2UXXA 3I64A 4P9UA 1FYMA 2RQPA 3LAJA 5H6QA 2BYVE 1J0RA 2HKOA 2CFXA 4B8XA 2F5DA 4BH9A 3DFGA 1IXRC 1JHHA 2CQKA 1P4WA 1K78A 4B09A 4O5VA 1QBJA 2ELHA 1UCRA 2CSOA 1S7OA 3VODA 1GVJA 4XSZF 1SD7A 1DPUA 4A5NA 1F5TA 3QPHA 3MAJA 3E5UA 3OOPA 3COAC 4Y15A 1S3JA 3IWFA 3U2RA 3RI4A 2RDPA 1MDMB 2FMLA 4BXUA 2XKPA 3M7GA 1B59A 1FOKA 2FSWA 4CGZA 2YSRA 2ZNZA 4RS8A 2A3SA 1WRJA 4KIBA 5J8FA 2F5EA 4EQQA 3ROUA 2GWRA 3C1DA 1B6AA 4EJUA 3F3XA 2KRFA 2DT5A 4ZYEA 1BN5A 2OZUA 2OQRA 4QWQA 4KMFA 2P4WA 2XV4S 2Z5UA 1R1VA 2G7UA 5FGMA 1ODDA 6PAXA 2O8XA 4M73A 1R23A 3KFWX 5HLIA 2P5KA 3ERED 2ZJ2A 2EA4A 3J80K 3V8LA 3VFZA 1T38A 2FBIA 4EV0A 1O3TA 4KIGA 4F7ZA 2MBFA 1KA8A 3P9IA 2C6YA 4BQAA 4S04A 2EFWA 3EETA 3U9GA 4OMZA 3FXRA 1D5VA 4IRIA 4I09A 4OIOF 1KQ9A 1YLFA 3EYYA 1ZYRF 2EFQA 2Z9OA 3JAMK 3FHZA 1RUNA 2COMA 1ZRCA 1JGSA 4OMYA 1ZHFA 2DQRA 2V1UA 4EMSA 2H09A 3T5XA 5D6FA 1BI3A 4HZFA 5L3FA 5JHUA 2M1BA 1ON1A 2H6CA 3BROA 1S7AA 1Z7UA 3WG9A 1K78B 2D1HA 3I5UA 2FE3A 2GAUA 4KNYA 1X3UA 2E1CA 5IT9Z 2RKHA 4MNUA 1QZZA 5H20A 1MJBA 5AONA 1IN4A 2UWMA 5L3BA 2ADUA 2Z33A 3VEPA 2F5FA 4RGSA 4XSXF 1USSA 2EB7A 4MQVA 5D5VB 2IPQX 3RYPA 3FM3A 4A0XA 1Y0UA 3V8JA 2LNBA 1YIOA 2L02A 1XSXA 4WXCA 1R22A 5F1RA 2HS5A 3E6BA 5E1XA 3SZPA 1IAWA 4EGYA 4KFCA 5DEQA 3MQ0A 3BOQA 1FT9A 4KT5C 3F8CA 2LSOA 5E18F 3FX3A 2VODA 4GO1A 2NYXA 3HRSA 2CYYA 1DP7P 2OAZA 1FY7A 2XAHA 1R5HA 4M9XA 4P9FA 4LK0F 5JVTA 1G3TA 1KYZA 3BZ6A 2YR2A 2JPBA 5FFXA 1XDSA 3WE3A 2FQ3A 1O7LA 5E20A 3WU0A 3H3ZA 4P96A 3B02A 3GZ6A 2XROA 4M71A 3SHFA 1Z6RA 2EA2A 2K86A 3LQRA 4R1HA 3HOTA 2QWWA 5D6EA 2X4HA 5CVIA 4G7ZF 1KU7A 2DQLA 1R58A 2D2WA 1IRGA 3ECOA 3IRRA 2K4BA 1LQ1A 3DPLC 1SMYF 3TO6A 2ACJA 2XIGA 2O3FA 3WTVC 2V1XA 1F4KA 3ISPA 4EJWA 5TRDA 1FSHA 4UV9A 3KP5A 3WODF 2QVOA 4KA4A 2A61A 4YFKF 1G3WA 3O6BB 2VT3A 4MQ9F 1Z91A 1YW8A 1HSTA 4L18B 3EDPA 4N9HA 3J80Z 5K5QA 1C0WA 3F8NA 3ZMVA 5BS6A 5HS7A 3ABUA 1EV7A 4E70A 3P9CA 1XCVA 4Y17A 1P6RA 4G94A 2ZNYA 4A12A 3NRVA 1HW2A 4AIKA 1HKTA 5HS8A 2H27A 4U7BA 1UB9A 3TKYA 2MLGA 3WTUC 3QOPA 4KN7X 3S2WA 4I0BA 1B9NA 2HQNA 5E17F 4FX0A 2VBYA 1W5SA 3IL2A 2HDCA 3I4PA 4RGRA 3BDDA 4S05A 2EFOA 1QNTA 5AIPA 5LRRA 3RKYA 1O57A 1BI2A 5DCFA 4A2UA 2L3DA 1OYYA 4KDPA 2MH9A 2WC2A 3CO7C 3T1BA 2QQBA 3C3WA 3SQNA 5K5OA 5E1WA 1PP8F 4M74A 3L00A 4CDGA 3CJNA 3DP7A 3ELKA 4LFUA 1GXPA 4N0BA 1XMKA 2DAOA 3U1DA 2XVCA 4BHPA 3K1PA 1P92A 3KP6A 1T98A 2CO5A 3I53A 1I1SA 2HYFA 1YS6A 2FNAA 4RB2C 2NNNA 4KN4X 1B1BA 5L3GA 1WWXA 2HEOA 4WXHA 3ML6A 2IP2A 1G3SA 4MEXF 2ZXJA 4GYGA 1LEAA 3GXOA 1J5YA 4HLXA 4HDUA 3KLOA 2QENA 4OIQF 2PJPA 3FMQA 3ZN0A 3G73A 4UV8A 2M30A 2QBYA 3E3VA 2DFIA 3WTWC 5HLHA 1HSJA 1RZ4A 1A04A 2KJCA 3F22A 4OU0A 3DF8A 1DPRA 2BV6A 1LDKB 1OMIA 5FB2A 1RIOH 4M6XA 2QYOA 3N97A 3ZMZA 1SFEA 1L0OC 2Q8KA 4Q48A 3KP7A 5HDGA 2M87A 4L0YB 2LDUA 4U88A 5EEHA 4M6YA 1XB4A 2DTRA 2XUBA 2JT1A 3F8FA 5HVQC 1XMAA 1F1ZA 2O0YA 4IRGA 2HGCA 1HW5A 4HX7A 3ZMSA 5DV5A 2FBHA 3IKTA 3J81Z 1KU9A 2XAQA 1U6GA 3VOEA 3JTHA 3ZQ7A 3NEUA 5BPDA 3RPQA 3FMRA 2MD5A 2P7CB 4HQMA 2VT2A 3I54A 5K1YA 3M8FA 1SFXA 3E6CC 2WV0A 2XKOA 3D0SA 2KKOA 2E7XA 3F6VA 2YX4A 2CG4A 2IRFG 2D1VA 1IN7A 3TO9A 3R6SA 4LJZF 5A2QK 4OOIA 2RC4A 5DD8A 1KQ0A 2VN2A 1HW1A 2RN7A 3HIFA 1HKQA 1ZG1A 2ISYA 5CLSA 2EFPA 3QP6A 1TW3A 1H9GA 2DI3A 5LGTA 3W6JB 3WGIA 4IHTA 1RUOA 2PEXA 1B4AA 3NQOA 1ZG3A 2XRNA 4WX9A 3G3ZA 3HSEA 3P7NA 2YX7A 1KQ8A 1TBXA 2K4JA 2GIVA 2J5PA 2P6TA 3MFKA 1U3EM 1P4AA 4N9IA 2H6BA 1SD6A 2FNPA 2A68F 4HYEA 1YS7A 4EVIA 3RKXA 1I5ZA 5L3EA 1RNLA 3IWZA 5L3CA 4L5IA 2QBYB 3ZP5A 3HHHA 1CF7B 5ICFA 1LNWA 2QZ8A 5D5WB 1W7PA 2Y48A 1HKSA 2W57A 4BAYA 1OPCA 4EJTA 2BGCA 3WTXC 3AAFA 3FMSA 3E97A 4U0VA 4IHSA 3I59A 3RIRA 2JRTA 4LG0B 2DBBA 1XGOA 3K1NA 1O3RA 3O3KA 4ON0A 1LVAA 1S8NA 1XD7A 4HF2A 4AIJA 2W84A 2LF8A 2VOPA 5KK1A 1J7KA 1R7JA 2EFNA 2ETHA 4LGWA 3TDUC 2HTJA 1BI0A 2V79A 2DW4A 2HZTA 4HX4A 4XLPF 5J6XA 2OA4A 1D3YA 1JHFA 2HR3A 2H94A 2AXLA 4U0YA 3EYIA 3QRFF 3RPUA 4YIIA 3L9FA 4NQWA 4P5OA 2ZFWA 4ENMA 3V4GA 1RI7A 3MCZA 2UZKA 2VONA 2FBKA 3TQNA 3V7SA 4L9NA 2ESHA 1UHWA 3FXQA 1ONVA 3WTSC 4XBFA 4ESJA 1LDDA 4FT8A 2FA5A 4HOBA 4KIFA 4G7OF 1HXDA 5DCMA 3LSTA 3T8RA 2O61A 5K5RA 3FF5A 4PDKA 3GZ5A 5JR3A 3L2CA 1AWCA 4IXAA 4A0ZA 2PN6A 2O6GE 2J5OA 1ZG5A 5DUIA 1H9TA 2W24A 3L7WA 3HTSB 3JTGA 3IKVA 1BIAA 1MJ9A 5D8KB 4H0EA 1O3SA 4K2EA 1D8JA 3F8MA 5LEKA 1K7AA 3GEZA 1YTYA 4ZYHA 1MJAA 2OZ6A 3KETA 2DLLA 4I01A 1YYVA 2IA2A 4DQ2A 1BOAA 3VB2A 2X0LA 2STWA 5J8CA 1E17A 2XASA 4CICA 1USTA 5E8GA 2Z99A 3FM5A 3GFMA 4UVBA 4UVCA 1TTYA 3RJPA 4KYWA 3Q9SA 3WTTC 5A2QZ 3H3UA 2MH2A 5BOXA 1J59A 1W7PD 4U0WA 5ICCA 3L09A 3K0LA 4RAYA 3GX4X 3M8EA 1B9MA 3HYIA 2QUFA 3REOA 3J81K 3K9TA 1O3QA 1NHAA 5FD6A 5LHGA 3GW2A 4MEYF 2M5WA 2FRHA 2LKPA 1XSVA 2RGVA 5D8LB 1I27A 1OYWA 2EWNA 1ZREA 3CDHA 4EJVA 4MHGA 1KYWA 1IF1A 3CLOA 5HDKA 3D5LA 1JE8A 3F23A 2V6CA 4WWCA 4BYYA 1ZH5A 4YG2F 1K79A 3PQJA 1WSUA 5CJ9A 4QLCU 1U5TA 3F72A 2BE5F 1ZLKA 1G4DA 1LDJA 2QLZA 2PG4A 4HF0A 1UFMA 1W4MA 2K02A 1IZ1A 3DPTA 2F2EA 1R1TA 3SFZA 2P5LC 1T0FA 2GA1A 3ECHA 1TLHB 5KVRA 2V1DA 3FWEA 2D45A 1MZBA 2W85A 4Q5SF 5JFRA 3H92A 1EH6A 1TNTA 3GO5A 3FXUA 5CVRA 1T39A 1H0MA 1W5TA 1FNNA 4L9JA 4BNCA 1ZN2A 4AWXB 2VC0A 1ZRDA 5CYVA 5FO5A 1FYKA 4ZH4F 2AS5F 2PLYA 2RVCA 4AVPA 2OQGA 3QP5A 4EM1A 1R5GA 3P9KA 1FBQA 1G6NA 4EM0B 3TOBA 3LQQA 3F21A 1BM9A 1T2KA 3CO6C 1IXCA 2Q2EA 5E8IA 1VTNC 4CXFA 4WXDA 1D8KA 3GVAA 4RB1A 4UXNA 3GUDA 1QGPA 2A69F 1QQIA 2A5YB 2WTEA 4L5JA 5LGUA 5CVJA 1QZYA 4L9TA 2NNYA 2VBXA 1IRFA 3HTUA 3WTZA 3RKWA 1U2WA 3PQKA 4JK1X 3QPTA 3PFIA 4KUMA 3V7RA 1YW7A 5DDGA 2DO7A 1J2XA 5AIQA 4UNOA 1OKRA 1I6XA 1AOYA 1Z05A 3TDZC 2CGPA 3E6DA 2PFBA 2VC1A 4IJAA 4HA8A 1IXSB 2GA2A 3MWMA 1TQPA 2B0LA 2FOKA 1O7FA 4UUVA 5ICGA 4R79A 3V8KA 2VXZA 1R36A 1U5TB 1FPQA 3K2ZA 4WF2A 1DUXC 1IW7F 3HSFA 1Z6TA 2V9VA 1ZARA 4ESFA 4MTDA 3GYHX 2HKXA 4LMYA 5ILUA 4O3MA 1IUYA 1ULYA 1MD0A 2GXGA 4WK8F 4TV7A 2E1NA 1XGSA 5HDNA 3E6MA 3HRTA 4I0AA 5FLXZ 2QQAA 3TOAA 4ZYDA 3WU1B 4HDVA 4G8XA 3B73A 1HBXG 3BJOA 2PQ8A 5F64A 1SAXA 2QM3A 3ZMDA 5E1ZB 3O2PE 1ZGAA 4IF4A 1CGPA 2LF7A 1FYLA 3GFLA 2A6EF 3KP2A 4I02A 2E7WA 2ZMEA 1QPMA 1FBUA 2FEZA 4OIRF 2RNJA 2W25A 3JSOA 3HSRA 2OBPA 3WGGA 1YQAA 2FXAA 2R7FA 3KP4A 3KZYA 1YG2A 3C18A 2L4MA 4NHJA 4LB6B 4KICA 2DU9A 2WWYA 1FZPB 3GWZA 1U8RA 3MZHA 3BPVA 5CVVA 3KP3A 4GGGA 5H6RA 4HX8A 1U5TC 4YFXF 3JSPA 3R0JA 4RGUA 2PI0A 5F6FA 3KE2A 4PGGA 3WGHA 3LFKA 2EJRA 2IA0A 3E5QA 1L3LA 4FX4A 4MGRA 5CVUA 3DV8A 1BC8C 1P2FA 4YIFA 1FP1D 1FBSA 1F9NA 2EV5A 2XGXA 1V3FA 4HW0A 4D0PA 3GLXA 3Q9VA 2PMUA 5JI6A 2R7DA 3KCCA 2OU2A 3ZN1A 1FP2A 3V7CA 2FU4A 2L54A 1SD4A 3LA3A 2NS0A 4NB5A 3R0AA 5ED4A 3BPXA 2IA1A 1S6LA 4RGXA 2YPRA 4LLGF 5DYMA 4HF1A 3IRQA 3LAPA 5ILSA 1XSDA 3DQVC 1U78A 4CZZA 2G7HA 2G9WA 1SFUA 2IJLA 3GFJA 1XGNA 2XAFA 4R8HA 3I71A 5L3DA 3EUHA 1WI9A 2IVMA 4ESBA 1ZAOA 3BY6A 3TO7A 2MA3A 3MZYA 1JXSA 4O6JA 4MTEA 2L01A 3ZMTA 3M9AA 5ERIA 2YU3A 3RDIA 3HHGA 2R3SA 3MEXA 4UHTA 4CYDA 1V4RA 3JW4A 4GYIA 4EM2A 3HOSA 5TJJA 4IPAA 4ENJA 4PGHA 4HV6A 2PMHA 3F6OA 4Z2YA 3BWGA 2ZMEB 3ULQB 2Z3YA 4XLNF 4OIPF 2FMYA 3CTAA 3BJ6A 2M45A 4ZZDA 1IN5A 2DK5A 3SZTA 5LBQA 3GFIA 3I58A 2F5CA 1HQCA 4ENKA 3ZMUA 2ZBKA 3I0TA 4LLLA 1BBYA 5D5UB 1YO5C 4RAZA 3W6KB 1ON2A 1SD5A 4CO8A 3KEOA 2M8EA 5D5XB 5BMZA 3T0YA 4ZZLA 1KU3A 4IVNA 1R1UA 2CW0F 2JTVA 2ZCWA 2PBIA 3CUQA 3DEUA 2KJBA 2VE8A 4GCVA 3R4KA 1ZRFA 2DPDA 3K1MA 3HRMA 3LA2A 1YFHA 1Z1DA 4OINF 1W7PB 4GXOA 1OR7A 1R00A 2JZYA 2QQ9A 2GQQA 4EGZA 1XGMA 5D4SA 4DNCA 2KIMA 1XN7A 2Y0MA 3LA7A 5FLXK 3T8TA 3IHUA 5LHHA 3I59B 2P7VB 4PZJA 4CHUA 2IW5A 2MC3A 5LRSA 4RB3C 2O03A 4I2OA 4G9YA 2CWEA 4U7DA 2K7LA 5HLGA 1YW9A 1ZLJA 3QAHA 1BJAA 2L4AA 2STTA 2ZKZA 3Q5FA 3BP8A 3KZZA 4UVAA 4M72A 3LWFA 2OD5A 5DUKA 4A0YA 5DD4A 1XCBA 2JSCA 3ABTA 2HWVA 3EQLF 2KIFA 2TDXA 2VBWA 1LB2A 3WE2A 4LK1F 2P8TA 1KGSA 5D4RA 5BPIA 1ZGJA 1REPC 1J75A 4AD9A 2EV0A 4A5MA 1TQMA 3C7JA 4P55A 3QU6A 2ZO4A 2JPCA 4JBAA 2VOOA 1IN8A 2HQRA 1XDUA 2HOEA 2BBYA 3RYRA 4EJOA 5ICEA 1FLIA 2A07F 1BIBA 4HLYA 4G6DA 2KIUA 3F8BA 1K6OA 5DCMB 4BHBA 3HRUA 2P6SA 3DKWA 4I98B 2HTSA 1J9IA 2NRAC 4A6EA 2VE9A 2XAGA 1MGTA 4G6QA 3GF2A 4Q4ZF 1I1GA 2EV6A 4L0ZB 4YFNF 1S29A 1EH7A 2IT0A 4KMUX 3FZVA 2UXNA 3R60A 4ETSA 1BC7C 3JAMZ 3CUQB 1GHCA 3J7AO 1EH8A 2GZWA 5IT3A 2Y75A 2HYGD 4PCQA 1Q1HA 3CUOA 5EEGA 1T6SA 1BI1A 3WTYC 4HAMA 1PUEE 4HBLA 1KU2A 4L9VA 1GXQA 2FF4A 2DPUA 4AIHA 1P4XA 4Y13A 1FSEA 1IN6A 2K27A 5LEJA 1MDMA 3KEQA 1FC3A 4LLNA 1STZA 4ASNA 3BJAA 4HV5A 2ISZA 1WKMA 3N4MA 2GXBA 1FWZA 2DK8A 3QU3A 2A6HF 4ZYGA 1MKMA 2P5VA 4XRFA 4A6DA 3ZPLA 1OYIA 3E5XA 2RV8A 4LB5A 3KLNA 1Z9CA 4Q47A 2HFHA 5LGNA 3M1EA 3R61A 1SMTA 3RTRA 1PDNC 5HS9A 3SXYA 3TGNA 5FD5A 5BQTA 4M9ZA 1QO0D 2VBZA 5HOOA 4G7HF 4BHCA 4I7HA 2BEOA 1WQ2A 1CF7A 1DDNA 5LHIA 5IT9K 1LEBA 1FX7A 1G3YA 4JQFA 4FHTA 4HQEA 4ENNA 3CUQC 3HUGA 2XAJA 4LD5A 4IRHA 1UHMA 3OV8A 1TNSA 3K69A 2XHKA 5FFZA 2ESNA 1LJ9A 2NAZA 4LG0A 5ILVA 1E2XA 5LLQA
chains in the Genus database with same CATH superfamily
1TW2A 1XPXA 2EK5A 3ASNH 2R5YB 2Q0OA 3LSHA 4WCGA 4HNTA 4RB0A 2Z16A 1JJ8C 1FIAA 2V4JC 3JREA 3FXJA 4M9SA 2MLKA 3IV5A 1TQIA 2DMUA 3IC7A 3C2BA 4HRIA 4Y7NJ 3AG3H 3DXJF 4E7SA 1FOYA 5C4JJ 1PP7U 2UXXA 1UELB 3I64A 3MN2A 3HOYJ 4P9UA 2WA0A 3CMYA 1MIJA 2BY2A 3JCUC 1FYMA 1DU6A 1D1AA 2IAIA 2ICWG 4XLEA 3TMOA 2RQPA 3H0DA 1BJZA 3LAJA 3VYTB 3K4LA 1LVKA 5H6QA 4IOCF 2BYVE 4IEJA 4KJZA 1J0RA 2HKOA 3CCUI 2CFXA 4E7IA 4B8XA 2F5DA 4BH9A 1I6HJ 3DFGA 3BLYA 2ELJA 3K10A 5J3LA 1JTYA 5FKNA 1IXRC 1JHHA 4A93J 2CQKA 1P4WA 2Q2EB 2UUZA 1JKRC 1K78A 4B09A 4O5VA 1QBJA 1TT5B 2ELHA 4F91B 1UCRA 2CSOA 1S7OA 3VODA 1JT0A 1A31A 2JA7J 1GVJA 2W48A 1AKHA 4HNUA 4XSZF 2KP6A 1OCOH 1SD7A 5F27A 1DPUA 2LKXA 3JRBA 5GP9A 4A5NA 1F5TA 2PJRA 3QPHA 5B1BH 3MAJA 3E5UA 1WGXA 3Q3SA 3OOPA 3COAC 3PNVA 4FE7A 2WY7Q 4Y15A 1S3JA 1DP3A 2V9KA 2OTLI 3IWFA 3U2RA 2GOXB 3RI4A 4GFBA 2RDPA 2KT0A 2JK3A 1MDMB 1QA6A 3ZCOA 4U87A 5E3OA 2FMLA 4BXUA 2XKPA 2Z2SB 3M7GA 4NC7A 1B59A 1S9HA 1W1WE 4B3AA 1FOKA 2Y30A 2FSWA 4CGZA 2YSRA 2ZNZA 2VUMJ 5GAHJ 4RS8A 2A3SA 1WRJA 1HOMA 4KIBA 4IHYA 5J8FA 2F5EA 1HDPA 3SDBA 4EQQA 1NH3A 3CF5F 3ROUA 1MH3A 2VKDA 3H1CA 3CCLI 3S3NA 2XB0X 2GWRA 3MKWB 3C1DA 1B6AA 3S16J 4EJUA 3F3XA 1R71A 2KRFA 2DT5A 3AG2H 4ZYEA 1BN5A 2AXTC 1NK2P 2DN0A 2OZUA 2OQRA 4QWQA 5EGOB 4KMFA 5M5YJ 2P4WA 2VXDA 2XV4S 3DBRB 1P9QC 1WH5A 3BR2A 2HNHA 2Z5UA 1R1VA 2G7UA 4LG3A 3ZQCA 4AVZA 5FGMA 4B3XA 1ODDA 6PAXA 5C4XJ 4B48A 3MVPA 5FKLA 1P7IA 2O8XA 5K7ZA 1A5JA 4M73A 1R23A 2HZDA 3KFWX 1X2MA 4BY7J 4RBOA 5HLIA 4F55A 1B8IA 2P5KA 3ERED 2ZJ2A 2EA4A 1VQ6I 4ABZA 3J80K 2KRCA 4A3KJ 2R7TA 2L7KA 3V8LA 3VFZA 1T38A 2FBIA 3MKLA 3DTEA 4EV0A 5GPAA 1WZ2A 1O3TA 4KIGA 4F7ZA 3LSJA 3PSFA 2EILH 2MBFA 2QF7A 5LFAA 2ZJPF 1KA8A 3P9IA 2C6YA 4BQAA 2DMTA 1LFBA 4S04A 5FLVA 4A3GJ 4BXFA 2NOGA 5K7HA 2EFWA 3EETA 3U9GA 2XSDC 1VFCA 3LL7A 3RQIA 2VKHA 4OMZA 1ZR4A 1IUFA 3FXRA 1D5VA 4IRIA 4I09A 3ERMA 2X1CA 2LK2A 4OIOF 4CSWA 1KQ9A 1YLFA 4QTRA 1ZGWA 1NG6A 3EYYA 2GXAA 1ZYRF 2EFQA 1PVEA 2EZHA 2Z9OA 3JAMK 2OPTA 1R6RA 3FHZA 1TP4A 3HGGA 2Z1DA 2MSYA 1J09A 2COMA 3HKZA 1RUNA 4E7ZA 3C2GA 3FK7A 5DS9A 3I56I 1ZRCA 3U1KA 1JGSA 4OMYA 4E7HA 1ZHFA 2DQRA 5IP7J 2V1UA 4EMSA 3CDIA 1R9TJ 1BL0A 1MBJA 2H09A 3BZKA 2CV2A 2CFOA 4Z6YA 3T5XA 3VDXA 1R4NB 5D6FA 1BI3A 1P7JA 3H9QA 4HZFA 5JHUA 5L3FA 1FTTA 1TWHJ 3G1LA 4C3HJ 4RAGA 5CQGA 2X6OA 2M1BA 4IKFA 1ON1A 2K3PA 2JWTA 3B6CA 2R5ZB 3L2UA 3HB9A 2H6CA 3BROA 4XKCA 3A0HC 1W36D 2G0EA 1D5YA 1S7AA 2X51A 2LY9A 1Z7UA 1JUPA 3WG9A 1K78B 4BQNA 3QQAA 2DT7B 2D1HA 2XGDA 2I5UA 3I5UA 2FE3A 2GAUA 4KNYA 1X3UA 2DJIA 5E3LA 3S1RJ 1X1AA 2E1CA 5IT9Z 2RKHA 4MNUA 1QZZA 2HYJA 2HQ5A 3EUAA 5H20A 1RESA 1MJBA 2K9NA 2L2OA 2XSJC 1GDTA 5AONA 3BG9A 1IN4A 3P5JA 2IGNA 2UWMA 5L3BA 3ZQGA 2ADUA 2Z33A 2EZIA 4BJ6C 4S0HB 3VEPA 2F5FA 5J1YA 4RGSA 4XSXF 1USSA 1IV8A 2X48A 3OSFA 2EB7A 3OS1A 4MQVA 5D5VB 3LSGA 2IPQX 4D5FA 3RYPA 1WJDA 3FM3A 4JYKA 3SFIA 1Y0UA 4A0XA 3V8JA 2LNBA 1YIOA 5C3EJ 2L02A 4M3DA 5E3MA 1N77A 1JKOC 1XMXA 1XSXA 2F4MB 4WXCA 1R22A 5F1RA 5F1JA 2HS5A 3QYEA 3E6BA 2WAEA 1VQLI 2E2IJ 5E1XA 5DM6F 3SZPA 1IAWA 2OF7A 4EGYA 4KFCA 5DEQA 3MQ0A 3OL4A 3BOQA 3OYGA 1FT9A 4KT5C 4M3BA 3F8CA 3UR3C 2LSOA 5E18F 3F0CA 3FX3A 2ZJRF 1X3ZB 2VODA 3K4BA 4GO1A 3S14J 2NYXA 3HRSA 2CYYA 4XRSG 1DP7P 2QCOA 1PUFA 2BY3A 3AG4H 2OAZA 3H5RA 1FY7A 4BQQA 5GAGJ 1YJNI 2XAHA 2M7AA 5M3FJ 1YJWI 1R5HA 4M9XA 4P9FA 4LK0F 3GTQJ 3OL3A 1B8IB 1W36C 5JVTA 2EZLA 4BBSJ 4F92B 2IS6A 1G3TA 1KYZA 2BY1A 3G6EI 2OTJI 3BZ6A 1UHSA 2YR2A 2JPBA 5FFXA 1XDSA 3K4KA 3WE3A 5BNGA 2FQ3A 1O7LA 3LOCA 5E20A 3WU0A 3FIWA 1XG1A 3H3ZA 3OWTA 2IGKA 4ZDPA 1S5LC 2VJIA 4P96A 4W1UA 3B02A 3GZ6A 2XROA 4M71A 3SHFA 2ZXIA 1Z6RA 1DQUA 2EA2A 2K86A 4JX6A 2BHZA 3LQRA 4R1HA 3HOTA 2QWWA 5D6EA 2X4HA 4C2TA 5CVIA 4G7ZF 1KU7A 3GLLA 3RKQA 1LFPA 3K2AA 4PJNA 2DQLA 2VI6A 1VQ5I 2KMUA 3ZR8X 3OYIA 1MBEA 1R58A 3BQZA 2VB6A 2D2WA 1D0YA 2CV1A 1IRGA 4UB8C 3ECOA 2DA6A 3I4MJ 2K9MA 2K4BA 3IRRA 1U0JA 4PFOA 1LQ1A 3DPLC 1SMYF 3PJRA 3TO6A 2ACJA 3S3OA 2XIGA 1A6QA 2O3FA 3WTVC 4BDYA 2E5NA 1OLTA 2V1XA 1F4KA 3KZIC 3C2HA 3TL4X 3ISPA 5KAIC 3BTIA 2ZSHB 4EJWA 1TWGJ 5TRDA 1FSHA 3K4JA 4UV9A 1K4SA 3KP5A 3WODF 2QVOA 4DZJA 4KA4A 2A61A 4YFKF 2JJ7A 1OQYA 1G3WA 3O6BB 2VT3A 3BG5A 2AO9A 5GAEJ 4MQ9F 1Z91A 1YW8A 3TP0A 3TW7A 1HSTA 4L18B 3EDPA 4N9HA 4E7JA 3J80Z 1QZEA 5K5QA 3DU6A 1C0WA 3F8NA 3ZMVA 5BS6A 5K7FA 4HSRA 5HS7A 3A02A 3ABUA 4B44A 1EV7A 4E70A 3AKZA 3P9CA 1XCVA 2WV1A 4Y17A 1SANA 3Q0VA 2AHQA 3F9KA 1P6RA 2JMWA 1W5CC 1MSFC 2LFBA 3W2WA 1QHHD 4ZDOA 1POGA 4D9JA 3JRDA 2R0QC 4N9IA 4G94A 2ZNYA 3I3LA 3ABKH 2E2JJ 4A12A 3NRVA 5EDNA 1HW2A 4LITA 4CH7A 4AIKA 5HS8A 3M8JA 1HKTA 3CCJI 1S7EA 1SVOA 2H27A 4U7BA 1UB9A 3IP4B 3TKYA 1VQMI 2MLGA 3WTUC 3OR1C 3QOPA 4KN7X 3S2WA 2XC7A 4I0BA 1B9NA 5EG0A 2HQNA 5E17F 4FX0A 4D5CA 2VBYA 1W5SA 3IL2A 4BJ5C 2HDCA 4YIRX 5FRNA 3I4PA 4RGRA 1MSEC 3LSRA 3BDDA 3CDLA 4PK4A 2EFOA 1QNTA 5AIPA 5LRRA 4S05A 3RKYA 2IS1A 1O57A 2KQRA 4UY8I 1BI2A 5DCFA 4A2UA 4IL6C 3LSMA 2X1DA 2PMZN 1EJ9A 2KISA 2CUFA 2KHMA 2L3DA 1OYYA 2X6YA 3CJQB 3SEZA 3SJMA 1EA3A 4KDPA 4X6AJ 3FDYA 2KLOA 1BOBA 2MH9A 2WC2A 3CO7C 3T1BA 2QQBA 2FQ4A 4XORA 2Y9YA 4A3IJ 3HDDA 3IUOA 3C3WA 3SQNA 1V5EA 5E1WA 5K5OA 1PP8F 2PMZA 4M74A 1E3OC 4AUXA 3L00A 4CDGA 3CJNA 3DP7A 2LOOA 2JUCA 3B6AA 3ELKA 4LFUA 4XLCA 2M0MA 1XMKA 4N0BA 1Q1VA 1Z67A 2DAOA 1VQ8I 3EUKL 3U1DA 2XVCA 4BHPA 3K1PA 2VQHA 1P92A 3CLQA 3KP6A 3CZ6A 1T98A 4NDLA 2LYCA 3J7AY 3PNYA 4H4KC 2CO5A 1FIPA 3I53A 4B1RA 1I1SA 2HYFA 2NVXJ 5DTDA 1YS6A 3A01A 4L5EA 1G2HA 5IOYA 1TWAJ 2FNAA 2RQQA 4RB2C 2NNNA 3GTKJ 4KN4X 3S15J 1B1BA 5L3GA 2KIQA 2CU7A 1WWXA 2HEOA 3UNGC 2YS9A 4WXHA 3ML6A 2IP2A 1G3SA 2LC2A 4AYBA 4MEXF 2Y31A 2ZXJA 4M6VA 1VQOI 2DA3A 1RR8C 1OFCX 4GYGA 1LEAA 2JA2A 4C2MJ 4IZZA 3GXOA 1J5YA 4HLXA 4HDUA 3KLOA 2QENA 4OIQF 2XPWA 2PJPA 3BTJA 2HOTA 3FMQA 3ZN0A 3VWBA 5DM7F 3DKXA 3G2BA 2NXNB 3G73A 3K4NA 2QA4I 4UV8A 2M30A 4BBRJ 3QWLA 2QBYA 3S1MJ 3E3VA 2DFIA 3WTWC 4FE4A 5HLHA 4Y3OA 2VQCA 2CS3A 1HSJA 2X1EA 2IEKA 2EIJH 3GMEA 1RZ4A 5EEAA 2L9SA 1A04A 2KJCA 1T08B 3F22A 4XM3A 4OU0A 3DF8A 1IDYA 2CW7A 1DPRA 2BV6A 1VNDA 2R7XA 5J47A 1LDKB 5C44J 1OMIA 5FB2A 1T8IA 2V9PA 1RIOH 2Q1ZB 2HPIA 5J4VA 4M6XA 2QYOA 1IC8A 3N97A 3ZMZA 1SFEA 1H88C 1L0OC 2YUSA 2Q8KA 4Q48A 3EPZA 1XX5A 3KP7A 5HDGA 2O5RA 2M87A 1ZELA 2NVUB 4L0YB 2LDUA 4U88A 2LH9A 2OJED 5EEHA 4E7KA 3BC8A 1OR7C 4M6YA 1XB4A 2DTRA 4BE1A 4E4HA 2XUBA 2QSGX 1ERDA 2BVMA 3OYHA 4PJ0C 2ID6A 1IO2A 3OYEA 4II3A 1GT0C 2JT1A 2XB5A 3F8FA 5HVQC 4UUSA 1XMAA 4P1WA 5FRMA 1F1ZA 2O0YA 4IRGA 2R7RA 2HGCA 1HW5A 4HX7A 3SEQA 5HODA 3ZMSA 2DA1A 5DV5A 3D5SC 2HOAA 1APLC 2FBHA 2FX0A 3IKTA 3J81Z 1KU9A 2XAQA 1U6GA 3VOEA 3JTHA 3GTMJ 4ANJA 2ME6A 2JA8J 3ZQ7A 3NEUA 5BPDA 3CD6I 3RPQA 4DYRA 3FMRA 2MD5A 2HI3A 3MKYB 2P7CB 2L9RA 4HQMA 5M3MJ 2VT2A 3ABMH 2KRHA 3I54A 5K1YA 5EG0B 1MMGA 3M8FA 5KHDA 1SFXA 3E6CC 2DT6A 2XAUA 2WV0A 2XKOA 3D0SA 2KKOA 2E7XA 3F6VA 2YX4A 3OOUA 3CESA 2CG4A 2V7FA 2IRFG 2D1VA 1IN7A 1Y56A 2ME0A 3GTLJ 3TO9A 1NG7A 3QODA 3R6SA 1RC9A 1O4XA 4D7MA 4LJZF 1V5FA 5A2QK 1ETOA 4OOIA 1EKEA 2OCEA 2ZC2A 2RC4A 5DD8A 1KQ0A 2VN2A 1OCRH 2KL4A 1HW1A 3DEWA 2RN7A 3HIFA 3J7YJ 1HKQA 4G12A 3K70D 4DBRA 3JRCA 1ZG1A 3ZQLA 1GV2A 2ISYA 5CLSA 1OCCH 5B1AH 4CYCA 2EFPA 3G71I 3QP6A 2R7WA 1TW3A 3BT9A 1H9GA 2DI3A 5LGTA 2DA7A 4B43A 3W6JB 1WPKA 3FXMA 3WGIA 2ECCA 2RAEA 4IHWA 4IHTA 1RUOA 2PEXA 1B4AA 3NQOA 2DODA 1ZG3A 2XRNA 3L2QA 3HOVJ 4WX9A 3DTIA 3G3ZA 4UB6C 3HPGA 3VSLA 2LR8A 3HSEA 5IOZA 2BHYA 2E2HJ 2QQ8A 3P7NA 2LLKA 2YX7A 3OS0A 1KQ8A 3ZGKA 1TBXA 1Z21A 2K4JA 2L7FP 2GIVA 2DTZA 2J5PA 2P6TA 3MFKA 1U3EM 1P4AA 3CP8A 1WVRA 2H6BA 1SD6A 2ZXWH 1WHUA 2A68F 2FNPA 2XDVA 1YS7A 2JN6A 4HYEA 2M2EA 4EVIA 4RDUA 3OY9A 2DFEA 4JOMA 4A3JJ 4XN3A 4RM3A 2K85A 2W1OA 3RKXA 3BG3A 5FJ8J 1I5ZA 2VJ4A 1X2NA 2MC4A 5L3EA 1RNLA 3IWZA 4FTHA 1FEXA 3MKZA 5L3CA 1CQTA 4L5IA 2QBYB 3ZP5A 4QPQA 2DA4A 3HHHA 1CF7B 2BXYA 4HG2A 5ICFA 1LNWA 4E6KG 2QZ8A 2DYSH 5D5WB 1W7PA 4XMYA 1AA7A 2Y48A 2JA5J 3AL0C 1HKSA 2W57A 2QGUA 2HXIA 3HUGB 4BAYA 1OPCA 3K7AJ 4EJTA 3KYDB 2BGCA 3ZQFA 3WTXC 3RZDJ 3AAFA 3OYNA 3FMSA 3E97A 4U0VA 1G8XA 4IHSA 3I59A 3RIRA 2CJJA 2JRTA 3HG9A 4LG0B 3TBIA 2ZFUA 2DBBA 1XGOA 4CUGA 3HKZN 4V2FA 3K1NA 3GZNB 1O3RA 3O3KA 4DOZA 4ON0A 1LVAA 1S8NA 1Y6IA 1XD7A 3WHBA 4HF2A 4AIJA 4KITB 2W84A 1ZR2A 2MD0A 2LF8A 3FBIB 2VOPA 2XF7A 5KK1A 3KPHA 1J7KA 1R7JA 2EFNA 4XIDA 3OIQA 4UUSB 2L7MP 2BY0A 2X6XA 2VQLA 1K83J 2FJ1A 4W97A 2ETHA 1XTAA 3GTPJ 4ZC3A 2HOSA 4LGWA 3TDUC 2HTJA 3WHCA 4BDZA 1BI0A 2V79A 2DW4A 2HZTA 4PSXA 4HX4A 4XLPF 4RAFA 1I50J 2OA4A 5J6XA 5IY5H 1D3YA 4XK4A 1JHFA 3H5NA 2VJJA 1MMAA 4QIWN 4XQFA 4A3CJ 3FISA 2DJNA 2HR3A 2H94A 2AXLA 4U0YA 2NOJB 3EYIA 1LE8A 2R7VA 3QRFF 4I76A 1X4PA 3RPUA 3X2QH 4BEHA 1ACIA 2MABA 1ENHA 4YIIA 2K5CA 3L9FA 4NQWA 3CCYA 1E3HA 4P5OA 3GCMA 4FISA 2ZFWA 3S2HJ 1JKPC 4ENMA 3V4GA 5FLMJ 2ZJQF 1RI7A 3MCZA 1AKHB 4YELA 4CCOA 2A05A 3SYTA 2UZKA 2LVSA 2K40A 2FBKA 5KNLA 2VONA 3TQNA 3V7SA 3S1QJ 5EZGA 2PJRB 4L9NA 2ESHA 2EBIA 2K3FA 3PO2J 3OYJA 1UHWA 3FXQA 1ONVA 2DDBA 3WTSC 4XBFA 3HGYA 2Y0SN 5TISC 4XLFA 1DGWY 2L5QA 4B4CA 4CZCA 3G1OA 4ESJA 1E0EA 1LDDA 2LMDA 2RNGA 2FA5A 4FT8A 4HOBA 4KIFA 1YI2I 4G7OF 3BTLA 1YX5A 3PFYA 1HXDA 4RLFA 5DCMA 1FMWA 3LSTA 2Y0SA 3T8RA 2O61A 5K5RA 3FF5A 1LKXA 3O8HA 4BUPA 3TW6A 2R7UA 1QVUA 4PDKA 2EINH 3CJRB 3GZ5A 3TP3A 5JR3A 3L2CA 5TGTA 4IXAA 1YJ9I 1SEUA 4A0ZA 2PN6A 1AWCA 1PJRA 2O6GE 1FTZA 4KT6A 3IH4A 2J5OA 3LFUA 4BY1J 1ZG5A 2BW3A 5DUIA 1H9TA 2W24A 2IXSA 4AIDA 3DPUA 1ZKGA 3L7WA 3HTSB 3JTGA 3L2VA 3IKVA 1BIAA 1MJ9A 5D8KB 4GRIA 4H0EA 1O3SA 1K61A 4K2EA 3I9V2 3F8MA 5LEKA 1K7AA 1D8JA 1TWFJ 3CCRI 3GEZA 5F0CA 1N25A 1YTYA 4ZYHA 1MJAA 2OZ6A 3KETA 2R7SA 2DLLA 4I01A 1YYVA 3L2RA 2XGEA 2IA2A 3JRFA 4DQ2A 2M4KA 5EF6A 1BOAA 3VB2A 2X0LA 3K6GA 3PUBA 2STWA 5J8CA 3PM1A 2LKSA 2XASA 1E17A 4CICA 1USTA 5E8GA 1E3PA 2Z99A 3FM5A 3GFMA 4N4OB 4UVBA 4UVCA 4F93B 1TTYA 1U9OA 3PNTA 3RJPA 3DEEA 4KYWA 3Q9SA 3WTTC 1QRYA 4YRVA 5A2QZ 1RR7A 3H3UA 2MH2A 5BOXA 2WB1N 1J59A 1QPIA 3CC7I 1GV5A 1W7PD 4U0WA 5ICCA 3L09A 3K0LA 3A2KA 2R4GA 2COBA 4RAYA 3GX4X 3M8EA 4M3GA 1B9MA 3HYIA 3RCOA 2QUFA 4GDFA 3REOA 4DBQA 3J81K 2W4SA 4C30A 2D5VA 2I8DA 3PO3J 3K9TA 1O3QA 2WB1A 1NHAA 5FD6A 4X0GA 4IHVA 5LHGA 4CCNA 3GW2A 4MEYF 2M5WA 2FRHA 4IQ4A 2VJ5A 4D7NA 1GVDA 2LKPA 1XSVA 2RGVA 3RQ4A 1I27A 1OISA 3ESWB 5D8LB 2L7ZA 2NVQJ 1OYWA 5JHFA 2EWNA 1ZREA 4XKVA 3CDHA 4EJVA 1SFOJ 2BXZA 4MHGA 3NWSA 3S17J 1MMDA 3DCFA 2WADA 4A3DJ 3H36A 1KYWA 2ZSIB 5KCMA 1IF1A 3CLOA 5HDKA 1I3AA 5EYRA 3H9GA 3D5LA 1JE8A 1ZK8A 3F23A 3CC4I 3HXLA 4FCYA 2V6CA 5JLWA 1V5GA 4WWCA 2KPMA 4BYYA 2F4OB 4J01A 1ZH5A 4YG2F 1N75A 1K79A 2BOLA 3KIOA 4HEA2 3PQJA 4BEHB 3BZCA 1WSUA 5CJ9A 4QLCU 3H3VK 2WY8Q 4HSTA 1U5TA 3F72A 1U9NA 1D0XA 2BE5F 2CUZA 1AHDP 1G4DA 1ZLKA 1HA8A 3QPSA 4C9YA 1LDJA 2QLZA 2PG4A 3BG7A 4HF0A 1UFMA 2CMPA 1W4MA 3LNQA 3RPUD 2K02A 2FOWA 1IZ1A 3DPTA 2OC6A 2F2EA 5M5WJ 3VSKA 1R1TA 3CMMA 3MD2A 3GTOJ 1WI3A 3SFZA 2P5LC 1T0FA 2GA1A 4XRMA 2M34A 3ECHA 5EZHA 4DZPA 1TLHB 5KVRA 1JI8A 4Y4RA 2R5YA 1JKQC 2WBMA 3QYFA 3OYCA 2V1DA 2RREA 3FWEA 1K4TA 4MLOA 1SVLA 2D45A 4ZJZA 1MZBA 2W85A 4Q5SF 5JFRA 1FMVA 2EZKA 3H92A 1EH6A 1TNTA 3GO5A 1RKWA 1X19A 3FXUA 5CVRA 1T39A 1H0MA 1W5TA 1FNNA 4L9JA 4BNCA 2JA6J 1ZN2A 5F0HA 2LD5A 5FKOA 4AWXB 1Z0XA 3S8PA 4FQGA 2K9SA 2VC0A 2E35A 1ZRDA 5CYVA 3BCBA 2E19A 5FO5A 3GTGJ 4IHXA 3CMAI 1FYKA 1X58A 1BR1A 3QPLA 4ZH4F 3E0JB 2AS5F 2PLYA 1MBHA 3HEFA 2CUEA 2RVCA 1WJBA 1W0TA 3IAS2 4C2UA 4AVPA 1JTXA 1I39A 4EATA 2OQGA 3QP5A 2IBDA 2BW3B 4EM1A 3BR6A 1R4MB 1R5GA 1BR4A 3P9KA 1FBQA 2X9DA 3M3YJ 1ORKA 1G6NA 4EM0B 1V55H 3TOBA 4QPOA 3LQQA 3F21A 5B5EC 1LFUP 1BM9A 1VQPI 2VKVA 1T2KA 2Y2ZA 2B9SA 3DBHB 1IXCA 5E8IA 2LBFA 2Q2EA 3CO6C 1VTNC 4NNJA 1PUFB 4CXFA 4XR6A 5GADJ 4WXDA 3OSGA 1OCTC 2E71A 1D8KA 1IRXA 3GVAA 1MMSA 3HOWJ 2R7QA 4RB1A 2UV1A 4UXNA 3GUDA 1QGPA 2A69F 1QQIA 2A5YB 2DCEA 2WTEA 1WJAA 4L5JA 5LGUA 5CVJA 1QZYA 4L9TA 2N8GA 2NNYA 2H1LA 2VBXA 1IRFA 2QKMB 3AG1H 3HTUA 3WTZA 2DMNA 2VIXA 3RKWA 3HOZJ 4BE2A 2HVSA 4AYBN 4DW6A 1U2WA 4NC6A 3PQKA 5GTHC 2NS8A 4JK1X 1FOWA 3QPTA 3PFIA 4KUMA 1KZHA 4XOPA 3V7RA 1YW7A 5DDGA 1TL8A 2DO7A 1J2XA 3MMYB 5AIQA 4M3FA 4UNOA 1NTCA 1OKRA 1I6XA 2OV7A 1AOYA 4DYQA 2JVHA 5E79C 2X85A 1Z05A 2CQXA 3TDZC 1JJ6C 2CGPA 3E6DA 2HPMA 5EGOA 1OJLA 2PFBA 4F3QA 2VC1A 4IJAA 4IQJA 2L0KA 4HA8A 3VYRB 1IXSB 4A3LJ 1X1DA 3ABLH 2GA2A 3MWMA 2DXIA 1TQPA 2B0LA 1ETXA 2HXOA 4Y33A 1U8BA 1VF9A 4XLHA 2FOKA 1BR2A 3D1NI 4I99C 1O7FA 2VLAA 1A36A 4UUVA 4J00A 5ICGA 4R79A 3BR1A 3FXLA 3V8KA 2VXZA 2JQ7A 3BR5A 1R49A 1R36A 1U5TB 1FPQA 3K2ZA 4WF2A 2KDZA 1DUXC 1BW5A 3FKIJ 2DYRH 1IW7F 3HSFA 2A6TA 1Z6TA 4X1EA 2M7BA 1ZARA 2V9VA 4OAYA 4ESFA 4MTDA 3GYHX 3Q0WA 4BQOA 3I55I 4XOTA 2HKXA 2GIZA 4LMYA 3BCAA 5ILUA 4ZDLA 3S93A 4O3MA 1IUYA 4FASD 1ULYA 1M1EB 1MD0A 2GXGA 4A69C 1GXPA 4WK8F 4TV7A 1IG7A 1X1CA 2E1NA 3G4SI 2E1MB 1XGSA 3IAM2 5HDNA 3JRHA 3WG7H 3E6MA 2CQQA 3CP2A 3HRTA 4I0AA 5FLXZ 1X1PA 2QQAA 2H8WA 3TOAA 4ZYDA 2CQ7A 1R5ID 4DYCA 3WU1B 4HDVA 1IDZA 4NC8A 1VQKI 2VPLA 1VQ7I 4G8XA 2VQGA 3B73A 1TWCJ 1HBXG 3LSIA 4PJLA 1KONA 3BJOA 2PQ8A 5F64A 1SAXA 2QM3A 5IYCJ 4QSHA 3AL0B 2DFFA 3ZMDA 3PIPF 5E1ZB 3LMMA 3O2PE 4EEFG 3PL8A 4XN0A 1ZGAA 4IF4A 1CGPA 1T33A 2LF7A 1FYLA 1SAUA 4ZYAA 3GFLA 2A6EF 3KP2A 4I02A 2E7WA 5H2FC 2ZMEA 2R5ZA 1QPMA 1AU7A 1FBUA 2FEZA 5EJCA 3I4NJ 1MH4A 4OIRF 3FK6A 3VPRA 2RNJA 2W25A 3ASOH 5GPCA 3PUFA 3JSOA 1FJLA 3HSRA 2OBPA 3WGGA 1YQAA 2QKLB 2TCTA 2H8RA 2FXAA 2R7FA 1T56A 3KP4A 1Z3YA 2LBFB 3KZYA 1YG2A 5J1UA 3C18A 2L4MA 2LRDA 2ELKA 4NHJA 1HCRA 1ZTRA 4UUTA 4LB6B 1JT6A 2O7OA 3BQYA 2VKEA 1HLVA 4PUSA 4KICA 1JUMA 2GOMA 2DU9A 1Y8RB 2WWYA 4IOAF 1FZPB 3GWZA 1U8RA 3JR9A 2EPFA 3OMYA 3MZHA 3BPVA 3NWTA 1GUUA 3HPHA 3KP3A 5CVVA 4GGGA 4LIUA 1K6YA 5H6RA 5IP9J 3OYKA 4I6ZA 4A3FJ 4HX8A 1PYVA 1U5TC 2XPUA 4ITVA 4YFXF 3JSPA 3R0JA 3UKGA 3LSPA 1Z7LA 3HOXJ 3FXOA 4RGUA 1WJFA 2BVLA 2P0WA 5F0FA 3A01B 5F6FA 4PSWA 3TEDA 2PI0A 1D1BA 4NBQA 3KE2A 4PGGA 2F6CA 3WGHA 3LFKA 3S2DJ 3MZ8A 2LY2A 2EJRA 2IA0A 3QOEA 3E5QA 1L3LA 2CRGA 3A1YA 4FX4A 4MGRA 5CVUA 4HNVA 3OYLA 1WH7A 2E1MC 3DV8A 1BC8C 1VQNI 3OIOA 1T0FC 2DMQA 2KDOA 2V26A 3K4CA 1N78A 1P2FA 3NAUA 2KZVA 3KEYA 3OYDA 4YIFA 2HU9A 1FP1D 1FBSA 1F9NA 2EV5A 1VQ4I 3ZXSA 4XRSA 1MNDA 1HF0A 2XGXA 4BU2A 1V3FA 4HW0A 2IGOA 4D0PA 3GLXA 3Q9VA 2PMUA 1LPQA 1V54H 5JI6A 2M4GA 1MW7A 3CJTB 4MIMA 2EIMH 2R7DA 3KCCA 2OU2A 3ZN1A 2VL8A 1FP2A 3V7CA 5IP6A 4Y52J 4LIVA 4RMNA 4D1QA 1RETA 2FU4A 3K4MA 2L54A 1IRZA 3W3CA 1Z77A 2DA5A 1SD4A 1B72A 5IYDJ 3WU2C 2ECBA 3HBLA 1Y39A 2VASA 4A3EJ 5B3SH 1GLNA 3LA3A 2JVGA 2NS0A 3O8GA 3CQZJ 2R7OA 3R0AA 4NB5A 3A0BC 5ED4A 2XF5A 3BPXA 3K70C 5CPRB 2IA1A 1S6LA 4CCLA 4RA2A 4RGXA 2OCCH 2YPRA 4LLGF 5DYMA 3OYFA 4HF1A 2NVYJ 3IRQA 5E3NA 5ILSA 3SZGA 3LAPA 1XSDA 3A03A 5J40A 3DQVC 1U78A 4CZZA 1WJEA 2G7HA 1YITI 2G9WA 4JP0A 4F52A 4NUBA 1SFUA 2IJLA 3GFJA 1IGNA 1XGNA 2XAFA 4R8HA 1UAAA 3I71A 4II2A 2LTPA 1D0ZA 5L3DA 3EUHA 3ZQIA 1WI9A 2IVMA 2X6WA 1Z3XA 4BGDA 4ESBA 1ZAOA 1YE9A 3BY6A 3TO7A 2MA3A 1WJCA 3ZQQA 3MZYA 3N05A 1JXSA 3OYAA 4O6JA 4XICA 4MTEA 2L01A 1QU3A 1YX3A 2GBYA 3ZMTA 4BACA 1A6IA 3M9AA 4B47A 4IO9F 1Y0NA 5ERIA 1YRNA 4HPQA 1G59A 5HNFA 3HZJA 5KAFC 2YU3A 3RDIA 3ZQHA 3HHGA 3H5AA 2R3SA 2EH3A 3MEXA 2M9HA 4XONA 3BG6A 1MBGA 3LSKA 2K9LA 4LOCA 3W6VA 2ZXHA 4UHTA 2FD5A 4CYDA 4PFPA 1V4RA 3JW4A 4GYIA 4EM2A 3HOSA 5TJJA 1ZQ3P 3DTKA 4IPAA 4ENJA 4MFEA 4PGHA 2HDWA 4HV6A 4V2GA 2PMHA 3F6OA 4Z2YA 3BWGA 2EIKH 1WCMJ 2ZMEB 3BR3A 3H9JA 2E60A 3HJEA 3ULQB 2Z3YA 1MNEA 2ID3A 2WAFA 4XLNF 4OIPF 1UG0A 5CQEA 1JUSA 1SVMA 2FMYA 2R92J 1VI0A 1T95A 3CTAA 5F04A 3BJ6A 2M45A 4JX4A 2DMPA 2IS4A 4ZZDA 2L9NA 2E1OA 2H1KA 1IN5A 3S3MA 3KYCB 2DOEA 2A5WA 2DK5A 3SZTA 5LBQA 3GFIA 2GLOA 3I58A 2F5CA 4CYCB 2WAQN 1HQCA 3BR0A 1DGRM 1ETVA 1BW6A 4ENKA 4A3MJ 4AC0A 3ZMUA 2ZBKA 3I0TA 4LLLA 1TT0A 2Y9ZA 4XKBA 2WAQA 1NK3P 1BBYA 3CF2A 4J19A 2Y69H 5J4YA 5D5UB 4DJAA 1W0UA 2M0CA 1D1CA 1YO5C 3DU5A 4AU7A 3HL2A 1SC7A 4RAZA 3W6KB 1ON2A 1SD5A 2W7NA 4CO8A 3KEOA 2M8EA 2E5ZA 2XF6A 5D5XB 2M3AA 5BMZA 3T0YA 4ZZLA 3KYLA 1KU3A 4IVNA 1R1UA 4BS9A 2CW0F 2JTVA 2ZCWA 5J1RA 2PBIA 3CUQA 4IX7A 3DEUA 2LY1A 3DWLE 2CV0A 2KJBA 2R7ZJ 2F48A 3V42A 2NS7A 2VE8A 2QSHX 2KZGA 1OCPA 2W82A 1XC5A 4GCVA 4PJMA 2F4IA 3R4KA 4YEJA 3FKJA 2B63J 1ZRFA 2DPDA 3K1MA 3HRMA 3S1NJ 3CMEI 5CKTA 3PSIA 4CCKA 3LA2A 1UMQA 1Z1DA 1YFHA 4DGWB 4OINF 1W7PB 2FUG2 4GXOA 2NVTJ 1OR7A 1R00A 2JZYA 2MW8A 4XKWA 3H0GJ 2QQ9A 4V19K 2GQQA 4EGZA 1XGMA 5D4SA 4DNCA 3CCSI 1MNMC 1B72B 1IJWC 2KIMA 1XN7A 2Y0MA 3LA7A 5FLXK 2OUMA 3T8TA 4FETA 3IHUA 5LHHA 1YOVB 3I59B 5GTIC 3H35A 2P7VB 2ZMEC 2IS2A 4CCMA 2O8KA 4PZJA 2QEXI 2MYSA 5HNHA 4CHUA 2IW5A 2MG4A 3HOUJ 3E7LA 2MC3A 5LRSA 1ITYA 1HDDC 3D5RC 4RB3C 4BJTA 2O03A 5F08A 4C3JJ 1Y1WJ 4OAZA 4I2OA 4G9YA 3S32A 1X1BA 2CWEA 2KFDA 4U7DA 5B66C 5JLXA 1WJ5A 2K7LA 5HLGA 1YW9A 4MO7A 4MFDA 1LUJB 1ZLJA 3FBNB 3HM5A 3DKYA 3QAHA 3IH3A 2AQEA 1BJAA 1F43A 3L2WA 2L4AA 2STTA 3DLLF 2ZKZA 2CH0A 3Q5FA 5HLTA 2B7EA 3BP8A 2XGCA 3KZZA 4UVAA 1YRNB 4M72A 3LWFA 2OD5A 5DUKA 4A0YA 2JUGA 5DD4A 1WFXA 1XCBA 1QHGA 2JSCA 3ABTA 2HWVA 1LE8B 3EQLF 2KIFA 2TDXA 2VBWA 1LB2A 3WE2A 3OYBA 4LK1F 2P8TA 1RPWA 1KGSA 1RKTA 5D4RA 2CW8A 1IV6A 4NQWB 1YIJI 5BPIA 2HDDA 1ZGJA 1REPC 1J75A 1HC8A 1ETYA 4AD9A 9ANTA 2EV0A 4A5MA 1S72I 3KX2A 1ETKA 1TQMA 3C7JA 2JRMA 4ZTJA 4P55A 3QU6A 2VPRA 2IGMA 1TZLA 1UZCA 3JRAA 2ZO4A 2JPCA 2LP0A 4JBAA 2DFHA 2VOOA 1IN8A 2BZTA 2HQRA 1XDUA 2E36A 1MMNA 2MFZA 2V1NA 2HOEA 2BBYA 3RYRA 4EJOA 2YU9J 4XL9A 5ICEA 1FLIA 2A07F 3CC2I 3GBGA 1BIBA 4HLYA 4G6DA 3JRIA 2KIUA 2LG4A 3E1SA 3F8BA 1K6OA 2HQAA 5DCMB 3J7ZI 2PX9A 4PJJA 4BHBA 3HRUA 5FROA 2P6SA 4OWRB 2DA2A 3DKWA 1ETWA 4I98B 1SFKA 3CCMI 5JVGF 3M07A 2V6EA 2HTSA 1JGGA 3HC7A 1J9IA 2E34A 3G1MA 2NRAC 4A6EA 2VE9A 2XAGA 1MGTA 4G6QA 3GF2A 4C3IJ 4Q4ZF 3ZOBA 2EQRA 1I1GA 5FKMA 2EV6A 1MBKA 1I3QJ 2F5VA 4L0ZB 2DOFA 4YFNF 3FHNA 1S29A 2GM4A 1EH7A 1YHQI 2IT0A 4KMUX 3L1PA 3FZVA 3EUHC 1VQ9I 2UXNA 3R60A 4ETSA 1BC7C 3JAMZ 3CUQB 2AQFA 1GHCA 4G6TB 1EH8A 3J7AO 2GZWA 5IT3A 4BL0B 3DBLB 2Y75A 3PIOF 2HYGD 4PCQA 4KISA 1Q1HA 3CUOA 2TRTA 3DLAA 1FOXA 5EEGA 1MBFA 1A35A 1T6SA 1BI1A 3WTYC 4HAMA 1PUEE 4HBLA 1KU2A 1QVTA 4L9VA 1GXQA 2FF4A 2DPUA 3OS2A 1H8AC 1X3WB 4AIHA 1P4XA 5IPAA 4Y13A 1FSEA 1IN6A 2W00A 3CCEI 2K27A 4CA0A 5LEJA 4N4NB 1MDMA 3KEQA 2LREA 4M3EA 1FC3A 4LLNA 1STZA 4ASNA 1UJ8A 3BJAA 1UG2A 4CCJA 4HV5A 2ISZA 1WKMA 3FXKA 3SDGA 3N4MA 2GXBA 1DU0A 1FWZA 5M5XJ 2DK8A 3QU3A 3VYSB 4BKXA 3OYMA 3M4OJ 2CQNA 4BE0A 2A6HF 3ONQA 4ZYGA 1MKMA 1Y1VJ 2P5VA 4XRFA 2K9QA 4A6DA 4E7LA 3ZPLA 1OCZH 1OYIA 3OR2C 3E5XA 1Y8QB 2CUJA 2RV8A 4LB5A 4RM2A 3KLNA 3Q0UA 1RRJA 3W2VA 1Z9CA 4Q47A 4XNFA 2HFHA 5LGNA 3M1EA 3R61A 2XRLA 1SMTA 3RTRA 3CCVI 2HVRA 3U21A 1X4OA 1TC3C 3VYUB 4AM3A 2QSFX 1PDNC 5HS9A 3SXYA 4ZTFA 2DOAA 3TGNA 2MGQA 5FD5A 5LD2C 4RLQA 1H89C 3RSNA 2ZB9A 5BQTA 1F36A 4M9ZA 1QO0D 4DIQA 3GTJJ 2M8GX 3JRGA 3IH2A 2VBZA 5HOOA 1EF4A 3CCQI 3ZRGA 4G7HF 4BHCA 3W2AA 1XS9A 4I7HA 2BEOA 4A3BJ 1WQ2A 3M1CA 1CF7A 3AFHA 2L9VA 1DDNA 5LHIA 4BXXJ 5IT9K 1LEBA 1FX7A 1G3YA 2R93J 4JQFA 4FHTA 4HQEA 2O9LA 5IYBJ 3A4CA 2HVQA 2I10A 2DDAA 5FKKA 4ENNA 3CUQC 3HUGA 4JX5A 2XAJA 4LD5A 3BTCA 2JSPA 1UHMA 3OIPA 4IRHA 4XLAA 3RZOJ 3OV8A 1BA5A 1TNSA 3K69A 2XPVA 2XHKA 5FFZA 2ESNA 3QYBA 1VZ0A 2P81A 1LJ9A 2NAZA 4LG0A 1ETQA 5ILVA 1E2XA 5LLQA 3NARA
chains in the Genus database with same CATH topology
1TW2A 2EK5A 2Q0OA 4WCGA 4RB0A 4M9SA 2MLKA 1TQIA 3IC7A 3DXJF 1PP7U 2UXXA 3I64A 4P9UA 1FYMA 2RQPA 3LAJA 5H6QA 2BYVE 1J0RA 2HKOA 2CFXA 4B8XA 2F5DA 4BH9A 3DFGA 1IXRC 1JHHA 2CQKA 1P4WA 1K78A 4B09A 4O5VA 1QBJA 2ELHA 1UCRA 2CSOA 1S7OA 3VODA 1GVJA 4XSZF 1SD7A 1DPUA 4A5NA 1F5TA 3QPHA 3MAJA 3E5UA 3OOPA 3COAC 4Y15A 1S3JA 3IWFA 3U2RA 3RI4A 2RDPA 1MDMB 2FMLA 4BXUA 2XKPA 3M7GA 1B59A 1FOKA 2FSWA 4CGZA 2YSRA 2ZNZA 4RS8A 2A3SA 1WRJA 4KIBA 5J8FA 2F5EA 4EQQA 3ROUA 2GWRA 3C1DA 1B6AA 4EJUA 3F3XA 2KRFA 2DT5A 4ZYEA 1BN5A 2OZUA 2OQRA 4QWQA 4KMFA 2P4WA 2XV4S 2Z5UA 1R1VA 2G7UA 5FGMA 1ODDA 6PAXA 2O8XA 4M73A 1R23A 3KFWX 5HLIA 2P5KA 3ERED 2ZJ2A 2EA4A 3J80K 3V8LA 3VFZA 1T38A 2FBIA 4EV0A 1O3TA 4KIGA 4F7ZA 2MBFA 1KA8A 3P9IA 2C6YA 4BQAA 4S04A 2EFWA 3EETA 3U9GA 4OMZA 3FXRA 1D5VA 4IRIA 4I09A 4OIOF 1KQ9A 1YLFA 3EYYA 1ZYRF 2EFQA 2Z9OA 3JAMK 3FHZA 1RUNA 2COMA 1ZRCA 1JGSA 4OMYA 1ZHFA 2DQRA 2V1UA 4EMSA 2H09A 3T5XA 5D6FA 1BI3A 4HZFA 5L3FA 5JHUA 2M1BA 1ON1A 2H6CA 3BROA 1S7AA 1Z7UA 3WG9A 1K78B 2D1HA 3I5UA 2FE3A 2GAUA 4KNYA 1X3UA 2E1CA 5IT9Z 2RKHA 4MNUA 1QZZA 5H20A 1MJBA 5AONA 1IN4A 2UWMA 5L3BA 2ADUA 2Z33A 3VEPA 2F5FA 4RGSA 4XSXF 1USSA 2EB7A 4MQVA 5D5VB 2IPQX 3RYPA 3FM3A 4A0XA 1Y0UA 3V8JA 2LNBA 1YIOA 2L02A 1XSXA 4WXCA 1R22A 5F1RA 2HS5A 3E6BA 5E1XA 3SZPA 1IAWA 4EGYA 4KFCA 5DEQA 3MQ0A 3BOQA 1FT9A 4KT5C 3F8CA 2LSOA 5E18F 3FX3A 2VODA 4GO1A 2NYXA 3HRSA 2CYYA 1DP7P 2OAZA 1FY7A 2XAHA 1R5HA 4M9XA 4P9FA 4LK0F 5JVTA 1G3TA 1KYZA 3BZ6A 2YR2A 2JPBA 5FFXA 1XDSA 3WE3A 2FQ3A 1O7LA 5E20A 3WU0A 3H3ZA 4P96A 3B02A 3GZ6A 2XROA 4M71A 3SHFA 1Z6RA 2EA2A 2K86A 3LQRA 4R1HA 3HOTA 2QWWA 5D6EA 2X4HA 5CVIA 4G7ZF 1KU7A 2DQLA 1R58A 2D2WA 1IRGA 3ECOA 3IRRA 2K4BA 1LQ1A 3DPLC 1SMYF 3TO6A 2ACJA 2XIGA 2O3FA 3WTVC 2V1XA 1F4KA 3ISPA 4EJWA 5TRDA 1FSHA 4UV9A 3KP5A 3WODF 2QVOA 4KA4A 2A61A 4YFKF 1G3WA 3O6BB 2VT3A 4MQ9F 1Z91A 1YW8A 1HSTA 4L18B 3EDPA 4N9HA 3J80Z 5K5QA 1C0WA 3F8NA 3ZMVA 5BS6A 5HS7A 3ABUA 1EV7A 4E70A 3P9CA 1XCVA 4Y17A 1P6RA 4G94A 2ZNYA 4A12A 3NRVA 1HW2A 4AIKA 1HKTA 5HS8A 2H27A 4U7BA 1UB9A 3TKYA 2MLGA 3WTUC 3QOPA 4KN7X 3S2WA 4I0BA 1B9NA 2HQNA 5E17F 4FX0A 2VBYA 1W5SA 3IL2A 2HDCA 3I4PA 4RGRA 3BDDA 4S05A 2EFOA 1QNTA 5AIPA 5LRRA 3RKYA 1O57A 1BI2A 5DCFA 4A2UA 2L3DA 1OYYA 4KDPA 2MH9A 2WC2A 3CO7C 3T1BA 2QQBA 3C3WA 3SQNA 5K5OA 5E1WA 1PP8F 4M74A 3L00A 4CDGA 3CJNA 3DP7A 3ELKA 4LFUA 1GXPA 4N0BA 1XMKA 2DAOA 3U1DA 2XVCA 4BHPA 3K1PA 1P92A 3KP6A 1T98A 2CO5A 3I53A 1I1SA 2HYFA 1YS6A 2FNAA 4RB2C 2NNNA 4KN4X 1B1BA 5L3GA 1WWXA 2HEOA 4WXHA 3ML6A 2IP2A 1G3SA 4MEXF 2ZXJA 4GYGA 1LEAA 3GXOA 1J5YA 4HLXA 4HDUA 3KLOA 2QENA 4OIQF 2PJPA 3FMQA 3ZN0A 3G73A 4UV8A 2M30A 2QBYA 3E3VA 2DFIA 3WTWC 5HLHA 1HSJA 1RZ4A 1A04A 2KJCA 3F22A 4OU0A 3DF8A 1DPRA 2BV6A 1LDKB 1OMIA 5FB2A 1RIOH 4M6XA 2QYOA 3N97A 3ZMZA 1SFEA 1L0OC 2Q8KA 4Q48A 3KP7A 5HDGA 2M87A 4L0YB 2LDUA 4U88A 5EEHA 4M6YA 1XB4A 2DTRA 2XUBA 2JT1A 3F8FA 5HVQC 1XMAA 1F1ZA 2O0YA 4IRGA 2HGCA 1HW5A 4HX7A 3ZMSA 5DV5A 2FBHA 3IKTA 3J81Z 1KU9A 2XAQA 1U6GA 3VOEA 3JTHA 3ZQ7A 3NEUA 5BPDA 3RPQA 3FMRA 2MD5A 2P7CB 4HQMA 2VT2A 3I54A 5K1YA 3M8FA 1SFXA 3E6CC 2WV0A 2XKOA 3D0SA 2KKOA 2E7XA 3F6VA 2YX4A 2CG4A 2IRFG 2D1VA 1IN7A 3TO9A 3R6SA 4LJZF 5A2QK 4OOIA 2RC4A 5DD8A 1KQ0A 2VN2A 1HW1A 2RN7A 3HIFA 1HKQA 1ZG1A 2ISYA 5CLSA 2EFPA 3QP6A 1TW3A 1H9GA 2DI3A 5LGTA 3W6JB 3WGIA 4IHTA 1RUOA 2PEXA 1B4AA 3NQOA 1ZG3A 2XRNA 4WX9A 3G3ZA 3HSEA 3P7NA 2YX7A 1KQ8A 1TBXA 2K4JA 2GIVA 2J5PA 2P6TA 3MFKA 1U3EM 1P4AA 4N9IA 2H6BA 1SD6A 2FNPA 2A68F 4HYEA 1YS7A 4EVIA 3RKXA 1I5ZA 5L3EA 1RNLA 3IWZA 5L3CA 4L5IA 2QBYB 3ZP5A 3HHHA 1CF7B 5ICFA 1LNWA 2QZ8A 5D5WB 1W7PA 2Y48A 1HKSA 2W57A 4BAYA 1OPCA 4EJTA 2BGCA 3WTXC 3AAFA 3FMSA 3E97A 4U0VA 4IHSA 3I59A 3RIRA 2JRTA 4LG0B 2DBBA 1XGOA 3K1NA 1O3RA 3O3KA 4ON0A 1LVAA 1S8NA 1XD7A 4HF2A 4AIJA 2W84A 2LF8A 2VOPA 5KK1A 1J7KA 1R7JA 2EFNA 2ETHA 4LGWA 3TDUC 2HTJA 1BI0A 2V79A 2DW4A 2HZTA 4HX4A 4XLPF 5J6XA 2OA4A 1D3YA 1JHFA 2HR3A 2H94A 2AXLA 4U0YA 3EYIA 3QRFF 3RPUA 4YIIA 3L9FA 4NQWA 4P5OA 2ZFWA 4ENMA 3V4GA 1RI7A 3MCZA 2UZKA 2VONA 2FBKA 3TQNA 3V7SA 4L9NA 2ESHA 1UHWA 3FXQA 1ONVA 3WTSC 4XBFA 4ESJA 1LDDA 4FT8A 2FA5A 4HOBA 4KIFA 4G7OF 1HXDA 5DCMA 3LSTA 3T8RA 2O61A 5K5RA 3FF5A 4PDKA 3GZ5A 5JR3A 3L2CA 1AWCA 4IXAA 4A0ZA 2PN6A 2O6GE 2J5OA 1ZG5A 5DUIA 1H9TA 2W24A 3L7WA 3HTSB 3JTGA 3IKVA 1BIAA 1MJ9A 5D8KB 4H0EA 1O3SA 4K2EA 1D8JA 3F8MA 5LEKA 1K7AA 3GEZA 1YTYA 4ZYHA 1MJAA 2OZ6A 3KETA 2DLLA 4I01A 1YYVA 2IA2A 4DQ2A 1BOAA 3VB2A 2X0LA 2STWA 5J8CA 1E17A 2XASA 4CICA 1USTA 5E8GA 2Z99A 3FM5A 3GFMA 4UVBA 4UVCA 1TTYA 3RJPA 4KYWA 3Q9SA 3WTTC 5A2QZ 3H3UA 2MH2A 5BOXA 1J59A 1W7PD 4U0WA 5ICCA 3L09A 3K0LA 4RAYA 3GX4X 3M8EA 1B9MA 3HYIA 2QUFA 3REOA 3J81K 3K9TA 1O3QA 1NHAA 5FD6A 5LHGA 3GW2A 4MEYF 2M5WA 2FRHA 2LKPA 1XSVA 2RGVA 5D8LB 1I27A 1OYWA 2EWNA 1ZREA 3CDHA 4EJVA 4MHGA 1KYWA 1IF1A 3CLOA 5HDKA 3D5LA 1JE8A 3F23A 2V6CA 4WWCA 4BYYA 1ZH5A 4YG2F 1K79A 3PQJA 1WSUA 5CJ9A 4QLCU 1U5TA 3F72A 2BE5F 1ZLKA 1G4DA 1LDJA 2QLZA 2PG4A 4HF0A 1UFMA 1W4MA 2K02A 1IZ1A 3DPTA 2F2EA 1R1TA 3SFZA 2P5LC 1T0FA 2GA1A 3ECHA 1TLHB 5KVRA 2V1DA 3FWEA 2D45A 1MZBA 2W85A 4Q5SF 5JFRA 3H92A 1EH6A 1TNTA 3GO5A 3FXUA 5CVRA 1T39A 1H0MA 1W5TA 1FNNA 4L9JA 4BNCA 1ZN2A 4AWXB 2VC0A 1ZRDA 5CYVA 5FO5A 1FYKA 4ZH4F 2AS5F 2PLYA 2RVCA 4AVPA 2OQGA 3QP5A 4EM1A 1R5GA 3P9KA 1FBQA 1G6NA 4EM0B 3TOBA 3LQQA 3F21A 1BM9A 1T2KA 3CO6C 1IXCA 2Q2EA 5E8IA 1VTNC 4CXFA 4WXDA 1D8KA 3GVAA 4RB1A 4UXNA 3GUDA 1QGPA 2A69F 1QQIA 2A5YB 2WTEA 4L5JA 5LGUA 5CVJA 1QZYA 4L9TA 2NNYA 2VBXA 1IRFA 3HTUA 3WTZA 3RKWA 1U2WA 3PQKA 4JK1X 3QPTA 3PFIA 4KUMA 3V7RA 1YW7A 5DDGA 2DO7A 1J2XA 5AIQA 4UNOA 1OKRA 1I6XA 1AOYA 1Z05A 3TDZC 2CGPA 3E6DA 2PFBA 2VC1A 4IJAA 4HA8A 1IXSB 2GA2A 3MWMA 1TQPA 2B0LA 2FOKA 1O7FA 4UUVA 5ICGA 4R79A 3V8KA 2VXZA 1R36A 1U5TB 1FPQA 3K2ZA 4WF2A 1DUXC 1IW7F 3HSFA 1Z6TA 2V9VA 1ZARA 4ESFA 4MTDA 3GYHX 2HKXA 4LMYA 5ILUA 4O3MA 1IUYA 1ULYA 1MD0A 2GXGA 4WK8F 4TV7A 2E1NA 1XGSA 5HDNA 3E6MA 3HRTA 4I0AA 5FLXZ 2QQAA 3TOAA 4ZYDA 3WU1B 4HDVA 4G8XA 3B73A 1HBXG 3BJOA 2PQ8A 5F64A 1SAXA 2QM3A 3ZMDA 5E1ZB 3O2PE 1ZGAA 4IF4A 1CGPA 2LF7A 1FYLA 3GFLA 2A6EF 3KP2A 4I02A 2E7WA 2ZMEA 1QPMA 1FBUA 2FEZA 4OIRF 2RNJA 2W25A 3JSOA 3HSRA 2OBPA 3WGGA 1YQAA 2FXAA 2R7FA 3KP4A 3KZYA 1YG2A 3C18A 2L4MA 4NHJA 4LB6B 4KICA 2DU9A 2WWYA 1FZPB 3GWZA 1U8RA 3MZHA 3BPVA 5CVVA 3KP3A 4GGGA 5H6RA 4HX8A 1U5TC 4YFXF 3JSPA 3R0JA 4RGUA 2PI0A 5F6FA 3KE2A 4PGGA 3WGHA 3LFKA 2EJRA 2IA0A 3E5QA 1L3LA 4FX4A 4MGRA 5CVUA 3DV8A 1BC8C 1P2FA 4YIFA 1FP1D 1FBSA 1F9NA 2EV5A 2XGXA 1V3FA 4HW0A 4D0PA 3GLXA 3Q9VA 2PMUA 5JI6A 2R7DA 3KCCA 2OU2A 3ZN1A 1FP2A 3V7CA 2FU4A 2L54A 1SD4A 3LA3A 2NS0A 4NB5A 3R0AA 5ED4A 3BPXA 2IA1A 1S6LA 4RGXA 2YPRA 4LLGF 5DYMA 4HF1A 3IRQA 3LAPA 5ILSA 1XSDA 3DQVC 1U78A 4CZZA 2G7HA 2G9WA 1SFUA 2IJLA 3GFJA 1XGNA 2XAFA 4R8HA 3I71A 5L3DA 3EUHA 1WI9A 2IVMA 4ESBA 1ZAOA 3BY6A 3TO7A 2MA3A 3MZYA 1JXSA 4O6JA 4MTEA 2L01A 3ZMTA 3M9AA 5ERIA 2YU3A 3RDIA 3HHGA 2R3SA 3MEXA 4UHTA 4CYDA 1V4RA 3JW4A 4GYIA 4EM2A 3HOSA 5TJJA 4IPAA 4ENJA 4PGHA 4HV6A 2PMHA 3F6OA 4Z2YA 3BWGA 2ZMEB 3ULQB 2Z3YA 4XLNF 4OIPF 2FMYA 3CTAA 3BJ6A 2M45A 4ZZDA 1IN5A 2DK5A 3SZTA 5LBQA 3GFIA 3I58A 2F5CA 1HQCA 4ENKA 3ZMUA 2ZBKA 3I0TA 4LLLA 1BBYA 5D5UB 1YO5C 4RAZA 3W6KB 1ON2A 1SD5A 4CO8A 3KEOA 2M8EA 5D5XB 5BMZA 3T0YA 4ZZLA 1KU3A 4IVNA 1R1UA 2CW0F 2JTVA 2ZCWA 2PBIA 3CUQA 3DEUA 2KJBA 2VE8A 4GCVA 3R4KA 1ZRFA 2DPDA 3K1MA 3HRMA 3LA2A 1YFHA 1Z1DA 4OINF 1W7PB 4GXOA 1OR7A 1R00A 2JZYA 2QQ9A 2GQQA 4EGZA 1XGMA 5D4SA 4DNCA 2KIMA 1XN7A 2Y0MA 3LA7A 5FLXK 3T8TA 3IHUA 5LHHA 3I59B 2P7VB 4PZJA 4CHUA 2IW5A 2MC3A 5LRSA 4RB3C 2O03A 4I2OA 4G9YA 2CWEA 4U7DA 2K7LA 5HLGA 1YW9A 1ZLJA 3QAHA 1BJAA 2L4AA 2STTA 2ZKZA 3Q5FA 3BP8A 3KZZA 4UVAA 4M72A 3LWFA 2OD5A 5DUKA 4A0YA 5DD4A 1XCBA 2JSCA 3ABTA 2HWVA 3EQLF 2KIFA 2TDXA 2VBWA 1LB2A 3WE2A 4LK1F 2P8TA 1KGSA 5D4RA 5BPIA 1ZGJA 1REPC 1J75A 4AD9A 2EV0A 4A5MA 1TQMA 3C7JA 4P55A 3QU6A 2ZO4A 2JPCA 4JBAA 2VOOA 1IN8A 2HQRA 1XDUA 2HOEA 2BBYA 3RYRA 4EJOA 5ICEA 1FLIA 2A07F 1BIBA 4HLYA 4G6DA 2KIUA 3F8BA 1K6OA 5DCMB 4BHBA 3HRUA 2P6SA 3DKWA 4I98B 2HTSA 1J9IA 2NRAC 4A6EA 2VE9A 2XAGA 1MGTA 4G6QA 3GF2A 4Q4ZF 1I1GA 2EV6A 4L0ZB 4YFNF 1S29A 1EH7A 2IT0A 4KMUX 3FZVA 2UXNA 3R60A 4ETSA 1BC7C 3JAMZ 3CUQB 1GHCA 3J7AO 1EH8A 2GZWA 5IT3A 2Y75A 2HYGD 4PCQA 1Q1HA 3CUOA 5EEGA 1T6SA 1BI1A 3WTYC 4HAMA 1PUEE 4HBLA 1KU2A 4L9VA 1GXQA 2FF4A 2DPUA 4AIHA 1P4XA 4Y13A 1FSEA 1IN6A 2K27A 5LEJA 1MDMA 3KEQA 1FC3A 4LLNA 1STZA 4ASNA 3BJAA 4HV5A 2ISZA 1WKMA 3N4MA 2GXBA 1FWZA 2DK8A 3QU3A 2A6HF 4ZYGA 1MKMA 2P5VA 4XRFA 4A6DA 3ZPLA 1OYIA 3E5XA 2RV8A 4LB5A 3KLNA 1Z9CA 4Q47A 2HFHA 5LGNA 3M1EA 3R61A 1SMTA 3RTRA 1PDNC 5HS9A 3SXYA 3TGNA 5FD5A 5BQTA 4M9ZA 1QO0D 2VBZA 5HOOA 4G7HF 4BHCA 4I7HA 2BEOA 1WQ2A 1CF7A 1DDNA 5LHIA 5IT9K 1LEBA 1FX7A 1G3YA 4JQFA 4FHTA 4HQEA 4ENNA 3CUQC 3HUGA 2XAJA 4LD5A 4IRHA 1UHMA 3OV8A 1TNSA 3K69A 2XHKA 5FFZA 2ESNA 1LJ9A 2NAZA 4LG0A 5ILVA 1E2XA 5LLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW2 A;  2EK5 A;  2Q0O A;  4WCG A;  4RB0 A;  4M9S A;  2MLK A;  1TQI A;  3IC7 A;  3DXJ F;  1PP7 U;  2UXX A;  3I64 A;  4P9U A;  1FYM A;  2RQP A;  3LAJ A;  5H6Q A;  2BYV E;  1J0R A;  2HKO A;  2CFX A;  4B8X A;  2F5D A;  4BH9 A;  3DFG A;  1IXR C;  1JHH A;  2CQK A;  1P4W A;  1K78 A;  4B09 A;  4O5V A;  1QBJ A;  2ELH A;  1UCR A;  2CSO A;  1S7O A;  3VOD A;  1GVJ A;  4XSZ F;  1SD7 A;  1DPU A;  4A5N A;  1F5T A;  3QPH A;  3MAJ A;  3E5U A;  3OOP A;  3COA C;  4Y15 A;  1S3J A;  3IWF A;  3U2R A;  3RI4 A;  2RDP A;  1MDM B;  2FML A;  4BXU A;  2XKP A;  3M7G A;  1B59 A;  1FOK A;  2FSW A;  4CGZ A;  2YSR A;  2ZNZ A;  4RS8 A;  2A3S A;  1WRJ A;  4KIB A;  5J8F A;  2F5E A;  4EQQ A;  3ROU A;  2GWR A;  3C1D A;  1B6A A;  4EJU A;  3F3X A;  2KRF A;  2DT5 A;  4ZYE A;  1BN5 A;  2OZU A;  2OQR A;  4QWQ A;  4KMF A;  2P4W A;  2XV4 S;  2Z5U A;  1R1V A;  2G7U A;  5FGM A;  1ODD A;  6PAX A;  2O8X A;  4M73 A;  1R23 A;  3KFW X;  5HLI A;  2P5K A;  3ERE D;  2ZJ2 A;  2EA4 A;  3J80 K;  3V8L A;  3VFZ A;  1T38 A;  2FBI A;  4EV0 A;  1O3T A;  4KIG A;  4F7Z A;  2MBF A;  1KA8 A;  3P9I A;  2C6Y A;  4BQA A;  4S04 A;  2EFW A;  3EET A;  3U9G A;  4OMZ A;  3FXR A;  1D5V A;  4IRI A;  4I09 A;  4OIO F;  1KQ9 A;  1YLF A;  3EYY A;  1ZYR F;  2EFQ A;  2Z9O A;  3JAM K;  3FHZ A;  1RUN A;  2COM A;  1ZRC A;  1JGS A;  4OMY A;  1ZHF A;  2DQR A;  2V1U A;  4EMS A;  2H09 A;  3T5X A;  5D6F A;  1BI3 A;  4HZF A;  5L3F A;  5JHU A;  2M1B A;  1ON1 A;  2H6C A;  3BRO A;  1S7A A;  1Z7U A;  3WG9 A;  1K78 B;  2D1H A;  3I5U A;  2FE3 A;  2GAU A;  4KNY A;  1X3U A;  2E1C A;  5IT9 Z;  2RKH A;  4MNU A;  1QZZ A;  5H20 A;  1MJB A;  5AON A;  1IN4 A;  2UWM A;  5L3B A;  2ADU A;  2Z33 A;  3VEP A;  2F5F A;  4RGS A;  4XSX F;  1USS A;  2EB7 A;  4MQV A;  5D5V B;  2IPQ X;  3RYP A;  3FM3 A;  4A0X A;  1Y0U A;  3V8J A;  2LNB A;  1YIO A;  2L02 A;  1XSX A;  4WXC A;  1R22 A;  5F1R A;  2HS5 A;  3E6B A;  5E1X A;  3SZP A;  1IAW A;  4EGY A;  4KFC A;  5DEQ A;  3MQ0 A;  3BOQ A;  1FT9 A;  4KT5 C;  3F8C A;  2LSO A;  5E18 F;  3FX3 A;  2VOD A;  4GO1 A;  2NYX A;  3HRS A;  2CYY A;  1DP7 P;  2OAZ A;  1FY7 A;  2XAH A;  1R5H A;  4M9X A;  4P9F A;  4LK0 F;  5JVT A;  1G3T A;  1KYZ A;  3BZ6 A;  2YR2 A;  2JPB A;  5FFX A;  1XDS A;  3WE3 A;  2FQ3 A;  1O7L A;  5E20 A;  3WU0 A;  3H3Z A;  4P96 A;  3B02 A;  3GZ6 A;  2XRO A;  4M71 A;  3SHF A;  1Z6R A;  2EA2 A;  2K86 A;  3LQR A;  4R1H A;  3HOT A;  2QWW A;  5D6E A;  2X4H A;  5CVI A;  4G7Z F;  1KU7 A;  2DQL A;  1R58 A;  2D2W A;  1IRG A;  3ECO A;  3IRR A;  2K4B A;  1LQ1 A;  3DPL C;  1SMY F;  3TO6 A;  2ACJ A;  2XIG A;  2O3F A;  3WTV C;  2V1X A;  1F4K A;  3ISP A;  4EJW A;  5TRD A;  1FSH A;  4UV9 A;  3KP5 A;  3WOD F;  2QVO A;  4KA4 A;  2A61 A;  4YFK F;  1G3W A;  3O6B B;  2VT3 A;  4MQ9 F;  1Z91 A;  1YW8 A;  1HST A;  4L18 B;  3EDP A;  4N9H A;  3J80 Z;  5K5Q A;  1C0W A;  3F8N A;  3ZMV A;  5BS6 A;  5HS7 A;  3ABU A;  1EV7 A;  4E70 A;  3P9C A;  1XCV A;  4Y17 A;  1P6R A;  4G94 A;  2ZNY A;  4A12 A;  3NRV A;  1HW2 A;  4AIK A;  1HKT A;  5HS8 A;  2H27 A;  4U7B A;  1UB9 A;  3TKY A;  2MLG A;  3WTU C;  3QOP A;  4KN7 X;  3S2W A;  4I0B A;  1B9N A;  2HQN A;  5E17 F;  4FX0 A;  2VBY A;  1W5S A;  3IL2 A;  2HDC A;  3I4P A;  4RGR A;  3BDD A;  4S05 A;  2EFO A;  1QNT A;  5AIP A;  5LRR A;  3RKY A;  1O57 A;  1BI2 A;  5DCF A;  4A2U A;  2L3D A;  1OYY A;  4KDP A;  2MH9 A;  2WC2 A;  3CO7 C;  3T1B A;  2QQB A;  3C3W A;  3SQN A;  5K5O A;  5E1W A;  1PP8 F;  4M74 A;  3L00 A;  4CDG A;  3CJN A;  3DP7 A;  3ELK A;  4LFU A;  1GXP A;  4N0B A;  1XMK A;  2DAO A;  3U1D A;  2XVC A;  4BHP A;  3K1P A;  1P92 A;  3KP6 A;  1T98 A;  2CO5 A;  3I53 A;  1I1S A;  2HYF A;  1YS6 A;  2FNA A;  4RB2 C;  2NNN A;  4KN4 X;  1B1B A;  5L3G A;  1WWX A;  2HEO A;  4WXH A;  3ML6 A;  2IP2 A;  1G3S A;  4MEX F;  2ZXJ A;  4GYG A;  1LEA A;  3GXO A;  1J5Y A;  4HLX A;  4HDU A;  3KLO A;  2QEN A;  4OIQ F;  2PJP A;  3FMQ A;  3ZN0 A;  3G73 A;  4UV8 A;  2M30 A;  2QBY A;  3E3V A;  2DFI A;  3WTW C;  5HLH A;  1HSJ A;  1RZ4 A;  1A04 A;  2KJC A;  3F22 A;  4OU0 A;  3DF8 A;  1DPR A;  2BV6 A;  1LDK B;  1OMI A;  5FB2 A;  1RIO H;  4M6X A;  2QYO A;  3N97 A;  3ZMZ A;  1SFE A;  1L0O C;  2Q8K A;  4Q48 A;  3KP7 A;  5HDG A;  2M87 A;  4L0Y B;  2LDU A;  4U88 A;  5EEH A;  4M6Y A;  1XB4 A;  2DTR A;  2XUB A;  2JT1 A;  3F8F A;  5HVQ C;  1XMA A;  1F1Z A;  2O0Y A;  4IRG A;  2HGC A;  1HW5 A;  4HX7 A;  3ZMS A;  5DV5 A;  2FBH A;  3IKT A;  3J81 Z;  1KU9 A;  2XAQ A;  1U6G A;  3VOE A;  3JTH A;  3ZQ7 A;  3NEU A;  5BPD A;  3RPQ A;  3FMR A;  2MD5 A;  2P7C B;  4HQM A;  2VT2 A;  3I54 A;  5K1Y A;  3M8F A;  1SFX A;  3E6C C;  2WV0 A;  2XKO A;  3D0S A;  2KKO A;  2E7X A;  3F6V A;  2YX4 A;  2CG4 A;  2IRF G;  2D1V A;  1IN7 A;  3TO9 A;  3R6S A;  4LJZ F;  5A2Q K;  4OOI A;  2RC4 A;  5DD8 A;  1KQ0 A;  2VN2 A;  1HW1 A;  2RN7 A;  3HIF A;  1HKQ A;  1ZG1 A;  2ISY A;  5CLS A;  2EFP A;  3QP6 A;  1TW3 A;  1H9G A;  2DI3 A;  5LGT A;  3W6J B;  3WGI A;  4IHT A;  1RUO A;  2PEX A;  1B4A A;  3NQO A;  1ZG3 A;  2XRN A;  4WX9 A;  3G3Z A;  3HSE A;  3P7N A;  2YX7 A;  1KQ8 A;  1TBX A;  2K4J A;  2GIV A;  2J5P A;  2P6T A;  3MFK A;  1U3E M;  1P4A A;  4N9I A;  2H6B A;  1SD6 A;  2FNP A;  2A68 F;  4HYE A;  1YS7 A;  4EVI A;  3RKX A;  1I5Z A;  5L3E A;  1RNL A;  3IWZ A;  5L3C A;  4L5I A;  2QBY B;  3ZP5 A;  3HHH A;  1CF7 B;  5ICF A;  1LNW A;  2QZ8 A;  5D5W B;  1W7P A;  2Y48 A;  1HKS A;  2W57 A;  4BAY A;  1OPC A;  4EJT A;  2BGC A;  3WTX C;  3AAF A;  3FMS A;  3E97 A;  4U0V A;  4IHS A;  3I59 A;  3RIR A;  2JRT A;  4LG0 B;  2DBB A;  1XGO A;  3K1N A;  1O3R A;  3O3K A;  4ON0 A;  1LVA A;  1S8N A;  1XD7 A;  4HF2 A;  4AIJ A;  2W84 A;  2LF8 A;  2VOP A;  5KK1 A;  1J7K A;  1R7J A;  2EFN A;  2ETH A;  4LGW A;  3TDU C;  2HTJ A;  1BI0 A;  2V79 A;  2DW4 A;  2HZT A;  4HX4 A;  4XLP F;  5J6X A;  2OA4 A;  1D3Y A;  1JHF A;  2HR3 A;  2H94 A;  2AXL A;  4U0Y A;  3EYI A;  3QRF F;  3RPU A;  4YII A;  3L9F A;  4NQW A;  4P5O A;  2ZFW A;  4ENM A;  3V4G A;  1RI7 A;  3MCZ A;  2UZK A;  2VON A;  2FBK A;  3TQN A;  3V7S A;  4L9N A;  2ESH A;  1UHW A;  3FXQ A;  1ONV A;  3WTS C;  4XBF A;  4ESJ A;  1LDD A;  4FT8 A;  2FA5 A;  4HOB A;  4KIF A;  4G7O F;  1HXD A;  5DCM A;  3LST A;  3T8R A;  2O61 A;  5K5R A;  3FF5 A;  4PDK A;  3GZ5 A;  5JR3 A;  3L2C A;  1AWC A;  4IXA A;  4A0Z A;  2PN6 A;  2O6G E;  2J5O A;  1ZG5 A;  5DUI A;  1H9T A;  2W24 A;  3L7W A;  3HTS B;  3JTG A;  3IKV A;  1BIA A;  1MJ9 A;  5D8K B;  4H0E A;  1O3S A;  4K2E A;  1D8J A;  3F8M A;  5LEK A;  1K7A A;  3GEZ A;  1YTY A;  4ZYH A;  1MJA A;  2OZ6 A;  3KET A;  2DLL A;  4I01 A;  1YYV A;  2IA2 A;  4DQ2 A;  1BOA A;  3VB2 A;  2X0L A;  2STW A;  5J8C A;  1E17 A;  2XAS A;  4CIC A;  1UST A;  5E8G A;  2Z99 A;  3FM5 A;  3GFM A;  4UVB A;  4UVC A;  1TTY A;  3RJP A;  4KYW A;  3Q9S A;  3WTT C;  5A2Q Z;  3H3U A;  2MH2 A;  5BOX A;  1J59 A;  1W7P D;  4U0W A;  5ICC A;  3L09 A;  3K0L A;  4RAY A;  3GX4 X;  3M8E A;  1B9M A;  3HYI A;  2QUF A;  3REO A;  3J81 K;  3K9T A;  1O3Q A;  1NHA A;  5FD6 A;  5LHG A;  3GW2 A;  4MEY F;  2M5W A;  2FRH A;  2LKP A;  1XSV A;  2RGV A;  5D8L B;  1I27 A;  1OYW A;  2EWN A;  1ZRE A;  3CDH A;  4EJV A;  4MHG A;  1KYW A;  1IF1 A;  3CLO A;  5HDK A;  3D5L A;  1JE8 A;  3F23 A;  2V6C A;  4WWC A;  4BYY A;  1ZH5 A;  4YG2 F;  1K79 A;  3PQJ A;  1WSU A;  5CJ9 A;  4QLC U;  1U5T A;  3F72 A;  2BE5 F;  1ZLK A;  1G4D A;  1LDJ A;  2QLZ A;  2PG4 A;  4HF0 A;  1UFM A;  1W4M A;  2K02 A;  1IZ1 A;  3DPT A;  2F2E A;  1R1T A;  3SFZ A;  2P5L C;  1T0F A;  2GA1 A;  3ECH A;  1TLH B;  5KVR A;  2V1D A;  3FWE A;  2D45 A;  1MZB A;  2W85 A;  4Q5S F;  5JFR A;  3H92 A;  1EH6 A;  1TNT A;  3GO5 A;  3FXU A;  5CVR A;  1T39 A;  1H0M A;  1W5T A;  1FNN A;  4L9J A;  4BNC A;  1ZN2 A;  4AWX B;  2VC0 A;  1ZRD A;  5CYV A;  5FO5 A;  1FYK A;  4ZH4 F;  2AS5 F;  2PLY A;  2RVC A;  4AVP A;  2OQG A;  3QP5 A;  4EM1 A;  1R5G A;  3P9K A;  1FBQ A;  1G6N A;  4EM0 B;  3TOB A;  3LQQ A;  3F21 A;  1BM9 A;  1T2K A;  3CO6 C;  1IXC A;  2Q2E A;  5E8I A;  1VTN C;  4CXF A;  4WXD A;  1D8K A;  3GVA A;  4RB1 A;  4UXN A;  3GUD A;  1QGP A;  2A69 F;  1QQI A;  2A5Y B;  2WTE A;  4L5J A;  5LGU A;  5CVJ A;  1QZY A;  4L9T A;  2NNY A;  2VBX A;  1IRF A;  3HTU A;  3WTZ A;  3RKW A;  1U2W A;  3PQK A;  4JK1 X;  3QPT A;  3PFI A;  4KUM A;  3V7R A;  1YW7 A;  5DDG A;  2DO7 A;  1J2X A;  5AIQ A;  4UNO A;  1OKR A;  1I6X A;  1AOY A;  1Z05 A;  3TDZ C;  2CGP A;  3E6D A;  2PFB A;  2VC1 A;  4IJA A;  4HA8 A;  1IXS B;  2GA2 A;  3MWM A;  1TQP A;  2B0L A;  2FOK A;  1O7F A;  4UUV A;  5ICG A;  4R79 A;  3V8K A;  2VXZ A;  1R36 A;  1U5T B;  1FPQ A;  3K2Z A;  4WF2 A;  1DUX C;  1IW7 F;  3HSF A;  1Z6T A;  2V9V A;  1ZAR A;  4ESF A;  4MTD A;  3GYH X;  2HKX A;  4LMY A;  5ILU A;  4O3M A;  1IUY A;  1ULY A;  1MD0 A;  2GXG A;  4WK8 F;  4TV7 A;  2E1N A;  1XGS A;  5HDN A;  3E6M A;  3HRT A;  4I0A A;  5FLX Z;  2QQA A;  3TOA A;  4ZYD A;  3WU1 B;  4HDV A;  4G8X A;  3B73 A;  1HBX G;  3BJO A;  2PQ8 A;  5F64 A;  1SAX A;  2QM3 A;  3ZMD A;  5E1Z B;  3O2P E;  1ZGA A;  4IF4 A;  1CGP A;  2LF7 A;  1FYL A;  3GFL A;  2A6E F;  3KP2 A;  4I02 A;  2E7W A;  2ZME A;  1QPM A;  1FBU A;  2FEZ A;  4OIR F;  2RNJ A;  2W25 A;  3JSO A;  3HSR A;  2OBP A;  3WGG A;  1YQA A;  2FXA A;  2R7F A;  3KP4 A;  3KZY A;  1YG2 A;  3C18 A;  2L4M A;  4NHJ A;  4LB6 B;  4KIC A;  2DU9 A;  2WWY A;  1FZP B;  3GWZ A;  1U8R A;  3MZH A;  3BPV A;  5CVV A;  3KP3 A;  4GGG A;  5H6R A;  4HX8 A;  1U5T C;  4YFX F;  3JSP A;  3R0J A;  4RGU A;  2PI0 A;  5F6F A;  3KE2 A;  4PGG A;  3WGH A;  3LFK A;  2EJR A;  2IA0 A;  3E5Q A;  1L3L A;  4FX4 A;  4MGR A;  5CVU A;  3DV8 A;  1BC8 C;  1P2F A;  4YIF A;  1FP1 D;  1FBS A;  1F9N A;  2EV5 A;  2XGX A;  1V3F A;  4HW0 A;  4D0P A;  3GLX A;  3Q9V A;  2PMU A;  5JI6 A;  2R7D A;  3KCC A;  2OU2 A;  3ZN1 A;  1FP2 A;  3V7C A;  2FU4 A;  2L54 A;  1SD4 A;  3LA3 A;  2NS0 A;  4NB5 A;  3R0A A;  5ED4 A;  3BPX A;  2IA1 A;  1S6L A;  4RGX A;  2YPR A;  4LLG F;  5DYM A;  4HF1 A;  3IRQ A;  3LAP A;  5ILS A;  1XSD A;  3DQV C;  1U78 A;  4CZZ A;  2G7H A;  2G9W A;  1SFU A;  2IJL A;  3GFJ A;  1XGN A;  2XAF A;  4R8H A;  3I71 A;  5L3D A;  3EUH A;  1WI9 A;  2IVM A;  4ESB A;  1ZAO A;  3BY6 A;  3TO7 A;  2MA3 A;  3MZY A;  1JXS A;  4O6J A;  4MTE A;  2L01 A;  3ZMT A;  3M9A A;  5ERI A;  2YU3 A;  3RDI A;  3HHG A;  2R3S A;  3MEX A;  4UHT A;  4CYD A;  1V4R A;  3JW4 A;  4GYI A;  4EM2 A;  3HOS A;  5TJJ A;  4IPA A;  4ENJ A;  4PGH A;  4HV6 A;  2PMH A;  3F6O A;  4Z2Y A;  3BWG A;  2ZME B;  3ULQ B;  2Z3Y A;  4XLN F;  4OIP F;  2FMY A;  3CTA A;  3BJ6 A;  2M45 A;  4ZZD A;  1IN5 A;  2DK5 A;  3SZT A;  5LBQ A;  3GFI A;  3I58 A;  2F5C A;  1HQC A;  4ENK A;  3ZMU A;  2ZBK A;  3I0T A;  4LLL A;  1BBY A;  5D5U B;  1YO5 C;  4RAZ A;  3W6K B;  1ON2 A;  1SD5 A;  4CO8 A;  3KEO A;  2M8E A;  5D5X B;  5BMZ A;  3T0Y A;  4ZZL A;  1KU3 A;  4IVN A;  1R1U A;  2CW0 F;  2JTV A;  2ZCW A;  2PBI A;  3CUQ A;  3DEU A;  2KJB A;  2VE8 A;  4GCV A;  3R4K A;  1ZRF A;  2DPD A;  3K1M A;  3HRM A;  3LA2 A;  1YFH A;  1Z1D A;  4OIN F;  1W7P B;  4GXO A;  1OR7 A;  1R00 A;  2JZY A;  2QQ9 A;  2GQQ A;  4EGZ A;  1XGM A;  5D4S A;  4DNC A;  2KIM A;  1XN7 A;  2Y0M A;  3LA7 A;  5FLX K;  3T8T A;  3IHU A;  5LHH A;  3I59 B;  2P7V B;  4PZJ A;  4CHU A;  2IW5 A;  2MC3 A;  5LRS A;  4RB3 C;  2O03 A;  4I2O A;  4G9Y A;  2CWE A;  4U7D A;  2K7L A;  5HLG A;  1YW9 A;  1ZLJ A;  3QAH A;  1BJA A;  2L4A A;  2STT A;  2ZKZ A;  3Q5F A;  3BP8 A;  3KZZ A;  4UVA A;  4M72 A;  3LWF A;  2OD5 A;  5DUK A;  4A0Y A;  5DD4 A;  1XCB A;  2JSC A;  3ABT A;  2HWV A;  3EQL F;  2KIF A;  2TDX A;  2VBW A;  1LB2 A;  3WE2 A;  4LK1 F;  2P8T A;  1KGS A;  5D4R A;  5BPI A;  1ZGJ A;  1REP C;  1J75 A;  4AD9 A;  2EV0 A;  4A5M A;  1TQM A;  3C7J A;  4P55 A;  3QU6 A;  2ZO4 A;  2JPC A;  4JBA A;  2VOO A;  1IN8 A;  2HQR A;  1XDU A;  2HOE A;  2BBY A;  3RYR A;  4EJO A;  5ICE A;  1FLI A;  2A07 F;  1BIB A;  4HLY A;  4G6D A;  2KIU A;  3F8B A;  1K6O A;  5DCM B;  4BHB A;  3HRU A;  2P6S A;  3DKW A;  4I98 B;  2HTS A;  1J9I A;  2NRA C;  4A6E A;  2VE9 A;  2XAG A;  1MGT A;  4G6Q A;  3GF2 A;  4Q4Z F;  1I1G A;  2EV6 A;  4L0Z B;  4YFN F;  1S29 A;  1EH7 A;  2IT0 A;  4KMU X;  3FZV A;  2UXN A;  3R60 A;  4ETS A;  1BC7 C;  3JAM Z;  3CUQ B;  1GHC A;  3J7A O;  1EH8 A;  2GZW A;  5IT3 A;  2Y75 A;  2HYG D;  4PCQ A;  1Q1H A;  3CUO A;  5EEG A;  1T6S A;  1BI1 A;  3WTY C;  4HAM A;  1PUE E;  4HBL A;  1KU2 A;  4L9V A;  1GXQ A;  2FF4 A;  2DPU A;  4AIH A;  1P4X A;  4Y13 A;  1FSE A;  1IN6 A;  2K27 A;  5LEJ A;  1MDM A;  3KEQ A;  1FC3 A;  4LLN A;  1STZ A;  4ASN A;  3BJA A;  4HV5 A;  2ISZ A;  1WKM A;  3N4M A;  2GXB A;  1FWZ A;  2DK8 A;  3QU3 A;  2A6H F;  4ZYG A;  1MKM A;  2P5V A;  4XRF A;  4A6D A;  3ZPL A;  1OYI A;  3E5X A;  2RV8 A;  4LB5 A;  3KLN A;  1Z9C A;  4Q47 A;  2HFH A;  5LGN A;  3M1E A;  3R61 A;  1SMT A;  3RTR A;  1PDN C;  5HS9 A;  3SXY A;  3TGN A;  5FD5 A;  5BQT A;  4M9Z A;  1QO0 D;  2VBZ A;  5HOO A;  4G7H F;  4BHC A;  4I7H A;  2BEO A;  1WQ2 A;  1CF7 A;  1DDN A;  5LHI A;  5IT9 K;  1LEB A;  1FX7 A;  1G3Y A;  4JQF A;  4FHT A;  4HQE A;  4ENN A;  3CUQ C;  3HUG A;  2XAJ A;  4LD5 A;  4IRH A;  1UHM A;  3OV8 A;  1TNS A;  3K69 A;  2XHK A;  5FFZ A;  2ESN A;  1LJ9 A;  2NAZ A;  4LG0 A;  5ILV A;  1E2X A;  5LLQ A; 
#chains in the Genus database with same CATH topology
 1TW2 A;  1XPX A;  2EK5 A;  3ASN H;  2R5Y B;  2Q0O A;  3LSH A;  4WCG A;  4HNT A;  4RB0 A;  2Z16 A;  1JJ8 C;  1FIA A;  2V4J C;  3JRE A;  3FXJ A;  4M9S A;  2MLK A;  3IV5 A;  1TQI A;  2DMU A;  3IC7 A;  3C2B A;  4HRI A;  4Y7N J;  3AG3 H;  3DXJ F;  4E7S A;  1FOY A;  5C4J J;  1PP7 U;  2UXX A;  1UEL B;  3I64 A;  3MN2 A;  3HOY J;  4P9U A;  2WA0 A;  3CMY A;  1MIJ A;  2BY2 A;  3JCU C;  1FYM A;  1DU6 A;  1D1A A;  2IAI A;  2ICW G;  4XLE A;  3TMO A;  2RQP A;  3H0D A;  1BJZ A;  3LAJ A;  3VYT B;  3K4L A;  1LVK A;  5H6Q A;  4IOC F;  2BYV E;  4IEJ A;  4KJZ A;  1J0R A;  2HKO A;  3CCU I;  2CFX A;  4E7I A;  4B8X A;  2F5D A;  4BH9 A;  1I6H J;  3DFG A;  3BLY A;  2ELJ A;  3K10 A;  5J3L A;  1JTY A;  5FKN A;  1IXR C;  1JHH A;  4A93 J;  2CQK A;  1P4W A;  2Q2E B;  2UUZ A;  1JKR C;  1K78 A;  4B09 A;  4O5V A;  1QBJ A;  1TT5 B;  2ELH A;  4F91 B;  1UCR A;  2CSO A;  1S7O A;  3VOD A;  1JT0 A;  1A31 A;  2JA7 J;  1GVJ A;  2W48 A;  1AKH A;  4HNU A;  4XSZ F;  2KP6 A;  1OCO H;  1SD7 A;  5F27 A;  1DPU A;  2LKX A;  3JRB A;  5GP9 A;  4A5N A;  1F5T A;  2PJR A;  3QPH A;  5B1B H;  3MAJ A;  3E5U A;  1WGX A;  3Q3S A;  3OOP A;  3COA C;  3PNV A;  4FE7 A;  2WY7 Q;  4Y15 A;  1S3J A;  1DP3 A;  2V9K A;  2OTL I;  3IWF A;  3U2R A;  2GOX B;  3RI4 A;  4GFB A;  2RDP A;  2KT0 A;  2JK3 A;  1MDM B;  1QA6 A;  3ZCO A;  4U87 A;  5E3O A;  2FML A;  4BXU A;  2XKP A;  2Z2S B;  3M7G A;  4NC7 A;  1B59 A;  1S9H A;  1W1W E;  4B3A A;  1FOK A;  2Y30 A;  2FSW A;  4CGZ A;  2YSR A;  2ZNZ A;  2VUM J;  5GAH J;  4RS8 A;  2A3S A;  1WRJ A;  1HOM A;  4KIB A;  4IHY A;  5J8F A;  2F5E A;  1HDP A;  3SDB A;  4EQQ A;  1NH3 A;  3CF5 F;  3ROU A;  1MH3 A;  2VKD A;  3H1C A;  3CCL I;  3S3N A;  2XB0 X;  2GWR A;  3MKW B;  3C1D A;  1B6A A;  3S16 J;  4EJU A;  3F3X A;  1R71 A;  2KRF A;  2DT5 A;  3AG2 H;  4ZYE A;  1BN5 A;  2AXT C;  1NK2 P;  2DN0 A;  2OZU A;  2OQR A;  4QWQ A;  5EGO B;  4KMF A;  5M5Y J;  2P4W A;  2VXD A;  2XV4 S;  3DBR B;  1P9Q C;  1WH5 A;  3BR2 A;  2HNH A;  2Z5U A;  1R1V A;  2G7U A;  4LG3 A;  3ZQC A;  4AVZ A;  5FGM A;  4B3X A;  1ODD A;  6PAX A;  5C4X J;  4B48 A;  3MVP A;  5FKL A;  1P7I A;  2O8X A;  5K7Z A;  1A5J A;  4M73 A;  1R23 A;  2HZD A;  3KFW X;  1X2M A;  4BY7 J;  4RBO A;  5HLI A;  4F55 A;  1B8I A;  2P5K A;  3ERE D;  2ZJ2 A;  2EA4 A;  1VQ6 I;  4ABZ A;  3J80 K;  2KRC A;  4A3K J;  2R7T A;  2L7K A;  3V8L A;  3VFZ A;  1T38 A;  2FBI A;  3MKL A;  3DTE A;  4EV0 A;  5GPA A;  1WZ2 A;  1O3T A;  4KIG A;  4F7Z A;  3LSJ A;  3PSF A;  2EIL H;  2MBF A;  2QF7 A;  5LFA A;  2ZJP F;  1KA8 A;  3P9I A;  2C6Y A;  4BQA A;  2DMT A;  1LFB A;  4S04 A;  5FLV A;  4A3G J;  4BXF A;  2NOG A;  5K7H A;  2EFW A;  3EET A;  3U9G A;  2XSD C;  1VFC A;  3LL7 A;  3RQI A;  2VKH A;  4OMZ A;  1ZR4 A;  1IUF A;  3FXR A;  1D5V A;  4IRI A;  4I09 A;  3ERM A;  2X1C A;  2LK2 A;  4OIO F;  4CSW A;  1KQ9 A;  1YLF A;  4QTR A;  1ZGW A;  1NG6 A;  3EYY A;  2GXA A;  1ZYR F;  2EFQ A;  1PVE A;  2EZH A;  2Z9O A;  3JAM K;  2OPT A;  1R6R A;  3FHZ A;  1TP4 A;  3HGG A;  2Z1D A;  2MSY A;  1J09 A;  2COM A;  3HKZ A;  1RUN A;  4E7Z A;  3C2G A;  3FK7 A;  5DS9 A;  3I56 I;  1ZRC A;  3U1K A;  1JGS A;  4OMY A;  4E7H A;  1ZHF A;  2DQR A;  5IP7 J;  2V1U A;  4EMS A;  3CDI A;  1R9T J;  1BL0 A;  1MBJ A;  2H09 A;  3BZK A;  2CV2 A;  2CFO A;  4Z6Y A;  3T5X A;  3VDX A;  1R4N B;  5D6F A;  1BI3 A;  1P7J A;  3H9Q A;  4HZF A;  5JHU A;  5L3F A;  1FTT A;  1TWH J;  3G1L A;  4C3H J;  4RAG A;  5CQG A;  2X6O A;  2M1B A;  4IKF A;  1ON1 A;  2K3P A;  2JWT A;  3B6C A;  2R5Z B;  3L2U A;  3HB9 A;  2H6C A;  3BRO A;  4XKC A;  3A0H C;  1W36 D;  2G0E A;  1D5Y A;  1S7A A;  2X51 A;  2LY9 A;  1Z7U A;  1JUP A;  3WG9 A;  1K78 B;  4BQN A;  3QQA A;  2DT7 B;  2D1H A;  2XGD A;  2I5U A;  3I5U A;  2FE3 A;  2GAU A;  4KNY A;  1X3U A;  2DJI A;  5E3L A;  3S1R J;  1X1A A;  2E1C A;  5IT9 Z;  2RKH A;  4MNU A;  1QZZ A;  2HYJ A;  2HQ5 A;  3EUA A;  5H20 A;  1RES A;  1MJB A;  2K9N A;  2L2O A;  2XSJ C;  1GDT A;  5AON A;  3BG9 A;  1IN4 A;  3P5J A;  2IGN A;  2UWM A;  5L3B A;  3ZQG A;  2ADU A;  2Z33 A;  2EZI A;  4BJ6 C;  4S0H B;  3VEP A;  2F5F A;  5J1Y A;  4RGS A;  4XSX F;  1USS A;  1IV8 A;  2X48 A;  3OSF A;  2EB7 A;  3OS1 A;  4MQV A;  5D5V B;  3LSG A;  2IPQ X;  4D5F A;  3RYP A;  1WJD A;  3FM3 A;  4JYK A;  3SFI A;  1Y0U A;  4A0X A;  3V8J A;  2LNB A;  1YIO A;  5C3E J;  2L02 A;  4M3D A;  5E3M A;  1N77 A;  1JKO C;  1XMX A;  1XSX A;  2F4M B;  4WXC A;  1R22 A;  5F1R A;  5F1J A;  2HS5 A;  3QYE A;  3E6B A;  2WAE A;  1VQL I;  2E2I J;  5E1X A;  5DM6 F;  3SZP A;  1IAW A;  2OF7 A;  4EGY A;  4KFC A;  5DEQ A;  3MQ0 A;  3OL4 A;  3BOQ A;  3OYG A;  1FT9 A;  4KT5 C;  4M3B A;  3F8C A;  3UR3 C;  2LSO A;  5E18 F;  3F0C A;  3FX3 A;  2ZJR F;  1X3Z B;  2VOD A;  3K4B A;  4GO1 A;  3S14 J;  2NYX A;  3HRS A;  2CYY A;  4XRS G;  1DP7 P;  2QCO A;  1PUF A;  2BY3 A;  3AG4 H;  2OAZ A;  3H5R A;  1FY7 A;  4BQQ A;  5GAG J;  1YJN I;  2XAH A;  2M7A A;  5M3F J;  1YJW I;  1R5H A;  4M9X A;  4P9F A;  4LK0 F;  3GTQ J;  3OL3 A;  1B8I B;  1W36 C;  5JVT A;  2EZL A;  4BBS J;  4F92 B;  2IS6 A;  1G3T A;  1KYZ A;  2BY1 A;  3G6E I;  2OTJ I;  3BZ6 A;  1UHS A;  2YR2 A;  2JPB A;  5FFX A;  1XDS A;  3K4K A;  3WE3 A;  5BNG A;  2FQ3 A;  1O7L A;  3LOC A;  5E20 A;  3WU0 A;  3FIW A;  1XG1 A;  3H3Z A;  3OWT A;  2IGK A;  4ZDP A;  1S5L C;  2VJI A;  4P96 A;  4W1U A;  3B02 A;  3GZ6 A;  2XRO A;  4M71 A;  3SHF A;  2ZXI A;  1Z6R A;  1DQU A;  2EA2 A;  2K86 A;  4JX6 A;  2BHZ A;  3LQR A;  4R1H A;  3HOT A;  2QWW A;  5D6E A;  2X4H A;  4C2T A;  5CVI A;  4G7Z F;  1KU7 A;  3GLL A;  3RKQ A;  1LFP A;  3K2A A;  4PJN A;  2DQL A;  2VI6 A;  1VQ5 I;  2KMU A;  3ZR8 X;  3OYI A;  1MBE A;  1R58 A;  3BQZ A;  2VB6 A;  2D2W A;  1D0Y A;  2CV1 A;  1IRG A;  4UB8 C;  3ECO A;  2DA6 A;  3I4M J;  2K9M A;  2K4B A;  3IRR A;  1U0J A;  4PFO A;  1LQ1 A;  3DPL C;  1SMY F;  3PJR A;  3TO6 A;  2ACJ A;  3S3O A;  2XIG A;  1A6Q A;  2O3F A;  3WTV C;  4BDY A;  2E5N A;  1OLT A;  2V1X A;  1F4K A;  3KZI C;  3C2H A;  3TL4 X;  3ISP A;  5KAI C;  3BTI A;  2ZSH B;  4EJW A;  1TWG J;  5TRD A;  1FSH A;  3K4J A;  4UV9 A;  1K4S A;  3KP5 A;  3WOD F;  2QVO A;  4DZJ A;  4KA4 A;  2A61 A;  4YFK F;  2JJ7 A;  1OQY A;  1G3W A;  3O6B B;  2VT3 A;  3BG5 A;  2AO9 A;  5GAE J;  4MQ9 F;  1Z91 A;  1YW8 A;  3TP0 A;  3TW7 A;  1HST A;  4L18 B;  3EDP A;  4N9H A;  4E7J A;  3J80 Z;  1QZE A;  5K5Q A;  3DU6 A;  1C0W A;  3F8N A;  3ZMV A;  5BS6 A;  5K7F A;  4HSR A;  5HS7 A;  3A02 A;  3ABU A;  4B44 A;  1EV7 A;  4E70 A;  3AKZ A;  3P9C A;  1XCV A;  2WV1 A;  4Y17 A;  1SAN A;  3Q0V A;  2AHQ A;  3F9K A;  1P6R A;  2JMW A;  1W5C C;  1MSF C;  2LFB A;  3W2W A;  1QHH D;  4ZDO A;  1POG A;  4D9J A;  3JRD A;  2R0Q C;  4N9I A;  4G94 A;  2ZNY A;  3I3L A;  3ABK H;  2E2J J;  4A12 A;  3NRV A;  5EDN A;  1HW2 A;  4LIT A;  4CH7 A;  4AIK A;  5HS8 A;  3M8J A;  1HKT A;  3CCJ I;  1S7E A;  1SVO A;  2H27 A;  4U7B A;  1UB9 A;  3IP4 B;  3TKY A;  1VQM I;  2MLG A;  3WTU C;  3OR1 C;  3QOP A;  4KN7 X;  3S2W A;  2XC7 A;  4I0B A;  1B9N A;  5EG0 A;  2HQN A;  5E17 F;  4FX0 A;  4D5C A;  2VBY A;  1W5S A;  3IL2 A;  4BJ5 C;  2HDC A;  4YIR X;  5FRN A;  3I4P A;  4RGR A;  1MSE C;  3LSR A;  3BDD A;  3CDL A;  4PK4 A;  2EFO A;  1QNT A;  5AIP A;  5LRR A;  4S05 A;  3RKY A;  2IS1 A;  1O57 A;  2KQR A;  4UY8 I;  1BI2 A;  5DCF A;  4A2U A;  4IL6 C;  3LSM A;  2X1D A;  2PMZ N;  1EJ9 A;  2KIS A;  2CUF A;  2KHM A;  2L3D A;  1OYY A;  2X6Y A;  3CJQ B;  3SEZ A;  3SJM A;  1EA3 A;  4KDP A;  4X6A J;  3FDY A;  2KLO A;  1BOB A;  2MH9 A;  2WC2 A;  3CO7 C;  3T1B A;  2QQB A;  2FQ4 A;  4XOR A;  2Y9Y A;  4A3I J;  3HDD A;  3IUO A;  3C3W A;  3SQN A;  1V5E A;  5E1W A;  5K5O A;  1PP8 F;  2PMZ A;  4M74 A;  1E3O C;  4AUX A;  3L00 A;  4CDG A;  3CJN A;  3DP7 A;  2LOO A;  2JUC A;  3B6A A;  3ELK A;  4LFU A;  4XLC A;  2M0M A;  1XMK A;  4N0B A;  1Q1V A;  1Z67 A;  2DAO A;  1VQ8 I;  3EUK L;  3U1D A;  2XVC A;  4BHP A;  3K1P A;  2VQH A;  1P92 A;  3CLQ A;  3KP6 A;  3CZ6 A;  1T98 A;  4NDL A;  2LYC A;  3J7A Y;  3PNY A;  4H4K C;  2CO5 A;  1FIP A;  3I53 A;  4B1R A;  1I1S A;  2HYF A;  2NVX J;  5DTD A;  1YS6 A;  3A01 A;  4L5E A;  1G2H A;  5IOY A;  1TWA J;  2FNA A;  2RQQ A;  4RB2 C;  2NNN A;  3GTK J;  4KN4 X;  3S15 J;  1B1B A;  5L3G A;  2KIQ A;  2CU7 A;  1WWX A;  2HEO A;  3UNG C;  2YS9 A;  4WXH A;  3ML6 A;  2IP2 A;  1G3S A;  2LC2 A;  4AYB A;  4MEX F;  2Y31 A;  2ZXJ A;  4M6V A;  1VQO I;  2DA3 A;  1RR8 C;  1OFC X;  4GYG A;  1LEA A;  2JA2 A;  4C2M J;  4IZZ A;  3GXO A;  1J5Y A;  4HLX A;  4HDU A;  3KLO A;  2QEN A;  4OIQ F;  2XPW A;  2PJP A;  3BTJ A;  2HOT A;  3FMQ A;  3ZN0 A;  3VWB A;  5DM7 F;  3DKX A;  3G2B A;  2NXN B;  3G73 A;  3K4N A;  2QA4 I;  4UV8 A;  2M30 A;  4BBR J;  3QWL A;  2QBY A;  3S1M J;  3E3V A;  2DFI A;  3WTW C;  4FE4 A;  5HLH A;  4Y3O A;  2VQC A;  2CS3 A;  1HSJ A;  2X1E A;  2IEK A;  2EIJ H;  3GME A;  1RZ4 A;  5EEA A;  2L9S A;  1A04 A;  2KJC A;  1T08 B;  3F22 A;  4XM3 A;  4OU0 A;  3DF8 A;  1IDY A;  2CW7 A;  1DPR A;  2BV6 A;  1VND A;  2R7X A;  5J47 A;  1LDK B;  5C44 J;  1OMI A;  5FB2 A;  1T8I A;  2V9P A;  1RIO H;  2Q1Z B;  2HPI A;  5J4V A;  4M6X A;  2QYO A;  1IC8 A;  3N97 A;  3ZMZ A;  1SFE A;  1H88 C;  1L0O C;  2YUS A;  2Q8K A;  4Q48 A;  3EPZ A;  1XX5 A;  3KP7 A;  5HDG A;  2O5R A;  2M87 A;  1ZEL A;  2NVU B;  4L0Y B;  2LDU A;  4U88 A;  2LH9 A;  2OJE D;  5EEH A;  4E7K A;  3BC8 A;  1OR7 C;  4M6Y A;  1XB4 A;  2DTR A;  4BE1 A;  4E4H A;  2XUB A;  2QSG X;  1ERD A;  2BVM A;  3OYH A;  4PJ0 C;  2ID6 A;  1IO2 A;  3OYE A;  4II3 A;  1GT0 C;  2JT1 A;  2XB5 A;  3F8F A;  5HVQ C;  4UUS A;  1XMA A;  4P1W A;  5FRM A;  1F1Z A;  2O0Y A;  4IRG A;  2R7R A;  2HGC A;  1HW5 A;  4HX7 A;  3SEQ A;  5HOD A;  3ZMS A;  2DA1 A;  5DV5 A;  3D5S C;  2HOA A;  1APL C;  2FBH A;  2FX0 A;  3IKT A;  3J81 Z;  1KU9 A;  2XAQ A;  1U6G A;  3VOE A;  3JTH A;  3GTM J;  4ANJ A;  2ME6 A;  2JA8 J;  3ZQ7 A;  3NEU A;  5BPD A;  3CD6 I;  3RPQ A;  4DYR A;  3FMR A;  2MD5 A;  2HI3 A;  3MKY B;  2P7C B;  2L9R A;  4HQM A;  5M3M J;  2VT2 A;  3ABM H;  2KRH A;  3I54 A;  5K1Y A;  5EG0 B;  1MMG A;  3M8F A;  5KHD A;  1SFX A;  3E6C C;  2DT6 A;  2XAU A;  2WV0 A;  2XKO A;  3D0S A;  2KKO A;  2E7X A;  3F6V A;  2YX4 A;  3OOU A;  3CES A;  2CG4 A;  2V7F A;  2IRF G;  2D1V A;  1IN7 A;  1Y56 A;  2ME0 A;  3GTL J;  3TO9 A;  1NG7 A;  3QOD A;  3R6S A;  1RC9 A;  1O4X A;  4D7M A;  4LJZ F;  1V5F A;  5A2Q K;  1ETO A;  4OOI A;  1EKE A;  2OCE A;  2ZC2 A;  2RC4 A;  5DD8 A;  1KQ0 A;  2VN2 A;  1OCR H;  2KL4 A;  1HW1 A;  3DEW A;  2RN7 A;  3HIF A;  3J7Y J;  1HKQ A;  4G12 A;  3K70 D;  4DBR A;  3JRC A;  1ZG1 A;  3ZQL A;  1GV2 A;  2ISY A;  5CLS A;  1OCC H;  5B1A H;  4CYC A;  2EFP A;  3G71 I;  3QP6 A;  2R7W A;  1TW3 A;  3BT9 A;  1H9G A;  2DI3 A;  5LGT A;  2DA7 A;  4B43 A;  3W6J B;  1WPK A;  3FXM A;  3WGI A;  2ECC A;  2RAE A;  4IHW A;  4IHT A;  1RUO A;  2PEX A;  1B4A A;  3NQO A;  2DOD A;  1ZG3 A;  2XRN A;  3L2Q A;  3HOV J;  4WX9 A;  3DTI A;  3G3Z A;  4UB6 C;  3HPG A;  3VSL A;  2LR8 A;  3HSE A;  5IOZ A;  2BHY A;  2E2H J;  2QQ8 A;  3P7N A;  2LLK A;  2YX7 A;  3OS0 A;  1KQ8 A;  3ZGK A;  1TBX A;  1Z21 A;  2K4J A;  2L7F P;  2GIV A;  2DTZ A;  2J5P A;  2P6T A;  3MFK A;  1U3E M;  1P4A A;  3CP8 A;  1WVR A;  2H6B A;  1SD6 A;  2ZXW H;  1WHU A;  2A68 F;  2FNP A;  2XDV A;  1YS7 A;  2JN6 A;  4HYE A;  2M2E A;  4EVI A;  4RDU A;  3OY9 A;  2DFE A;  4JOM A;  4A3J J;  4XN3 A;  4RM3 A;  2K85 A;  2W1O A;  3RKX A;  3BG3 A;  5FJ8 J;  1I5Z A;  2VJ4 A;  1X2N A;  2MC4 A;  5L3E A;  1RNL A;  3IWZ A;  4FTH A;  1FEX A;  3MKZ A;  5L3C A;  1CQT A;  4L5I A;  2QBY B;  3ZP5 A;  4QPQ A;  2DA4 A;  3HHH A;  1CF7 B;  2BXY A;  4HG2 A;  5ICF A;  1LNW A;  4E6K G;  2QZ8 A;  2DYS H;  5D5W B;  1W7P A;  4XMY A;  1AA7 A;  2Y48 A;  2JA5 J;  3AL0 C;  1HKS A;  2W57 A;  2QGU A;  2HXI A;  3HUG B;  4BAY A;  1OPC A;  3K7A J;  4EJT A;  3KYD B;  2BGC A;  3ZQF A;  3WTX C;  3RZD J;  3AAF A;  3OYN A;  3FMS A;  3E97 A;  4U0V A;  1G8X A;  4IHS A;  3I59 A;  3RIR A;  2CJJ A;  2JRT A;  3HG9 A;  4LG0 B;  3TBI A;  2ZFU A;  2DBB A;  1XGO A;  4CUG A;  3HKZ N;  4V2F A;  3K1N A;  3GZN B;  1O3R A;  3O3K A;  4DOZ A;  4ON0 A;  1LVA A;  1S8N A;  1Y6I A;  1XD7 A;  3WHB A;  4HF2 A;  4AIJ A;  4KIT B;  2W84 A;  1ZR2 A;  2MD0 A;  2LF8 A;  3FBI B;  2VOP A;  2XF7 A;  5KK1 A;  3KPH A;  1J7K A;  1R7J A;  2EFN A;  4XID A;  3OIQ A;  4UUS B;  2L7M P;  2BY0 A;  2X6X A;  2VQL A;  1K83 J;  2FJ1 A;  4W97 A;  2ETH A;  1XTA A;  3GTP J;  4ZC3 A;  2HOS A;  4LGW A;  3TDU C;  2HTJ A;  3WHC A;  4BDZ A;  1BI0 A;  2V79 A;  2DW4 A;  2HZT A;  4PSX A;  4HX4 A;  4XLP F;  4RAF A;  1I50 J;  2OA4 A;  5J6X A;  5IY5 H;  1D3Y A;  4XK4 A;  1JHF A;  3H5N A;  2VJJ A;  1MMA A;  4QIW N;  4XQF A;  4A3C J;  3FIS A;  2DJN A;  2HR3 A;  2H94 A;  2AXL A;  4U0Y A;  2NOJ B;  3EYI A;  1LE8 A;  2R7V A;  3QRF F;  4I76 A;  1X4P A;  3RPU A;  3X2Q H;  4BEH A;  1ACI A;  2MAB A;  1ENH A;  4YII A;  2K5C A;  3L9F A;  4NQW A;  3CCY A;  1E3H A;  4P5O A;  3GCM A;  4FIS A;  2ZFW A;  3S2H J;  1JKP C;  4ENM A;  3V4G A;  5FLM J;  2ZJQ F;  1RI7 A;  3MCZ A;  1AKH B;  4YEL A;  4CCO A;  2A05 A;  3SYT A;  2UZK A;  2LVS A;  2K40 A;  2FBK A;  5KNL A;  2VON A;  3TQN A;  3V7S A;  3S1Q J;  5EZG A;  2PJR B;  4L9N A;  2ESH A;  2EBI A;  2K3F A;  3PO2 J;  3OYJ A;  1UHW A;  3FXQ A;  1ONV A;  2DDB A;  3WTS C;  4XBF A;  3HGY A;  2Y0S N;  5TIS C;  4XLF A;  1DGW Y;  2L5Q A;  4B4C A;  4CZC A;  3G1O A;  4ESJ A;  1E0E A;  1LDD A;  2LMD A;  2RNG A;  2FA5 A;  4FT8 A;  4HOB A;  4KIF A;  1YI2 I;  4G7O F;  3BTL A;  1YX5 A;  3PFY A;  1HXD A;  4RLF A;  5DCM A;  1FMW A;  3LST A;  2Y0S A;  3T8R A;  2O61 A;  5K5R A;  3FF5 A;  1LKX A;  3O8H A;  4BUP A;  3TW6 A;  2R7U A;  1QVU A;  4PDK A;  2EIN H;  3CJR B;  3GZ5 A;  3TP3 A;  5JR3 A;  3L2C A;  5TGT A;  4IXA A;  1YJ9 I;  1SEU A;  4A0Z A;  2PN6 A;  1AWC A;  1PJR A;  2O6G E;  1FTZ A;  4KT6 A;  3IH4 A;  2J5O A;  3LFU A;  4BY1 J;  1ZG5 A;  2BW3 A;  5DUI A;  1H9T A;  2W24 A;  2IXS A;  4AID A;  3DPU A;  1ZKG A;  3L7W A;  3HTS B;  3JTG A;  3L2V A;  3IKV A;  1BIA A;  1MJ9 A;  5D8K B;  4GRI A;  4H0E A;  1O3S A;  1K61 A;  4K2E A;  3I9V 2;  3F8M A;  5LEK A;  1K7A A;  1D8J A;  1TWF J;  3CCR I;  3GEZ A;  5F0C A;  1N25 A;  1YTY A;  4ZYH A;  1MJA A;  2OZ6 A;  3KET A;  2R7S A;  2DLL A;  4I01 A;  1YYV A;  3L2R A;  2XGE A;  2IA2 A;  3JRF A;  4DQ2 A;  2M4K A;  5EF6 A;  1BOA A;  3VB2 A;  2X0L A;  3K6G A;  3PUB A;  2STW A;  5J8C A;  3PM1 A;  2LKS A;  2XAS A;  1E17 A;  4CIC A;  1UST A;  5E8G A;  1E3P A;  2Z99 A;  3FM5 A;  3GFM A;  4N4O B;  4UVB A;  4UVC A;  4F93 B;  1TTY A;  1U9O A;  3PNT A;  3RJP A;  3DEE A;  4KYW A;  3Q9S A;  3WTT C;  1QRY A;  4YRV A;  5A2Q Z;  1RR7 A;  3H3U A;  2MH2 A;  5BOX A;  2WB1 N;  1J59 A;  1QPI A;  3CC7 I;  1GV5 A;  1W7P D;  4U0W A;  5ICC A;  3L09 A;  3K0L A;  3A2K A;  2R4G A;  2COB A;  4RAY A;  3GX4 X;  3M8E A;  4M3G A;  1B9M A;  3HYI A;  3RCO A;  2QUF A;  4GDF A;  3REO A;  4DBQ A;  3J81 K;  2W4S A;  4C30 A;  2D5V A;  2I8D A;  3PO3 J;  3K9T A;  1O3Q A;  2WB1 A;  1NHA A;  5FD6 A;  4X0G A;  4IHV A;  5LHG A;  4CCN A;  3GW2 A;  4MEY F;  2M5W A;  2FRH A;  4IQ4 A;  2VJ5 A;  4D7N A;  1GVD A;  2LKP A;  1XSV A;  2RGV A;  3RQ4 A;  1I27 A;  1OIS A;  3ESW B;  5D8L B;  2L7Z A;  2NVQ J;  1OYW A;  5JHF A;  2EWN A;  1ZRE A;  4XKV A;  3CDH A;  4EJV A;  1SFO J;  2BXZ A;  4MHG A;  3NWS A;  3S17 J;  1MMD A;  3DCF A;  2WAD A;  4A3D J;  3H36 A;  1KYW A;  2ZSI B;  5KCM A;  1IF1 A;  3CLO A;  5HDK A;  1I3A A;  5EYR A;  3H9G A;  3D5L A;  1JE8 A;  1ZK8 A;  3F23 A;  3CC4 I;  3HXL A;  4FCY A;  2V6C A;  5JLW A;  1V5G A;  4WWC A;  2KPM A;  4BYY A;  2F4O B;  4J01 A;  1ZH5 A;  4YG2 F;  1N75 A;  1K79 A;  2BOL A;  3KIO A;  4HEA 2;  3PQJ A;  4BEH B;  3BZC A;  1WSU A;  5CJ9 A;  4QLC U;  3H3V K;  2WY8 Q;  4HST A;  1U5T A;  3F72 A;  1U9N A;  1D0X A;  2BE5 F;  2CUZ A;  1AHD P;  1G4D A;  1ZLK A;  1HA8 A;  3QPS A;  4C9Y A;  1LDJ A;  2QLZ A;  2PG4 A;  3BG7 A;  4HF0 A;  1UFM A;  2CMP A;  1W4M A;  3LNQ A;  3RPU D;  2K02 A;  2FOW A;  1IZ1 A;  3DPT A;  2OC6 A;  2F2E A;  5M5W J;  3VSK A;  1R1T A;  3CMM A;  3MD2 A;  3GTO J;  1WI3 A;  3SFZ A;  2P5L C;  1T0F A;  2GA1 A;  4XRM A;  2M34 A;  3ECH A;  5EZH A;  4DZP A;  1TLH B;  5KVR A;  1JI8 A;  4Y4R A;  2R5Y A;  1JKQ C;  2WBM A;  3QYF A;  3OYC A;  2V1D A;  2RRE A;  3FWE A;  1K4T A;  4MLO A;  1SVL A;  2D45 A;  4ZJZ A;  1MZB A;  2W85 A;  4Q5S F;  5JFR A;  1FMV A;  2EZK A;  3H92 A;  1EH6 A;  1TNT A;  3GO5 A;  1RKW A;  1X19 A;  3FXU A;  5CVR A;  1T39 A;  1H0M A;  1W5T A;  1FNN A;  4L9J A;  4BNC A;  2JA6 J;  1ZN2 A;  5F0H A;  2LD5 A;  5FKO A;  4AWX B;  1Z0X A;  3S8P A;  4FQG A;  2K9S A;  2VC0 A;  2E35 A;  1ZRD A;  5CYV A;  3BCB A;  2E19 A;  5FO5 A;  3GTG J;  4IHX A;  3CMA I;  1FYK A;  1X58 A;  1BR1 A;  3QPL A;  4ZH4 F;  3E0J B;  2AS5 F;  2PLY A;  1MBH A;  3HEF A;  2CUE A;  2RVC A;  1WJB A;  1W0T A;  3IAS 2;  4C2U A;  4AVP A;  1JTX A;  1I39 A;  4EAT A;  2OQG A;  3QP5 A;  2IBD A;  2BW3 B;  4EM1 A;  3BR6 A;  1R4M B;  1R5G A;  1BR4 A;  3P9K A;  1FBQ A;  2X9D A;  3M3Y J;  1ORK A;  1G6N A;  4EM0 B;  1V55 H;  3TOB A;  4QPO A;  3LQQ A;  3F21 A;  5B5E C;  1LFU P;  1BM9 A;  1VQP I;  2VKV A;  1T2K A;  2Y2Z A;  2B9S A;  3DBH B;  1IXC A;  5E8I A;  2LBF A;  2Q2E A;  3CO6 C;  1VTN C;  4NNJ A;  1PUF B;  4CXF A;  4XR6 A;  5GAD J;  4WXD A;  3OSG A;  1OCT C;  2E71 A;  1D8K A;  1IRX A;  3GVA A;  1MMS A;  3HOW J;  2R7Q A;  4RB1 A;  2UV1 A;  4UXN A;  3GUD A;  1QGP A;  2A69 F;  1QQI A;  2A5Y B;  2DCE A;  2WTE A;  1WJA A;  4L5J A;  5LGU A;  5CVJ A;  1QZY A;  4L9T A;  2N8G A;  2NNY A;  2H1L A;  2VBX A;  1IRF A;  2QKM B;  3AG1 H;  3HTU A;  3WTZ A;  2DMN A;  2VIX A;  3RKW A;  3HOZ J;  4BE2 A;  2HVS A;  4AYB N;  4DW6 A;  1U2W A;  4NC6 A;  3PQK A;  5GTH C;  2NS8 A;  4JK1 X;  1FOW A;  3QPT A;  3PFI A;  4KUM A;  1KZH A;  4XOP A;  3V7R A;  1YW7 A;  5DDG A;  1TL8 A;  2DO7 A;  1J2X A;  3MMY B;  5AIQ A;  4M3F A;  4UNO A;  1NTC A;  1OKR A;  1I6X A;  2OV7 A;  1AOY A;  4DYQ A;  2JVH A;  5E79 C;  2X85 A;  1Z05 A;  2CQX A;  3TDZ C;  1JJ6 C;  2CGP A;  3E6D A;  2HPM A;  5EGO A;  1OJL A;  2PFB A;  4F3Q A;  2VC1 A;  4IJA A;  4IQJ A;  2L0K A;  4HA8 A;  3VYR B;  1IXS B;  4A3L J;  1X1D A;  3ABL H;  2GA2 A;  3MWM A;  2DXI A;  1TQP A;  2B0L A;  1ETX A;  2HXO A;  4Y33 A;  1U8B A;  1VF9 A;  4XLH A;  2FOK A;  1BR2 A;  3D1N I;  4I99 C;  1O7F A;  2VLA A;  1A36 A;  4UUV A;  4J00 A;  5ICG A;  4R79 A;  3BR1 A;  3FXL A;  3V8K A;  2VXZ A;  2JQ7 A;  3BR5 A;  1R49 A;  1R36 A;  1U5T B;  1FPQ A;  3K2Z A;  4WF2 A;  2KDZ A;  1DUX C;  1BW5 A;  3FKI J;  2DYR H;  1IW7 F;  3HSF A;  2A6T A;  1Z6T A;  4X1E A;  2M7B A;  1ZAR A;  2V9V A;  4OAY A;  4ESF A;  4MTD A;  3GYH X;  3Q0W A;  4BQO A;  3I55 I;  4XOT A;  2HKX A;  2GIZ A;  4LMY A;  3BCA A;  5ILU A;  4ZDL A;  3S93 A;  4O3M A;  1IUY A;  4FAS D;  1ULY A;  1M1E B;  1MD0 A;  2GXG A;  4A69 C;  1GXP A;  4WK8 F;  4TV7 A;  1IG7 A;  1X1C A;  2E1N A;  3G4S I;  2E1M B;  1XGS A;  3IAM 2;  5HDN A;  3JRH A;  3WG7 H;  3E6M A;  2CQQ A;  3CP2 A;  3HRT A;  4I0A A;  5FLX Z;  1X1P A;  2QQA A;  2H8W A;  3TOA A;  4ZYD A;  2CQ7 A;  1R5I D;  4DYC A;  3WU1 B;  4HDV A;  1IDZ A;  4NC8 A;  1VQK I;  2VPL A;  1VQ7 I;  4G8X A;  2VQG A;  3B73 A;  1TWC J;  1HBX G;  3LSI A;  4PJL A;  1KON A;  3BJO A;  2PQ8 A;  5F64 A;  1SAX A;  2QM3 A;  5IYC J;  4QSH A;  3AL0 B;  2DFF A;  3ZMD A;  3PIP F;  5E1Z B;  3LMM A;  3O2P E;  4EEF G;  3PL8 A;  4XN0 A;  1ZGA A;  4IF4 A;  1CGP A;  1T33 A;  2LF7 A;  1FYL A;  1SAU A;  4ZYA A;  3GFL A;  2A6E F;  3KP2 A;  4I02 A;  2E7W A;  5H2F C;  2ZME A;  2R5Z A;  1QPM A;  1AU7 A;  1FBU A;  2FEZ A;  5EJC A;  3I4N J;  1MH4 A;  4OIR F;  3FK6 A;  3VPR A;  2RNJ A;  2W25 A;  3ASO H;  5GPC A;  3PUF A;  3JSO A;  1FJL A;  3HSR A;  2OBP A;  3WGG A;  1YQA A;  2QKL B;  2TCT A;  2H8R A;  2FXA A;  2R7F A;  1T56 A;  3KP4 A;  1Z3Y A;  2LBF B;  3KZY A;  1YG2 A;  5J1U A;  3C18 A;  2L4M A;  2LRD A;  2ELK A;  4NHJ A;  1HCR A;  1ZTR A;  4UUT A;  4LB6 B;  1JT6 A;  2O7O A;  3BQY A;  2VKE A;  1HLV A;  4PUS A;  4KIC A;  1JUM A;  2GOM A;  2DU9 A;  1Y8R B;  2WWY A;  4IOA F;  1FZP B;  3GWZ A;  1U8R A;  3JR9 A;  2EPF A;  3OMY A;  3MZH A;  3BPV A;  3NWT A;  1GUU A;  3HPH A;  3KP3 A;  5CVV A;  4GGG A;  4LIU A;  1K6Y A;  5H6R A;  5IP9 J;  3OYK A;  4I6Z A;  4A3F J;  4HX8 A;  1PYV A;  1U5T C;  2XPU A;  4ITV A;  4YFX F;  3JSP A;  3R0J A;  3UKG A;  3LSP A;  1Z7L A;  3HOX J;  3FXO A;  4RGU A;  1WJF A;  2BVL A;  2P0W A;  5F0F A;  3A01 B;  5F6F A;  4PSW A;  3TED A;  2PI0 A;  1D1B A;  4NBQ A;  3KE2 A;  4PGG A;  2F6C A;  3WGH A;  3LFK A;  3S2D J;  3MZ8 A;  2LY2 A;  2EJR A;  2IA0 A;  3QOE A;  3E5Q A;  1L3L A;  2CRG A;  3A1Y A;  4FX4 A;  4MGR A;  5CVU A;  4HNV A;  3OYL A;  1WH7 A;  2E1M C;  3DV8 A;  1BC8 C;  1VQN I;  3OIO A;  1T0F C;  2DMQ A;  2KDO A;  2V26 A;  3K4C A;  1N78 A;  1P2F A;  3NAU A;  2KZV A;  3KEY A;  3OYD A;  4YIF A;  2HU9 A;  1FP1 D;  1FBS A;  1F9N A;  2EV5 A;  1VQ4 I;  3ZXS A;  4XRS A;  1MND A;  1HF0 A;  2XGX A;  4BU2 A;  1V3F A;  4HW0 A;  2IGO A;  4D0P A;  3GLX A;  3Q9V A;  2PMU A;  1LPQ A;  1V54 H;  5JI6 A;  2M4G A;  1MW7 A;  3CJT B;  4MIM A;  2EIM H;  2R7D A;  3KCC A;  2OU2 A;  3ZN1 A;  2VL8 A;  1FP2 A;  3V7C A;  5IP6 A;  4Y52 J;  4LIV A;  4RMN A;  4D1Q A;  1RET A;  2FU4 A;  3K4M A;  2L54 A;  1IRZ A;  3W3C A;  1Z77 A;  2DA5 A;  1SD4 A;  1B72 A;  5IYD J;  3WU2 C;  2ECB A;  3HBL A;  1Y39 A;  2VAS A;  4A3E J;  5B3S H;  1GLN A;  3LA3 A;  2JVG A;  2NS0 A;  3O8G A;  3CQZ J;  2R7O A;  3R0A A;  4NB5 A;  3A0B C;  5ED4 A;  2XF5 A;  3BPX A;  3K70 C;  5CPR B;  2IA1 A;  1S6L A;  4CCL A;  4RA2 A;  4RGX A;  2OCC H;  2YPR A;  4LLG F;  5DYM A;  3OYF A;  4HF1 A;  2NVY J;  3IRQ A;  5E3N A;  5ILS A;  3SZG A;  3LAP A;  1XSD A;  3A03 A;  5J40 A;  3DQV C;  1U78 A;  4CZZ A;  1WJE A;  2G7H A;  1YIT I;  2G9W A;  4JP0 A;  4F52 A;  4NUB A;  1SFU A;  2IJL A;  3GFJ A;  1IGN A;  1XGN A;  2XAF A;  4R8H A;  1UAA A;  3I71 A;  4II2 A;  2LTP A;  1D0Z A;  5L3D A;  3EUH A;  3ZQI A;  1WI9 A;  2IVM A;  2X6W A;  1Z3X A;  4BGD A;  4ESB A;  1ZAO A;  1YE9 A;  3BY6 A;  3TO7 A;  2MA3 A;  1WJC A;  3ZQQ A;  3MZY A;  3N05 A;  1JXS A;  3OYA A;  4O6J A;  4XIC A;  4MTE A;  2L01 A;  1QU3 A;  1YX3 A;  2GBY A;  3ZMT A;  4BAC A;  1A6I A;  3M9A A;  4B47 A;  4IO9 F;  1Y0N A;  5ERI A;  1YRN A;  4HPQ A;  1G59 A;  5HNF A;  3HZJ A;  5KAF C;  2YU3 A;  3RDI A;  3ZQH A;  3HHG A;  3H5A A;  2R3S A;  2EH3 A;  3MEX A;  2M9H A;  4XON A;  3BG6 A;  1MBG A;  3LSK A;  2K9L A;  4LOC A;  3W6V A;  2ZXH A;  4UHT A;  2FD5 A;  4CYD A;  4PFP A;  1V4R A;  3JW4 A;  4GYI A;  4EM2 A;  3HOS A;  5TJJ A;  1ZQ3 P;  3DTK A;  4IPA A;  4ENJ A;  4MFE A;  4PGH A;  2HDW A;  4HV6 A;  4V2G A;  2PMH A;  3F6O A;  4Z2Y A;  3BWG A;  2EIK H;  1WCM J;  2ZME B;  3BR3 A;  3H9J A;  2E60 A;  3HJE A;  3ULQ B;  2Z3Y A;  1MNE A;  2ID3 A;  2WAF A;  4XLN F;  4OIP F;  1UG0 A;  5CQE A;  1JUS A;  1SVM A;  2FMY A;  2R92 J;  1VI0 A;  1T95 A;  3CTA A;  5F04 A;  3BJ6 A;  2M45 A;  4JX4 A;  2DMP A;  2IS4 A;  4ZZD A;  2L9N A;  2E1O A;  2H1K A;  1IN5 A;  3S3M A;  3KYC B;  2DOE A;  2A5W A;  2DK5 A;  3SZT A;  5LBQ A;  3GFI A;  2GLO A;  3I58 A;  2F5C A;  4CYC B;  2WAQ N;  1HQC A;  3BR0 A;  1DGR M;  1ETV A;  1BW6 A;  4ENK A;  4A3M J;  4AC0 A;  3ZMU A;  2ZBK A;  3I0T A;  4LLL A;  1TT0 A;  2Y9Z A;  4XKB A;  2WAQ A;  1NK3 P;  1BBY A;  3CF2 A;  4J19 A;  2Y69 H;  5J4Y A;  5D5U B;  4DJA A;  1W0U A;  2M0C A;  1D1C A;  1YO5 C;  3DU5 A;  4AU7 A;  3HL2 A;  1SC7 A;  4RAZ A;  3W6K B;  1ON2 A;  1SD5 A;  2W7N A;  4CO8 A;  3KEO A;  2M8E A;  2E5Z A;  2XF6 A;  5D5X B;  2M3A A;  5BMZ A;  3T0Y A;  4ZZL A;  3KYL A;  1KU3 A;  4IVN A;  1R1U A;  4BS9 A;  2CW0 F;  2JTV A;  2ZCW A;  5J1R A;  2PBI A;  3CUQ A;  4IX7 A;  3DEU A;  2LY1 A;  3DWL E;  2CV0 A;  2KJB A;  2R7Z J;  2F48 A;  3V42 A;  2NS7 A;  2VE8 A;  2QSH X;  2KZG A;  1OCP A;  2W82 A;  1XC5 A;  4GCV A;  4PJM A;  2F4I A;  3R4K A;  4YEJ A;  3FKJ A;  2B63 J;  1ZRF A;  2DPD A;  3K1M A;  3HRM A;  3S1N J;  3CME I;  5CKT A;  3PSI A;  4CCK A;  3LA2 A;  1UMQ A;  1Z1D A;  1YFH A;  4DGW B;  4OIN F;  1W7P B;  2FUG 2;  4GXO A;  2NVT J;  1OR7 A;  1R00 A;  2JZY A;  2MW8 A;  4XKW A;  3H0G J;  2QQ9 A;  4V19 K;  2GQQ A;  4EGZ A;  1XGM A;  5D4S A;  4DNC A;  3CCS I;  1MNM C;  1B72 B;  1IJW C;  2KIM A;  1XN7 A;  2Y0M A;  3LA7 A;  5FLX K;  2OUM A;  3T8T A;  4FET A;  3IHU A;  5LHH A;  1YOV B;  3I59 B;  5GTI C;  3H35 A;  2P7V B;  2ZME C;  2IS2 A;  4CCM A;  2O8K A;  4PZJ A;  2QEX I;  2MYS A;  5HNH A;  4CHU A;  2IW5 A;  2MG4 A;  3HOU J;  3E7L A;  2MC3 A;  5LRS A;  1ITY A;  1HDD C;  3D5R C;  4RB3 C;  4BJT A;  2O03 A;  5F08 A;  4C3J J;  1Y1W J;  4OAZ A;  4I2O A;  4G9Y A;  3S32 A;  1X1B A;  2CWE A;  2KFD A;  4U7D A;  5B66 C;  5JLX A;  1WJ5 A;  2K7L A;  5HLG A;  1YW9 A;  4MO7 A;  4MFD A;  1LUJ B;  1ZLJ A;  3FBN B;  3HM5 A;  3DKY A;  3QAH A;  3IH3 A;  2AQE A;  1BJA A;  1F43 A;  3L2W A;  2L4A A;  2STT A;  3DLL F;  2ZKZ A;  2CH0 A;  3Q5F A;  5HLT A;  2B7E A;  3BP8 A;  2XGC A;  3KZZ A;  4UVA A;  1YRN B;  4M72 A;  3LWF A;  2OD5 A;  5DUK A;  4A0Y A;  2JUG A;  5DD4 A;  1WFX A;  1XCB A;  1QHG A;  2JSC A;  3ABT A;  2HWV A;  1LE8 B;  3EQL F;  2KIF A;  2TDX A;  2VBW A;  1LB2 A;  3WE2 A;  3OYB A;  4LK1 F;  2P8T A;  1RPW A;  1KGS A;  1RKT A;  5D4R A;  2CW8 A;  1IV6 A;  4NQW B;  1YIJ I;  5BPI A;  2HDD A;  1ZGJ A;  1REP C;  1J75 A;  1HC8 A;  1ETY A;  4AD9 A;  9ANT A;  2EV0 A;  4A5M A;  1S72 I;  3KX2 A;  1ETK A;  1TQM A;  3C7J A;  2JRM A;  4ZTJ A;  4P55 A;  3QU6 A;  2VPR A;  2IGM A;  1TZL A;  1UZC A;  3JRA A;  2ZO4 A;  2JPC A;  2LP0 A;  4JBA A;  2DFH A;  2VOO A;  1IN8 A;  2BZT A;  2HQR A;  1XDU A;  2E36 A;  1MMN A;  2MFZ A;  2V1N A;  2HOE A;  2BBY A;  3RYR A;  4EJO A;  2YU9 J;  4XL9 A;  5ICE A;  1FLI A;  2A07 F;  3CC2 I;  3GBG A;  1BIB A;  4HLY A;  4G6D A;  3JRI A;  2KIU A;  2LG4 A;  3E1S A;  3F8B A;  1K6O A;  2HQA A;  5DCM B;  3J7Z I;  2PX9 A;  4PJJ A;  4BHB A;  3HRU A;  5FRO A;  2P6S A;  4OWR B;  2DA2 A;  3DKW A;  1ETW A;  4I98 B;  1SFK A;  3CCM I;  5JVG F;  3M07 A;  2V6E A;  2HTS A;  1JGG A;  3HC7 A;  1J9I A;  2E34 A;  3G1M A;  2NRA C;  4A6E A;  2VE9 A;  2XAG A;  1MGT A;  4G6Q A;  3GF2 A;  4C3I J;  4Q4Z F;  3ZOB A;  2EQR A;  1I1G A;  5FKM A;  2EV6 A;  1MBK A;  1I3Q J;  2F5V A;  4L0Z B;  2DOF A;  4YFN F;  3FHN A;  1S29 A;  2GM4 A;  1EH7 A;  1YHQ I;  2IT0 A;  4KMU X;  3L1P A;  3FZV A;  3EUH C;  1VQ9 I;  2UXN A;  3R60 A;  4ETS A;  1BC7 C;  3JAM Z;  3CUQ B;  2AQF A;  1GHC A;  4G6T B;  1EH8 A;  3J7A O;  2GZW A;  5IT3 A;  4BL0 B;  3DBL B;  2Y75 A;  3PIO F;  2HYG D;  4PCQ A;  4KIS A;  1Q1H A;  3CUO A;  2TRT A;  3DLA A;  1FOX A;  5EEG A;  1MBF A;  1A35 A;  1T6S A;  1BI1 A;  3WTY C;  4HAM A;  1PUE E;  4HBL A;  1KU2 A;  1QVT A;  4L9V A;  1GXQ A;  2FF4 A;  2DPU A;  3OS2 A;  1H8A C;  1X3W B;  4AIH A;  1P4X A;  5IPA A;  4Y13 A;  1FSE A;  1IN6 A;  2W00 A;  3CCE I;  2K27 A;  4CA0 A;  5LEJ A;  4N4N B;  1MDM A;  3KEQ A;  2LRE A;  4M3E A;  1FC3 A;  4LLN A;  1STZ A;  4ASN A;  1UJ8 A;  3BJA A;  1UG2 A;  4CCJ A;  4HV5 A;  2ISZ A;  1WKM A;  3FXK A;  3SDG A;  3N4M A;  2GXB A;  1DU0 A;  1FWZ A;  5M5X J;  2DK8 A;  3QU3 A;  3VYS B;  4BKX A;  3OYM A;  3M4O J;  2CQN A;  4BE0 A;  2A6H F;  3ONQ A;  4ZYG A;  1MKM A;  1Y1V J;  2P5V A;  4XRF A;  2K9Q A;  4A6D A;  4E7L A;  3ZPL A;  1OCZ H;  1OYI A;  3OR2 C;  3E5X A;  1Y8Q B;  2CUJ A;  2RV8 A;  4LB5 A;  4RM2 A;  3KLN A;  3Q0U A;  1RRJ A;  3W2V A;  1Z9C A;  4Q47 A;  4XNF A;  2HFH A;  5LGN A;  3M1E A;  3R61 A;  2XRL A;  1SMT A;  3RTR A;  3CCV I;  2HVR A;  3U21 A;  1X4O A;  1TC3 C;  3VYU B;  4AM3 A;  2QSF X;  1PDN C;  5HS9 A;  3SXY A;  4ZTF A;  2DOA A;  3TGN A;  2MGQ A;  5FD5 A;  5LD2 C;  4RLQ A;  1H89 C;  3RSN A;  2ZB9 A;  5BQT A;  1F36 A;  4M9Z A;  1QO0 D;  4DIQ A;  3GTJ J;  2M8G X;  3JRG A;  3IH2 A;  2VBZ A;  5HOO A;  1EF4 A;  3CCQ I;  3ZRG A;  4G7H F;  4BHC A;  3W2A A;  1XS9 A;  4I7H A;  2BEO A;  4A3B J;  1WQ2 A;  3M1C A;  1CF7 A;  3AFH A;  2L9V A;  1DDN A;  5LHI A;  4BXX J;  5IT9 K;  1LEB A;  1FX7 A;  1G3Y A;  2R93 J;  4JQF A;  4FHT A;  4HQE A;  2O9L A;  5IYB J;  3A4C A;  2HVQ A;  2I10 A;  2DDA A;  5FKK A;  4ENN A;  3CUQ C;  3HUG A;  4JX5 A;  2XAJ A;  4LD5 A;  3BTC A;  2JSP A;  1UHM A;  3OIP A;  4IRH A;  4XLA A;  3RZO J;  3OV8 A;  1BA5 A;  1TNS A;  3K69 A;  2XPV A;  2XHK A;  5FFZ A;  2ESN A;  3QYB A;  1VZ0 A;  2P81 A;  1LJ9 A;  2NAZ A;  4LG0 A;  1ETQ A;  5ILV A;  1E2X A;  5LLQ A;  3NAR A; 
#chains in the Genus database with same CATH homology
 1TW2 A;  2EK5 A;  2Q0O A;  4WCG A;  4RB0 A;  4M9S A;  2MLK A;  1TQI A;  3IC7 A;  3DXJ F;  1PP7 U;  2UXX A;  3I64 A;  4P9U A;  1FYM A;  2RQP A;  3LAJ A;  5H6Q A;  2BYV E;  1J0R A;  2HKO A;  2CFX A;  4B8X A;  2F5D A;  4BH9 A;  3DFG A;  1IXR C;  1JHH A;  2CQK A;  1P4W A;  1K78 A;  4B09 A;  4O5V A;  1QBJ A;  2ELH A;  1UCR A;  2CSO A;  1S7O A;  3VOD A;  1GVJ A;  4XSZ F;  1SD7 A;  1DPU A;  4A5N A;  1F5T A;  3QPH A;  3MAJ A;  3E5U A;  3OOP A;  3COA C;  4Y15 A;  1S3J A;  3IWF A;  3U2R A;  3RI4 A;  2RDP A;  1MDM B;  2FML A;  4BXU A;  2XKP A;  3M7G A;  1B59 A;  1FOK A;  2FSW A;  4CGZ A;  2YSR A;  2ZNZ A;  4RS8 A;  2A3S A;  1WRJ A;  4KIB A;  5J8F A;  2F5E A;  4EQQ A;  3ROU A;  2GWR A;  3C1D A;  1B6A A;  4EJU A;  3F3X A;  2KRF A;  2DT5 A;  4ZYE A;  1BN5 A;  2OZU A;  2OQR A;  4QWQ A;  4KMF A;  2P4W A;  2XV4 S;  2Z5U A;  1R1V A;  2G7U A;  5FGM A;  1ODD A;  6PAX A;  2O8X A;  4M73 A;  1R23 A;  3KFW X;  5HLI A;  2P5K A;  3ERE D;  2ZJ2 A;  2EA4 A;  3J80 K;  3V8L A;  3VFZ A;  1T38 A;  2FBI A;  4EV0 A;  1O3T A;  4KIG A;  4F7Z A;  2MBF A;  1KA8 A;  3P9I A;  2C6Y A;  4BQA A;  4S04 A;  2EFW A;  3EET A;  3U9G A;  4OMZ A;  3FXR A;  1D5V A;  4IRI A;  4I09 A;  4OIO F;  1KQ9 A;  1YLF A;  3EYY A;  1ZYR F;  2EFQ A;  2Z9O A;  3JAM K;  3FHZ A;  1RUN A;  2COM A;  1ZRC A;  1JGS A;  4OMY A;  1ZHF A;  2DQR A;  2V1U A;  4EMS A;  2H09 A;  3T5X A;  5D6F A;  1BI3 A;  4HZF A;  5L3F A;  5JHU A;  2M1B A;  1ON1 A;  2H6C A;  3BRO A;  1S7A A;  1Z7U A;  3WG9 A;  1K78 B;  2D1H A;  3I5U A;  2FE3 A;  2GAU A;  4KNY A;  1X3U A;  2E1C A;  5IT9 Z;  2RKH A;  4MNU A;  1QZZ A;  5H20 A;  1MJB A;  5AON A;  1IN4 A;  2UWM A;  5L3B A;  2ADU A;  2Z33 A;  3VEP A;  2F5F A;  4RGS A;  4XSX F;  1USS A;  2EB7 A;  4MQV A;  5D5V B;  2IPQ X;  3RYP A;  3FM3 A;  4A0X A;  1Y0U A;  3V8J A;  2LNB A;  1YIO A;  2L02 A;  1XSX A;  4WXC A;  1R22 A;  5F1R A;  2HS5 A;  3E6B A;  5E1X A;  3SZP A;  1IAW A;  4EGY A;  4KFC A;  5DEQ A;  3MQ0 A;  3BOQ A;  1FT9 A;  4KT5 C;  3F8C A;  2LSO A;  5E18 F;  3FX3 A;  2VOD A;  4GO1 A;  2NYX A;  3HRS A;  2CYY A;  1DP7 P;  2OAZ A;  1FY7 A;  2XAH A;  1R5H A;  4M9X A;  4P9F A;  4LK0 F;  5JVT A;  1G3T A;  1KYZ A;  3BZ6 A;  2YR2 A;  2JPB A;  5FFX A;  1XDS A;  3WE3 A;  2FQ3 A;  1O7L A;  5E20 A;  3WU0 A;  3H3Z A;  4P96 A;  3B02 A;  3GZ6 A;  2XRO A;  4M71 A;  3SHF A;  1Z6R A;  2EA2 A;  2K86 A;  3LQR A;  4R1H A;  3HOT A;  2QWW A;  5D6E A;  2X4H A;  5CVI A;  4G7Z F;  1KU7 A;  2DQL A;  1R58 A;  2D2W A;  1IRG A;  3ECO A;  3IRR A;  2K4B A;  1LQ1 A;  3DPL C;  1SMY F;  3TO6 A;  2ACJ A;  2XIG A;  2O3F A;  3WTV C;  2V1X A;  1F4K A;  3ISP A;  4EJW A;  5TRD A;  1FSH A;  4UV9 A;  3KP5 A;  3WOD F;  2QVO A;  4KA4 A;  2A61 A;  4YFK F;  1G3W A;  3O6B B;  2VT3 A;  4MQ9 F;  1Z91 A;  1YW8 A;  1HST A;  4L18 B;  3EDP A;  4N9H A;  3J80 Z;  5K5Q A;  1C0W A;  3F8N A;  3ZMV A;  5BS6 A;  5HS7 A;  3ABU A;  1EV7 A;  4E70 A;  3P9C A;  1XCV A;  4Y17 A;  1P6R A;  4G94 A;  2ZNY A;  4A12 A;  3NRV A;  1HW2 A;  4AIK A;  1HKT A;  5HS8 A;  2H27 A;  4U7B A;  1UB9 A;  3TKY A;  2MLG A;  3WTU C;  3QOP A;  4KN7 X;  3S2W A;  4I0B A;  1B9N A;  2HQN A;  5E17 F;  4FX0 A;  2VBY A;  1W5S A;  3IL2 A;  2HDC A;  3I4P A;  4RGR A;  3BDD A;  4S05 A;  2EFO A;  1QNT A;  5AIP A;  5LRR A;  3RKY A;  1O57 A;  1BI2 A;  5DCF A;  4A2U A;  2L3D A;  1OYY A;  4KDP A;  2MH9 A;  2WC2 A;  3CO7 C;  3T1B A;  2QQB A;  3C3W A;  3SQN A;  5K5O A;  5E1W A;  1PP8 F;  4M74 A;  3L00 A;  4CDG A;  3CJN A;  3DP7 A;  3ELK A;  4LFU A;  1GXP A;  4N0B A;  1XMK A;  2DAO A;  3U1D A;  2XVC A;  4BHP A;  3K1P A;  1P92 A;  3KP6 A;  1T98 A;  2CO5 A;  3I53 A;  1I1S A;  2HYF A;  1YS6 A;  2FNA A;  4RB2 C;  2NNN A;  4KN4 X;  1B1B A;  5L3G A;  1WWX A;  2HEO A;  4WXH A;  3ML6 A;  2IP2 A;  1G3S A;  4MEX F;  2ZXJ A;  4GYG A;  1LEA A;  3GXO A;  1J5Y A;  4HLX A;  4HDU A;  3KLO A;  2QEN A;  4OIQ F;  2PJP A;  3FMQ A;  3ZN0 A;  3G73 A;  4UV8 A;  2M30 A;  2QBY A;  3E3V A;  2DFI A;  3WTW C;  5HLH A;  1HSJ A;  1RZ4 A;  1A04 A;  2KJC A;  3F22 A;  4OU0 A;  3DF8 A;  1DPR A;  2BV6 A;  1LDK B;  1OMI A;  5FB2 A;  1RIO H;  4M6X A;  2QYO A;  3N97 A;  3ZMZ A;  1SFE A;  1L0O C;  2Q8K A;  4Q48 A;  3KP7 A;  5HDG A;  2M87 A;  4L0Y B;  2LDU A;  4U88 A;  5EEH A;  4M6Y A;  1XB4 A;  2DTR A;  2XUB A;  2JT1 A;  3F8F A;  5HVQ C;  1XMA A;  1F1Z A;  2O0Y A;  4IRG A;  2HGC A;  1HW5 A;  4HX7 A;  3ZMS A;  5DV5 A;  2FBH A;  3IKT A;  3J81 Z;  1KU9 A;  2XAQ A;  1U6G A;  3VOE A;  3JTH A;  3ZQ7 A;  3NEU A;  5BPD A;  3RPQ A;  3FMR A;  2MD5 A;  2P7C B;  4HQM A;  2VT2 A;  3I54 A;  5K1Y A;  3M8F A;  1SFX A;  3E6C C;  2WV0 A;  2XKO A;  3D0S A;  2KKO A;  2E7X A;  3F6V A;  2YX4 A;  2CG4 A;  2IRF G;  2D1V A;  1IN7 A;  3TO9 A;  3R6S A;  4LJZ F;  5A2Q K;  4OOI A;  2RC4 A;  5DD8 A;  1KQ0 A;  2VN2 A;  1HW1 A;  2RN7 A;  3HIF A;  1HKQ A;  1ZG1 A;  2ISY A;  5CLS A;  2EFP A;  3QP6 A;  1TW3 A;  1H9G A;  2DI3 A;  5LGT A;  3W6J B;  3WGI A;  4IHT A;  1RUO A;  2PEX A;  1B4A A;  3NQO A;  1ZG3 A;  2XRN A;  4WX9 A;  3G3Z A;  3HSE A;  3P7N A;  2YX7 A;  1KQ8 A;  1TBX A;  2K4J A;  2GIV A;  2J5P A;  2P6T A;  3MFK A;  1U3E M;  1P4A A;  4N9I A;  2H6B A;  1SD6 A;  2FNP A;  2A68 F;  4HYE A;  1YS7 A;  4EVI A;  3RKX A;  1I5Z A;  5L3E A;  1RNL A;  3IWZ A;  5L3C A;  4L5I A;  2QBY B;  3ZP5 A;  3HHH A;  1CF7 B;  5ICF A;  1LNW A;  2QZ8 A;  5D5W B;  1W7P A;  2Y48 A;  1HKS A;  2W57 A;  4BAY A;  1OPC A;  4EJT A;  2BGC A;  3WTX C;  3AAF A;  3FMS A;  3E97 A;  4U0V A;  4IHS A;  3I59 A;  3RIR A;  2JRT A;  4LG0 B;  2DBB A;  1XGO A;  3K1N A;  1O3R A;  3O3K A;  4ON0 A;  1LVA A;  1S8N A;  1XD7 A;  4HF2 A;  4AIJ A;  2W84 A;  2LF8 A;  2VOP A;  5KK1 A;  1J7K A;  1R7J A;  2EFN A;  2ETH A;  4LGW A;  3TDU C;  2HTJ A;  1BI0 A;  2V79 A;  2DW4 A;  2HZT A;  4HX4 A;  4XLP F;  5J6X A;  2OA4 A;  1D3Y A;  1JHF A;  2HR3 A;  2H94 A;  2AXL A;  4U0Y A;  3EYI A;  3QRF F;  3RPU A;  4YII A;  3L9F A;  4NQW A;  4P5O A;  2ZFW A;  4ENM A;  3V4G A;  1RI7 A;  3MCZ A;  2UZK A;  2VON A;  2FBK A;  3TQN A;  3V7S A;  4L9N A;  2ESH A;  1UHW A;  3FXQ A;  1ONV A;  3WTS C;  4XBF A;  4ESJ A;  1LDD A;  4FT8 A;  2FA5 A;  4HOB A;  4KIF A;  4G7O F;  1HXD A;  5DCM A;  3LST A;  3T8R A;  2O61 A;  5K5R A;  3FF5 A;  4PDK A;  3GZ5 A;  5JR3 A;  3L2C A;  1AWC A;  4IXA A;  4A0Z A;  2PN6 A;  2O6G E;  2J5O A;  1ZG5 A;  5DUI A;  1H9T A;  2W24 A;  3L7W A;  3HTS B;  3JTG A;  3IKV A;  1BIA A;  1MJ9 A;  5D8K B;  4H0E A;  1O3S A;  4K2E A;  1D8J A;  3F8M A;  5LEK A;  1K7A A;  3GEZ A;  1YTY A;  4ZYH A;  1MJA A;  2OZ6 A;  3KET A;  2DLL A;  4I01 A;  1YYV A;  2IA2 A;  4DQ2 A;  1BOA A;  3VB2 A;  2X0L A;  2STW A;  5J8C A;  1E17 A;  2XAS A;  4CIC A;  1UST A;  5E8G A;  2Z99 A;  3FM5 A;  3GFM A;  4UVB A;  4UVC A;  1TTY A;  3RJP A;  4KYW A;  3Q9S A;  3WTT C;  5A2Q Z;  3H3U A;  2MH2 A;  5BOX A;  1J59 A;  1W7P D;  4U0W A;  5ICC A;  3L09 A;  3K0L A;  4RAY A;  3GX4 X;  3M8E A;  1B9M A;  3HYI A;  2QUF A;  3REO A;  3J81 K;  3K9T A;  1O3Q A;  1NHA A;  5FD6 A;  5LHG A;  3GW2 A;  4MEY F;  2M5W A;  2FRH A;  2LKP A;  1XSV A;  2RGV A;  5D8L B;  1I27 A;  1OYW A;  2EWN A;  1ZRE A;  3CDH A;  4EJV A;  4MHG A;  1KYW A;  1IF1 A;  3CLO A;  5HDK A;  3D5L A;  1JE8 A;  3F23 A;  2V6C A;  4WWC A;  4BYY A;  1ZH5 A;  4YG2 F;  1K79 A;  3PQJ A;  1WSU A;  5CJ9 A;  4QLC U;  1U5T A;  3F72 A;  2BE5 F;  1ZLK A;  1G4D A;  1LDJ A;  2QLZ A;  2PG4 A;  4HF0 A;  1UFM A;  1W4M A;  2K02 A;  1IZ1 A;  3DPT A;  2F2E A;  1R1T A;  3SFZ A;  2P5L C;  1T0F A;  2GA1 A;  3ECH A;  1TLH B;  5KVR A;  2V1D A;  3FWE A;  2D45 A;  1MZB A;  2W85 A;  4Q5S F;  5JFR A;  3H92 A;  1EH6 A;  1TNT A;  3GO5 A;  3FXU A;  5CVR A;  1T39 A;  1H0M A;  1W5T A;  1FNN A;  4L9J A;  4BNC A;  1ZN2 A;  4AWX B;  2VC0 A;  1ZRD A;  5CYV A;  5FO5 A;  1FYK A;  4ZH4 F;  2AS5 F;  2PLY A;  2RVC A;  4AVP A;  2OQG A;  3QP5 A;  4EM1 A;  1R5G A;  3P9K A;  1FBQ A;  1G6N A;  4EM0 B;  3TOB A;  3LQQ A;  3F21 A;  1BM9 A;  1T2K A;  3CO6 C;  1IXC A;  2Q2E A;  5E8I A;  1VTN C;  4CXF A;  4WXD A;  1D8K A;  3GVA A;  4RB1 A;  4UXN A;  3GUD A;  1QGP A;  2A69 F;  1QQI A;  2A5Y B;  2WTE A;  4L5J A;  5LGU A;  5CVJ A;  1QZY A;  4L9T A;  2NNY A;  2VBX A;  1IRF A;  3HTU A;  3WTZ A;  3RKW A;  1U2W A;  3PQK A;  4JK1 X;  3QPT A;  3PFI A;  4KUM A;  3V7R A;  1YW7 A;  5DDG A;  2DO7 A;  1J2X A;  5AIQ A;  4UNO A;  1OKR A;  1I6X A;  1AOY A;  1Z05 A;  3TDZ C;  2CGP A;  3E6D A;  2PFB A;  2VC1 A;  4IJA A;  4HA8 A;  1IXS B;  2GA2 A;  3MWM A;  1TQP A;  2B0L A;  2FOK A;  1O7F A;  4UUV A;  5ICG A;  4R79 A;  3V8K A;  2VXZ A;  1R36 A;  1U5T B;  1FPQ A;  3K2Z A;  4WF2 A;  1DUX C;  1IW7 F;  3HSF A;  1Z6T A;  2V9V A;  1ZAR A;  4ESF A;  4MTD A;  3GYH X;  2HKX A;  4LMY A;  5ILU A;  4O3M A;  1IUY A;  1ULY A;  1MD0 A;  2GXG A;  4WK8 F;  4TV7 A;  2E1N A;  1XGS A;  5HDN A;  3E6M A;  3HRT A;  4I0A A;  5FLX Z;  2QQA A;  3TOA A;  4ZYD A;  3WU1 B;  4HDV A;  4G8X A;  3B73 A;  1HBX G;  3BJO A;  2PQ8 A;  5F64 A;  1SAX A;  2QM3 A;  3ZMD A;  5E1Z B;  3O2P E;  1ZGA A;  4IF4 A;  1CGP A;  2LF7 A;  1FYL A;  3GFL A;  2A6E F;  3KP2 A;  4I02 A;  2E7W A;  2ZME A;  1QPM A;  1FBU A;  2FEZ A;  4OIR F;  2RNJ A;  2W25 A;  3JSO A;  3HSR A;  2OBP A;  3WGG A;  1YQA A;  2FXA A;  2R7F A;  3KP4 A;  3KZY A;  1YG2 A;  3C18 A;  2L4M A;  4NHJ A;  4LB6 B;  4KIC A;  2DU9 A;  2WWY A;  1FZP B;  3GWZ A;  1U8R A;  3MZH A;  3BPV A;  5CVV A;  3KP3 A;  4GGG A;  5H6R A;  4HX8 A;  1U5T C;  4YFX F;  3JSP A;  3R0J A;  4RGU A;  2PI0 A;  5F6F A;  3KE2 A;  4PGG A;  3WGH A;  3LFK A;  2EJR A;  2IA0 A;  3E5Q A;  1L3L A;  4FX4 A;  4MGR A;  5CVU A;  3DV8 A;  1BC8 C;  1P2F A;  4YIF A;  1FP1 D;  1FBS A;  1F9N A;  2EV5 A;  2XGX A;  1V3F A;  4HW0 A;  4D0P A;  3GLX A;  3Q9V A;  2PMU A;  5JI6 A;  2R7D A;  3KCC A;  2OU2 A;  3ZN1 A;  1FP2 A;  3V7C A;  2FU4 A;  2L54 A;  1SD4 A;  3LA3 A;  2NS0 A;  4NB5 A;  3R0A A;  5ED4 A;  3BPX A;  2IA1 A;  1S6L A;  4RGX A;  2YPR A;  4LLG F;  5DYM A;  4HF1 A;  3IRQ A;  3LAP A;  5ILS A;  1XSD A;  3DQV C;  1U78 A;  4CZZ A;  2G7H A;  2G9W A;  1SFU A;  2IJL A;  3GFJ A;  1XGN A;  2XAF A;  4R8H A;  3I71 A;  5L3D A;  3EUH A;  1WI9 A;  2IVM A;  4ESB A;  1ZAO A;  3BY6 A;  3TO7 A;  2MA3 A;  3MZY A;  1JXS A;  4O6J A;  4MTE A;  2L01 A;  3ZMT A;  3M9A A;  5ERI A;  2YU3 A;  3RDI A;  3HHG A;  2R3S A;  3MEX A;  4UHT A;  4CYD A;  1V4R A;  3JW4 A;  4GYI A;  4EM2 A;  3HOS A;  5TJJ A;  4IPA A;  4ENJ A;  4PGH A;  4HV6 A;  2PMH A;  3F6O A;  4Z2Y A;  3BWG A;  2ZME B;  3ULQ B;  2Z3Y A;  4XLN F;  4OIP F;  2FMY A;  3CTA A;  3BJ6 A;  2M45 A;  4ZZD A;  1IN5 A;  2DK5 A;  3SZT A;  5LBQ A;  3GFI A;  3I58 A;  2F5C A;  1HQC A;  4ENK A;  3ZMU A;  2ZBK A;  3I0T A;  4LLL A;  1BBY A;  5D5U B;  1YO5 C;  4RAZ A;  3W6K B;  1ON2 A;  1SD5 A;  4CO8 A;  3KEO A;  2M8E A;  5D5X B;  5BMZ A;  3T0Y A;  4ZZL A;  1KU3 A;  4IVN A;  1R1U A;  2CW0 F;  2JTV A;  2ZCW A;  2PBI A;  3CUQ A;  3DEU A;  2KJB A;  2VE8 A;  4GCV A;  3R4K A;  1ZRF A;  2DPD A;  3K1M A;  3HRM A;  3LA2 A;  1YFH A;  1Z1D A;  4OIN F;  1W7P B;  4GXO A;  1OR7 A;  1R00 A;  2JZY A;  2QQ9 A;  2GQQ A;  4EGZ A;  1XGM A;  5D4S A;  4DNC A;  2KIM A;  1XN7 A;  2Y0M A;  3LA7 A;  5FLX K;  3T8T A;  3IHU A;  5LHH A;  3I59 B;  2P7V B;  4PZJ A;  4CHU A;  2IW5 A;  2MC3 A;  5LRS A;  4RB3 C;  2O03 A;  4I2O A;  4G9Y A;  2CWE A;  4U7D A;  2K7L A;  5HLG A;  1YW9 A;  1ZLJ A;  3QAH A;  1BJA A;  2L4A A;  2STT A;  2ZKZ A;  3Q5F A;  3BP8 A;  3KZZ A;  4UVA A;  4M72 A;  3LWF A;  2OD5 A;  5DUK A;  4A0Y A;  5DD4 A;  1XCB A;  2JSC A;  3ABT A;  2HWV A;  3EQL F;  2KIF A;  2TDX A;  2VBW A;  1LB2 A;  3WE2 A;  4LK1 F;  2P8T A;  1KGS A;  5D4R A;  5BPI A;  1ZGJ A;  1REP C;  1J75 A;  4AD9 A;  2EV0 A;  4A5M A;  1TQM A;  3C7J A;  4P55 A;  3QU6 A;  2ZO4 A;  2JPC A;  4JBA A;  2VOO A;  1IN8 A;  2HQR A;  1XDU A;  2HOE A;  2BBY A;  3RYR A;  4EJO A;  5ICE A;  1FLI A;  2A07 F;  1BIB A;  4HLY A;  4G6D A;  2KIU A;  3F8B A;  1K6O A;  5DCM B;  4BHB A;  3HRU A;  2P6S A;  3DKW A;  4I98 B;  2HTS A;  1J9I A;  2NRA C;  4A6E A;  2VE9 A;  2XAG A;  1MGT A;  4G6Q A;  3GF2 A;  4Q4Z F;  1I1G A;  2EV6 A;  4L0Z B;  4YFN F;  1S29 A;  1EH7 A;  2IT0 A;  4KMU X;  3FZV A;  2UXN A;  3R60 A;  4ETS A;  1BC7 C;  3JAM Z;  3CUQ B;  1GHC A;  3J7A O;  1EH8 A;  2GZW A;  5IT3 A;  2Y75 A;  2HYG D;  4PCQ A;  1Q1H A;  3CUO A;  5EEG A;  1T6S A;  1BI1 A;  3WTY C;  4HAM A;  1PUE E;  4HBL A;  1KU2 A;  4L9V A;  1GXQ A;  2FF4 A;  2DPU A;  4AIH A;  1P4X A;  4Y13 A;  1FSE A;  1IN6 A;  2K27 A;  5LEJ A;  1MDM A;  3KEQ A;  1FC3 A;  4LLN A;  1STZ A;  4ASN A;  3BJA A;  4HV5 A;  2ISZ A;  1WKM A;  3N4M A;  2GXB A;  1FWZ A;  2DK8 A;  3QU3 A;  2A6H F;  4ZYG A;  1MKM A;  2P5V A;  4XRF A;  4A6D A;  3ZPL A;  1OYI A;  3E5X A;  2RV8 A;  4LB5 A;  3KLN A;  1Z9C A;  4Q47 A;  2HFH A;  5LGN A;  3M1E A;  3R61 A;  1SMT A;  3RTR A;  1PDN C;  5HS9 A;  3SXY A;  3TGN A;  5FD5 A;  5BQT A;  4M9Z A;  1QO0 D;  2VBZ A;  5HOO A;  4G7H F;  4BHC A;  4I7H A;  2BEO A;  1WQ2 A;  1CF7 A;  1DDN A;  5LHI A;  5IT9 K;  1LEB A;  1FX7 A;  1G3Y A;  4JQF A;  4FHT A;  4HQE A;  4ENN A;  3CUQ C;  3HUG A;  2XAJ A;  4LD5 A;  4IRH A;  1UHM A;  3OV8 A;  1TNS A;  3K69 A;  2XHK A;  5FFZ A;  2ESN A;  1LJ9 A;  2NAZ A;  4LG0 A;  5ILV A;  1E2X A;  5LLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...