4RSMA

Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. mc2 155, target efi-510970, in complex with d-threitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
DTTRIGVTVYDMSSFITAGKEGMDAYAKDNNIELIWNSANLDVSTQASQVDSMINQGVDAIIVVPVQADSLAPQVASAKAKGIPLVPVNAALDSKDIAGNVQPDDVAAGAQEMQMMADRLGGKGNIVILQGPLGQSGELDRSKGIEQVLAKYPDIKVLAKDTANWKRDEAVNKMKNWISGFGPQIDGVVAQNDDMGLGALQALKESGRTGVPIVGIDGIEDGLNAVKSGDFIGTSLQNGTVELAAGLAVANRLAKGEPVNKEPVYIMPAITKDNVDVAIEHVVTERQQFLDGLTELINKNLETGDIAYEGIPGQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title A General Strategy for the Discovery of Metabolic Pathways: d-Threitol, l-Threitol, and Erythritol Utilization in Mycobacterium smegmatis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 128
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rsmA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rsmA01
3RVJA 5FWYB 1DG9A 1RXIA 1GCAA 2FMHA 2KYRA 3EQZA 3C3MA 4MPTA 3FDFA 2E4ZA 3LMKA 2PJUA 1MVOA 5TQ2A 4Z99A 3RVLA 2OENG 3NHMA 3QX8A 4IRXA 4YWHA 5IUJC 4WXMA 3CKMA 4RK4A 4TLMB 2A9RA 1D1QA 1GLGA 2B4AA 2GI4A 5T3YA 5IX8A 2GWRA 3N0XA 4OG2A 2FQXA 2IPAB 1P6UA 3FGZA 3FMVA 4RK7A 5JNWA 2E4UA 1FSPA 4JAVC 1M5UA 3C6QA 1ABFA 4QYWA 1SXIA 2IPMA 3GWGA 2PL9A 3ROTA 1DCMA 4YP9A 2PUEA 3GL9A 2HQOA 4IMIB 1PUXA 1DC8A 1A2OA 1Z12A 2OQRA 3O1IC 3I45A 1Z13A 3NHZA 4N41A 3GYBA 3UKJA 2PUAA 1D2AA 2E4VA 3JS5A 1GCGA 1JHZA 4FE7A 3T38A 1YMUA 3O75A 4RXMA 3EULA 5IEBA 4LDZA 2PE5A 2LIVA 4DQDA 3LUGA 2WY2D 3DZDA 2YHBA 1JDPA 4PEVA 2O20A 3N6VA 4G0MA 4QPJC 1SD5A 3D8UA 4OTZA 3RVNA 2E4YA 5KC9A 4YS6A 4DADA 2NZUG 5DKFA 4OATA 4W5RA 2YHAA 1JF8A 3O2SB 4F06A 1M2FA 3HXMA 1QQBA 5FWXA 3MA0A 1QO0D 1EWVA 3M9XA 1LJLA 3KTOA 1Z26A 1C0EA 3KCNA 3R0JA 1NXWA 3K9CA 3HDVA 2PL1A 4WUTA 1GUDA 2A9QA 4EY3A 1UDRA 2FN8A 1F51E 4WT7A 1E6LA 3TD9A 3L6UA 1FFWA 4ML3A 2L2QA 3MMNA 2R25B 3H6GA 5F64A 4FB4A 3W9SA 1E2BA 3IP6A 1USGA 3IPAA 2QXYA 4O5AA 2JVJA 3H5WA 3TO5A 1D5WA 1M2EA 3HSYA 3Q7TA 4LRQA 4MS1B 5CNIA 1ZHHA 4W5NA 5EWMA 3I5AA 3ILYA 3OLYA 2A9PA 1EWKA 1PHRA 2JVKA 3EAFA 5E3JA 2FKAA 4EVRA 2HJ9A 5EWLB 4NCAA 2FEKA 4XXHA 1KRXA 1VPWA 3CU5A 3QELB 6ABPA 4L85A 1H9CA 3HUUA 2FMFA 4JP1A 2E4XA 5BRJA 3HEBA 1QNLA 4JA2A 4YCSA 4P98A 1YIOA 3IP5A 3LTEA 3A3KA 3UUGA 5IULC 5B3JC 4N76A 4MR8B 4G0PA 3KSMA 4Z9BA 4RXTA 1ZESA 4RXUA 5KQLA 2WRZA 1T34A 4LZLA 1C4WA 2HQRA 4MYRA 5D2CA 4Z4HA 3Q9SA 4W5TA 1Z17A 2QU7A 2PLNA 3BRQA 1FFSA 3HJFA 4MQEA 4EVQA 2HSGA 2FEPA 1J56A 3CZCA 1JBEA 3RVSA 5JNVA 3MYYA 4ZMRA 5TPZD 4MR9B 2FW0A 4G97A 1NXTA 3H5LA 1NXXA 2GX6A 4KVFA 3F73A 3MF4A 1ZAYA 1XHFA 5I4CA 4KPYA 2FSPA 3OQOA 2F8SA 1ISSA 1YTUA 2LBPA 4GPAA 4KQCA 1A04A 1D4ZA 1JLKA 2FN9A 1EHCA 5CNKA 4ZJPA 2JBAB 2XDYA 5DCLA 2BGGA 1MAVA 3VNAA 1JH9A 2MSKA 5DTEA 1QQAA 1W25A 2NZVG 3N0RA 3QLUC 3CNBA 3CG4A 1JWLA 3LUDA 3GBPA 2ZAYA 1S8NA 4JB0A 4PYRA 1JL3A 1P8AA 4KK4A 3A0UA 2LPMA 5HQJA 4MRMB 3H75A 4ZMSA 3LUCA 5DLEA 1AB6A 3DGFC 3OQMA 2JK1A 4Z4FA 3SAJA 1EAYA 1DBQA 3H1GA 4GNRA 3T8YA 1I3CA 3OQNA 3LKBA 3O21A 4KQ9A 5GQSA 4RK0A 4YRZA 2PUFA 3NNDA 1XHEA 4M88A 5TQ0A 3K4HA 1ZITA 5EWMB 2QSJA 3LUAA 4MAAA 2FXIA 4RDCA 4KFCA 1RZRD 1DRKA 2W42A 4EUKA 1BVHA 3KG2A 3BRSA 2VK2A 4ETMA 5JNTA 2X7XA 5KQGA 3QLVC 2WMYA 1DCKA 2ID9A 1LBHA 2MSWA 2WB4A 4RY0A 5C5EA 4N03A 4ETIA 2Q5CA 2FMIA 1Z18A 3LUKA 4RKRA 2R48A 3EGCA 2PUBA 2B1JA 2GKGA 4IF4A 3JY6A 2NUBA 1MB3A 3NBMA 1OXBB 4QYMA 2CHEA 3O74A 5TQJA 1YS7A 4MS3B 4RV5A 1ZGZA 4D6YA 1E6MA 4RKQA 3O2QB 4EYKA 3B2NA 3OLVA 4MQFB 4O1IA 5TPWB 1Z25A 1BDHA 3F7NA 3OLWA 3BREA 3DBIA 2IDMA 2MYTA 3A10A 3CLKA 4D74A 3EODA 1CHNA 2MYUA 3QEMA 5FBHA 5T7BA 1KRWA 1QO0A 2RDMA 4W5QA 1DBPA 5C5CA 2JRLA 2FTKE 3LUJA 3VNBA 1P2FA 3G85A 3L49A 4LE0A 5JNRA 1BA2A 5GOTA 5IUKC 4RS3A 1K68A 3OM1A 4XFKA 2L17A 5JS1A 1QPZA 2J48A 2QZJA 4IMJB 2QVCA 1IIBA 1OXKB 3C3WA 5IBQA 4KV7A 4PE5B 1B00A 4CBVA 4Z4IA 7ABPA 2WWVD 1D1PA 2QV0A 3E3MA 4YV7A 5FWYA 1RNLA 1ABEA 4HNSA 4RWEA 3FFTA 5IC5A 4JASB 2FQWA 2RGYA 3LKVA 4PICA 4KMRA 4KREA 2N9UA 3JPWA 3LUHA 1YK0A 1YK1A 3FFXA 3KLOA 4OBBA 4DN6A 1RPJA 2A9OA 3RVKA 1VRVA 5ABPA 1BDIA 4EYQA 4G0QA 5TQ2B 4EYOA 5IUNC 4TMYA 1JYEA 1QP4A 3T95A 5HM6A 1YVUA 4F11A 1Z15A 3HCWA 5BR1A 1NXPA 5KI6A 5ED4A 3GA5A 3KS9A 1KGSA 4RY9A 3E61A 3CFYA 1Z2DA 3FFWA 1JFVA 2VYCA 1RXEA 3IPCA 4XASA 1Y1LA 2MSLA 5CHYA 3DLHA 4XAQA 4OLBA 1K66A 1TVMA 3KKEA 2M98A 3I42A 2NT3A 3RVPA 4ZYLA 9ABPA 1VKRA 4H3KB 3HVRA 3HK2A 1JX6A 1KMIY 2H3HA 2LP4Y 3RH0A 3RVQA 1GUBA 1PEAA 5HKOA 5KQPA 1ZVVA 2IPNA 2PKXA 5B3JA 4MLDA 3M9WA 1NATA 4N0QA 1ZGGA 3A0RB 4YLEA 2P9HA 3Q7SA 1Z16A 3NNSA 3CG0A 4E7OA 4MS4A 4LE1A 4NQRA 3RVOA 5IEJA 3HO1A 4OLAA 1DRJA 5TPZA 2HPHA 1CYEA 1ZY2A 2R4QA 5JNUA 1U0SY 3D02A 3H5VA 2CWDA 4IILA 5JNSA 1QP0A 3RQIA 3N75A 4YR7A 1USKA 1A0OA 3HM9A 3G1WA 1W9HA 1L5YA 1VLZA 4JOQA 4Z4CA 2NT4A 1DZ3A 1WETA 1TM2A 3SY8A 2R47A 1Z2EA 3OMXA 2FQYA 3GV0A 2JB9A 4MLCA 5FWXB 3TB6A 2TMYA 3OMWA 4QICA 1HEYA 4WZZA 2RJNA 1LBIA 3IDOA 1EWTA 3OLXA 4Z4GA 4UHJA 3EQ2A 4ETNA 2PAFA 3I09A 2ID7A 3H5IA 3QLUA 4MS1A 4Q6WA 1PEYA 3NNNA 4WXEA 1USIA 2DRIA 4H3HB 1LJUA 1AB5A 1M5TA 1U2QA 1PNTA 4Q6BA 3SNKA 3ILHA 2AYZA 3SM9A 2V0NA 5EWLA 3KYIB 5JS2A 1ZDMA 1YMVA 1SRRA 3QELA 1QMPA 1R8JA 4S05A 1APBA 1FQWA 4HNQA 4RY8A 5KC8A 2JVIA 3O1JC 3F6PA 1JYFA 4S04A 1RZRA 5CNMA 2FEWB 4N47A 1NXSA 1ZH2A 4MR8A 3MIZA 1NXOA 4RSMA 1FFGA 4KZKA 5EWJA 3LFTA 1DP4A 2PMCA 1XWWA 4JB2A 4EVSA 4XLTA 3N53A 3JVDA 4O1HA 3IP7A 3OLZA 3URMA 4Z4EA 5KQMA 4YO7A 1TLFA 4IGAA 4LDAA 1JFTA 4F8JA 3QLVA 3EDCA 4W5OA 3EJWA 3O2JA 3T6KA 2LUOA 4MR9A 4MQEB 2M1ZA 2PUGA 1BAPA 4HYEA 2QR3A 4TLLB 2P4UA 4Q7EA 3UK0A 4MS4B 3TX6A 3OO0A 4N0PA 3HS3A 1P6QA 4UHKA 4G0OA 3GBVA 3HZHA 4LE2A 4MR7A 4RZSA 2WJWA 2JBAA 2FMKA 3IP9A 2F8TA 2H0AA 4Y9TA 3M6MD 2FVYA 1NXVA 4HNRA 3KHTA 2L18A 5BRAA 3S99A 4NCBA 1F4VA 3O1HB 3C3KA 2AYXA 3OO1A 3JVIA 3OM0A 2HQBA 3CHYA 6CHYA 5HSGA 3GT7A 5CNJA 1EFAA 4MRMA 1QP7A 2QVGA 3P9YA 1JFSA 1ZH4A 1MB0A 4NICA 1U04A 2ZWMA 1DBWA 3BILA 4F3TA 3HDGA 1YS6A 2VUIB 4P1ZA 3MM4A 3SG0A 1DCFA 1URPA 4ZPJA 4B09A 3DLBA 3SQNA 3LUFA 1NTRA 4Z9AA 1LK0A 2IKSA 2L19A 3QLTA 4MGEA 1U2PA 4G86A 4EGSA 2VUHB 3H5TA 3CS3A 1JDNA 4RU1A 1QKKA 5TQ0B 4G0XA 2IOYA 4D6XA 1ZN2A 1SXGA 2PUDA 4WWHA 3CZ5A 4EYGA 3HV2A 3HUTA 1MIHA 4KK3A 4TN5A 1U8TA 3H1FA 3TMYA 3H6HA 3CRNA 3JPYA 1NY5A 3MQ4A 4LX8A 4XARA 1ISRA 3F6CA 4H60A 3RVMA 3QK7A 3RVRA 3C97A 5EWJB 4FE4A 5KWSA 5BQ3A 4MS3A 3H5OA 3GRCA 1SXHA 4MQFA 2IYNA 5TPWA 4E7PA 5PNTA 3H1EA 3Q15C 4YGXB 2CD7A 1TMYA 3CTPA 4RK6A 2MYNA 1E6KA 4G0YA 2I6FA 5TE9A 2FLWA 2GBPA 1BDJA 3Q41A 1CEYA 5FBKA 4KNYA 3QEMB 1PNRA 3KLNA 4F12A 2E4WA 3BBLA 2FLKA 3QEKA 3KJXA 1DC7A 4PZ0A 3N8IA 2MYPA 3JTEA 2IPLA 2RJOA 3DGEC 3Q7RA 3ROFA 2CHFA 3KYJB 3LOPA 4RK1A 1L5ZA 8ABPA 4G0ZA 4MR7B 3N0WA 1TJYA 4Z0NA 2JCGA 2QW1A 2WJAA 1DJMA 4KRFA 4L4UA 4NV3A 3QX9A 2PUCA 4RK5A 5DGCA
chains in the Genus database with same CATH superfamily
4RYLA 3ANXA 1N6NA 1PR9A 1SBCA 4OHYA 3CVOA 3ZHXA 4IXMA 2E55A 2HFKA 2XWQA 1ADBA 3GDGA 5EINA 3O9MA 4L57A 2FWMX 2E4ZA 5F4BA 5B7PA 4MWEA 3W1WA 2HWUA 2B6NA 1P45A 2CL0X 1L9KA 1HLGA 3IAXA 5J63A 4AF7A 1VI5A 3EGXB 3B6IA 5CDSA 4E09A 1ODKA 3M3DA 1FX0B 3TSAA 1GTMA 3ZHTA 1S01A 1WG8A 2Q50A 2Z57A 5KSZA 1Q0RA 1Z0FA 2VT7A 1V5IA 2X42A 3GUUA 1YR1A 1ISMA 3LPDA 5DM1A 3W7BA 4M1MA 3DE3X 1S02A 3HLTA 5H59A 1Y9EA 3IB3A 2AR7A 2P30A 3OZFA 1LI4A 1Z6ZA 1Z12A 4ILEA 4XYGA 1KQFA 1XLWA 2FMXA 3EW7A 1KVTA 4QQNA 3RJ5A 1IZYA 2FUG1 3P9ZA 5IARA 1IWOA 1PIWA 2HBRA 3DE2X 3T38A 3GPCA 3STYA 1QFXA 2ISCA 1H4QA 2I76A 1KNXA 2A84A 1SUFA 3A7DA 3B38A 3FRHA 4LBYA 4M98A 1S4MA 2PZMA 2EL9A 1YBMA 2O20A 1RDFA 2R1VB 1NVTA 3D3WA 3CONA 4WVFA 4PTYA 4QPJC 1FYEA 1SD5A 2CMGA 2G0AA 2G28A 2P6UA 3A3NA 1G2PA 3ESQA 1XQ6A 4JLUA 3W2IA 3GLIA 4UEOA 5DTRA 2GVNA 5DGHA 1N9GA 1M2OB 2V98A 4OU4A 3ROMA 1E2LA 1K06A 1M2FA 4NZYA 1CY6A 1QO0D 2AD1A 4ER5A 3IIJA 4PZPA 4DM7A 1Y1PA 1L7NA 3CXRA 3M9XA 3PGKA 5AJYA 3N0TA 5DT2A 1YCFA 1CZHA 1HFKA 3SBXA 1P62B 4D45A 2YWBA 5HBGA 1B7GO 2AN5A 2WK1A 5EIFA 3OPQA 5C1IA 2IXEA 4OMUA 1TIKA 2JGKA 1AQ6A 1UOPA 2W2LA 4MO2A 5LFAA 2F90A 4Q3CA 4DZTA 4Q00A 4TX1A 1FIUA 2G77B 3KJNA 1S8OA 1Q0UA 3KVRA 4FU0A 2C0CA 4YRQA 1E2BA 3DAPA 5JAOA 2R0QC 2JI7A 3KAJA 3UXMA 1C41A 1D5WA 1L7DA 3PE3A 5CA1B 2PZGA 4ZCMA 5I7OA 4PRKA 4UD2A 1XRLA 2YRWA 3NJRA 1GNPA 1GLVA 4KXLA 1U2ZA 1G20A 3VDRA 1ZW6A 2C9BA 3CEAA 3I5UA 4CQLA 5BMVA 4C7JA 3KEGA 2GKSA 3E2PA 2ZBPA 4Y8VA 5BVHA 4LDQA 5KOYA 4BXOA 2JD2A 4U2BA 4P86A 2YOGA 3AIIA 5CGQB 2ZJ1A 2D7CA 4G5SA 4JXKA 2FEMA 2OFPA 2ZYWX 1MJFA 1AKYA 5IMBA 5IWCA 1KRXA 2J9FA 1RAEA 2BDEA 2G06A 4WVLA 3TN7A 1YJ5A 4Q4AB 4CEIB 3P9QA 5JDCC 3BEOA 3NHKA 3TOCA 1YIOA 3NC0C 4YCSA 5JOQA 3LBFA 1H2ZA 1UBEA 3PPWA 1E6EA 2WD7B 2WI8A 1PS8A 3CUTA 1IN5A 1EWRA 1NN5A 1X0VA 3C7AA 4MR8B 4MWDA 1WM1A 1UKAA 2X9NA 3AUUA 4R2HA 4RXTA 4MWGA 5E4JA 5KQLA 4DNPA 1SBTA 3TFOA 1W96A 3NV7A 1DAGA 3DOUA 1K97A 3IERA 5CURA 2XHEA 1ZOSA 1XMIA 3R9WA 1D6JA 2HCJB 1PYDA 3TMAA 2QNBA 4XYEA 2QMHA 4UOZA 3IESA 4Q4JA 1Z4QA 1YL5A 1MRSA 3NTXA 3PC4A 1WWKA 1YC2A 2I2DA 4AY3A 5CIYA 2C5SA 1NNSA 3QWBA 1W44A 1SEVA 2CZQA 4N8SA 4BZWA 3LL7A 4MGIR 2PUGA 1NXXA 3OZUA 3L7KA 4DDHA 1W4LA 4AT1A 4LZNA 4KPYA 3V4SA 4FS8A 3TOXA 1V37A 2I2XB 1P2SA 1JLSA 3CX8A 2XYHA 2JDIA 5AIAA 1AN0A 2O8NA 3K5HA 3DF9A 3TQCA 4HGZA 4ENTA 4PLTA 4PZYA 4CR8A 2EL7A 3BWMA 1Y6ZA 5HUQA 4U7DA 4DQKA 3EPKA 4FC7A 4X61A 4ARBA 3PNYA 5LQAA 3EX7C 4HMQA 2VDNB 2YXDA 4FFPA 4DR4B 3NHSA 1C80A 1CF9A 2R7LA 4TKVA 1J8MF 1O95A 2CB0A 2VBFA 4LN1A 1N7HA 1KYYA 2I1VB 1ADCA 2JKZA 3P9PA 3SFTA 3V8PA 3WMWA 4B80A 5B5SA 2C2OA 4M9SA 4LQLA 4F84A 1W76A 3QFTA 2C57A 2WR8A 3ZK8A 5GZ3A 1UPTA 2XUGA 3DQQA 2OPHA 2WFLA 3KD3A 4FOSA 4IJ5A 1J00A 3RLFA 4QTUB 4LIPD 1E7YA 3SLKA 3VO9A 5AVQA 4LNUB 3RRZA 1R88A 3E82A 2N0SA 1S2MA 2O2XA 2QYSA 4OHCA 3O7WA 5K0FA 4DR5B 4YC7A 1A4UA 1AU9A 1GKUB 1K6XA 1XQYA 2IYPA 2NXWA 2Y27A 4TQ9A 3BMQA 4E2FA 5FTWA 3RKSA 4JEIA 1OYYA 4G0UA 3MWDA 1DRKA 2W42A 1RZRD 1MIOA 1JEQB 4BFWA 1RD4A 3PD0A 1PL6A 1RWKA 4HXGA 1M8FA 2WMYA 4XVRA 2A1TR 2ID9A 3TQOA 3EFEA 2BKAA 5IC4A 5E7MA 5FHQA 2FCAA 1JLRA 4GC9A 3TYXA 5C5EA 4PPFA 4RKWA 3NG1A 4I6EA 3JQCA 2JJ1D 3LUKA 3C6MA 1G8GA 3ONVA 5BN3B 3G1TA 3ED1A 1OPXA 3I6ZA 4N82A 3HXPA 1I14A 1KE2A 1G8MA 4O6VA 5M5BA 4ZOCA 1R7RA 1CDOA 1IHOA 4PSAA 3ZTTA 1HZZC 1J9ZA 3ZV3A 3C2QA 3F7NA 4Y2SA 3ZCXA 2XZOA 1TF7A 4COOA 4MINA 1HT0A 4LJ5A 2A9KA 3V7YA 3WSTA 1MOQA 1A7UA 1UXKA 4DNOA 2CV2A 2R5WA 4E46A 3B3QA 4D3SA 3LY9A 2NUPB 2WWHA 1QTQA 1T2EA 3TJZA 2WKPA 2I34A 2UYYA 5KMGB 3TLAA 3C4JA 1HL3A 4FR0A 2VP6A 4WADA 3HDTA 4W1QA 2P62A 2J32A 4ZO6A 4E1BA 4BB9A 3C7KA 4F1WA 4F6CA 4DB4A 2XRMA 2XB2A 3MS2A 2GK7A 1ZM9A 4IIGA 2UZ4A 1HOXA 1ZIPA 2JK0A 3E3LA 3IH5A 2N3ZA 3LWDA 4EY6A 4MQLA 4A36A 5B4UA 1EXNA 3ZJ5A 5JQGB 1LI7A 2QWXA 4KFRA 5KNCH 3I39X 3TTVA 1W1IA 4G5RA 5K0CA 4WAUA 2QSYA 2A2ZA 4HNSA 4DR2B 5BN5A 2VT6A 3I2FA 4KQ1A 3IE1A 1DARA 4QJ4A 3LQ4A 1U7TA 2GXUA 2KB0A 1LNZA 5TJ9A 3WRXA 2VF8A 3BOSA 4BNGA 5KU1A 1UT6A 2XIJA 2IH5A 1CB7A 4MVJD 4X7RA 4CDGA 2GPNA 4YT8A 5K01A 2JBHA 4NC9A 3TNJA 3FPCA 1KPGA 4WRRA 4PPNA 3EGWA 1CSEE 2BYTA 3GOQA 1WXDA 3VR5H 5DOZA 3JWIA 5LU9A 1ID8A 1TQ8A 1M74A 1KZ9A 3LQYA 2AFIE 2DGDA 3DG9A 3G7NA 2IEZA 3TLMA 3WHPA 2PZ8A 2Q45A 1K66A 1NLZA 2R2AA 3E8SA 5THQA 4B8ZA 4M46A 4BP9A 1Z0DA 2ZS7A 2F1RA 3ABOB 5EE9A 2A7QA 2F67A 2W6ZA 4ZOQI 4YRPA 2LP4Y 3O4VA 5J2TB 3O95A 2PZEA 3M9WA 5B58C 1W36D 4CLXA 3A36A 4LECA 2GEUA 4NMHA 3NNSA 4MVJP 4OYLA 2Q3LA 3F5QA 4IO1A 5REQA 4JQSA 2HPHA 2W2QA 5KDDA 3TZ6A 1QYXA 3CGWA 4OO3A 5D3MA 1TPZA 4FHZA 4MI9A 3GJ5A 1ISPA 3TLBA 4YR7A 4J0FA 3WQRA 1PEKE 2WG0A 5JXWA 2AFHB 3ZWBA 3R7SA 1HNZB 2JLRA 5P8WA 3KAKA 4Z4CA 2Q5JA 3PQDA 1RWPA 1WETA 2CFOA 2EWWA 2PH1A 4FZRA 3BF8A 1C7QA 1ETHA 5EUBA 5GONA 1Q0ZA 5IBPA 3SC2A 1SN7A 4FILA 3PV0A 3PLAE 2ZTSA 1JHMA 1ZINA 2ZYVX 2KM1A 4D0LB 4DBLE 5DLYA 4NDNE 4WQMA 2JCBA 3GDFA 1FXSA 3ZHZA 1VZ3A 1Z28A 2BBSA 1Q92A 3PU6A 1QDEA 2FPIA 4OGWA 1TYZA 4HNUA 1PD1A 2QZ4A 2H65A 2OV4A 3EPRA 4R2IA 2YWJA 2J08A 5HJ5A 2ET6A 3UMMA 3T9CA 2FR8A 5HUHA 3MT0A 2POCA 1UFRA 1S9HA 4WXEA 5EP1A 4UVEA 3MGCA 3VYRB 3HE3A 4DSAA 1E1QD 5FUMA 2I7CA 4MJXA 1XJ5A 1VMIA 3WGKA 2JATA 3EBLA 4C4ZA 2QUJA 2O8CB 3BGIA 4JHXA 4KQEA 5I9NA 2IHYA 3EG5A 2NP6A 4ALNA 3ZCQA 4F5WA 1SRRA 2D7DA 2GZ1A 1IHDA 4MDHA 1NX6A 1C4XA 2NVBA 2J9XB 1JG4A 1DMSA 5DFAA 3UMCA 5KC8A 5KOHA 3TH5A 5I9LA 3IP1A 1RIFA 4L50A 1AKMA 5DMHA 4D46A 2GGSA 2O57A 1J2JA 4LJ8A 5FL3A 2ZBDA 1ZD1A 2EBUA 4YRDA 16PKA 2NVUB 3IKVA 1PLJA 2X8LA 4JB2A 3CNLA 1NOJA 2D74A 5FOXA 1IQUA 1N9KA 2CFCA 2UZIR 2IPOA 1NUSA 1ZEJA 1D2RA 1TLFA 2QP3A 2XF8A 3IDFA 3NDJA 2ZYAA 3BE6A 3OA2A 3ZHCA 5IHPA 1DGQA 3ZY4A 1I01A 4GHWA 4IWXA 1Z6AA 2FNAA 1ZUIA 2BGMA 2NTEA 3O2JA 4R54A 2ZJ5A 3T6KA 4MR9A 1NFRA 1G8AA 2IDJA 3K5WA 3KR1A 2OFFA 3N2KB 3VC2A 2QBYA 1FJHA 2FGJA 3HB0A 3KD2A 2JLVA 5G2OA 3GN2A 6REQB 1YE3A 2YWDA 1HFJA 3K1AA 3BXGA 4I4LA 3UV6A 1SCUA 1KO4A 1V5EA 3ZLTA 4D80A 1TC1A 4C20A 2W6QA 3KKQA 4N5DA 5DZSA 4EGCB 3HYSA 5JDIA 5BVGA 3FYSA 4PXSA 1QIIA 3N2GA 3IP9A 3AZPA 4W63A 2XQJA 4WZBE 2PLAA 3OOHA 1NVFA 1VI6A 2FG6C 1HXHA 3GRPA 1SXJD 4GF5A 4EY4A 5H81A 4V0OA 2RH8A 3A2KA 4ZAFA 1IN6A 1P2BA 4DCNA 5IDWA 2BI4A 2FZ4A 3RFFA 3ZWCA 4HEA1 2RAPA 1E3EA 1L4MA 2X8JA 1BRMA 3V97A 3IQZA 4XIIA 4ZYZA 5LWQA 4UMDA 1OFUX 3DDZX 4MUBA 3ZWXA 5HZHA 3PKIA 5TEWA 3OF2A 4QDKA 1IG0A 3BILA 1K3FA 1ZSYA 5HF5A 2VDWA 3PTLA 1QIMA 4P1ZA 2GZSA 2H1OA 3ZDRA 1B2LA 3LXXA 3NWOA 2CNDA 3A11A 1LB1B 4G8CA 1Z33A 3G0DA 1Q17A 3VU3A 1T35A 4XUGB 2TECE 2YH2A 1GP2A 2IKSA 4EHDA 4MGEA 1H4SA 4DABA 4G89A 4EGSA 4EITA 2I3AA 3FGOA 2C7OA 1REQB 2CK3D 4NOMA 1U5AA 1XEXB 3WNCA 1US8A 5AOBA 2VYVA 1EFCA 4MB6A 1QHXA 4ESOA 4EYGA 2OCAA 3KXDA 3ADDA 3WO0A 3PQ7A 5LLSA 3P0HA 4DR1B 3V9PA 2WAAA 2B30A 1N4AA 3LT1A 5FL7D 3SMQA 3EIEA 1U8CB 4HVAA 5HKLA 3VR4D 3UOGA 1XKLA 2Q2NA 2IFTA 3AUTA 3H2GA 2ALJA 2WM9B 4H60A 1J2YA 4MHTA 2RHLA 3GLGE 3OSZA 2WIKA 5JT1A 5SYAA 2YWCA 3F7TA 3H19A 3BGDA 3UZUA 1YRWA 4IHKA 4YRCA 4EDHA 1XJWA 1XVTA 1ONOA 3ZK7A 2XNJA 4G1CA 3EZGA 2YFKA 3H16A 1V43A 4P4NA 4B0PA 5H0IA 1NBAA 1Y1RA 2P9JA 2NV6A 3PB3A 3RVBA 1AXGA 4ER0A 5A5VA 5HK8A 2OQIA 1PVDA 4W1SA 1Q2XA 3HCAA 1SKMA 2OCPA 5KYGA 4FMBB 1E7WA 2CJFA 1UINA 3HM2A 4R41A 5TE9A 1KYIA 1U8YA 3ZWQA 3V32A 4Y2QA 2P6MA 3A8TA 3ZWKA 5FBKA 4US2R 1ELOA 2Q4TA 4RAOA 4K9LA 5CM8B 1XZPA 2J0VA 1AZWA 5LVAA 1G59A 4L9WA 3WIEA 1E3IA 1YI8A 3HU1A 3JASB 4EG5A 5J1SB 1FRFS 1Z8HA 1QIJA 4R7TA 3TQFA 1ZKMA 4LSWA 3RU2A 1H8ED 1UZUA 2IXBA 5E1OA 2BSXA 1Q74A 1NJ2A 1G4HA 1SK8A 2WJ3A 1DX6A 3RUPA 1DKLA 2BGJA 2EKBA 1M6VB 4D9NA 1GR1A 2QZ9A 3NBAA 4E94A 1HF3A 2YINC 2MHCA 3MUOA 4UDYX 3NPAA 5AT1A 2HZ7A 1NM5C 4KVAA 4S24A 4PX2A 3MIIA 1M54A 1NNUA 3ISVA 2O05A 3FSGA 1JQDA 3C3MA 3HI6A 4Z3OA 3AUKA 4LY3A 2P27A 2ZR9A 3ZPXA 4F6LA 3RVLA 5AKYA 1VBKA 5HRUA 1KERA 2QQFA 3LPNA 1NAHA 2R68A 4F3CA 1JN0A 3BBPA 1BQ3A 4TTPA 3PUXA 1SRQA 4M7WA 1LLCA 1K8ZB 1PBNA 1PQWA 3VMMA 5B58T 3LO8A 1FJGB 3MTIA 4F97A 1EFVA 1P6UA 1QKIA 1YIDA 3W05A 3RUDA 4DEVA 3EEOA 5C31A 2Y68A 4Y9DA 3T5GA 3KQLA 1N3YA 4EPVA 3WBJA 3DDUA 2G7ZA 3PFCA 4Z51A 1GSHA 5MN6A 2R7AA 3CY6A 1Y37A 3PA6A 4TYMA 5L3SA 4LJRA 4S1TA 1D6NA 2J3DA 2FPPA 1O8BA 2QX8A 3ROTA 1DCMA 2V1XA 4GSYA 2P6PA 5DDIP 4DXAA 4YRIA 2PUEA 1XU4A 2J3QA 2YBDA 2OK7A 1E1RD 3HA5A 2HNBA 2XYQA 3I45A 3K4QA 1DEOA 3RANA 4K8OA 4UCFA 3VOTA 4UAUA 2IBTA 3O4FA 1GCGA 2V3VA 3F6RA 1QONA 2P9ZA 3FRIA 3HKDA 4LC1A 3N76A 1QFMA 2IT1A 2V55B 2WY2D 3VPFA 1SK9A 5K0SA 4PEVA 4IS2A 3VPHA 1ATZA 2NTNA 2ZQYA 3BD8A 4IIHA 4RULA 3KSAC 4GDFA 3KM0A 1LGYA 4LYDA 4BFCA 4UPEA 2E5FA 2C2WA 1N5KA 2NZUG 1K8YB 4N0EA 3P9KA 5D1HA 2B4YA 5FTMA 4G0NA 4Q7KA 4A7PA 3WOHA 4F06A 4QOJA 3IALA 4EJ2A 3QP9A 3L84A 2AG6A 2JEOA 2XOXA 4H18A 1ONPA 1FXWF 2GZMA 4NCJA 4B43A 2H8GA 4EKGA 2HTFA 2F9MA 2ZSJA 2CUKA 2OM6A 4OB8A 4EY3A 5KTOA 5H9VA 1N5OX 5CVVA 1VYHA 4YUVA 1SKBA 4FMCF 4HDSB 2W8BA 4IIXA 1FDTA 4W8GA 1BX0A 4W9NC 3NB0A 1VYVA 2W37A 1OR8A 4B3RB 1LWOA 2OV8A 1E1CB 1YCHA 4U2CA 1TTTA 2UZAA 2YWEA 3GJ4A 4OP3A 3CURA 3V8BA 1MW8X 4X94A 1ZM7A 3DKIA 2PYDA 4P92A 3Q87B 2OQVA 4XVHA 4XZ3A 1M9NA 3USZA 1Z5VA 3WNDA 5E0OA 4G0WA 2M6KA 2DBVO 2B3TA 3QI2A 4GIBA 2XNKA 5D01A 3UHAA 2F4NA 1G6KA 4CQMA 3EAFA 2X40A 3IDAA 3EZ9A 1V3VA 4JROA 3ST7A 2FVXA 5BWLA 8MHTA 1X7WA 1JSZA 2B7BA 2NQTA 1CUWA 2ZEJA 3JR7A 1QNFA 3QXXA 4WXYB 3HUUA 3NH6A 4J29A 4A8HA 2Z4SA 5IZ4A 4I6JA 1W94A 2DERA 5E6SB 3KWJA 3WLEA 4P98A 4EB6A 4QTYA 2QK4A 2TMKA 1YBVA 3UH0A 4NESA 2R66A 3E05A 3MMSA 1G1MA 1UQTA 5HCNA 3P2EA 3NBYC 1V71A 1A95A 2BI8A 2HA6A 5F1YA 5K9ZA 4KR2A 1AHHA 3BXPA 4V0LA 5A4JA 2YNMA 1U6IA 3H99A 1NL3A 4L8FA 4M60A 1QH1A 1W1WA 1ZJWA 5T6BA 1WJGA 4EVQA 4NBKA 3ICVA 3L8DA 3Q9UA 1UMCB 1VJCA 1JLHA 2GPSA 2ISQA 1NP3A 4ZVTA 3TKAA 4JT4A 1RQGA 2PH3A 4ZGBA 1GM5A 4IZOA 2D13A 3AF1A 4ZI7A 4BO0A 4IPTA 2PWAA 1AQNA 4MW7A 4MOWA 4N5HX 5G1NA 1XHFA 2HSEA 3MS7A 5I4CA 1UDCA 1HM5A 3KR0A 1QCZA 1FNNA 3ZWYA 1H2BA 3H13A 3CKKA 2VJLA 1JPNA 3FWNA 2YN4A 1ZL0A 1E98A 2H1IA 1AX9A 2WM3A 1G9TA 3QPCA 4HYYA 1YHZA 2YYYA 1KO8A 3KE9A 1RXSA 3NHJA 3EUFA 1P74A 4D0SA 4HB4A 1N9GB 1YNSA 2Q6TA 1ZRSA 1QQAA 1EBFA 1G291 3TZCA 2BUAA 1Z4PX 4Y2HA 4YP5A 3GHYA 2QMEA 3H2JA 5EOVA 4JB0A 4HB3A 4PYRA 1NW8A 4QKQA 2HO4A 1G18A 4OXXA 1Q7TA 4OP2A 4S1OA 3OZSA 4JC4A 3UJ6A 1AUOA 4BVFA 3CSSA 1EI9A 3KUCA 5A02A 3EYAA 5BT9A 4JP5A 4GBED 1M8GA 1Z38A 2JZNA 3ZE8A 3K6SA 3OQMA 4QTXA 4NCKA 1DFGA 5IG2A 3BKWA 4M8SA 1LVUA 5GM2A 2PAAA 2QTLA 3MCUA 2PXCA 4L27A 3BFPA 4XJVA 2C82A 4KAAA 1R4AA 3DFMA 1V11B 4A82A 4LHXA 4XIJA 3CBGA 1BD4A 5TQ0A 5AHXA 4LV6A 3RSQA 1ZITA 3WTBA 5I7FA 2LCIA 1C3OB 5JMOA 2D3TA 5BMVB 1GTZA 3JATB 3MCAA 5H3HA 3EIWA 5EHXA 4X8HA 3B20A 3ZHYA 1XF1A 4DW8A 4YCNA 3OD1A 4FKMA 4ZAYA 1P1IA 1XTSA 2W2KB 4KWEA 4WLNA 4BMXA 2VNIA 2PKWA 1IZ7A 5ER6A 2J9FB 2VF7A 3O8QA 4ENWA 1A9QA 2D5LA 1MHTA 2JGNA 1Y82A 1ML4A 2WBLC 3KUUA 4HWPA 1RBQA 4JUFA 3GPDG 4MJ3A 4DSOA 5C3MA 3V1MA 3TRKA 2VDPB 3TZHA 4WEOA 1OHHA 2FYTA 3CQ9A 1FPQA 1GAWA 3I92A 1G21E 3JQ6A 4QYMA 4E4YA 4H7PA 5G02A 5HS4A 4RV5A 2YHIB 4D9KA 3LXRA 1J8YF 4JCCA 4AZ3B 1ZRNA 4X1KB 4X7PA 1OQAA 1GQSA 1P5ZB 1Y4ZA 4H7KA 1L4LA 4HPWA 1G5TA 2LR0A 1BJTA 1FSZA 2DH5A 2I6TA 3PEWA 4BJ5A 2OKCA 3D8BA 4FB5A 4Q4JB 2D1QA 1PTJC 5BNTA 3W0LB 3AR4A 4NMMA 1EGVB 4WNYA 5IDVA 2DB3A 3F3MA 1P7PA 2DPLA 4BYGA 1E69A 3EK2A 3A14A 2SCUA 2JHFA 1CDZA 3MJHA 3VA7A 4F2GA 4IIVA 2NU7B 3Q3EA 4JLDA 4DVGA 2QE7A 1IIBA 1TECE 5GJWC 1CJVC 4LMBA 1M1YE 3LWZA 1E0JA 3SKXA 1NNEA 3ZZNA 2W00A 4FFRA 3HKEB 3OKFA 3HR7A 3ZXXA 2A35A 4EJMA 3NC4A 4CL3A 5JUWA 1QV9A 5DEOA 3NH9A 4BX0A 4LKOA 1ULSA 1MF7A 3U40A 1BS9A 4HX2A 3HVUA 4WN9A 4YJHB 4E6EA 4ZGWA 1TQ2A 2J3LA 5KTMA 1XA0A 1L3CA 2QTFA 3MYRA 4KMRA 3QBTA 1XNJA 5A7HA 3T1YB 4JX9A 2PQMA 4LXXA 2JEZA 1BWRA 2ZIAA 2XBMA 4UUNA 1A8PA 3RC2A 3A2MA 2IEAA 1UZAA 3NYIA 5AM2A 2ENWA 4MP3A 4CDRA 4W7IA 2QP4A 2X4DA 4O1MA 3FKSD 4YMUA 3JARA 1U5BA 1WO8A 4WHMA 4Y6RA 3DLHA 4MW6A 1X13A 4NI5A 1NZJA 4NZ9A 2YZGA 4F0JA 2XCUA 1F2UA 2AOTB 3HU3A 2A9FA 4PFKA 1BN6A 2GPBA 4C4AA 4O3MA 4BMYA 2QTBA 2QM8A 1HWYA 4DA8A 4XPIA 1H2EA 2YIVX 4ID3A 1TLTA 1NJGA 4MLDA 2J1LA 4MJLA 4P7FA 4YXWA 3WLIA 5BXYA 2QI9C 4OF4A 3UQYS 1KJIA 1TK9A 3HO1A 3F6BX 4LE1A 3MFQA 5DF1A 3TTUA 3PLRA 1OWMA 2HA5A 4RDHA 5L53A 5FO0A 4I8DA 1F0KA 1X1AA 2H2HA 2IUFA 1Y3DE 2ZJ8A 4IILA 4MWOA 4BX9A 3AJDA 4HDKB 5C1DA 1SURA 1F5SA 2DPYA 2C92A 5C46F 1RYFA 2JH9A 4J0GA 4F4JA 4JOQA 5IYZA 4ZT2A 1KMHB 3GJXC 1PO7A 4PFJA 4GAEA 4AUMA 4QM7A 1S8AA 4R0VA 3RB8A 3UG6A 4AYTA 1M0EA 1SUSA 4P22A 1XXHA 4XLLA 1EJ2A 4MQMA 2F7SA 3K71B 3ESBA 1TT7A 4MLCA 3PLNA 1GL9B 3N6XA 2QL7A 3OMWA 4TPKA 5B36A 4MXDA 2IW3A 2HRZA 3G0BA 3T54A 4GPTA 1GRRA 4DKJA 3N0VA 2EKPA 1QF7A 5BUCA 4JJ6A 4MW2A 2ZAMA 1OVGA 3REQA 1ZOPA 5H83A 1N1MA 4HZGA 4DNFA 1RLOA 2O3SA 1T8YA 2V7WA 1EIWA 1NV9A 2V6FA 4I1IA 3AOEC 4OKSA 1ZQ9A 1RRKA 4V0MA 1PL0A 3UJ3X 3V4RA 1DNPA 3MGBA 3SNKA 4F96A 1O9HA 4M0UA 3SM9A 4TV9A 2WKSA 4C4RA 5CXUA 1UBSB 2EX0A 3EA0A 5JSHA 1FQKA 1PW5A 3F90A 3IO5A 2P7HA 4HQLA 4B1FA 3WYAA 2OHFA 4ZANA 5ADVA 1KJ8A 2Q2WA 2RC5A 3RC9A 2YFYA 1WMSA 1K7EB 5ERXA 5T3UA 3HFGA 1BDBA 1H23A 1JYFA 4M8IA 3VR3A 4G5QA 5DM60 1I9CA 2LDBA 2VXBA 4LVUA 3HPRA 3UMVA 1IHXA 1NXSA 5KBYA 1U3VA 2QAGB 5HOQA 2JD1A 1SBIA 1W19A 1ESNA 3OICA 1C1DB 2BEWB 3LFTA 3P9RA 3CZAA 4H16A 2XGJA 1QYRA 3OIFA 4TUYA 1XK6A 1PL8A 1XWWA 3G8CA 4RPKA 3ZV5A 1QWOA 4LISA 1V6AA 4LTNA 5A9TA 1NUUA 1ZD8A 2X9QA 2YVAA 3DYBA 3BZWA 3OZXA 2VTDA 4IGAA 2CXSA 5KREA 1K8RA 4RTLA 1VHQA 3ICEA 1H2WA 1G3RA 2AFVA 5BOSA 3ZWDA 3MINB 2QR5A 2PDAA 3L0ZA 1HRKA 5ITZA 4JHLA 1TA0A 1M2JA 4FINA 4L8LA 3WZ2A 3ZCPA 4LMRA 4YREA 1ZN8A 4HYEA 4TLLB 5KNDH 3EXEA 4WCFC 3VM6A 1L5OA 3AO0B 1OBFO 3VR5D 4BJHB 1ECJA 3V2GA 4AULA 4EKYA 1UAGA 4M9RA 4Y18A 5REQB 4BX3A 4RTJA 3J7AC 2BJWA 2BY4A 2RHJA 4URUR 1OH7A 2QW0X 3IBCA 3P26A 3H7AA 4ND5A 3W06A 1BX3A 4Z7JA 5LQJA 3RS3A 3RRJA 1PWXA 4L6AA 3TLGA 1LDMA 3B82A 4KG7A 7YASA 2O59A 4TMZA 3WIDA 3PHIA 1Z47A 1NXVA 3TECE 2B94A 4IH9A 4C30A 1JMKC 3IUEA 1CRWG 2DH6A 1USUA 2NLOA 5IDYA 1N33B 3SC6A 1CCWA 2IEIA 1ADJA 3H1TA 1VHLA 4GE3A 4PIPA 4OQNA 5A0VA 2RB5A 5LBIA 3TW4A 2WDZA 3TSCA 2H5IA 5EHQA 1NQTA 1OC4A 1SC3A 2DLNA 3NDRA 4N49A 4F5ZA 4HAXA 5C18A 3TVYA 2PLFA 4UU8A 2BGLA 2I71A 4CKWB 5I5EA 3CNNA 4P36A 1O6FA 4JC5A 2VHCA 4Q1CA 4B6GA 4P0QB 2HNKA 1JJFA 3I01A 3AGPA 1N2SA 1SMKA 2PGJA 4OI2A 5FAXA 5FPPA 4UHEA 1N0UA 2B2XA 3FMOB 3RUCA 3VAZA 2PS3A 1MR3F 4KODA 4X90A 3I6QA 4RDIA 2J8ZA 2HX1A 2DULA 3AMVA 5FUVA 3CRVA 4D8WA 1BEZA 1QHYA 5DTJA 3MCWA 2PNJA 1JR4A 3SHFA 3TI7A 1W0JA 2OCDA 3WP1B 5AUPB 5K0ZA 3VU9A 1DX4A 4OUKX 1TAQA 4N3GA 5AM4A 2AS0A 5ICCA 4ZAVA 3ROXA 2P4HX 3I9KA 3PT9A 1CR0A 4GPEA 4TKUA 2ZZNA 1R10A 2J59A 1CLEA 1MFPA 2JKYA 3B1VA 3R6WA 3DBOB 4XFDA 1MIHA 2VXOA 4KK3A 1T5LA 2BGNA 2EW2A 3H6HA 2A9VA 3G2JA 3OFVA 3K8ZA 4G9BA 1YRBA 4MV3A 1O0CA 3PC8A 1BFKA 1Z5PA 2VXYA 3U7QA 5JR3A 3ELDA 2IS4A 3OJFA 1LPAB 5IDXA 2PJRA 2QMUA 4G56A 4F3YA 1T0UA 2OORC 2OLKA 4CCYB 4BQFA 3OZRA 4A16A 1ZRHA 2V0CA 3ABRB 2CLSA 1ANKA 3DKKA 2CNWA 2NN3C 2RG7A 4TL8A 3SZMA 2E2WA 4V3CA 3TRJA 1VB5A 5LQNA 5LYJF 4DR7B 2C07A 3RUIA 1EM8A 3VJLA 1TMYA 3CTPA 3H0EA 1N2CE 3HVKA 5FPHA 4AWBA 4CETA 5D7BA 5JY6A 1J1UA 2GR9A 1H1LB 2BGUA 1V8PA 1AV7A 3WRYA 4C7KA 2HCBA 5IFLA 3SF8A 1WHTB 3JYNA 3P9XA 2FCRA 3W4KA 1JPUA 2WJ4A 2I1WA 1UF9A 5B1HA 1ZJJA 5F7XA 1XTZA 5DXJA 4QPPA 4YT2A 1SO8A 4RKFA 1Q20A 1NJSA 2DPHA 4P08A 2PTGA 5J4KA 1GR0A 4ZI3A 4KTTE 2XQGA 3EOBI 4ZXFA 4G0ZA 1MABB 1RKUA 3C1OA 3N2GB 3PK0A 4DYVA 4DSZA 1WR8A 2HDWA 5MFZA 1ZIXA 3RS4A 1FDIA 4C89A 2BM9A 3GT0A 4LA4A 5CRIA 4JJGA 2GJ4A 3KPVA 1ZUWA 4P32A 2B6HA 2XQVA 1GPH1 4ZIRA 1MT3A 1KDYA 2IIBA 1XIVA 4Z99A 1Z0SA 1T2DA 3OZIA 2GZRA 4QM6A 3OCZA 3RD5A 4OBXA 1E1KA 4DIUA 4F7WA 4RBNA 3I53A 5DX0A 1LPSA 2AMJA 4WACA 4X3OA 5LZ8A 3WFJA 5HZGA 4ARIA 2VDWB 5CITA 4WBNB 3GUCA 4TV8F 4LJ7A 3EXHC 4MSUA 3DA8A 1NTOA 3UGKA 5AW0A 5H7XA 1T0PA 1U63A 5CDTA 2MINA 4BE7B 3B51X 4TVSA 4JOSA 3W9BA 4BTEA 5EZ5A 1BXGA 1GWNA 1EK5A 5DRTA 5EN4A 4YP9A 3KQPA 1A2QA 4IMIB 4I3FA 4HDNA 4LY9A 3O82A 3JWPA 3OHMA 3L6CA 3V34A 4EEZA 4IOJA 1US8B 4KMSA 2KMLA 1BA3A 2HF8A 5HX7A 2GAOA 1MD9A 3OIDA 4DIFA 4MRPA 4UMFA 1CS0B 2ZSHA 4RCVA 5IX8A 2H00A 1QPGA 5JZSA 1NMQA 4BASA 3FPJA 1J0XO 1XQVA 3M3PA 3SKVA 1D2CA 3N6VA 2OD9A 2OHHA 4HEQA 4LCBA 2QY9A 3FNRA 4DEYA 4ZFNA 2B8EA 1QFSA 5A1JA 5K5EA 3K5IA 2DC1A 2Q1XA 3MJSA 2DFKB 1NW6A 2IHJA 5H16A 3EC1A 4PNZA 4AUNA 5ITVA 3EIHA 3FKQA 4NH0A 5JC1A 1Z82A 5GMOA 3RLIA 1M6YA 3PYXA 4X93A 3WE7A 3OOYA 3W5AA 4NNOA 2D54A 2NSHA 2PU5A 4IJKA 2PRZA 4YUWA 3URKA 1OXVA 3UJBA 3GGPA 4A0SA 5EJ6A 3L6UA 4Z5XA 4Q18A 2GETA 3HNOA 4NBWA 4TLEA 1FFWA 5JATA 1JB1A 2V7VA 4NCXA 1W2WB 5EZYB 1MJGM 4CM6A 2W43A 3OCVA 5CJPA 4KPUB 3AERA 4LRQA 2P3OA 3PL5A 3Q7TA 4OXIA 3GLFE 4C2AA 2JS7A 1O9GA 3V5NA 2QGNA 4I99A 1AUXA 1YKFA 3LC2O 4KIGA 4RD6A 5AKHA 3BG5A 3K31A 3O6VA 5B30A 3REOA 3VBEA 4FWIB 3PUVA 3QWIA 4EVRA 4MCHA 3BJIC 4C0QC 4UTXA 3OJ0A 4WERA 5CHEA 3O3MB 2WJHA 1E2FA 2B4TO 3QELB 1XZLA 3LLUA 3N2IA 4FCTA 3FR8A 1RS0A 5CR9A 3MAAC 4BFZA 3O8CA 1O7JA 7MDHA 5DV9A 3IQIX 1XTQA 2GA8A 3ZI0A 3D7NA 1XZMA 4G0PA 5EZSA 4UFPA 1MJHA 2PX4A 4KO4S 4UHDA 5F76A 2WRZA 1EFVB 1T2AA 2NXCA 3IQHX 2X1HA 5BW8A 4XWWA 3KKLA 1JQ3A 4MUMA 5T67A 4CTOA 4ESVA 2OO3A 2A5GA 1X8KA 1LA2A 3AEZA 3MAJA 3GD5A 2ZAGA 5CDHA 2Q3DA 3PC6A 3SEQA 1E9CA 5EP2A 1X15A 1CZRA 4BNUA 4OKNA 5JE8A 1I2BA 5TARA 3WV4A 5KHAA 1ZMXA 4MPJA 4DMLA 1KJNA 1V16A 5AXBA 3SYLA 1M0TA 4GL4A 1ZBDA 5B2EA 2G9VA 5DULA 1G8JA 2Z6AA 1MPTA 4OP1A 4DY4A 2VJNA 2WOJA 3ZY3A 3MF4A 2O2EA 2FSPA 1XDGA 2PSDA 1YZLA 4TMWA 5A62A 3ZDFA 3BN3A 4GPAA 2FUNB 4P80A 2I54A 1K3TA 2VO1A 2EWVA 3BK2A 5A2GA 1UXIA 3CV3A 1LY1A 2D5IA 5KKNB 2BFCA 3E9ZA 1TQHA 3PXEA 3QRWA 3UPUA 3GJTA 4RS4A 1MAVA 5EA2A 1O94C 3LKZA 5DSXA 4CQJA 1UM9B 2BM1A 1QBKC 3NO4A 2HSZA 3P96A 3PVZA 4OQ4A 3JAKB 3CG4A 3Q85A 2WZQA 2XUIA 4PXYA 4BC0A 4OPMA 5A6VA 4ZHQB 3GBPA 4KIFA 3S2UA 2GT1A 3KJFA 1JL3A 3U4IA 4RHTA 1CG6A 3DTVD 4A5SA 3A0UA 4GR4A 1MT0A 1SKYB 2HMYB 2DETA 4OY3A 2QPLA 5ALRA 1AGNA 1T0BA 3G2NA 3Q2IA 4UM9D 1ZN9A 3HA3A 4B73A 1AOXA 5F3WB 5FQNA 3LLMA 3O26A 2ZJ6A 1EP3B 5E0KB 4BNIA 4C2BA 2R6ZA 4DSUA 5AI6A 3FOFC 4Z0HO 3E7PA 3LZCA 4E51A 3INTA 4WZBB 4PS0A 1RE1A 4TMXA 5K03A 1PUJA 3JTMA 5JMWA 4FHDA 3M8KA 2AHOA 1OASA 2W9XA 3ZJ4A 1WA5A 4CQMB 3BWVA 3HO6A 5E1MA 5CLLA 4HH0A 2UUAB 1RACA 5CB8A 1C14A 3QNMA 1OKKA 1J09A 3EMDA 1NASA 1KVQA 5F33A 4YALA 3ZU4A 4N03A 3K0CA 4EB6B 5EIBC 4RKRA 3QOYA 4C5BA 4DUGD 1L7MA 1SY7A 1FLNA 3G6WA 4RVCA 2BEVB 3NANA 1USVA 2JFYA 1LDYA 2P9EA 3HH8A 1QRDA 1Y34E 3L7NA 1XCOA 2YJ3A 3R3VA 2DBQA 2XW6A 2ZRNA 3L4BC 3LF2A 3MJDA 5DBHX 4AKSA 3ZHSA 3RNLA 4AUEA 4CMEC 1TYAE 2PEYA 4U0KA 1MBZA 1WXEA 2FFRA 3DBIA 4EYEA 5ELXA 2PYZA 5TVKA 2AEMA 1QCDA 2ARKA 4HNAA 5G0SA 1G3IA 3LCUA 2GKOA 1LC0A 1RADA 1IEVA 1U9IC 2NZ2A 4GLFA 4X9XA 3U5TA 2JLCA 1T8RA 2FTKE 4BE4A 2PD3A 3VNBA 4JMPA 1PRYA 2VTEA 5E1BA 3JYQA 5GOTA 1LDBA 1W52X 1QV6A 2A3RA 4TWIA 4HN9A 5IXSA 3C5HA 3HADA 4E07A 3SXUA 2CEKA 4RS3A 3I64A 3MWEA 4AS2A 1F48A 3CLVA 3KSUA 2A14A 3PUZA 4HWKA 4O3FA 4WKPA 2ZROA 4MHOA 1Y6GA 4GMHA 1SXQA 4AP9A 1GAEO 3IUYA 3ZY5A 1GG5A 3DAYA 2CHQA 4L0QA 4U2KA 4ZREA 7ABPA 1F9AA 4TYWA 1N1DA 1RNLA 1UUFA 4GMFA 2B7CA 2FP4B 3LFHA 4GM1A 3L2OB 4LI0A 4OQPA 1RMTA 5BUQA 2O6HA 3EDYA 1ORIA 1XE3A 3JQBA 4PICA 3IT2A 3ORQA 1GNTA 4Q19A 4ZVPA 4UUPA 4AQ7A 3TLXA 2JCXA 3RBAA 4E5UA 1K27A 2QN6A 3HDJA 2BEJA 3WYFA 3KL2A 1IEWA 4G0QA 1PR5A 3KHSA 3UWPA 1KWKA 5K51A 3C1AA 1IVSA 2H63A 1ECCA 3BJMA 4DZZA 4OHKA 1F0NA 4H77A 2DKNA 1RM0A 1WDMA 1XYYA 1SZDA 1NJ6A 4JYBA 4Z2AA 1WW2A 1XCLA 3E61A 2B2CA 3FFWA 1DAOA 4B7AA 1N2XA 2HWXA 2M6RA 1E5LA 2OBBA 2ODTX 2JW5A 3LKDA 5C1OA 1MX3A 3GDWA 2HK9A 2JFNA 3I83A 4D3YA 1GV0A 5I7VA 1U0TA 2C04A 2OOKA 4KQHA 5ESWA 1NRJB 5TGTA 1ZVVA 4HXYA 4DUZB 3T3HA 3MD0A 3SZLA 2A30A 5ALIA 4MLZA 3QVGA 2VA8A 4MMXB 3OI7A 2F17A 3JQ8A 4N9WA 3GRKA 3TTWA 4F8EA 2QLTA 3G5UA 4RA9A 3B1JA 1RJDA 3DLPX 1JAXA 3BRWA 5EJ8A 4JBIA 5JFGA 1U2TA 1XZDA 3D02A 5IVKA 4GE0A 2XUFA 1USKA 4HC4A 2CXRA 4F5EA 2ODEA 1EFRD 2OT3B 3G1WA 1X7XA 2CXOA 5TMEA 2AR0A 5K6AC 3IOCA 1M83A 3ENVA 4JYPA 1DKUA 1JS1X 1YR2A 2P2NA 2Q3JA 3OZ7A 5ALOA 2HJHA 3RW9A 2BH2A 3DVAB 5FI5A 3LC7O 3J81k 1GTSA 2QVBA 1QE5A 3ODPA 4KUHA 3D7RA 5CJ2A 3CNHA 2FSUA 2YY5A 3VOSA 5LR6A 3VZBA 1AQUA 1DAIA 2C1XA 4F2PA 1T6BY 4LZJA 1BH6A 1WDWB 2O3UA 3UK7A 2C03A 2ZU0C 3DH0A 3K53A 1G2QA 4H17A 4C1NA 1DELA 4MEAA 4QBFA 1OJLA 4L72A 4BBPA 2HBYA 2HZBA 1IBCA 2CJWA 1DO2A 2JLBA 3AUJB 4HUQA 4XGKA 1E1YA 3WQBA 3JAWB 3L8CA 5JCJD 2CLCX 2JIMA 1FRVA 2OZPA 1XQXA 3PUKA 2O50A 4GI1A 4F85A 3PFNA 4N8EA 4YWJA 1W5FA 1PW7A 1UMDB 2H7CA 1QQ5A 2PR7A 1N6OA 4X63A 3OCUA 3WG9A 3DAOA 3ETDA 2QTWB 4M1ZA 2FRVA 3OEHD 3GARA 2R751 5C8XA 4XM1A 4U3JA 4XDGA 3I1FA 4L1KA 4OM7A 3TW0A 4IO0A 1FQWA 5CFPA 5HDQA 3ZQUA 4CM7A 2XV1A 1QZUA 1FRZA 5K0BA 1ZGBA 2V0GA 1RFGE 2ANCA 1B8UA 3KZXA 2WMDA 5ETJA 2DLCX 3CRW1 1YZUA 3P2JA 3THXB 3RNOA 4KN5A 1YB2A 3FYUC 3I4LA 5C8DA 3I4FA 3DMPA 3ITEA 4ZCPA 3SEZA 4ATNA 2VJOA 4JUIA 1KO7A 3WY9A 1JDSA 1KYZA 2PGDA 4ERXA 3U6KA 3CM0A 3VH3A 4M6WA 4ARAA 5IMSA 3C0KA 3SYKA 1AM4D 2XZPA 2CV1A 3GJ8A 1MX9A 3EIUA 1NZDA 2C58A 3A1EA 3E3AA 2IS6A 3OX4A 5HM8A 2WSIA 3DOJA 4OHOA 4I9FA 1IHPA 3KT8A 2KWIA 2QI9F 4PC1A 1QGED 5JSZA 4KRYA 1NDQA 1CEEA 2W11A 2HIGA 3GI1A 5A3SA 4MWSA 4RIIA 4R9UC 2VP0A 4Q3OA 4WBXC 2I91A 1EEXB 3F8TA 4N0PA 2P6RA 3LWBA 3IE0A 3L8YA 1Y8CA 1DKMA 3NHYA 5E38A 1JMYA 3OM8A 5IPFA 2WJWA 2XITA 3DULA 3G7SA 3VYUB 2GM4A 4RZUA 3SU8A 3Q98A 2C88A 4I19A 2AFRA 2HOQA 5HGJA 3UJAA 3T99A 4P5PA 3I3SR 2A3NA 2AYXA 2GN2A 4W8OA 4KITB 1FOEB 4BKRA 2FQ1A 4YCJA 1XPRA 3FNFA 3JVIA 3OM0A 1QZXA 2I4NA 5J4VA 1MLDA 1VE5A 1VI2A 2QPTA 2PMWB 4KXVA 1EFAA 1TB4A 2C94A 3B5IA 2IYFA 3E81A 4ZVQA 1VLQA 2DJ5A 2QN8A 2XODA 3ETNA 2EJBA 2WJYA 3H3FA 3UWSA 2ZWMA 3ZWMA 4ND2A 4MUNA 1P4JA 1UC4B 4XSHA 1ZD2P 3GD7A 4HAUA 2GCIA 3UB4A 2Q5LA 1Q95A 3U4MA 4RJJA 3OY7A 4FNAA 2HBQA 5JZBA 4DE5A 1IBRA 1KYWA 2PXAA 2P8SA 4OHVA 1SZPA 2RGRA 1Z34A 4GICA 4UBOA 3G7UA 2FSGA 3I0NA 2PSSA 1VPLA 1OZFA 2VUHB 3E84A 3DWIA 1P0FA 3MBIA 4J91A 5JPCA 3NUZA 3LTNC 3QXCA 4GZ6A 1G3MA 1KSJA 2QD4A 3QE2A 4GUAA 4UHCA 2IRWA 3HUTA 1FZTA 3A6PC 3RADC 5GP1A 3DO6A 2ZBGA 4MWZA 4L7VA 4OFWA 2FJUA 3FA2A 3JPYA 4J0EA 1ULTA 5FBLB 5A2QA 1XNQB 3R23A 1FTYA 4XJSA 1SR8A 3QBEA 4G8JA 5I3CA 2J0UA 1M5RA 5KJFA 3TBFA 3K32A 3FTEA 4CN8A 5E8RA 5GIOE 5BQ3A 3EXAA 2XGMA 2W6MA 3OZDA 3DPSA 5B3KA 2C31A 2ZWIA 3DM5A 3ZK9A 1FNBA 1HC7A 2HF9A 5CYGA 1NSYA 4R2JA 3PNQA 2LKDA 3I04M 4M1WA 4PYKA 3U3ZA 3P0EA 1ULAA 3MOIA 2WVGA 4M3NA 4G0YA 2IHKA 4YVFA 5FA6A 5BOSB 4XYBA 3STUA 1HBJA 2DT8A 3COSA 4K6KA 3L18A 2CKDA 2FPLA 2NZYA 4CKCB 1Q7EA 1RYMA 2XVAA 4MV8A 4XUDA 2KX7A 1WABA 2Q1UA 1CUCA 2GJ8A 4G6ZA 5JAZA 3F4KA 1ZD5A 2UVPA 1AH2A 2Z6VA 3ACDA 3AU8A 2NPIA 3BWEA 3ADOA 4BNKA 3UMSA 5GADl 4UAVA 4QQFA 3PNSA 3SJZA 3ESRA 2ZYSA 1PR3A 3PCRB 1XTUA 2Y99A 3RSCA 1WKCA 1CQIB 4HS9A 1NMXA 1H6CA 3LUBA 4QLAA 1P2DA 4ESEA 1XTRA 2IY8A 1ESDA 1PX2A 1QHEA 3UJCA 4L5IA 5K3EA 3ROZA 3FZYA 1TDJA 2OILA 3WGNA 3ETHA 1KP9A 1KC1A 4NABA 1Z68A 1COZA 3SIXA 1O58A 3B1WA 4PSKA 2PJUA 3HA7A 2CXXA 2I55A 3LT0A 2PWBA 2GBGA 3LHSA 2C4NA 1T0JB 1WUTA 1G9SA 2M1XA 1XTVA 4UMEA 2ZUEA 3N3BC 5JBIA 3NEYA 1O77A 4JIMA 1DBSA 4Q1BA 1M6EX 4Q01A 4E4TA 2C9CA 2GD2A 1XD8A 3FGZA 3OIWA 2G76A 5HJ7A 1KO5A 4B0OA 2BKVA 5L95A 4ENVA 4JAVC 1YRHA 4HAVA 4DDMA 3AVXA 3R7LA 3GWGA 4KGVA 2GUGA 4KJZA 4EGAA 4WUVA 4BNHA 2CLDX 4Q9DA 4A8JB 2YMLA 1KZYC 2PJDA 4LRXA 1I5EA 3AVUA 1A9RA 1UK7A 3CKLA 1DIRA 3NT4A 4JL6A 1DADA 1GGMA 2KE5A 4JBYA 4MP6A 4R2WA 2PUAA 1JDBC 1GQFA 2DR3A 4C7OB 5T4HA 3A9TA 3TR5A 3X1KA 1OX6A 1I6WA 4UKDA 3ZZ1A 2O8EA 2B7LA 5AVYA 3U1TA 3GFFA 3ABQB 1FMLA 3HB9A 3MAGA 4XW2A 4R1UA 4YDHB 3CR7A 2O2DA 3ONWA 4FYMA 2OBLA 4ZV9A 3VR2D 1R0WA 1KMMA 2PX5A 2P68A 3GP5A 3D6UA 3TXXA 1EM8B 1TAGA 3AGQA 5B3AA 4DT1B 2GVDC 3IKJA 4ZT6A 4AF6A 5BV0A 1P60A 1IN1A 1KOLA 2X76A 3IQXA 4TKMA 3C8HA 4N5MA 5C3UA 1KFJB 5HTOA 3E5NA 4II3A 1Z5UA 2Y1OA 3COWA 4XYMA 1M3SA 3O73A 1CERA 1XEAA 2QMQA 4C7BA 1TMKA 2JCVA 4W5WA 1V47A 4X6LA 2WIDA 3FX2A 2IYTA 4KACA 1Y33E 3ZJYA 3ANTA 2I2AA 1KJYA 4GZLA 3R75A 4AMGA 4E03A 5SY4A 5H82A 1GUFA 1FLAA 2HJWA 3FOWA 3MPUA 3NGLA 3C3XA 3O90A 4J0QA 1GGVA 2OTCA 4TYNA 1XD2A 5EAIA 1OC2A 2G7MC 2FN4A 5FV4A 5JI3E 4H4CA 1FTSA 3TD6A 4FBLA 3HJAA 4XTCS 5JCOA 2C2GA 2OGZA 3FM9A 3OLYA 3VKGA 2EJWA 2YV2A 3VNUA 2Q1YA 3W8FA 3OE7A 1E4YA 1XGKA 1JIJA 2HJ9A 2ZUUA 4A4DA 1RXUA 5H9WA 1MC1A 2PIAA 1T15A 1QDUA 6ABPA 3F5MA 4AX4A 5AM5A 4JI2B 4KE7A 2E4XA 1I3NA 2H18A 3NCHA 5AI5A 2WPNA 4WKCA 3FOZA 3A3KA 3WLNA 1X7YA 4KR3A 5B3JC 4TS3A 3DR3A 2QN7A 5K3FA 4BLQA 3KSMA 4BNWA 4DIEA 3RYFB 3IQDB 2A67A 3BCHA 5L3QA 4M1SA 4NECA 2VAXA 2PK3A 3CO0S 4UVGA 1WIWA 1M2WA 2NX2A 2ZCJA 3FOAA 4MUHA 4PSCA 1RJFA 2QU7A 4YRRA 4DMHA 4O4JB 2B37A 3HRIA 2AVNA 5EGNA 4AXXA 2QDXA 3L1JA 4RD3A 4U5XA 4F93B 2MSDB 1BXGB 3DZGA 2DKFA 4K05A 5FFMA 2CHVA 2W2OA 4BV2A 5I51A 4HFRA 1MC8A 1M2GA 4K03A 3N74A 4KBYA 1LJ8A 2EEPA 4JBWA 5DGDA 2LTAA 4GSKA 3B48A 2Z5GA 2QVYX 2VQFB 4L2IA 1MKYA 3AFNA 4HAZA 3V8QA 4DSNA 4M9UA 1YZKA 2WB2A 1UOEA 4QSHA 2P2LA 1N7JA 4J16A 2Z0MA 2Q4RA 2AQ8A 2GO1A 3S55A 3R0VA 3EZ2A 2FN9A 2JCYA 1Z5WA 1F1BA 1Y3CE 4GH5A 5LA6F 3SSMA 4CJXA 3GHHA 2C20A 2BGGA 2Q0QA 2CUNA 5FDFA 2JLZA 3SZ3A 5A4MS 1MDBA 3H83A 4GXTA 4UE3S 3S8MA 3DW1X 2Z56A 4X24A 5B4TA 2A4KA 1MHPA 2I1LA 2QRNA 1KPHA 3TXAA 1B8VA 2GBCA 2Y6VA 1O94D 2J0EA 2ZXFA 2PVCA 3DL2A 3FIUA 3KTAB 1FMCA 4ZKEA 2X7JA 3M89A 4PHHA 5JASA 5LQDA 2IZ7A 2XWSA 5EXPA 4IDPA 3ZDQA 2ZJ2A 3DHNA 4IMPA 1NMZA 1TYBE 1W0KD 2GARA 3EDQA 4LYAA 4NDZA 1DBQA 1M7GA 1E99A 1HQKA 2ES4A 2I87A 3DZHA 3LY7A 3N5CA 3I9FA 4KXFB 4BZQA 1H0KA 1J0DA 1Q21A 4OAQA 4FFBA 1NLYA 3OIGA 2FR0A 4AY4A 1CW2B 1QH8A 2FOXA 1AMNA 2AC4A 3MWGA 2ZRHA 3FYDA 3VO2A 4IDGA 5CM9C 1E3WA 1SUEA 5BV2P 3BFKA 5C2JB 2REOA 1KZ4A 1ZQ1A 2C3YA 2QSJA 4KFCA 3K9FC 3EEFA 4I9UA 1EHIA 1GU1A 1EUDA 3EF1A 3FZGA 4DLLA 1AT1A 3GRZA 1JTFA 4RL6A 3ZCVA 2X7XA 2ONJA 1TUEA 3HRKA 1QZ3A 1F8FA 3ZTYA 4I7EA 1NYQA 3AEYA 3B3JA 2WB4A 4RY0A 4WXHA 5D7NA 3R7FA 4R8SA 5T64A 5K8VA 4RFSA 4JXXA 3BJZA 5FTNA 5E3IA 2GEJA 2Q5CA 5F4ZA 2Z1NA 4KUGA 3BICA 5AM3A 5LM3A 3W1VA 1AHNA 3SYRA 1VRWA 1N6KA 4IF4A 4L08A 3VPCA 5M04A 4XD7A 2ZCUA 5T5QA 4BC1A 3EGVA 3IRVA 4CKBB 2CHEA 2WJ6A 4FMDB 4DR6B 2CF6A 3TI9A 3I62A 1FDVA 1WSBA 1E6MA 2ZB3A 3O2QB 3FB1A 3FUCA 2V3WA 1AY0A 4OAOA 1YZGA 2CMKA 4UEJA 2YJTD 4GXRA 5ER9A 3OMLA 5EIBD 1VJTA 1D0SA 1VYUA 1VFPA 3JQFA 1W35A 1OSNA 2VEOA 1SGWA 3B1XA 1QB7A 3CZ4A 1COWA 3N8KA 3QW2A 3R5FA 4JJIA 3O4GA 3R7DA 3DEHA 1DBPA 2OMEA 1VJ0A 2J41A 2ZRBA 5HFAA 3VZCA 3WHIA 3TF5A 4RHEA 5D8DA 4BFTA 3IJEB 1IOWA 4UCWA 1HZZA 2W58A 3FZEA 5A9SB 1XD9A 1NVGA 2GBLC 3EPLA 3IE2A 2P35A 1BXKA 4BDTA 3EVDA 4OH7A 4Z7QB 5DBFA 2ONKA 3KYCA 2OAQ1 4IWNA 1Y5NA 4QTZA 2CDAA 3ZE9A 4EY5A 4G65A 4KV7A 1IQRA 1OWNA 4LAFA 4B71A 4JVLA 4E5KA 3EWIA 3KOZA 4OMFG 5EJIA 3SF0A 3H9BA 2P7IA 5F3RA 3RFCA 1ABEA 4IJMA 1DPGA 1RLIA 3FFTA 2VHWA 1DBIA 2RGYA 3F0TA 3U1BA 1P1BA 1P9WA 2H9IA 1HDEA 3E22B 3TKLA 2GXAA 1O0BA 1XPUA 4DN6A 5ABPA 3T41A 4EYOA 5TQ2B 1S4QA 2BLLA 2OB1A 3M4YA 3ZV6A 2NGRA 1JYEA 1MTOA 2WPDD 3SX4A 4K6OA 3L0IB 3UFXA 1TEVA 2Z8ZA 1TFUA 2WFAA 3TGPA 3TL2A 4P0PB 2DWCA 3FR7A 2I3GA 2X6TA 1TX4B 1R0XA 2BP7B 2PGAA 3A31A 3L4EA 1U7XA 1VGQA 2RG1A 4XAQA 5CHYA 3M49A 4NK4A 3TAHA 3NIFB 4KE6A 2Y1KA 4H3KB 4JGBA 1B42A 3AQ4A 3HCCA 4YNBA 4Y6QA 1IB0A 1KI3A 2Q1SA 3QVTA 4QVKA 3PG5A 1PQPA 3WL6A 2LW7A 3NOXA 5FV7A 4KGZA 4BGIA 1YFKA 3HZZA 3MXOA 5HCUA 1U7PA 3IURA 3WLOA 5FTJA 3FJYA 2DFPA 1GRCA 3JQGB 3HCEA 3JQAB 4ZQBA 5DI3B 2RHCA 4ZQGA 1DJOA 3EG9B 3JWHA 3WNBA 4CKZA 3H4VA 4OCZA 3AJEA 1M1NB 4QUKA 4W1PA 4XIGS 2C4WA 4ZAZA 3RUAA 4AQYB 3OLCX 1F4PA 3ROKA 2CZCA 4R8LA 2X6RA 4AROA 4EELA 3IMFA 1VCNA 1ILWA 3MELA 1ZGJA 2Q21A 5IU6A 1PZMA 4EG7A 2NZJA 3BMCA 5JROA 1XO1A 1FP7A 2NSYA 3TCKA 3UXHA 4BTVA 3I0MA 2P3QA 1C2TA 4BRSA 1YULA 4MUKA 2VDLB 1RM3A 2ZRLA 3DBLA 4QGGA 1G41A 2PFGA 3GV0A 3I28A 4RF3A 2H1WA 2P6OA 1JT9A 1HFEL 1V41E 4HNAB 3LZDA 3NHUA 4H6PA 1C30A 1GFIA 1GPNA 4URHA 4UTRA 5IANA 3OFNA 1FQOA 1YJAA 1GU0A 1YS9A 1E5QA 3QPUA 1DOAA 2DPMA 3FWZA 3DBHA 4Q1AA 4RORA 5GGXA 3TNDA 2JPDA 2CE7A 3HL4A 4Y67A 2JAWA 1EFPA 1E2QA 5AIBA 1USIA 1UEIA 3DHYA 4UNQA 1RRPA 1T36B 2YCLA 3LI2A 4ISBA 2LCFA 3TLZA 1I2ZA 1U2QA 3BL5A 4JL8A 4MWBA 2PPVA 1J1ZA 2CN1A 1DWUA 3B7GA 4NBLA 5A7GA 3FCUB 3UATA 1RABA 3W6PA 3Q7QA 1T1JA 1CY0A 3KKZA 2PZBA 4L5JA 5CBKA 1OIXA 1FFXA 2R87A 2JIDA 1WE2A 1APBA 2GNPA 1U0BB 2IEGA 3QYFA 3O03A 4LRYA 1OB5A 2RONA 3UV3A 3GMSA 4K2AA 1HURA 1EBUA 3C24A 3HQ4O 3WZLA 2YASA 2ZIXA 2PKYX 3RC3A 5HXAA 1X1EA 5CB0A 1PFWA 1U8FO 2O5CA 2GB4A 4ZOEA 4BV3A 5LNK6 1NE2A 4EPRA 3D0RA 3VPXA 4NJMA 3DWFA 2VG8A 3QQPA 3HSKA 2ERCA 5CVCA 1OZGA 1AGRA 3DONA 5CD1A 4QHTA 5ITSA 2B61A 4E5YA 3AP2A 3UUGA 2C5FA 1LBSA 1YE8A 3ZXYA 3WIBA 4WXPA 2XNDA 2XUAA 3OF5A 2II6A 2YJNA 3NJ4A 4POAA 3GEIA 5LYJA 4RO0A 1X0XA 1EK0A 3BXEA 2O7QA 1Z6XA 3I9NA 1I24A 4RA9B 1EXDA 1LNQA 4KRXA 4JENA 4OK6A 2Y1XA 5FB3A 3X44A 4QXOA 2QG4A 4H2DA 4BECA 2ZJFA 1UPFA 2JBAA 5CA0B 2CF5A 2O2SA 2XOEA 1TVKA 5DM2A 2CXPA 1X7XB 2CJPA 1ZCJA 2K7FA 4JITA 4G5YA 2ROQA 1GRVA 5BRAA 3MHPA 4GOJA 1ZH0A 2MSCB 4Q5IA 4QYIA 4AZVA 2ZJBA 2GBFA 9MHTA 3TTSA 4GLLA 2GYYA 4GX2A 4DC0A 3T7IA 3T3IA 3G8AA 1Z5OA 4B34A 5MN5A 2C3PA 3ZQKA 4MRMA 1QP7A 2BL4A 2IOFK 4RH3A 3D3NA 1G7CA 1Z3IX 4BLWA 3IUSA 3R2JA 3HSSA 4FOPA 4NE7A 1A77A 1QG6A 3JVVA 3TTXA 4AWAA 1V5WA 2L69A 4UULA 5CLGA 2WJVA 3C6YA 1MGOA 5H1YA 1YS6A 2RH9B 4ENUA 1PKEA 1DCFA 3FLEA 4P38A 1KI1A 1J4AA 3KC2A 4EHLA 4ZDJA 4WL0A 1RWNA 4D4MA 1Y80A 5DHTA 2O2CA 2P2SA 4NYIR 2ZBEA 3D8RA 4PW0A 3DOHA 1YZHA 3KPWA 3L8MA 1E9FA 2W71A 3V4PB 2VLIA 4UPVA 4BRZA 3S7TA 1TJPB 4OJYA 1T24A 4J9VA 3F8WA 1OPRA 3O92A 4UDOA 3SS7X 1XXHE 2WP8J 3ELUA 4BVEA 1PNQA 3HUFA 1Y7IA 4GOXA 2D0OB 2H17A 4JT2A 2CLLB 3LECA 3GT3A 4TV8A 5C52B 1P4RA 1TCVA 1PJQA 2NOAA 3PXDA 1NY5A 4REQB 3VV2A 4UXJA 4TMKA 3M6AA 5ALSA 1B4DA 4BLUA 4MQ5A 1H9AA 4TS4A 3G89A 5KWEA 1WBDA 5TF0A 1I36A 1VBFA 3RFTA 4O4LB 5JH7A 4IXWA 6PFKA 3C14C 1JEJA 3D6TB 1DCTA 5C34B 4DLSA 1XCBA 4INZA 4W7SA 2VSOA 2X4LA 4PO8A 5EJFA 1FP4B 5EIXA 3DPUA 3HI4A 4LCEA 4O2BA 3O9VA 2OG2A 2QOEA 3D54D 3G23A 3BXXA 1NI3A 4V0ME 3U4AA 4E2WA 2VL7A 2Z9CA 4YPOA 4ZGGA 5LP6B 1RJ9A 3CZRA 1WB5A 3IEKA 2AOWA 1JKIA 2C2KA 3P2KA 4IP0A 3GJ6A 4M6WB 4M89A 4ANFA 2CJYA 2IZ5A 1O5OA 3FVRA 4C01A 4A0HA 2NU9A 2PWPA 3R44A 4HKTA 1PNRA 1ODJA 2C8VA 5CMLA 2C7GA 2PR2A 1QJCA 4M1QA 4Y2UA 4DG8A 2JHCA 5A04A 5C5DA 3HUEA 3O83A 4QE3A 1YB5A 3AUSA 3F96A 4XEUA 3HCBA 4UDNA 3D1JA 3F98A 3PXGA 4MB0A 4KYTA 1N32B 1PZHA 2GYUA 3TLYA 1O95C 1TRHA 5BORA 2W8ZA 4NOLA 4UM7A 2RJOA 4L5BA 1XVUA 4GYYA 2IELA 3SNHA 3CZPA 1TI7A 3WGMA 3GG9A 3OPYB 1CP2A 1G0OA 2CFRA 2P11A 1QRAA 1IOVA 1N2BA 3EAGA 3R7NA 1OX4B 4B3IA 2PSEA 5ILOA 3RYTC 5DN6D 1PG0A 1PZXA 4MKGA 2PXXA 3C6BA 4HVCA 1GL6A 4IGKA 1DJMA 4WNIA 2QHXA 2QYHA 2VDJA 1G42A 1DXYA 3IUMA 4JEUA 3VR1A 2F3UA 4PS1A 3D7LA 1XTKA 3DDHA 3BIFA 1IK6A 1I1HA 1GN9A 1EDDA 1JIQA 3NORA 1MVOA 2ZGVA 2PUWA 1LBQA 3I2YX 4R6XA 2NO0A 4NE2A 1A8SA 4OXKA 3UOWA 2FHPA 4BGUA 3AQIA 2Y77A 4R1SA 2COUA 3WP0A 4R05A 3VH1A 1RKQA 2VPTA 1SD1A 3B1FA 2AI1A 4UDXX 4V39A 3ZVLA 3EAQA 4ZI5A 4K9KA 4CKXA 4KOEC 1V8BA 1Z0AA 2CVQA 1ABFA 4XB6B 2H1FA 3MSCA 4CMBA 4S2EA 3V7FA 1SXIA 3G1UA 2IF0A 3ISTA 3KXIA 1M6NA 3AT1A 4BRWA 4YMTA 3QU4A 2FZEA 1PT8A 4FHFA 1X39A 4DQVA 1CJTC 1SKUA 4WGGA 2VQ3A 4RTSA 1U4NA 3NBUA 3S2EA 1A1SA 5SZHB 1Y6QA 1ZGAA 1ZNXA 3U4CA 4PC7A 4NHEA 3UKJA 2GO7A 4M54A 1DVRA 4YAUA 4M36A 4ND8A 4BFYA 5AICA 2BFMA 4AMBA 4D92A 3ECAA 2HYIC 4D8YA 2LIVA 5LMUB 2D5BA 5I7HA 1I4LD 1YB1A 3DEJA 4RESA 5DHQA 3VSBA 2YMMA 2A0XA 2V7XA 3KZKA 3NDIA 4Y2PA 1SU4A 4MI6A 1Z4KA 3DVLA 2Z2JA 4G8DA 2WJGA 2JJ2A 2QQ0A 3IULA 2W2PA 3ER8A 1MAUA 3SZRA 1S0UA 1H8HA 3H2BA 1NKSA 4GT1A 2R5FA 3IQEA 3RVDA 2O23A 1E2PA 5FLXA 2JCSA 4XRRA 3U9LA 1U0LA 1ZU5A 2NO6A 3KFXA 3GAZA 1JIVA 4YPFA 2OXEA 5JQGF 3SJBA 1ONNA 2XMCA 2X3UA 2C2ZA 3NWBA 3GLHE 3KEOA 2JIZD 3QKIA 3V8NA 4LDRA 4J4HA 3SSNA 1A5BB 4JP3A 5F64A 4EUFA 3EEBA 2DFTA 1PF7E 4L15A 5CH8A 3WRXC 1CRPA 1USGA 2OE2A 2H3EA 3LVBA 2QAGC 2V7GA 3EHEA 3FYHA 3HSYA 3MUNA 4MS1B 1JDTA 1UFKA 3PTAA 2WAOA 2VTVA 4HV4A 1ODIA 1UIRA 4TSFD 4NULA 2VDUE 1IEQA 4E5DA 3RSZA 1JXMA 2IYAA 2JVKA 3T9AA 1I0IA 3DZ8A 1CUXA 5AK5A 3RTEA 1U7HA 4PZEA 3RG2A 4BLOA 2L42A 4WJLA 4A8TA 3CU5A 4TGLA 4E33A 5IABA 1JAHA 5J2TF 2X22A 3HBLA 2F43B 1RJEA 4W4TA 4PFSA 4XWGA 3HBFA 3LQKA 3FNHA 1XA3A 1NKVA 3GLUA 1UJNA 1Q16A 2C1ZA 1Y3IA 1YOBA 3WGIA 4I50B 1LTKA 2H08A 4RXUA 4JI6B 1RAFA 1V1RA 3COPA 1P9NA 1ZSNA 3MBKA 3NBXX 3O3CA 1ZK1A 4UUBA 4LWQA 5F3DA 4HUTA 3TTTA 1KC3A 1PT9A 3QKTA 4GNKA 2BJHA 2E4AA 1WSAA 3CUEF 1QQTA 3C3YA 3RF6A 3U3RA 2PSJA 2PH7A 1FFSA 1A4RA 4R0NA 3R8CA 3TSYA 2WD8A 3WMGA 5K20A 1EDBA 1WMAA 2BMDA 4GOMD 5K45A 1Q1BA 1BWSA 1IM2A 1POXA 3BTOA 5FTKA 3ZW7A 3L7AA 4LYHA 3F73A 3THYA 3AVTA 1BKDR 1ISIA 1UBHS 1GZ5A 1C9YA 2PS0A 1M1ZA 1UFVA 1XWIA 1Z4MA 2DBYA 3IBGA 3WNVA 3A1NA 4YLYA 4WLEA 1JHRA 2PGIA 2OC4A 3L8HA 1BIFA 1D4ZA 1AMUA 1S89A 1E2UA 2VAWA 4NS1A 4ZJPA 1VXOA 3HGQA 3FPKA 5DCLA 2AG5A 3VNAA 1OWOA 4CLRA 821PA 2FR8C 5FKJA 4DMUB 1W25A 3N07A 5SY6A 3EWNA 4CV0A 4Q9NA 3IPLA 4A92A 4X6YA 2B1RA 4JLJA 3EFOB 3AKCA 2YQ5A 2H7YA 1P8AA 2BDUA 1CUJA 5GJCA 3BZBA 1ZI9A 5HQJA 4Y7CA 5CBPA 3D6FA 2EGUA 5CD9A 2ZI9A 3B13B 4HN2A 1GEEA 4OJTA 2UDPA 4YASA 6AT1A 2BGWA 2IYRA 3DGFC 1FVXA 2QUAA 2YQ4A 3IIEA 1MDFA 3AL2A 3ICWA 4GNRA 5D3KA 5IKPA 1MH1A 4FYPA 2VI5A 1O96B 2WWFA 2YC2C 4OGLA 3ZY6A 2IHUA 3BA1A 2UUCB 2FEAA 5LKAA 4YRZA 3PNPA 1DRWA 2XMPA 2YIJA 4TT3D 1Y8RA 1XQWA 3A1CA 3W5SA 3NUGA 2Z98A 3DXYA 2CDCA 1VCHA 3HP7A 1A27A 2HSWA 1Q1QA 1V39A 3HHEA 2ZK7A 2JLAA 3CUYA 1TM3E 3LV8A 2ZWOA 4QO7A 2CXQA 5I8ZA 3V8EA 4ETMA 3ANMA 1MZPA 4GR5A 2JGMA 3E1KA 1DCKA 3LYHA 1QVAA 2FFHA 2IZ0A 3BL6A 4N7JA 1K7XB 5CJJA 2QY6A 3GLSA 3TQSA 5HW0A 2XY4A 3HHPA 5IKMA 6CHYA 1QXSA 1G5FA 2IOHA 2VJAA 1P73A 4WY2A 1X7YB 2DY1A 5U4XA 4M7RA 4BVHA 4AY2A 2VDKB 1XVIA 2OY0A 1C81A 5CT4A 2DUJA 1N8SA 1R50A 3NBMA 1OXBB 3EPJA 1CR1A 1LCIA 5DWDA 2DCMA 4OXQA 3OCXA 4D6YA 2NW6A 4DL9A 5AESA 4CODB 5JCZA 5LP1A 3CF6R 3ZIDA 5EZQA 1LW6E 5JDIC 4DMCA 3GVCA 5CM2Z 2YOFA 1L8LA 1T43A 3LNCA 1DQYA 3ZQ4A 3ASVA 1RWQA 3K20A 4EBFA 2CLFB 2YMPA 3GJ7A 2EG9A 4ZDKA 3LO5A 1DFHA 4MMZB 1ZJ6A 4W6QA 4OOEA 1FSGA 3NATA 1EWQA 3PGLA 5JNRA 1MO5A 3KVVA 3D2LA 3CLRC 2MSEB 2PANA 4L2IB 4PG8A 1ZKDA 4WN3A 3K70B 1DDIA 4ARCA 1J7KA 3II6X 4P7GA 4ENSA 4K0KB 5K3BA 4RVGA 5I47A 3GZJA 5SZKB 1F5NA 3AXTA 1HTWA 4Y9RA 5CVTA 3OUUA 5CLFA 1B00A 4CBVA 2W6ID 2OV3A 3FHJA 5DISB 1G66A 4H7IA 3E3MA 1ZISA 1YR6A 4JYMA 4JLAA 4XWYA 2O8DB 5CB4F 1O08A 2HLDD 5CYPA 4AZSA 4FYHA 1U4OA 1RCTE 4JASB 2FQWA 4Y0AA 3WR5A 1QAOA 4FPXA 4OLJA 2WZDA 3LXUX 2EP8A 3KTDA 3LFUA 1YK0A 4W7HA 3I2GA 4OKIA 1LLDA 1WZCA 1C3XA 3UXEA 2X58A 3VFDA 3N28A 4N7MA 4M99A 2C61A 4L8YA 4O4HA 5ELMA