4RSMA

Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. mc2 155, target efi-510970, in complex with d-threitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
DTTRIGVTVYDMSSFITAGKEGMDAYAKDNNIELIWNSANLDVSTQASQVDSMINQGVDAIIVVPVQADSLAPQVASAKAKGIPLVPVNAALDSKDIAGNVQPDDVAAGAQEMQMMADRLGGKGNIVILQGPLGQSGELDRSKGIEQVLAKYPDIKVLAKDTANWKRDEAVNKMKNWISGFGPQIDGVVAQNDDMGLGALQALKESGRTGVPIVGIDGIEDGLNAVKSGDFIGTSLQNGTVELAAGLAVANRLAKGEPVNKEPVYIMPAITKDNVDVAIEHVVTERQQFLDGLTELINKNLETGDIAYEGIPGQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title A General Strategy for the Discovery of Metabolic Pathways: d-Threitol, l-Threitol, and Erythritol Utilization in Mycobacterium smegmatis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 128
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rsmA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rsmA01
4N03A 3KHTA 2F8SA 1Z26A 2GX6A 2PJUA 4F8JA 1IIBA 4EVQA 1RZRA 4E7OA 1JH9A 1T34A 5IEBA 2PL1A 2MYNA 3LMKA 1L5YA 3E61A 4LE0A 1YTUA 1U8TA 1NATA 1QKKA 1ZH4A 2E4VA 4ZPJA 1E2BA 3BREA 3FFXA 2W42A 1DZ3A 1ZH2A 4Q6WA 4MS3B 2IDMA 3OLYA 4FB4A 1JDPA 2CD7A 2HJ9A 4RDCA 4TMYA 3HJFA 3MIZA 4YR7A 2FLKA 4G97A 2IKSA 4RK1A 5KI6A 1H9CA 4MLDA 3Q41A 1DC8A 3H5OA 1J56A 2A9PA 4ETMA 3BRQA 4ETIA 3CFYA 4MGEA 4MS1A 1QP0A 2JVJA 4JB0A 5IUJC 2MYTA 2FW0A 3B2NA 4RK6A 4MS1B 4RK4A 1P8AA 5KQGA 4EY3A 3DBIA 5DTEA 4Z9AA 4EVSA 2NT4A 5FWYA 3C97A 4RK7A 1ISSA 2E4YA 3W9SA 4G0OA 5CNJA 1FQWA 5JNTA 5KQLA 4W5TA 5FWYB 1ZAYA 2JBAA 4ETNA 4XARA 3L6UA 1Z15A 4RV5A 1NXSA 4TLMB 1U0SY 4LE2A 3QX9A 4RY9A 2ZWMA 1U2PA 1Y1LA 4RXTA 1TLFA 4KK4A 1K66A 3N8IA 1ZDMA 3N0WA 4IF4A 4KK3A 1TVMA 3P9YA 3Q7TA 1Z13A 5IUNC 1DP4A 1EFAA 1KRXA 1JL3A 3KYIB 3F6PA 1NY5A 5IBQA 1QPZA 5CNMA 3FFWA 4PEVA 1DCFA 2LPMA 3RVSA 3TO5A 2PKXA 4EYOA 1NXXA 4O5AA 2KYRA 4KMRA 4H3HB 3JVIA 2MSWA 4Z4FA 3IP5A 3HXMA 4JAVC 5JNWA 4ZMSA 1C0EA 4W5OA 1YVUA 2FMKA 3H6GA 4EGSA 1DCMA 4RZSA 1BDJA 4M88A 3H6HA 4G0QA 1KRWA 3HUTA 4G0PA 5EWLA 3OMXA 1NXTA 2IYNA 3D02A 1QO0A 4Z99A 1NXOA 5TPZA 5EWLB 1E6LA 4KQ9A 1JFVA 1VLZA 3H1EA 3F7NA 2PAFA 2V0NA 3MM4A 1XHEA 3MF4A 2A9QA 2MYUA 2QSJA 3QK7A 5TQ0A 3RVQA 1MB3A 4MLCA 5TQ0B 1EWKA 3CNBA 3A0UA 4KPYA 4RKRA 3FMVA 4RY0A 5BQ3A 3C3MA 3LOPA 4KREA 3OLZA 4N47A 3JPYA 2MSKA 1MB0A 2J48A 5T3YA 1PHRA 3CHYA 3D8UA 3VNBA 5BRAA 4PYRA 2GWRA 4P98A 3E3MA 4JASB 2LP4Y 2PUEA 2JK1A 1CEYA 2N9UA 1P2FA 1BA2A 1NXVA 4L85A 3NHMA 4QYMA 1D4ZA 2H0AA 1EWVA 3A0RB 2FXIA 4WZZA 3OO1A 5ABPA 3LUCA 2WWVD 3T6KA 4IGAA 3JPWA 4LDAA 4XFKA 4N0PA 1VKRA 3QEMB 4H3KB 3QLUC 4F11A 2QW1A 4S04A 2LUOA 2LIVA 1F4VA 2FQWA 5JNSA 2FQXA 3QEKA 1K68A 1L5ZA 3KLNA 1U04A 2R25B 3F6CA 4MR8B 3T8YA 3KG2A 4XAQA 3LFTA 1LBIA 3JS5A 4L4UA 4G0YA 4OG2A 1LK0A 3HEBA 4OATA 5HQJA 3LKVA 3UK0A 5HKOA 3KTOA 4LZLA 3O2SB 2JVIA 4N0QA 3FDFA 4G0XA 2VUHB 3GYBA 5JS2A 2PUGA 1ZVVA 1UDRA 2QVGA 4W5RA 1QP7A 3OQNA 3Q9SA 3QELB 3H1FA 3HV2A 2RJNA 3OM1A 2WB4A 4IRXA 4PE5B 1VRVA 4YV7A 1BDIA 1GUBA 2OQRA 3IP6A 4Z9BA 4F06A 1SXIA 2HQRA 1DG9A 1DRJA 4IILA 4O1HA 4IMIB 5C5EA 4O1IA 4CBVA 1NTRA 2P9HA 3IP9A 4MS3A 4RSMA 2HQBA 3HS3A 3SG0A 1AB5A 5IEJA 1JFSA 3EODA 1YK1A 3KYJB 5IULC 4JA2A 1EAYA 3JY6A 5F64A 3EQ2A 3KS9A 3QLVC 1E6MA 1QQBA 1D1PA 1DBPA 4YS6A 3QLTA 3OLXA 3R0JA 3H1GA 2QZJA 4MYRA 3M9XA 4XASA 5DLEA 4ZYLA 1ZITA 3M9WA 5IC5A 3HVRA 4KVFA 3KLOA 3SM9A 1SD5A 3K9CA 3SY8A 3DGFC 3QX8A 2B1JA 2FKAA 2MYPA 3OO0A 3N6VA 1OXBB 1JDNA 1BDHA 2L2QA 1FFSA 1DCKA 4E7PA 5GQSA 3UUGA 2E4WA 1F51E 2FEKA 4UHJA 3DGEC 3TMYA 3IP7A 3LKBA 2L17A 1P6QA 2IPNA 2A9OA 1KMIY 1ZN2A 3MQ4A 5EWMB 4YP9A 1QNLA 3A10A 2WMYA 4RXUA 3EDCA 2CHEA 4S05A 1FFWA 4P1ZA 2RGYA 1Z12A 3HUUA 4QYWA 2FEWB 3I09A 1LJUA 1RPJA 4RY8A 1DC7A 2JVKA 3NNNA 3MA0A 2JB9A 2TMYA 2PLNA 3HCWA 3RVOA 4MR7B 3CZ5A 3OQMA 3BILA 3SAJA 4Z4EA 3LTEA 4RU1A 4Y9TA 1URPA 1RZRD 5IX8A 2PE5A 4Z4GA 1W9HA 1RNLA 3RVMA 4MQFA 4KFCA 4MS4B 1A0OA 4HNRA 4IMJB 1VPWA 4MQFB 3GL9A 2CWDA 4MQEA 1QQAA 5KC8A 3LUHA 3ROTA 4OLAA 4EYQA 4MQEB 2H3HA 4EYKA 4JP1A 8ABPA 4HYEA 3OMWA 2YHBA 5JNRA 3T95A 4G0ZA 2I6FA 2M98A 4NQRA 3EQZA 3NNSA 4MRMB 4HNSA 2BGGA 2E4UA 4EUKA 3IPAA 3HK2A 3O2JA 2FEPA 3I45A 1QP4A 1B00A 4ZMRA 1M5TA 3HDVA 3G85A 3F73A 3CRNA 2F8TA 2FN8A 5KWSA 3HDGA 4ML3A 4KZKA 2FLWA 3TX6A 5B3JC 4OTZA 5KQMA 1M5UA 1D5WA 4NCBA 3JTEA 4MR9A 4DQDA 3TB6A 1ZHHA 3NBMA 3LUGA 2L19A 2RJOA 3O74A 4MR9B 3QEMA 3GV0A 1HEYA 1NXWA 5DCLA 1P6UA 4G86A 4W5QA 3H5IA 1USGA 4NCAA 4G0MA 1ISRA 3G1WA 3Q7SA 4MR8A 4NICA 4B09A 4W5NA 5I4CA 3RVPA 3LUKA 3I5AA 4Q7EA 4DADA 5ED4A 2MSLA 3LUDA 5CHYA 4KNYA 1PNTA 1D1QA 4GNRA 7ABPA 4NV3A 1ZGGA 3H5VA 4TN5A 2AYXA 5JNVA 3KKEA 2WY2D 3EULA 1MAVA 4F3TA 1Z17A 3C3KA 4MPTA 4JOQA 3C6QA 4YWHA 3QELA 1Z25A 2QR3A 4RXMA 2QXYA 3CS3A 2M1ZA 3DLBA 4MAAA 1JF8A 1GUDA 1C4WA 1Z2EA 3RVNA 3LUJA 2IPAB 1QO0D 3TD9A 5TPZD 2VK2A 3L49A 2L18A 3H75A 1XWWA 2NUBA 4PZ0A 5EWJB 3T38A 1JYEA 5PNTA 4PICA 5JS1A 4YO7A 4YCSA 4N41A 3OM0A 4XXHA 1PNRA 5TQ2A 2PL9A 1JYFA 1USIA 3ILHA 4KV7A 3CU5A 1Z16A 5TQ2B 3RQIA 1YS7A 2FMIA 1YMVA 3IPCA 2E4XA 2FQYA 2GKGA 3EGCA 4D74A 4DN6A 2R4QA 3VNAA 1CHNA 3HSYA 2WJAA 3GRCA 2PUBA 3QLUA 1FSPA 3O1IC 1LJLA 3RVKA 3UKJA 1PEAA 3EAFA 1A04A 2HQOA 1BAPA 5CNIA 1JBEA 4RS3A 2R47A 5BR1A 2ID9A 4F12A 4YRZA 1GCAA 5EWMA 2NZVG 4Z4IA 4WWHA 4RK5A 3GBVA 4RKQA 3HO1A 4H60A 3SNKA 2IPLA 4LRQA 4LDZA 4D6YA 3H5WA 2Q5CA 4TLLB 4QPJC 1JX6A 2ZAYA 5E3JA 3CLKA 1ABFA 4MR7A 1XHFA 3DZDA 4QICA 4XLTA 1A2OA 2FTKE 2JBAB 4KQCA 2JRLA 2O20A 1EHCA 5HSGA 4LX8A 4MS4A 5FBKA 4EVRA 1SXHA 1KGSA 3CZCA 1CYEA 3BBLA 3N53A 3CTPA 3O1JC 4JB2A 3QLVA 2QVCA 4WUTA 2B4AA 9ABPA 3GT7A 4WXMA 5FWXA 2FVYA 2VUIB 3GWGA 3K4HA 5FWXB 4WXEA 2RDMA 1DBQA 1QMPA 2E4ZA 5TQJA 5BRJA 3CG4A 4KRFA 3OLWA 2YHAA 3ROFA 1DRKA 4FE7A 4Z0NA 4MRMA 5D2CA 2AYZA 1D2AA 5CNKA 1USKA 2X7XA 1GCGA 3NHZA 1M2FA 3C3WA 3N0XA 2GBPA 1LBHA 3Q7RA 1U2QA 4EYGA 1SXGA 3OQOA 2QU7A 1BVHA 3N75A 3HZHA 6ABPA 2R48A 3BRSA 3O21A 4N76A 5DKFA 5KQPA 2IPMA 1JFTA 2VYCA 2LBPA 3N0RA 1NXPA 4HNQA 4RK0A 3MMNA 2DRIA 3LUAA 2FN9A 3RVLA 2PUDA 1SRRA 3KJXA 1MIHA 1YS6A 3FFTA 1AB6A 1MVOA 2PUFA 2FMFA 3RH0A 2FSPA 2GI4A 3H5LA 3MYYA 1YMUA 4FE4A 3ILYA 2P4UA 2A9RA 1W25A 3O75A 3GBPA 3OLVA 4YLEA 3JVDA 3EJWA 1EWTA 2CHFA 3H5TA 5C5CA 1DJMA 3RVJA 6CHYA 5T7BA 1TM2A 2QV0A 3CG0A 3IDOA 2NZUG 2HSGA 3URMA 1ZESA 1JHZA 4GPAA 1YK0A 1GLGA 3A3KA 1I3CA 1DBWA 1TMYA 3GA5A 4OLBA 1S8NA 5DGCA 1PEYA 3HM9A 2WJWA 1FFGA 3O2QB 5GOTA 3LUFA 3DLHA 4RWEA 2OENG 5TPWA 4Z4CA 1JWLA 2IOYA 1ZY2A 3KCNA 3NNDA 4WT7A 5FBHA 5TPWB 1JLKA 2NT3A 5IUKC 3S99A 1TJYA 2PMCA 5KC9A 1ABEA 5HM6A 2HPHA 3M6MD 4Q6BA 1YIOA 3CKMA 4D6XA 3Q15C 2WRZA 2PUAA 1Z18A 4Z4HA 2PUCA 5EWJA 2ID7A 5TE9A 3SQNA 5JNUA 1E6KA 1RXIA 3O1HB 4OBBA 5B3JA 3I42A 4UHKA 3FGZA 4ZJPA 4LE1A 2JCGA 2XDYA 4YGXB 1OXKB 1Z2DA 3RVRA 3KSMA 1APBA 2FMHA 1PUXA 1ZGZA 1M2EA 1RXEA 1R8JA 1WETA
chains in the Genus database with same CATH superfamily
3GLVA 1P33A 4PC1A 1QYWA 1E1QD 2OFXA 4ONEA 1A9ZA 5J1TB 5BSMA 3DONA 5K3FA 2JEYA 3K8OE 2RGRA 1FMJA 1RM5A 2PJRA 3O93A 3D8BA 1W2GA 1XRSB 3U49A 4GI5A 2XTZA 4H1TA 5CITA 2QRMA 1FFHA 1QZ3A 2PT5A 2UZ0A 1E3TA 3SS8A 1Y81A 4BLVA 4IJKA 5LZ2A 5F2OA 3B8HA 1EFUA 5C1BA 2H2GA 1U80A 2H4WA 1TC1A 3LBFA 3AFIA 4OAPA 3B5IA 4JKOA 2F00A 3V9PA 3Q3EA 2DUUA 5I9MA 4H16A 2CVPA 4RL4A 4BFCA 4I55F 2FLKA 4KOEC 4J29A 1YL6A 2GCOA 3R7LA 4A26A 1N2CE 5CLJA 1J56A 1KAGA 5HFJA 4B8ZA 2XIQA 3JD3A 4IIJB 1E5TA 2GJ9A 1T5LA 4HXGA 4BJ1A 4EW6A 5KOJA 1CQIA 4ARSA 5HF6A 3ENVA 3PLAE 1ULSA 5D1NA 5HJ5A 1QJCA 1RQNA 2BEWB 1JEAA 4PRKA 2GBCA 1I2MA 1Z75A 4NU8X 4FT4A 2WTBA 5CNJA 1NUUA 2PRSA 5A5VA 5FWYB 1EUZA 2JBAA 2JLBA 3DMTA 1R5JA 2AH5A 4MB2A 5TMBA 2B2CA 2EG5A 2E0IA 4B5LA 1Z15A 4Y6GB 4B47A 4P81A 3TQRA 4B84A 5CDGA 1KH1A 5DK6A 2OO3A 3QE2A 3UG6A 2OQIA 3VM6A 2PZLA 1M2OA 1Z3CA 2GEFA 2OBFA 3OT1A 4H1UA 1IXYA 2C2KA 1M1ZA 1C2TA 3EN0A 4M1TA 5JVDB 5CB4F 1BOFA 3F6EX 3RC7A 1GGEA 2P78A 2C8LA 2II6A 4FNOA 1ECBA 1U3TA 4IIHA 1P1RA 4Y2RA 3F6PA 4FFDA 5MDHA 4E07A 5CNMA 2IZ0A 5DYYA 1R9JA 1U7WA 1D2MA 2OKGA 3TPZA 5JNLA 4Y18A 3IJRA 4G89A 4HGZA 4CLXA 2GRJA 3KTAB 4B1FA 2P9FA 4KMRA 2RK4A 1ULUA 4NDNE 4BV8A 1NVKA 2IYLD 2F1OA 4ND2A 4ZZ1A 5IZCA 5JCOC 3B9BA 4HOYA 2J7PA 3PFFA 3NR2A 1EG2A 2WE8A 1KDTA 3CXUA 3FYTA 3KNZA 4FCCA 3ZBUA 5JNWA 2AMFA 3KJHA 1NLYA 3BWBA 3RUAA 2PGNA 2VKTA 1ZUHA 1AX9A 1T6XA 4MEAA 3NEJA 4XYLA 2HA6A 3ANSA 3BGDA 5D87A 4TKVA 5DHQA 2NXNA 5A4JA 4ESVA 4KV9A 1I3MA 2C7GA 1GZ3A 1TCUA 1NXTA 2AN3A 1RHUA 1JJ7A 1TPZA 2XQKA 3ANNA 3CJRA 4K0KB 3F4LA 2GCGA 2BFNA 4QHTA 4INJA 2QNBA 2AMJA 2C2BA 4UXIA 1XHEA 4KQKA 3LRTA 1V1MB 3W3AD 3FCEA 1P5JA 3MTJA 5IT0A 2IS1A 1R6DA 3C7KA 3N74A 2UVDA 4DLPA 5LP6B 4KFRA 3QVVA 1TK2A 2QU8A 4OXNA 4DA9A 1JI3A 2P9TA 4MLCA 3IUQA 1TE2A 4X6LA 1XAGA 3OQ1A 4N8EA 5JH7A 3AB8A 3HCOA 2HCTA 4NBWA 2PGXA 3A1FA 4MWDA 3U44B 3EVZA 3H2GA 1NMQA 1IAVA 2X2EA 1IM5A 1Z0DA 4GDFA 2EHJA 2D5AA 2F90A 3LDUA 4JSYA 4IICA 4RQBA 4M22A 1R6AA 4O0LA 4HQRA 3ZV5A 1DUIA 1DARA 5JADA 4G2TA 4P9NA 4YRAA 3DE5X 4RFSB 4N0PA 1MHTA 2HA0A 3ICOA 1DTEA 2EYQA 5KNDH 5DYGA 3T1VA 3VHXB 1U8XX 1VG0B 4H27A 4MROA 4I8DA 1X9IA 3BH7A 4CW7A 2VA9A 3JPWA 4LDAA 2NUAB 1YBFA 1T8YA 4AJIA 1C4XA 1D09A 1FDSA 1Z47A 1N8KA 2ZYRA 4L4SA 3JZFA 2AFVA 4JLSA 4GM4A 3WBKA 1LQUA 5C32A 1HGXA 1TJ4A 2VHZA 3QA3E 3QVUA 3KB1A 4MR8B 3E8XA 3WMRA 2R60A 1G3IA 4GR4A 3ZIUA 5JYDA 1CVRA 1Q7EA 4JN6B 1Y3AA 2X42A 1QRDA 4A0SA 2XVAA 3STYA 2JANA 2JI9A 3NTLA 3TRDA 2QG6A 3UHAA 2VDWB 4PYIA 3G5AA 2VJKA 2I7CA 2GK6A 5FWNA 2R3SA 1QE3A 4ZAGA 3U9SA 3OEEA 2XCOA 3NIBA 5BNZA 5AKIA 1D4OA 4J16A 5J58A 1ZNQO 4Q4HB 1WY5A 3KR9A 1A2KC 2B8TA 1N5JA 2B5WA 1N1DA 1LSUA 3P97A 2IQ5A 5DCYA 4AO8A 4AROA 4U0JA 3A32A 3EC1A 4RO0A 1JMKC 4YGYA 2NPFA 2IV3A 4PINA 4CQMA 1H1DA 3LLCA 4YMHA 2I6XA 2VK8A 3C6ZA 4MCAA 1W5EA 5CW1A 1P0CA 3REQB 3ROKA 1DX9A 3PG5A 4MS3A 2GF9A 4GP7A 1MIOA 4FIZA 4LWOA 1T4DA 1E7YA 3IKTA 3ZH2A 1XOIA 3Q3CA 3C16C 4OUDA 1KFKB 1WP9A 4O4LB 4KU4A 4NV1A 3WRYC 1UBSB 1AGPA 2NSJA 2ZJBA 1C9DB 3N2NA 4H3VA 4W6ZA 3RVBA 5DX1A 3MTIA 4I99A 4C4AA 3RAPR 1TECE 4ALIA 4DJJA 1EK1A 1GYPA 3M9WA 3UAXA 1HYHA 4ZT3A 1LK5A 3SXUA 1D1SA 1HURA 3QE0A 2ZUTA 1GYQA 1KO4A 1IXSB 1B0PA 1MQAA 2I87A 3JR7A 3MPOA 4M9CA 5E7JA 4EB6A 2FHSA 3E3OA 4LVCA 5KWSA 3B1WA 2XYQA 3LHKA 5JSZA 2CDRA 1TJ5A 4A15A 1KKMA 2V65A 1ADBA 2QRQA 4FC6A 4GL2A 1R3DA 3MRXA 4KFTA 4IV0A 3VKHA 1LDGA 3NALA 3USCS 1GFZA 1I80A 3LY7A 4INOA 4IDCA 4IV5A 1IPHA 1F48A 3NBKA 1KERA 3UK1A 4REOA 5HCNA 4BO9A 2FG6C 1L8AA 1N1EA 1ZN2A 1CQXA 3PR3A 4EFLA 2ZJ8A 5FUVA 3WGQA 4KDFA 1T8PA 5HMLA 4BX9A 4YCNA 3WC4A 3OUUA 3JD4A 3QKUA 1XFDA 1YR7A 2BRUC 3OTWA 2B94A 3B6MA 2XB4A 3H2SA 3OE7A 2ECKA 3M4ZA 1SKBA 1Z7GA 4YCBA 2XQJA 3K20A 4LXXA 4KHZA 5EMMA 2EKDA 4BO1A 4AKGA 5FWAA 1G2PA 1TYZA 3DP7A 4JVSB 1KZYC 4MCHA 1QFYA 3ZU2A 4GQIA 1QV6A 2HD4A 3I12A 3DBLA 3SEFA 1RNLA 4G9BA 4MWSA 3RS8A 3RTCA 2PYDA 3G5UA 2OD7A 3HACA 3C14C 2PTHA 4OK3A 3DYVA 4F56A 2EFDB 1T6NA 3IR5A 4LC9A 1DIGA 4Q03A 3HDQA 5F2NA 3DJFA 1IC6A 1NX9A 1OGIA 1UOEA 4HG2A 1GP2A 1IZ7A 4IKPA 3D7NA 2QY6A 1OFIA 3DYBA 4G1MB 4E46A 1B15A 4AQDA 3A9SA 2NVUB 2CT8A 3EF0A 3MINA 5CPFA 3L7YA 1TOAA 3BB4A 5JNRA 1EKXA 3SHVA 2QQ5A 1VMAA 4G0ZA 3TEJA 1Y6ZA 2I6FA 5BPFA 5FX2A 4FGLA 4MRMB 3WK5A 4D7AA 3VDQA 3A1EA 3UW1A 1WJGA 3HCNA 2C2YA 3JQRA 4JI6B 4IQ0A 3T7RA 4PC6A 4CLOA 4WD3A 1Y1KE 3PQEA 2IF2A 3CO0S 4X41A 2C92A 2ZPAA 3PRHA 4MQUA 3FFBA 5ICCA 4HEJA 4WCVA 1Y4DE 5ALYA 1QG0A 1ULTA 4HZUB 1MT0A 3DOHA 2ZB3A 3S55A 2FK7A 3ZN2A 1QS0A 4IWNA 4X84A 1D5WA 1JQKA 2AN5A 2PLAA 5ALXA 2WSLA 4ZTUB 2G88A 3GG2A 3FPCA 2WFLB 5KYXB 1J7JA 3HYSA 2PFGA 2RJOA 3FSGD 2ALJA 2ZZKA 3ZQ6A 1KEPA 3AVWA 1MU0A 2FAXA 2IGBA 3UAYA 4ZI3A 1IQUA 1JVNA 1LW7A 2ZJ6A 1NVWQ 1XRLA 3C85A 1F5NA 2I2AA 4V1CA 4N40A 2W4IA 2XD9A 1X7GA 3GAZA 2QRJA 4JJ7A 3RSGA 4DEVA 5BY2A 2C2HA 4MUKA 5K8CA 3GLGA 3RVPA 2YV5A 3TSZA 4BP9A 1TMKA 4QOIA 3IYLW 4C2UA 4L3VA 3GJZA 7ABPA 2H57A 2IA5A 4PX2A 1TZKA 2X0RA 1MJGA 4B7ZA 1W9MA 2RI6A 3CCCA 3LT0A 3BRCA 1U0TA 4IVNA 2WY2D 3NHJA 2CDAA 1VG1A 3SBOA 3ZV7A 2R65A 4NENB 2AFIA 1ADYA 3OURA 2GEBA 1FTWA 1BX0A 3EPRA 4KACA 2WFMA 2XPCA 3QW2A 5L8VA 5DHRA 2Y66A 5LDHA 1COZA 3DZGA 2Z2KA 1OSNA 1SVLA 4C0BA 3TD9A 3PNPA 4Z8XA 1GSHA 2DFLA 3ZD7A 3T9FA 2HV9A 3FHTA 3G0GA 5ERYA 1S02A 1VI5A 4ME6A 4PG4A 5EWJB 1H93A 2HO5A 2A59A 2YV4A 1S2GA 1BD4A 2VRCA 2Z5FA 3B52X 5E8RA 1EX9A 1M1YB 4HMQA 4D8WA 4E5NA 3RRJA 4DFDA 1PQYA 2EZ4A 4N41A 1TT7A 3UPDA 1RWPA 4RVFA 1RHRA 3BCSA 2PX6A 2PV0A 4U9IS 1FDWA 1DBSA 1ZOIA 1QH1B 2I91A 1YDFA 3H11A 1RWVA 4FNAA 1U2GA 2O1SA 1DV1A 4Q9JA 1ZC4A 3EGCA 1H2HA 2FQYA 3K2QA 1E6WA 1I24A 2BWJA 2V6GA 3B1FA 4KJXA 1CHNA 3HSYA 4IVRA 2XVMA 2QIPA 2ROQA 3FPFA 2XNJA 4LMAA 4WOBA 2BGWA 4AUNA 1W8IA 1E1YA 2GDJA 2P9QA 3AR5A 4Q5IA 4ECAA 5B36A 2CLKB 2SNIE 4TWJA 3U3OA 3C6KA 1EBFA 2ZB7A 3ZD9A 4V0QA 5T8KC 3Q88A 2Z43A 3K71B 2Z98A 4IXMA 3WWEA 3A7DA 5EIBD 4ED9A 3L92A 5FTNA 2ZAGA 3G0DA 4IFTA 4KIGA 3BJMA 2OR3A 3EIUA 3LPAA 4ZOBA 4FBGA 5F1YA 4C2AA 2XZTA 2HR1A 3IXLA 2CNWA 3DTVA 3BOSA 3SNKA 1DRUA 2H08A 2GSDA 1LRLA 1IVYA 2ENWA 2XE7A 5JHHB 3H9QA 3CRVA 3WR5A 1HNZB 5KVQA 4C7JA 3OKCA 4DCNA 3ELUA 4MIOA 3CUTA 3EVEA 3EVNA 1BS1A 1D3AA 3LSTA 1CV2A 3FTQA 3IQDB 4XSHA 1WDWB 1Z8NA 3IX7A 2F43B 3A36A 1QHXA 3RK0A 2ONKA 3EBOA 4ODIA 3DV0B 3JATA 2R44A 3AKCA 2IELA 3ELYA 4IHKA 2VJOA 1DI0A 3UC9A 4KQHA 5CA1A 1XZDA 1SXHA 1ODSA 3PNQA 2HRDA 1CKEA 4J0FA 1SCDA 1WAMA 4BLSA 3KVRA 1VM6A 4EK9A 2C2XA 3FDZB 1WHTA 2XBMA 1YJXA 5FWXA 5LUAA 4DSAA 1YOBA 3IR6A 3DV2A 3OQPA 4HKTA 4BWYA 3M9LA 4DTCA 2YHAA 4CEIB 3ZCRA 3W2EA 1OXUA 1CCWA 2J3MA 2R1UA 1TMOA 2XOXA 3OUZA 1KY3A 1K3TA 4LISA 4R84A 1M2VA 3UWOA 2YJGA 2AWNA 3LLMA 3OOJA 4BB0A 1AXGA 5ALOA 3G9TA 5CDFA 1C41A 1DWOA 3Q10A 4QD3A 3UFBA 5JQWA 2N1BA 1JHRA 2DVMA 5KVCA 4FC7A 4ZT4A 1C5KA 5A3RA 3WL5A 4JS0A 3ZWAA 3P7MA 4KR6A 1W4RA 3CRQA 2WIFA 3CZQA 4B6JA 4ZGBA 5IM4F 3U09A 3UJAA 3VO8A 2WU0A 2YIMA 4TLAA 4YAJA 2JGDA 2AT1A 1M0SA 2C96A 2ZKIA 3FF1A 1CR1A 3QVXA 2CEAA 5E95A 1CNFA 5U1PA 4R7ZA 1NA5A 2O3JA 1G66A 2XA2A 2TECE 3F46A 4XYEA 1SURA 3ONVA 4FDVA 3FOBA 4NU6A 4Z8YA 3H6KA 2NU9B 4BGUA 1IM8A 1V4BA 2EZTA 5ALZA 4Z0HO 3FPHA 5EIXA 1ML4A 3KC2A 2JLAA 1J90A 3JVEA 1PFVA 3CG0A 1E3EA 2B99A 2Y27A 4MULA 2AOVA 2NZUG 5CVTA 3E9MA 1WKCA 2A88A 4M1MA 5BUZA 1BWPA 1KHHA 4QELA 1JSCA 1IOVA 1P31A 1J42A 3N2GB 4BNHA 1ZIOA 4PQEA 1M1YE 1NVUQ 3HPRA 1S9DA 3I6IA 4X45A 2JGMA 1WBJB 5CGZA 2QXTA 1N7IA 1XQ1A 2X0EA 3HNPA 1F06A 2IUFA 1NVVQ 4OJKA 4DRXB 4JXXA 5EA2A 1NSFA 3EDRA 4KAXA 4PANA 2L0XA 2GCIA 3PPVA 4J6FA 4W5WA 5JASA 1Z2NX 4MW4A 1YS2X 4HS4A 1N6OA 1DIHA 3FTNA 1U9JA 3Q15C 4Z4HA 1JHXA 1SO8A 3IDFA 5FBZA 4DJEC 4OM7A 5AJTA 4D57A 5KDDA 3SQNA 4XJXA 4C22A 4RCZA 1FNMA 5B2FA 2R1TA 4CU5A 5BVHB 1HL7A 2OP1A 3P9KA 2JCGA 4LBWA 4C6RA 1X87A 1XP5A 2W6PA 3FCCA 3M4JA 3M4NA 3QF4B 4IVPA 4R2MA 1AF4A 2ZULA 1MB2A 4TS1A 2QDXA 4GH5A 4TSFD 4M0FA 1RXEA 1LLFA 1QYCA 3L6DA 3O3NB 4Q7KA 3WKCA 3ZKWB 1UBTS 4FUTA 5FFNA 4EM6A 3L7BA 4G6ZA 2JW5A 1OUMA 1IIBA 4P22A 4FSDA 1JH9A 2YX1A 2WEKA 3H4TA 1JFRA 3RTAA 2VSNA 3FDIA 1U5BA 4UJ3A 2CLEB 3COPA 5I7AA 2HMTA 2HLDA 4R3UC 3RODA 3R3UA 4HDKA 1RI2A 3W2FA 4ALMA 2G9UA 4F84A 4UM9B 4P5EA 3RRMA 1QQ7A 1TKCA 2NZYA 4DCMA 1RC8A 2IZZA 1AZWA 2BGMA 2QRGA 1ZH2A 3B85A 5JPIA 1SVKA 5K8VA 5EVJA 1JYSA 3UBTA 4PV7A 2WPDD 1L4FA 1RYHA 2XRYA 1JA1A 1ZMTA 2HN9A 2PVSA 4WERA 5COQA 2W58A 2ZWPA 4CTOA 2W6MA 2REBA 4A0HA 1FS6A 5CM8B 5BSHA 1R9GA 3LDGA 2WVGA 3CUUA 4NBSA 4WNAA 5CIWA 3T7AA 1UC4B 4P08A 4BNMA 4EGAA 4B3IA 1NBMD 3GEHA 1O8CA 3IE2A 1FDVA 1SEVA 3VR3D 2E85A 1KH3A 3B2NA 4TT3A 4RK6A 3LU1A 3N8KA 4U63A 5CT6A 1V3UA 5GONF 1MABA 3V6LA 4HNUA 1N2JA 4MJXA 4P0TA 4QHSA 4EFKA 1HO3A 1DV2A 2MOKA 4RK7A 4C3ZA 2YWDA 2IYXA 4Q24A 4QFCA 4W5TA 2QL7A 4O4IA 3LNTA 3WGUA 1P7ZA 2QOEA 2AK2A 2GLUA 4LW8A 1F1BA 4M21A 3L6UA 5H5JA 5LP6C 2G71A 1G5TA 3MQ2A 4KRYA 4D4MA 4GKAA 4DCUA 4FPXA 4F2GA 5KWEA 1LW6E 2NVBA 5KNCA 4TZ6A 1H2WA 2FW1A 5BWOA 5ES4B 1AUOA 3Q9UA 2BR5A 3IPRA 2YCBA 4ID3A 3IULA 4QOEA 3ZDBA 3KJFA 2XCLA 4JR0A 1CQJA 3K96A 4WJKB 2X1MA 4OU5A 2YY5A 5CFNA 2X77A 2BH9A 3R6LA 4G5HA 3OZBA 4FEEA 4YN3A 1OLOA 1GAQA 1VJ5A 2AD1A 3PQ6A 1SHUX 4PEVA 4XPIA 2HYDA 2O2JA 1ZD3A 3QPWA 4BO4A 5LBIA 2CJPA 4WSOA 3M1YA 4N0DA 3D8TA 2IEDA 5GM1A 4I4TF 3KYDA 1P7YA 1ODCA 2V3CC 1ZNWA 2WKSA 3QU4A 1KPGA 4KPFC 3PQFA 2O23A 2OXCA 4QRHA 2YFKA 5C37A 1T9GR 2V1UA 3OAAD 1BJKA 3K4QA 5KOHA 2BKAA 2Z2JA 3IB6A 1Z22A 3L06A 4HWPA 4J3JA 4M88A 3VHRA 2J3QA 3OMLA 2G1KA 4RTJA 3O4RA 3JV7A 2BVNA 4U3JA 2W2PA 4IHAA 1PJQA 1TCBA 3MD0A 1ESDA 5A62A 3G59A 4UOQA 3AEZA 4Y9UA 4ZAWA 3RBZA 2EGHA 5KUTA 3PDHA 2ZJ2A 1PK8A 5EKDA 1M2NA 4B3JA 1WCYA 4LRXA 3L05A 5D5QA 2R11A 2OE2A 4BMDA 5DYNA 4KWHA 4XVRA 2FP4B 2YS7A 3C48A 1ZOSA 4CKEA 2FDCA 4L4ZA 5JRDS 2Z4RA 2GSWA 4WA7A 3HLYA 4RY0A 1GAJA 1QZXA 2W6JD 4RAQA 3M34A 4UHDA 4KREA 3VPBA 1WXHA 1SRQA 4A8JB 3GNTA 1L5RA 1NNI1 2J48A 1KAEA 4K7JA 4PYRA 3Q87B 5HZHA 1VP9A 3OE4A 1I9CA 2ESRA 1AGXA 2CWWA 4FDAA 4HDSB 1X14A 4LN1A 4ZWNA 5CAEA 3B51X 4Z0PA 1P73A 4Y6SA 4ERXA 2P0EA 2H0AA 1V41E 3D7MA 3OZEA 2F62A 1IIRA 4IHJF 4E5KA 5ABPA 2XKAA 4F71A 3PHBE 4AKIA 2CYCA 3AJDA 3H8SA 2VATA 3NBUA 3V4VB 1ISHA 1CTQA 3QEMB 3MS7A 3QXSA 3IMFA 4UE2A 1L7MA 3TCNA 1QTQA 2QRUA 2BF4A 1XZCA 4C6HA 3C5CA 3ORQA 1MV5A 3KLNA 1L5MA 3F6CA 4LAFA 5EJMA 2Q62A 4XAQA 4X97A 3S5UA 4CEJB 5ALUA 1LBIA 5EKUA 3W4IA 5ICEA 4BRWA 2TRSB 4CTKA 2JLQA 1XTTA 3HV0A 2JGJA 4A8TA 4EF5A 1XPRA 4DM3A 1AGRA 4RQTA 3FBTA 3ML1A 2VC2B 5BSWA 4DLLA 1WQ3A 1JQ3A 2ZB8A 4BNUA 4F60A 3GYBA 3MB5A 3PPXA 3PTAA 5TEWA 1IHUA 2PUTA 3EGDB 2ZWIA 3FNHA 4ZOLA 4C6SA 5C8VA 5EXTA 2JFQA 1WUHS 2PXXA 3CPHA 5TF0A 1MP0A 1EFPA 3HKBB 4BNJA 1ZIYA 3VPHA 5AXCA 1BDIA 3B6EA 2DFNA 4YT8A 2C2ZA 3AEUB 4NS1A 2IYEA 3GC6A 4EI7A 1XEXA 4AQ7A 2CL5A 1UEXC 2IDJA 3S2FA 5BWLA 2AXQA 4RS4A 1PUIA 1F7UA 2SKEA 2PA0A 2IX3A 4LFAB 3UB4A 2I03A 3IAS6 5IULC 3SS7X 3TTWA 1RVDA 2PBRA 2XBLA 4JLKA 4EABA 2QGZA 1Z33A 5TMEA 4G1EB 3JQGA 1D1PA 3BD7A 4RADA 1L5LA 1E2PA 4YT2A 3OZGA 2BFDA 1Z35A 3TK1A 1INLA 3QOWA 4MYRA 2GZ1A 3IUEA 3PLRA 1P5ZB 2JD2A 3CB4A 4YB8A 2OO5C 3E4CA 4GOOD 2XDQA 3K6SB 2HDOA 3KE8A 4A23A 1F8YA 1P62B 2HU7A 2Q5IA 3SCZA 2MYPA 1DFIA 1HE5A 1OKKA 2RARA 2DPMA 3BFXA 3HUDA 5DIFA 3I1FA 5LYJA 5KKAA 2OPHA 3RLIA 2PZEA 2ON6A 3VDRA 4P54A 5AM5A 1W85A 2F3TA 2GB4A 3GLHB 4MHSA 3C74A 2Q8NA 4PG7A 821PA 3GNSA 1QVWA 4LK3A 5C3UA 3RYFB 3QSYA 4PTYA 3C5EA 4FQ5A 4FSXA 5J59A 5FOWA 1UFQA 2XAAA 4M6WA 2IPNA 2P5SA 5BR8B 4DM4A 1M6YA 1BOOA 5EWMB 1HFJA 2R8OA 3NIWA 4CG3A 4YA6A 3HN6A 4KMMA 3LZ6A 4P1ZA 1SBQA 5FTWA 1T9KA 3OE5A 2VWQA 3HLTA 3BB1A 3L18A 2ZUBA 3I09A 4NE7A 4QUHA 5I7WA 5U9CA 2JI4A 2ZU6A 4MUMA 4A0GA 1DOHA 2JVKA 2OXEA 1LQ2A 3KFVA 1UPBA 1C80A 1VMEA 2IE0A 1NYTA 4B79A 5C4IA 1RYZA 1ARZA 4OL9A 3U4DA 3PGMA 4RFVA 5F1OA 1KEWA 1GNVA 2GLXA 3EQ7A 3P2KA 5JDIA 3LTEA 1NPDA 2G9RA 4RU1A 4ZOCA 1GUAA 1N78A 2PRKA 3LFHA 5IJWA 1NVEA 1UBKS 1R8YA 2FUG1 3R0XA 1QFZA 2ZSBA 3RV3A 4BTLA 4MS4B 3LTNC 2ONZA 3ZTTA 1OA0A 2Q5OA 3HCAA 4DVJA 3WSVA 3NZEA 4ER7A 1D1TA 3VNUA 1PT7A 3LPMA 4ABYA 2J9RA 5KC8A 1CE8A 4BU0A 1SC3A 4PFQA 1JVSA 4C88A 2RHLA 4LTMA 4GYKA 4JP1A 4NL4H 1NLMA 1B16A 2Y3IA 4HYEA 3E9CA 4ZAYA 1U3UA 3BPSA 3GJSA 1CUGA 3UQZA 2VRWA 3ABZA 4G8DA 5KYNA 2J32A 3EIWA 4HLNA 2E4UA 3EC7A 1SCUB 4KR7A 3WO1A 2WU3A 2YNMD 3AK4A 3IPAA 3LT1A 1UJCA 3DEKA 4FX5A 4NAUA 1OF1A 1UDBA 2V6MA 2MR5A 1QLHA 5BMOA 2LCFA 4MXDA 3WNZA 4M0DA 3QPBA 4QKQA 1IBCA 1IXZA 3AX6A 4MTLA 1IAQA 4Q3CA 5IASA 3NQ41 1E1QA 4CXMA 3IXMA 2CMGA 2XLCA 4MWBA 3S4YA 1RHJA 1TYDE 2BRUA 5TMDA 3GFSA 4K6GA 3QIAA 3TYXA 3UMVA 2OCGA 4FHGA 1GUYA 3R9XA 2VYND 1P81A 2ZEJA 3OA0A 1IN1A 3K0HA 3RJTA 4HB0A 4TM8A 3WNDA 4YI3A 3EG9B 4QNRA 3LQ4A 1NVFA 1GGMA 2J0VA 1KQOA 4TYNA 1XZQA 2GNPA 2R0QC 2YL2A 5FOTA 1UBGA 4V24A 3NGLA 5TB5A 4JQCA 3U3KA 1G5FA 2O8VA 3Q7SA 1ABBA 1IBMB 2AC4A 2HGZA 5D5HA 1PZXA 2IZ7A 1QRAA 4KQ1A 2ZAMA 4V0SA 5EG5A 4C4OA 4CLRB 5JHGB 3I5AA 4NU0A 5DMXA 1PTKA 4NZZA 2DB3A 2C1EA 3WDLA 2ZWVA 3AF2A 5TDHA 3OX2A 2J5KA 3TFWA 4DCCA 4ENVA 1E2MA 2DCUA 3N28A 2V3VA 2ZR9A 3OHSX 1LX7A 2H2FA 3DDZX 2VTKA 4I4TB 4QJ5A 3TDNA 4B2PA 1QK5A 2H07A 2ONJA 3WV5A 3THXB 5IBPA 3T7SA 1EXVA 1GQRA 1XZBA 1RWBA 4J2HA 2HSEA 4IIXA 4N3BA 4XR4A 3QELA 4WFIA 1W88B 4YFYA 3H05A 1ZH8A 2OXFA 2JFZA 3A9TA 1RYFA 4YXWD 4MVJM 3E03A 4ZJUA 1WXEA 4BO0A 3TE6A 1BCSB 1Z2EA 2PANA 4I4LA 4NK4A 4O2AA 5E4YA 3OESA 1E7QA 5EHGA 4D02A 3O9ZA 3ZYZA 2L18A 1Z39A 4E13A 1SOWA 2OBXA 4LMRA 2EZUA 2YICA 4MLPA 4YT4A 4NS4A 1UZUA 3RK4A 3UK2A 1OVMA 4XH9B 2AEFA 3FTFA 4YRPA 3KB2A 1ELOA 4IKOA 4G01B 1NOIA 3ZHTA 4BMSA 4EZEA 5CIYA 4BO7A 2XCSB 1VB5A 3NH9A 3QOYA 4C7BA 3IRVA 4I14A 2YJNA 3GJ6A 4E4RA 2ONCA 2F67A 4I8XA 3ILHA 5EERA 2I9KA 1GAXA 1LLDA 2ZDQA 4LKOA 1KMHB 3B3AA 4BECA 3HWWA 4DN6A 1G8PA 2JCVA 1DXYA 1ZH0A 4DLKA 1WO8A 2G4CA 4MK4A 3OP4A 4Q7LA 3SSMA 1EHIA 1HXHA 2WD7A 1HT0A 3LC2O 2JIDA 3QVMA 4DA8A 1FSPA 2SCUB 3EVAA 1GTVA 2PRJA 3GFTA 3NATA 4Q82A 3R8FA 4INAA 1H6DA 1H05A 2VXYA 1SQ0A 5HIAA 4M1YA 3W7VA 3PXBA 1KPIA 3PI6A 4KE6A 4J43A 4IHJB 1KWKA 2AWOA 3RHFA 5AKEA 2K6GA 3FA2A 4D6PA 2N42A 3I6YA 4K8RB 3TI9A 4PZZA 2I6GA 5CVDA 5AK5A 1Y0BA 1ISIA 3B9RA 4LXUA 1N9GB 5CFPA 2I65A 4GFDA 4H60A 1A77A 3W3AA 4LRQA 4WL0A 3ST7A 3QOFA 2EBFX 1T0IA 4C1NA 1LI5A 1PGPA 3Q6NA 5EVCA 3TOZA 4GC5A 4AC9A 4IMRA 5IANA 3O8DA 4QWWA 4DR2B 3K16A 3EASA 1FXUA 4K2HA 2UZ3A 4KWCA 3CB2A 1B0AA 1KZ7B 3GUUA 3VU9A 4CWAA 3PJDA 4XWOA 1WPRA 4EEKA 3I2GA 4XLTA 1XALA 3OI7A 4HL6A 5DFAA 3VVCA 4I1PA 3ZY2A 2FPWA 2HDWA 4G5FA 1N2CA 3G1UA 1Y8QB 1E7SA 1HY3A 2RONA 4EBBA 4WLOA 2CUNA 4OK5A 1XAJA 3UCEA 1FYDA 2DFDA 1TM7E 2BGJA 3R23A 5CDTA 2FWJA 4MGKR 5FBLB 5J2UA 3TM5A 1KYQA 2GPAA 1JZSA 2Y1DA 3FUWA 4GIBA 1PJ2A 4HGRA 4JJ8A 4LDJA 4NDZA 5EGNA 4HVCA 4CFSA 3GZTB 1Z83A 3H4IA 1U0EA 1TA9A 3TLGB 1N33B 3OLWA 5I48A 4MVJG 1E66A 1RKBA 3S27A 2DH5A 2C1XA 1T3GA 1ES9A 2HTEA 1LZKA 1TZJA 3O84A 2RGEA 3NM6B 2ZUUA 2E3JA 3RDPA 4RV4A 5GJVC 4DQ0A 2ZIFA 1C1YA 4CM7A 1R5OA 3D2AA 3KLBA 4P4GA 5ICSA 4BN5A 3NKLA 4AY4A 4B40A 6ABPA 3BIWA 4EYSA 3E6AA 2ZBFA 4EFNA 4JXZA 3K2EA 2LBPA 4K87A 5K9ZA 1SIUA 5A03A 4BNNA 1GSIA 1ZONA 4RLSA 1GPNA 3RG8A 4EY7A 1N34B 2BH2A 5JFGA 5DX0A 5H0IA 1KYTA 3Q6IA 4OSEA 2OYCA 1UF9A 2G25A 2IOHA 5H9WA 3LWZA 2XUDA 1OFUX 2BTQB 3BHIA 3RH0A 1J2RA 5C81A 3CNEA 2J0EA 1VRWA 2Y93A 1P0QA 3V1MA 4B43A 2NLOA 3O26A 1ZGJA 2QE6A 4U7GA 1TCAA 3EJWA 3QU9A 1RBQA 1ZOLA 2OWDA 5M3BA 1J33A 1BRMA 1OWOA 1PD0A 2HKIA 3HA5A 1GCIA 3U4QB 2P3OA 1L7EA 4P3OA 4MKXA 4ZI2A 2X2PA 3AJRA 4ATNA 2CXUA 4ZYWA 1PFGA 5JPDA 1S8NA 3AB7A 1QJ4A 4CMCA 2O4UX 1FSSA 3DDUA 4EJFA 1CIJA 2DTEA 5DI9A 3U5ZB 1F0NA 2R6R1 1T5TA 1JKJB 2J4FA 1O6ZA 3DVAB 4ZI5A 5TV2A 3ZU3A 3TOCA 2VP2A 1JWLA 2GEVA 1I1OA 2ATVA 2I3ZA 3OIWA 1G5PA 2IYOA 1SUSA 1SVSA 2PG3A 2XW6A 4O4JB 4X20B 4FDLA 4CMIB 1Z07A 1NQVA 1XU9A 5IDXA 1WHSB 4J75A 2HEIA 2VHEA 4RV9A 3CKMA 2IIQA 2OMKA 5KCMA 4BLOA 4R1PA 5LZ5A 3WG9A 5TE9A 3W8DA 1I1NA 3WTCA 3LCMA 5T4BA 1P4GA 5KU7A 5EHXA 5B3JA 1VJ0A 4HGOA 4NMHA 1QWSA 4RTQA 1U2DA 3VAAA 3JYOA 3EAQA 4IRUB 4XCVA 3T5PA 3KQKA 4AY6A 3BSWA 5TARA 3VDNB 5AI0A 4DCGA 5G4KA 1NR7A 1ZD2P 1J1IA 4MDEA 3DBOB 3KSRA 1EVIA 1Q7GA 3G9QA 1W36B 1KDPA 3NWJA 1V6AA 1K8RA 4UVDA 3V4ZA 3BICA 3VR5H 4HWOA 3E61A 2GJKA 2Z9DA 3CX7A 1NUQA 4OJMX 4IIYA 1MF7A 2VJMB 3B7WA 1SBYA 2ZTUA 2OECA 1MJ5A 3JQDA 4GG1A 3WRVA 1VCMA 1T2AA 2J0SA 1YQTA 3FFXA 3PYLA 5IDYA 4K6CA 1NW7A 3U9TA 4Q6WA 1A97A 2O7NA 4DMKA 2VCYA 5H1YA 3ZYCA 2CXNA 4RDCA 4QLOA 1IY9A 1QGED 2VAXA 3PFCA 4OHMA 2RGGA 4M1SA 1Y1RA 3BFJA 3WOVA 2IBTA 1RZUA 2MT9A 4Q37A 4EQ6B 1BN6A 3CFYA 4M7RA 4NFSA 4OHWA 3ZDQA 4I1SA 4HDOB 5BOSB 1F8FA 4E1AA 1IEQA 4DR5B 2B8JA 3PQCA 4FJ1A 1BEZA 3ZH9B 2OAQ1 5FWYA 1JPVA 2O8NA 3UJ3X 2RHRA 2LNDA 2JFPA 2MMGA 1XQ6A 2PSHA 3GUVA 4PR3A 4XIJA 4OLFA 3F3KA 3WLOA 2C00A 3DOFA 3SICE 4DIBA 4PIVA 4K9NA 4TLMB 1O77A 1VCIA 3LS2A 3EPKA 2BFAA 4BFTA 4FYJA 4BWVA 1HDRA 4OXIA 1FPMA 1CF9A 1JLRA 5JVDA 1DE0A 2FZVA 2XY4A 3NAZA 1YR1A 2B9EA 1MXHA 1TGVA 1VGQA 3FSGA 4A8JC 2COKA 1QOZA 3ZK9A 1Z13A 1DKQA 2RH4A 5DNYB 5B37A 2NVOA 3KKPA 2O0MA 5T64A 4JYPA 3BSSA 3U3MA 5A2QA 1T36A 5IBQA 2JH9A 2EFGA 3KTAA 4Z9YA 3TZLA 5HGJA 3WAGA 5GIPE 1ZNZA 3P2IA 2NVWA 1XSEA 4L28A 2CDNA 3MWKA 2OCKA 1M67A 5F77A 2IHNA 2C3MA 2FPUA 3O2NA 2XZLA 1T24A 2B7BA 4AD8A 1PWZA 3S8MA 2B7CA 2QR2A 2YIDA 2ANBA 4HAUA 5EFZA 1K4MA 1TQ6A 2PGOA 3ICCA 1AG9A 2XTMA 3FMPB 3MAJA 1XZNA 4GBMA 4G0QA 4PZUA 3V1UA 2IEYA 4M7PA 3ZJ4A 3WIEA 1DPGA 4TGLA 5LXTF 1V25A 3E9EA 3WZMA 3UJBA 3TFOA 4Z99A 5D00A 1MB4A 3L4EA 3M2PA 1QDLB 4B6SA 2HA5A 1LXCA 4FYYA 4C5AA 4CGZA 3L9WA 4PX5A 2ZYSA 5LP6A 3NM5A 1UT6A 4IYRA 2Y1CA 3P94A 2A9QA 2CUTA 2O2HA 3JQ7A 4CF3A 4KO1S 5IWAB 2G5PA 3GMDA 4C6TB 5JTTA 4J9UE 4BX0A 1OTHA 1E9FA 5BQ5A 3RUHA 5ITSA 2AOXA 3D3NA 4L3OA 2ZWOA 1KSGA 3U62A 3W90A 4EGFA 4W8OA 2LCQA 3U16A 2YWHA 3I1IA 2MCFA 1GZUA 3CRZA 4NBLA 5EOVA 1L9KA 1MB0A 1UK6A 2ISQA 2QN2A 3TQTA 1I13A 5KYUB 2BMEA 3D4IA 1LVGA 1OFUA 3VHXA 3E3MA 3LHFA 4RA9B 2YCLA 4MYHA 2N9UA 1XJWA 4L0MA 6REQA 3G0CA 2NUAA 1D0SA 4BMYA 1U3WA 4HDRA 5EYPB 3W05A 3LUCA 3TAHA 2OPBA 2XGGA 4N0EA 1MO5A 1JHUA 3K31A 2EIXA 3F98A 5M04A 2JEZA 2HC9A 4WI1A 5F7OA 4TZ0A 4PQFA 2QW1A 1IB0A 1OBHA 4WXPA 3ZI0A 3U3RA 2FQWA 2W37A 2XVXA 3KPJA 4PAWA 4UAUA 3VYTB 4D3YA 3EBPA 3HO6A 2GNAA 3IHKA 1RC0A 1EXNA 1PZNA 1T29A 5HQJA 4G0YA 2CVOA 3FCXA 1ZVMA 5F4BA 2W6QA 4FOSA 1KP9A 1JZQA 2VT3A 1R15A 1MJHA 3F0TA 3Q4GA 4HAXA 4YRQA 1YACA 2HIAA 4N0QA 2IYWA 4Q4HA 4R16A 2DP4E 2PVPA 4LRYA 2PZAA 2RBEA 4HGNA 3V8MA 1DWPA 1J0AA 1JAIA 1ORRA 1LLCA 3L0IB 3UO8B 1Q15A 4XDGA 3M6IA 3E2PA 5JSFA 4X7BA 5KZMB 4FBMA 3IP6A 1CG6A 1VE9A 3REQA 4BC1A 4Q0MA 1Q1EA 2EGUA 1LPBB 3T5TA 1Y8RB 1EYZA 4D3ZA 3HP7A 1H94A 1DEAA 3CVOA 4PM4A 2WWGA 1JIXA 4O4LA 5DM0A 1SKAA 3PCRB 5FBRB 1UQRA 2AZDA 1ZCZA 2YXEA 3G2NA 3UMRA 2VAMA 1WPXA 5LOVF 2J87A 1GTL1 1ZVKA 4RJIA 1E1MA 4CM3A 1S89A 4HLQB 1JPNA 2ZE5A 3U1VA 3VU8A 2JIRA 3OJXA 5DLEA 1NW3A 4GLOA 2HHJA 4P4SB 4CQJA 1V43A 1W0KD 2JAPA 1R0CA 4DAOA 2FPGB 3M1IA 4OK6A 3HDHA 1HH4A 3LP6A 1ZKDA 3VZCA 4ARAA 3THRA 3PGJA 3VYVA 1E0JA 2A57A 3GCDA 3VH3A 1F9AA 4OX9Y 1FS4A 3DEHA 3CNQS 5BUCA 3AOEC 1CJKC 2V7BA 2ZS9A 5JYCA 2VHWA 3A6GA 3L0OA 1G291 1T6BY 2WC1A 4U7WA 3ROZA 2HPAA 3CF4G 4X8HA 1YULA 1KA9H 1PJSA 3QVKA 2CV0A 1ND6A 3FTPA 4AG6A 2ECPA 1X3SA 2IUYA 5C8XA 2EQAA 3QKSB 4IUYA 1PLJA 2AC2A 1M66A 3VR6D 2PE5A 1N3YA 3O9MA 2FG5A 1MAWA 5JG7A 4K9DA 4YJGB 2QQEA 3VSBA 3EY9A 4ND6A 2GAAA 3BWDD 3NS7A 3A8TA 3O4GA 3X1JA 9LDTA 1FXWF 4WOKA 3NNNA 3UUWA 3I76A 2TMYA 1X7ZB 3LY8A 3N70A 1DAIA 1AMNA 1V95A 3OQMA 2IC5A 3RAEC 6AT1A 2ZUEA 4BGIA 3CQ9A 4YI5A 3PWZA 3ZK7A 4ZDKA 2WHXA 2WSBA 2PCLA 4PG5A 4YRRA 4PAMA 2XTJA 3IODA 1OLUB 3L7OA 5C4GB 3RTDA 3RIGA 5JSQA 3DKVA 4EZBA 3GL9A 4HAOA 4HLUC 4JC5A 4O6VA 1XA3A 5T5QA 2Q5JA 4MVYA 1A2BA 1DUSA 3ZZNA 2OO5A 1N1GA 1U63A 1J39A 4R6XA 1PTJC 4WBSA 4JI5B 3QXGA 3U2QA 3P5SA 4I55A 3IGFA 2WJJA 1VBFA 1MQ8B 1Z0ZA 1Z56C 4HNSA 4LOIA 4PCLA 1EM6A 2GZDA 3P96A 2DETA 2Y99A 2YWFA 3JD2A 3KKQA 4KVZA 4LJ4A 1DWUA 4EYEA 5E9WA 4YAOA 4ZCQA 1C0IA 2IYUA 4G56A 4TSFA 3MN1A 5AUQA 1JEOA 4CPDA 2VDNB 2X9GA 3ER9A 1JHYA 1WUJS 2J3EA 4YCAA 4F0JA 1Q92A 2EG9A 3PQ7A 5ALPA 3IEVA 1PW5A 2GN0A 2JFWA 2PKYX 4N7BA 4Q1CA 5FFFA 1JJIA 3QHPA 3LT2A 3V7YA 2ILTA 2F9MA 1M7GA 4HGQA 1M5UA 1FRQA 2WFLA 2CLLB 2WHYA 4G07A 5KYXA 4NCBA 1FQJA 4IX9A 2WDPA 1OOEA 2QP4A 4WY2A 2GXAA 5IVKA 3DYIA 4P7GA 4BZZA 2QJWA 5CB4A 3D8HA 1M2GA 2Q3BA 2E21A 3OTQA 2Y1XA 1BXGB 1FYWA 1FB5A 4LJSA 1F2TB 2WPDA 5DBOA 3V80A 1V9SA 5IHPA 2X4DA 1T10A 1UK9A 3A3PA 2XMCA 4NCAA 1PWYE 1DJOA 3MFQA 4ZJYA 1RC1A 2J9FB 3PI7A 2TMKA 3II6X 3IAAA 1ENYA 1NBMA 4H7EA 1DQZA 2BEUA 5ED4A 2F1IA 2OO7A 4LCJA 3QIVA 5HG0A 3VR3A 3L40A 1MRSA 4IEFB 2D0OB 2J30A 4K5QA 3EXHB 3GQVA 2YWEA 4KXVA 1SCAA 4XDYA 3STHA 5CGQB 2ORVA 2I4IA 4FFNA 4YIHA 5JNVA 2IUEA 3TX2A 4Y6RA 1BMDA 2G7MC 4MEBA 3FVWA 3EWSA 1UXOA 2EEPA 3IOYA 4YDRA 4JBLA 4ZXFA 1XKLA 3ACDA 3RNOA 5JPCA 2QXYA 1UOPA 2BFEB 4A82A 3RRXA 3K70D 1U11A 2IEBA 3AI7A 5C52B 1GUDA 3HU5A 1ECFA 2IPAB 1DXQA 1DO2A 1OFTA 1ZN7A 4Y7DA 4X93A 3IEUA 4EY5A 3GPLA 3TW8A 1Z5OA 4EG7A 1CQPA 3WLLA 4NZOA 2ZTMA 3PCXA 3KDSE 2FZWA 3ETHA 5AJYA 1F8XA 2I4NA 4L75A 2OVFA 2HBRA 3DNFA 2Y76A 2OGZA 4FGKA 2VG8A 3ZKAA 5FDFA 1QH1A 2QI9C 1PNRA 5HS6A 4I9FA 2ADFA 1HE1C 3TIXB 1WZIA 4H7HA 1K7YA 2GKGA 5IVIA 2R4QA 3G13A 4PZPA 3DD5A 4FNMA 2VQ6A 3VNAA 3MXOA 2WJAA 5TGDA 4BATA 1XDSA 1GN8A 3QLUA 4CIDA 1CX9B 1LJLA 1YB6A 3OCZA 4JNKA 4UNIA 4WXHA 1PO7A 1BVUA 5EGSA 3UKJA 3OAAA 2X86A 4ZOAA 4B82A 4C3UA 4IFIA 3HVIA 4FR5A 4QXAA 3K0AB 2SKCA 2IUSA 3TJZA 4C07A 5B5SA 4MRRA 2JFYA 1N3LA 5JY6A 2CMFA 5IT9A 3QI2A 2R8ZA 1II0A 4L7QA 5BN3B 4J49A 4JB8A 4CV3A 4BOYA 2IS4A 2FN7A 3THSA 1BH6A 3WDMA 1A8IA 3E5MA 4HK4A 4MUBA 2QUJA 1CERA 1KFCB 4PNZA 4KN5A 3TL2A 2UZAA 2JFNA 1YB7A 2RH5A 3GH1A 4ND4A 4UPVA 4YCDA 5I5GA 4AULA 1YZGA 2ZT7A 4BE7B 2LDBA 3BTSA 5AXAA 3F3YA 5G0SA 1HYQA 2C4VA 2I9PA 5FB3A 4A8HA 3PUZA 4QDXA 2F43A 1BJRE 4JQYA 2QV7A 3CXRA 3QVSA 3S1AB 2W6JA 1BFDA 1KDRA 2Y67A 4QUGA 5DOVA 1Z08A 4IQGA 3IH5A 1GIAA 1VL2A 1Z68A 1YOVA 2VUUA 2XADA 1ODTC 1MN6A 3ENWA 3PQ2A 3VH1A 4EVRA 1M0EA 4X1IB 1E3MA 3S2ZA 4H59A 3B3GA 4EY8A 1Y80A 1KEZA 1ULHA 4KIFA 3WIUA 1YE8A 2B4AA 4FGWA 2MSEB 4Q3EA 5ELLA 5IBCA 3MT9A 3E53A 4YQFA 1SR8A 2DBZA 2JAUA 3EZ2A 1R6XA 1ZK4A 3MGKA 1TRHA 1SAYA 4I6EA 5TQJA 4F45A 2OFWA 4WUVA 5EIAA 2O2XA 3K0FA 3OQJA 4DF3A 1ZR4A 1ANKA 3EFHA 1YDEA 4I46A 1W19A 1HNNA 4GR5A 4Q01A 4CE6A 4UUOA 5KDOA 2YVKA 1X8JA 3DFKA 5LOVB 4CF4A 4QT4A 3DHYA 1PFUA 3RASA 5C18A 5K05A 1M2FA 1G0OA 1N6PA 4M86A 1A4RA 3P0EA 3VR0A 2DLDA 4JLNA 4U6NA 8LDHA 2BAGA 2VK4A 5E7QA 3N75A 2QVXX 1XBTA 2R48A 1NQXA 1QKIA 3R24A 1NQOA 4V0OA 1FRFS 1MC1A 4MITA 2O3SA 3MTBA 1E7MA 4IOMA 2P91A 4TKMA 3H9UA 3QVWA 1Y5IA 2AOTB 1WCIA 3KJQA 3FGOA 3VDMA 2R5WA 2HK8A 2C58A 3QE9Y 2VXOA 2FFQA 3PTLA 3GEGA 2P8SA 1W36C 4Q1BA 1TM5E 2WIKA 1ETHA 2P5TB 3UGKA 3K9LA 3JVDA 4L5CA 1E1KA 2IP1A 3DZJA 4LYEA 3TRKA 1JW9B 4BBZA 4WJLA 3IEKA 1D6NA 1E96A 1ONBA 5FBQB 3A58B 3KYBA 3WWPA 1FCJA 3ZW7A 4AZ3B 1NJSA 1FYFA 3KHUA 4F5WA 4HRXA 3FZNA 1XKXA 1IN4A 2QTFA 3N2GA 4JKYA 3CEJA 2C0CA 1NMXA 4QRIA 1XLVA 1BROA 3ESAA 4UMDA 1YVRA 3W1VA 3I2IA 3LUFA 2PWAA 2IU0A 2YV3A 4NMMA 4QOFA 4DRXA 1UJNA 4TWBA 2AW5A 2QVLA 4ESEA 1W8DA 3FNGA 2ZRQA 3OIVA 1G64A 3FRIA 5TPWB 4RPLA 2HWKA 3ZHVA 4YV1A 3PUHA 4DS3A 1X70A 2B4QA 1A7KA 5LDDC 4BGDA 1WV1A 3NOXA 3EIEA 5L9AA 3PPIA 5JCXA 4KIJA 5AP9A 4LOHA 3ESYA 3ICVA 5HDBB 1K7CA 2VH2A 2XB9A 3A4VA 3MLAA 3K9FC 3K9BA 4M8NE 1EVQA 2QBYA 4FMCB 2Q0XA 1MTOA 5BVHA 5FADA 3ZDDA 2X9LA 3QF4A 1I7NA 3FGZA 1UIMA 1V11B 2QN3A 1E69A 1WLSA 1R0YA 4NQZA 3I9MA 4NABA 4YJFB 5CD9A 4RKEA 2RHMA 1OLSB 3A1VA 4BFLA 3D2BA 1O0BA 3SKVA 1ACLA 3T5DA 3KHTA 1BD3A 1U9IA 4QAQA 1RLOA 2OM2A 3TEMA 2BM9A 1AKTA 1R3UA 3QNWA 1M8FA 3LMKA 1B3RA 1W1UA 1QSGA 3CLSD 4C7XA 1K75A 3GIWA 3BRWD 1U8TA 1H4TA 1NATA 4YP0A 5DRTA 1LNZA 5BSTA 2WFZA 3D4OA 3LC0A 3DD1A 4D99A 3TIGA 5JD3A 5IYZB 1OIWA 2RI1A 4IM7A 3H2HA 2QRNA 4U0KA 3PUJA 2Y0EA 4HZIA 4TMYA 4FB4A 3OOHA 5SZHB 4YR7A 1Q91A 3FR7A 2IKSA 4Y6QA 1O94D 3OTHA 4LNHA 2J5RA 3RHSA 4X3OA 3AOGA 4JU9A 3LHIA 2NW6A 2XUOA 1UK7A 2YNMA 3R7WB 1JHMA 4PNHA 2FRVA 4HNAB 4AL4A 4ZZ0A 1RXVA 3N9IA 3W5SA 3HM2A 5HOQA 4EVSA 3WWYA 1EIWA 3ELBA 2QLNA 1UZNA 2ORWA 4P4LA 2AHRA 3COWA 3OJ0A 1ZCBA 4BAZA 1BYIA 3D54D 3LL4A 4LJ8A 5TEVA 1GO2A 1DS6A 1DBRA 4D43A 4RV5A 1T9HA 2D4AA 3WKEA 2CLDX 3UXMA 3N86A 5BSVA 2BMDA 1Q0ZA 3RGWS 4AG3A 4DYDA 1RT9A 3GFPA 2VYNA 3OD1A 1KVQA 4PNPA 2OB1A 3HJNA 2IOQA 1E60A 1OAOA 2QLMA 3F7TA 1E2JA 4G1BA 4IF4A 4Q9KA 3BAZA 3BC1A 2Q3JA 4EO4A 2FFBA 1T1EA 5HS4A 3T9EA 2DWPA 1MJNA 1YS4A 1JIQA 3RS4A 1CBUA 3WLMA 4YMSA 8AT1A 2PUVA 2PKXA 3SZOA 4NZMA 4WVLA 3HEAA 3DMHA 1UKYA 4XGQA 3GLIE 5BSRA 1MD9A 2HWWA 1C8LA 4B46A 2FEOA 5DHPA 1MZPA 1J2JA 4MOWA 2ZI9A 3RUFA 5FLEX 3QQPA 3L4KA 3KTFA 1O9HA 1F2VA 2G17A 1G9SA 2R6CA 3BM5A 1VL1A 4LWZA 3SQMA 1M10A 3J7TA 1UP6A 2VQ3A 4RZSA 1IBRA 3PPYA 4Z7NB 2GPBA 2P77A 1PQ4A 2P9EA 1C7QA 2ZYWX 1M1UA 5L7YA 4YXWA 5GIOE 1J49A 1CFJA 2Q27A 3NDRA 4WASA 2P7IA 1F8UA 4BGVA 2IBMA 3MOSA 1F6DA 1NYLA 3G5TA 5BQFA 2QJRA 3AH8A 3SI7A 1NSTA 5EMHA 3T4UA 1QIEA 4YMWA 4OI1A 3ODPA 2PAFA 3TAXA 1CJBA 2F1RA 4ZVOA 1CJSA 5C7OO 1P7PA 2FPPA 2FOIA 3BWEA 2OLKA 2QD5A 4K9PA 3QNMA 2FP4A 2X5XA 3FUXA 2YN2A 3PFIA 4WKPA 1Z06A 4Y6OA 4BFWA 3NWEA 3VZRA 4EHJA 3NDPA 3ETDA 3I0NA 1MW8X 3NC1C 3I1JA 4UEKA 3P20A 4TMVA 5KJEA 3WGMA 4HFRA 3NTUA 5B7GA 2B78A 4P58A 3IQIX 1U5CA 4A8JA 2PDAA 3GT4A 5I4IA 1K98A 3BA1A 4HDSA 1L6RA 1QVRA 4ITUA 3WQBA 2GK3A 2J33A 3HI4A 4F6RB 5KTYA 1QO9A 4JR2A 2NXCA 1Q0PA 3EDMA 2PUEA 1L5SA 1LI7A 4E4YA 1UBEA 4JVLA 3AL0C 1M8KA 4ZMBA 3HB9A 3OO1A 1NJGA 3FOZA 3ZG6A 2RG1A 3HJTA 2HL6A 2JAQA 3HNRA 3IVMA 4UUMA 4CYMA 3PP8A 1X1QA 4JI0B 3ZGZA 4R9VA 2ZIVB 3W2HA 5FOQA 4EUHA 4HWTA 1NQTA 1XD2B 4PZAA 4XWWA 3FI0A 4GOKA 1XZMA 5HZKA 2IPXA 1QH8A 1ZM7A 3DEJA 8OHMA 4L4UA 3IBYA 1ZJZA 5C53B 4JQSA 5JAUA 1Q11A 3KKMA 1PEKE 1GXSB 2QRVB 2VP0A 2CW5A 2YW9A 3MOGA 3TTVA 1VG9B 1CZHA 3OIYA 3O2SB 3PIDA 3N2KB 2GQ0A 3IT1A 3FDFA 3EGDA 1NBHA 1WZUA 1AY0A 3G9XA 5AVJA 4O59O 1QWOA 1WRBA 2QAJA 3AB3A 3HKBA 5IM4A 1C0LA 4PAGA 2I71A 3O31A 3AEUA 4WADA 5KYYB 2I4RA 1C8BA 2QMOA 2GBLA 3CWCA 4KI7A 4MW2A 2E5LB 1DG9A 2QZPA 3GLUA 4JLAA 1SIOA 1N0UA 4DV2B 1EQ2A 1G5HA 1O8BA 4Q1EA 5HHTA 1DVRA 2QG9A 1N2GA 4D81A 4GSLA 2I3BA 3UB2A 5GMOA 3QYAA 4M99A 3IUNA 4PCVA 3RU7A 3KR0A 1ULAA 2WU4A 1BMQA 3CVVA 1J99A 2HRBA 4LNUB 3KR2A 4Z9XA 1WW3A 2D4HA 3R0JA 3I1YA 4N1AA 4DJDC 4I8IA 3A27A 4FINA 1VA4A 4KVFA 3GVIA 1SD5A 4UKDA 2WJZB 2M6RA 2QNIA 3WNQA 1CR6A 1WDMA 3DOUA 2LDXA 4DDUA 2NAPA 1FMCA 1OXBB 1EXDA 2I0FA 1U5AA 4COKA 3H9CA 2J3DA 4UXJA 1P0FA 3A2NA 2E4WA 5A4KA 1ZK0A 1YU6A 2O1WA 1TEVA 1TC2A 3DGEC 3HGQA 4GGOA 3QVGA 3IP7A 4NOMA 4H6WA 1JG4A 3H2BA 3NHUA 4RYDA 3HMQA 1CETA 1VHQA 2KBEA 2XUGA 3GGCA 3EWIA 4AX8A 1UDAA 4P0QB 2JRCA 2GAOA 4M38A 4GW3A 1KI8A 5ALNA 3WZ2A 3GLFB 3A10A 3EA0A 1XZLA 3WGZA 4E2ZA 4ZCMA 5KWVA 3DCIA 3B3QA 3HJGA 5HCIA 1GL3A 1VA5A 3M6UA 1OD6A 3MPUA 3NCTA 3U80A 4BE9A 2FE4A 3LBIA 5CT5A 1OROA 1JHDA 4X1YA 1CUCA 1LGYA 5HKBA 5IDVA 5BORA 4MA0A 1QIFA 2A92A 4PX3A 4OD0A 3RVOA 3L7AA 1C3XA 1OA1A 2CN1A 1WF6A 1R00A 3B2EA 5IX8A 4OF4A 3LXRA 4TRNA 2B4RO 1V9LA 1YNSA 1RZRD 1MT3A 3VNVA 3MWEB 3KVOA 1K1EA 2DUJA 2XDWA 4XVQA 2CWDA 1TW2A 1X39A 3A6ZA 3TLXA 3REGA 3EXHC 4ZIRB 4ENUA 1KK3A 3HCRA 3LJKA 4JIGA 3AXSA 1LTQA 3V46A 3OZUA 2AXPA 1N8SA 3DAHA 3HN7A 4N6GA 3RRZA 1A72A 8ABPA 3PC8C 2H7YA 4GI2A 1UZAA 2I2CA 3G82C 4OIFA 1SU4A 1E9EA 1ZO8A 5CB6A 4D4LA 1J97A 1WXDA 2ZT5A 1XKTA 3AR8A 3V97A 4EKNB 2M98A 2EHDA 3M5DA 4BMPB 4DYVA 5FWDA 5EQJB 3TKLA 1VMIA 1VPEA 4YEDA 2A30A 3SF8A 4O3FA 3QM1A 3QU2A 3HK2A 4GQAA 3S1SA 4LX0A 3EHDA 3PE6A 2AGVA 2JARA 2I1LA 2QJFA 2P62A 1GUZA 1GFSA 3TAUA 3TXYA 5L4LA 1Y34E 1OHHD 3COVA 3JD0A 1SXJE 2WF7A 3DLIA 3QJYA 3KFXA 3D8NA 3AP2A 4UAVA 3VO2A 5HM8A 1PL7A 1SKQA 4CMBA 3QFFA 4KZKA 4D4KA 1AC5A 4CKCB 3IUJA 2HAEA 3VKWA 4ZVSA 2D2VA 3MT8A 4Z6KA 3GD5A 3TB4A 4DSNA 3PEYA 1Q74A 1WXIA 4F8EA 5MFZA 1BQ4A 1I6LA 3JTEA 3MCUA 4GPIB 2F1JA 4NX2A 3W0LB 3WLNA 2V4ZA 5E6SB 3TB6A 4AF7A 5JD6A 2I7TA 1UR5A 3NBMA 2OXRA 4DLAA 3E9DA 5AR1A 4JA0A 5JT1A 4ALJA 2V6IA 4HTAA 4NHOA 1ZM2A 3EHEA 1TUGA 5DCLA 1LDMA 1XKQA 2O2EA 3NP9A 5KNCH 3VX4A 3MHPA 3EXFA 5ILOA 2RAPA 4CLRA 2RJ3A 4CV1A 5CB0A 5BW4A 4IIDA 3FBWA 3UNXA 2OILA 5D01A 1CDDA 4Y6LA 4L16A 1BKYA 1UPAA 3GXBA 4ABTA 1H5NA 1MAHA 3L84A 2YC2C 5TT1A 3FM9A 4I4TA 2NO6A 2XI4A 3KV3O 3P19A 1O3YA 3V2UA 1PQUA 3R5HA 3THXA 3CLUC 3FB4A 4NC9A 1PTJA 1RXWA 5ADVA 1EDDA 2AI1A 3T7EA 3H99A 3HB4X 2VJAA 3IBSA 3KKEA 1W88A 3DT9A 4JBXA 1KAQA 1MXFA 4J0EA 4M1OA 4V0NA 4CEHA 5JBIA 5ILQA 1GZ6A 1O54A 1M75A 1W29A 4ZYVA 3E5NA 3JXEA 1BCSA 1CEQA 1GPMA 2GZHA 3BMOB 4NPAA 2M6SA 1C4WA 2R6GA 2GH1A 2K7ZA 3AR3A 4L4YA 2I1VB 5CH3A 5TPZD 4ZMSA 1KFBB 1PJ3A 1RQPA 3H1AA 1X1BA 4TXJA 4XEHA 3U7RA 3W04A 4E08A 5ADUS 4Q66C 4ZQBA 5CA0B 2ZQZA 1O89A 3G2MA 4P93A 5FD8A 3U6KA 1CY0A 1CZUA 2BR3A 5FL7D 4Z7JA 3H0EA 3VR2D 4WECA 1A8SA 4OQLA 3DZKA 3E84A 3UMBA 4BP8A 1ETUA 4LY9A 2X76A 1Z4NA 5E6RB 5F35A 1WXQA 3LCJA 3LNCA 2GN4A 2PMWB 5HOEA 5KBYA 4IDEA 2FMIA 2NZXA 3E8MA 4PZCA 3GLFE 4JJGA 3NFRA 2I80A 2RHCA 1L7QA 3ZX4A 2R7LA 3W1WA 1J2YA 4UMVA 2SCUA 3FY4A 1KYVA 5BWMA 5LU8A 3NGXA 3ANTA 3RVKA 3KKKA 4XX1A 3SJAA 4QUKA 3WFZA 1D2NA 1U90A 4JX8A 4WINA 3WXMA 4UXHA 3I8SA 5I3CA 1TJ3A 3PQDA 4IS2A 4IHJA 5JRZA 2AYYA 4F38A 3GJ5A 3UV6A 1Q0LA 1EGVB 2QN1A 1A50B 1SXJD 3NDIA 2QM8A 3GCZA 1M6VB 2MINB 4XX0A 1P1BA 5DCUA 1KMQA 2RGNC 2V7XA 1H2RS 4WOCA 1N9GA 3D2LA 5T57A 1NUTA 2BKLA 4GZMA 4QUEA 2B37A 1TRKA 1UZLA 4QE3A 3RKRA 2OLEA 1A8QA 1A9XB 3TVYA 4EWLA 3ZDYB 2IE8A 5JCJD 2PWYA 2MHCA 2QE7D 4E31A 3GAAA 4TLLB 4AB1A 4IDDA 1D0IA 1MEEA 2GTIA 5CLFA 4WQMA 1W36D 1V47A 1QG6A 3EQ9A 3ZXYA 3ZWBA 4BFSA 3THWA 4P2BA 2A67A 2DFKB 1PRYA 2WOJA 4MR7A 4UUAA 1U28C 2VJCA 3DL0A 1FJGB 2J5QA 1PR5A 1G59A 4YCCA 3JWPA 5JRJA 2WHPA 2FZLA 1Y8QA 2O20A 3A4IA 2VNIA 1T3SA 3CRRA 3DCNA 5FBKA 3F6YA 1Q44A 1CEEA 3FHOA 4KYVA 1DX6A 5FPYA 3BBLA 1PZFA 4JB2A 5TVKA 1JIKA 1WX1A 1Z5WA 3E23A 2W2NA 1UQUA 3KXIA 3AZOA 3GWGA 5E0OA 5DBFA 2F7SA 3C4VA 1JE1A 3GMTA 1EIZA 3Q8LA 1QMPA 1YO6A 3I8OA 1LF5A 3T3DA 3JYHA 2ZITA 3FUVA 1OU4A 1IEXA 3HP4A 1UFOA 1WB9A 1SQGA 1UJ2A 2Q2WA 3GELA 4H0FA 1USKA 4MQBA 4MI6A 1PYOA 4HAZA 1F7VA 4LOLA 3NVAA 4IP0A 2WQ6A 1Q17A 2P9ZA 4DV5B 2NUPA 2GBPA 3RNLA 4EYGA 5LQRA 1BVHA 5AUPB 2G9ZA 2ZYAA 3FCYA 4PSUA 4YAIA 1CNMA 4HNVA 5IHXA 1JFTA 2Z6VA 4A3SA 4D9KA 1THTA 4GOJA 3WWCA 3D7LA 1DC5A 4G25A 4A6EA 1KRHA 4D3DA 4CNBA 2AA3A 2DQKA 3QXCA 4M46A 3WP0A 1ND5A 4EDFA 1TF5A 2AVNA 2V45A 3O5AA 4PAQA 4XOIA 1KEEA 2BTQA 3RAFC 1P7VA 1DDGA 1NW6A 1NRXA 2UVPB 2FSPA 2WSSD 2ZYVX 3AFMA 2VF4X 2CMHA 3MYYA 4LQLA 1V5FA 4B6EA 3ILYA 4J0JA 4YDSA 1JDVA 1W25A 1FNCA 1Y4UA 4WFQA 3PEWA 3DMGA 3PDIB 2GM9A 2NX2A 2CKDA 3MWDB 3SSNA 5SZIA 5AVQA 3U4QA 3GCWA 3WTBA 5JFOA 5KMGA 3F2VA 2JGRA 3H19A 4ZVMA 1ZCFA 2JLUA 2P9CA 1YKSA 4BNGA 5L7WA 4GDMA 2QPLA 4LHSA 3GA5A 1QG2A 1YCGA 3JQFC 2OSVA 3I04M 4GGMX 4Q4CA 3CIFA 1E2LA 2WQ7A 1W0KA 1XCJA 1JE0A 3EARA 3ZD8A 4AF8A 3ZCPA 4AG5A 4WKOA 4DMRA 2Q4OA 1CDOA 2BBSA 2X40A 1QGUB 3W6OA 4UASA 2EV9A 1G7CA 3IQZA 2Y8EA 3I83A 1GFWA 4PLHA 5DSZA 3V5NA 3OP1A 1DNPA 4G65A 4HEQA 3C6MA 2BL4A 2Q3DA 1SZJG 1KP2A 2ORYA 5FBHA 4D0SA 3AVUA 3ZWKA 5IKEA 4F92B 2FMUA 2V6FA 1SKUA 4OSOA 1XNJA 3NX4A 1N8NA 5K3OA 2UKDA 5A2GA 4DSTA 2DYKA 4AZTA 1PBTA 2QTVB 1GNQA 4MDHA 4P3PA 4YMVA 4AS2A 5FJIA 5BWBA 1S6YA 1YZ3A 5ALSA 1JG2A 1RXUA 1GQSA 1KC1A 2ID7A 2W2KB 3VR6A 1FF9A 5HIIA 5AW8A 3ZWPA 2QLLA 2ZTHA 2YXPX 4P8RA 1O96B 4XCXA 2DJIA 2YVLA 4MUAA 4K6KA 4OQMA 4E3ZA 1AN9A 1QHYA 2EW1A 2F3RA 1PZHA 4RZHA 4X1KB 1MC4A 3ZDCA 1RM4A 121PA 2C7RA 5IPFA 1VHDA 2H1HA 1G8GA 4OMDA 5EZ5A 2VDVE 1J1UA 1XVAA 4YAEA 4WNIA 2FPIA 2RC5A 4OXYA 1RMTA 4Y2GA 2MYNA 2I78A 3SPXA 2J3LA 3S81A 3C39A 1RYNA 2B21A 1U1DA 4V02A 3ZGVA 3AEQA 1M6EX 4GXQA 4CR6A 3BE4A 5SZKB 3BREA 5JIBA 2TSYB 5DRYA 4ZRNA 2ZYUX 2UAGA 4AURA 1L8QA 4O2BF 3HJFA 3RT9A 3SIPA 3PD1A 3QTLA 3AGQA 1QCCA 2PY6A 1YBVA 1GGNA 3FLAA 3L6OO 4RK1A 5G0TA 3UJDA 4EQ6A 1YVPA 4KUEA 4XQ0A 1X15A 1N57A 5FYQA 5BOSA 2BYTA 4MGEA 1QP0A 2WW8A 2Q4BA 1KZ6A 3ICEA 1XDWA 2C3OA 5C7LO 5KTSA 1SUBA 3FOWA 1P8AA 1QK3A 4RM2A 4EY3A 2VBFA 5DTEA 3FCOA 2VNAA 1JMVA 3AC0A 5K0CA 2F3PA 3WWDA 5L6LB 1RR6A 2R7AA 2WP0A 3OQ6A 4FK8A 2YW2A 1ZU4A 3ZU6A 3H18A 1Z73A 1L7AA 3TNYA 2EBWA 2ZZMA 2GK4A 4YJ2B 3KQYA 4HWSA 3COJA 3DMYA 2EYUA 4MDFA 4G8BA 2ZRJA 1XTKA 5AHOA 4FHCA 4RXTA 2FUEA 3BTOA 1Z6PA 5C8DA 5KJ1A 1RM3A 3H2IA 1JG3A 1ZDMA 2ZB2A 3LCCA 3WSWA 3GVHA 3MD9A 4RD2A 3F49S 3UAVA 4RZQA 2C9DA 1E2NA 1JL3A 4ZCPA 2RGCA 2JFVA 1DCFA 2TMGA 4YAWA 5IT4A 1XZEA 1FUIA 1XCGB 4A8PA 1D4AA 4FVTA 4ZVTA 4X24A 4IFEA 4WLEA 4BCCA 2V9PA 2XV1A 2HJVA 1SM4A 2COUA 1U7OA 3FW1A 4WZ6A 1GL7A 4B8WA 4DLZA 4ZEVA 1QIGA 4GLJA 1M72A 1ZGBA 3JQAB 1QBKC 3TZBA 5KOYA 1PGQA 3L7DA 1WNTA 2NADA 4HI0E 5CPBA 1SZCA 3KU1A 4I9GA 4EHAA 1QGYA 1AA9A 2D0IA 4Z5XA 1FIUA 3VC1A 1JTVA 4HQ0A 1BDJA 1C8VB 1HDIA 5HIMA 4L9SA 4ZVRA 1PVDA 2J67A 4EL0A 1KRWA 3DT8A 4LZZA 3W5JA 1L7XA 2OFPA 2QAGA 3ORSA 2YINC 3WI7A 2PPVA 4P5DA 3EVBA 4KBFA 2VZ9A 5F7JA 4I9HA 1W4LA 4MA4A 4HH0A 2CXHA 1SOAA 1OZGA 5ECYA 1YDHA 5G4LA 1E3LA 4X3PA 3O91A 2WSYB 4C6TA 4D0GA 5I4KA 1QU3A 1RHMA 1YA8A 1JSZA 3CONA 5EFOA 1EP9A 4G5RA 5CVCA 1CF2O 5A7GA 2XZOA 3CNBA 1GTRA 4RKRA 3IO3A 1JQBA 1UAGA 4L8WB 5BQ3A 2Y1GA 3BEOA 3DC7A 3LXXA 4RMJA 4EHHA 3I2YX 2MSKA 5F12A 5B4VA 4H1VA 5C7YA 3HY6A 4H0CA 2O2IA 2OOKA 3PQ5A 3RW9A 2JCYA 2BKEA 2GF0A 1A8PA 3UBMA 2ETVA 2CXQA 2GILA 4JASB 3SZRA 2I55A 4Q05A 4TYPA 4UHEA 3ZWOA 1LX6A 4FHDA 4YRMA 5FNVB 1PL6A 3AJ9A 4L85A 8GPBA 3A0RB 1TJNA 2APJA 2OGUA 2DULA 3AI3A 3CEMA 4XFKA 2P27A 2ZSJA 3RT7A 3KZ1E 1GAEO 1Z82A 4L72A 2PWBA 3RWBA 3TMKA 2A1IA 1Z4LA 2OZLB 2I3AA 3EXIB 3V55A 5F98A 3T1NA 3T8YA 4GXTA 1EGAA 1O08A 1U04A 1BEEA 1JSRA 3GROA 4HDMA 3V42A 1HE4A 1ZCJA 4OHKA 3RAJA 2F4VB 2D5IA 1H3EA 4LYFA 5GAJA 1LK0A 2PK3A 2FUG6 4A5OA 4ZDWA 3KBBA 1YRWA 4II3A 4NYMQ 2FGKA 1XCLA 2Q5LA 1I2ZA 3FHLA 4IXTA 3KTOA 2WKWA 3W2TA 1KJYA 3B82A 3OT5A 4CKYA 4BQSA 3LE8A 2AC7A 2W6NA 4L95C 4XEUA 4LZWA 2CHQA 1U8YA 4FE3A 2YMLA 4ZFNA 1Z4MA 3Q9SA 1KR5A 5JQGF 2Q6KA 4Y1RA 2GM5A 3D0QA 3DFFA 1P1KA 1M1XB 2IYPA 2D1QA 5CYPA 5B6JA 1A2QA 3RPEA 1TCCA 2P0YA 2WT4A 2V4MA 3RABA 2WK1A 3B1XA 2Y71A 1R12A 3MJFA 4FUQA 2AOWA 3CH7A 3ZPXA 2P9HA 3IP9A 3H9JA 4WGFA 2PBLA 4JUCA 5AXDA 1HV8A 3H2KA 2FFRA 1ADJA 4RPCA 2C7VA 1PT5A 5BQXA 2NU8A 4D8XA 4PHHA 4JROA 3WX0A 4ZO8A 1GG2A 3I61A 1Y3BE 3NJRA 4KDRA 3L6BA 2EP8A 5CEFA 4G1VA 1EA5A 3H1GA 1E9BA 3QE3A 4ND5A 1L5KA 3WBJA 3OSUA 3ICPA 1NFFA 1YJ8A 1ZITA 2G9VA 1Q1AA 3HCDA 3IHTA 3HGTA 4HEHA 2CFSA 1NN3A 1FP4A 4R69A 3R6WA 4I5GA 4QO7A 4UU1A 2V9ZA 3L0CA 2IXBA 4Q93A 5E9QA 3BXFA 1ZZGA 3INYA 5FI3A 2ZATA 4U5QA 3UWSA 4KITB 5A0VA 2EWMA 3K9NA 4UUNA 1PZMA 5IJ9A 3WQSB 4XGIA 4XI9A 2PL3A 3PTZA 4X66B 2DUNA