4RSUA

Crystal structure of the light and hvem complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
VNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Light and Hvem Complex
rcsb
molecule keywords Tumor necrosis factor ligand superfamily member 14, soluble
molecule tags Immune system
source organism Homo sapiens
total genus 27
structure length 149
sequence length 149
chains with identical sequence B, C, G, H, I
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rsuA00
2JG9A 2E7AA 2HEYF 3B9IA 1O91A 5TSWA 1PK6C 5KWRA 4MXWA 3FC0A 3K51A 5HBAA 2HEWF 4F3JA 1IQAA 2QDNA 4QQLA 1OQDA 4MXVA 3B93A 3TWIA 1JTZX 3ALQA 2Z5WA 1KXGA 1D4VB 3ME2A 1RJ8A 5KC6A 3TYJA 4QQPA 1U5ZA 4GIQA 4QPYA 2WNUC 3IT8A 2ZPXA 4MSVA 2O0OA 2TUNA 4TSVA 3AB0A 1JH5A 2R6QA 4D7YA 1S55A 4G3YC 4HT1T 4KG8A 2RJLA 1A8MA 1D2QA 2Q1MA 2WNVC 5CIRA 1PK6B 4N90A 2JG8B 4QQHA 1OSGA 2QE3A 3LKJA 4KGQA 2TNFA 4OUMA 2RJKA 3QD6A 1DU3D 2AZ5A 3V56A 1PK6A 2JG9C 3L9JT 1C3HA 2JG8A 3K48A 5KC5A 1U5YA 2WNUB 2R30A 1C28A 1U5XA 4TWTA 1WCKA 4KGGA 4E4SA 5BNQA 2RE9A 2R32A 4G4FA 2OIIA 3WD5A 2WNVB 1TNRA 1XU2A 2X29A 1RJ7A 2WNUA 4QQOA 4OUSA 4J6GA 2HEVF 1KD7A 3MI8A 1ALYA 4EN0A 2JG8C 1D0GA 2WNVA 2Q8OA 4DOUA 2ZJCA 2JG9B 1GR3A 3URFA 1OQEA 5L19A 1DG6A 5L36A 1TNFA 4MXWB 3QBQA 4NN0A 3B94A 4QQ2A 1XU1A 4DB5A 1I9RA 2KA3A 4OULA 4RSUA 4E4DX
chains in the Genus database with same CATH superfamily
4IESA 4URAA 5D1IA 3AM2A 3PJYA 2B7YA 2YFZA 1OF3A 1Y9QA 4NVPA 4FFIA 1CONA 2YYOA 2A7AA 1J3QA 3MIGA 4IGOA 3DXTA 4D94A 4WM8B 4AQ2A 4CEYA 4JVAA 1OUXA 5FJHA 3GZEA 1K3IA 3IDAA 4QKNA 2QQUA 1GP5A 4X6RB 1QJU2 1R1A2 2QDRA 3LSDA 4FO9A 1KJLA 4LBQD 1W8ZA 3HNBM 1DQ5A 1ZBA1 3ZR6A 4L8QA 1RVF2 4MGZE 4JKMA 1CIWA 4P08A 3VZMA 2ADDA 3TYJA 2UWCA 4QXKA 2UU8A 1SBDA 3KGZA 3CEWA 2Y6HA 2JEMA 2WYFA 4P00B 1AL21 5B4NA 2FDIA 2ZHLA 3AMMA 1HB1A 1ULGA 4EZHA 1NQJA 4QHBA 1W9FA 2C26A 3JZVA 3VDCA 3AB0A 1CN1A 1V6OA 1UQXA 4AL9A 1M4WA 3VKOA 1IPKA 2P1BA 1SLBA 2I74A 2VMDA 2WLPA 1XNTA 2XUEA 3KCXA 4HT1T 1HQWA 5IUQA 4LO6B 4YGBA 4A4AA 1CJDA 1MS3A 2DCJA 3HVDA 4QQHA 4MUVA 5E16A 1WLDA 4MYEA 4AR2A 4JKLA 4OUMA 4S2GA 4Y26A 2GZWA 4BOWA 3A21A 2ILMA 2OKXA 3AKRA 2ZZQA 1QJFA 2GN7A 5K9YA 1N1TA 2CTVA 1O5UA 3NWKA 5FYIA 2GP3A 3DKWA 1EYBA 4L99A 5FLIA 5ABJA 3T09A 2VZ3A 5A70A 4YSFA 4JC1A 4I01A 1GZ9A 4IL7A 1VBE3 3ZSLA 1MS9A 3M3EA 3R4UA 1HB3A 3H3LA 5BNQA 1RUC3 4COWA 3RSJA 3PVNA 1B35A 5HI0A 1DQ2A 3WZ1A 1P8JA 1OI6A 1X9PA 3WG2A 3P6BA 3SHRA 1XU2A 1YWKA 1V70A 1UIJA 4GQ7A 2RM22 1LOFA 4RD7A 3WQBA 3O14A 2A6VA 2BNNA 1LR5A 5FZ9A 5BYNA 4YYOA 3DCQA 4RR3B 4J6GA 2D40A 3H1WA 4M0HA 4YVWC 1EV13 1ALYA 1SBEA 2AEZA 3P3NA 3LQCA 3HR9A 4LBKA 3S7EA 3ST7A 2WO1A 5E89A 4QB2A 5CFCB 2GALA 1NCRA 4MHRA 2ZGNA 5T5JA 2QCSB 1VBA1 2WSVA 1FMD3 4XEZA 4IGPA 4QM9A 2WINB 1HW5A 4JZRA 1J1LA 2BTVC 3UJQA 1IKQA 2OUJA 2OQ7A 3JB8A 2VTFA 4JTNA 2VW2A 4HKLA 4U2AA 1ODMA 3MV11 2R042 5JZGB 4YG0A 4JDNA 1PVC2 5KBFA 2A3YA 4FPGA 2P4EA 3M3IA 4YW7A 4UBGA 1W6NB 4FPFA 2J1UA 4LEJA 4KG0A 4R52A 4Y5SA 1WA4A 4OVEA 4C0HA 1O7FA 1S2BA 3ZX7A 2XKPA 5JI9A 5FZHA 2X05A 1CWPA 3KLSA 1XE7A 2OT7A 3MF9A 2W5FA 1NA1B 3N9OA 3ZSKA 1L7QA 1WZXA 2D97A 2XR4A 1OQDA 5JIUA 4Q8KA 5LCWL 3I2HA 4V1PA 3W9AA 3MV01 3HJRA 1WMFA 5FYVA 3OD0A 5J98B 4PT6A 1PM4A 3HPNA 3QH6A 2YGLA 4IUGA 2EF6A 4YVWA 1V6NA 2BFUS 4AYUA 2EAAA 2YFUA 4I09A 2B9VA 2ZPXA 2ZZJA 4ASMB 3BPSA 1O5LA 4K20A 1U12A 2O0OA 3GALA 2K2SA 2XVLA 4FPCA 4NJ4A 3I59B 1XYOA 1NY72 2V4AA 3AP5A 1ZBA2 4OYUA 4QPGB 3AJZA 4LULA 1A8MA 5JVVA 2JKBA 3NKGA 4E2SA 2BVVA 4AOCA 3K4DA 4Q4V1 2F17A 1HRV2 3POFA 4ARXA 1ZZ8A 1CZSA 4BWOA 2ZCWA 2NMNA 3J7LA 1AL22 1KFXL 2GU9A 1BZWA 5CG9A 4AVAA 4ZPIA 4BCUA 2XB6C 2UURA 2VQUA 2XBO1 3N36A 3RZLA 4JTOA 2VMFA 1LHNA 2D3PA 3OUIA 3ZN6A 4FTEA 3WXPA 4CU7A 3KVAA 4HFSA 2FCTA 4L97A 1SPPB 4AEKA 1ZZ6A 4OHZA 1AXZA 4I3PA 5BNOA 3MLJA 4I0BA 2VVDA 2VBBA 4D7TA 4MGQA 1RUF2 2WA4A 1QJY2 4O9EA 5IWFA 3THPA 1CAXA 4JV4A 4RS5B 4MGYE 3GJBA 4TWTA 1Y9GA 1UYPA 3CBNA 2DU1A 3WDXA 4ZKTB 4OQ8A 5CISA 3KT1A 5DG2A 2PHXA 4HN1A 2VMCA 3G6JB 3VKMA 1ZNPA 4CP0A 5FBZA 1VMHA 3HNMA 3FHIB 1VALA 2ES3A 4QX2A 2ETEA 2VO5A 1MACA 1TVGA 5FK7A 5F32A 3VD3A 1WGPA 5EV7A 5IVBA 3U37A 3OSDA 4YVSA 1UX7A 5FYHA 3VBUC 4XFGA 1W6MB 4K1ZA 1NOVA 1SMVA 3ZN4A 5JI7A 3AMPA 3VZNA 3U75A 2X53S 3LEKA 3ZMOA 2QQVA 5CZKA 1EUUA 1OF4A 5LBEA 3URFA 4E4HA 1F5JA 3GBFA 1JS9A 4KI5M 2R063 3R05A 1JZ7A 1RUH3 2ORXA 3BB6A 4P5HA 3AVRA 2C5DA 3T3YA 4KNCA 1FPN3 1LEMA 3T1LA 4IV3C 1FYUA 1OD5A 3IDCB 4V2VA 1JU3A 4Q8LA 4XMAA 4LUKA 2DCKA 3S7IA 3ZSJA 5BNNC 2K0GA 1W2OA 4XXPA 5A1LA 5CFDB 1WLTA 1W3VA 4G9SB 3DN7A 2ZGKA 2VNOA 1OXCA 4YPJA 2E6VA 1JMUB 5FAXA 3WNPA 5IYYA 1SEFA 1PK6C 2WWSA 3T2QA 2VZTA 3T2TA 2OX0A 5F3EA 1AYN2 4HSJA 2I2SA 1JXNA 1TME3 1XE0A 2BOJA 4XF9A 3WQ0A 2B42B 5A7NA 1XSQA 1QOTA 1AR73 1LGBA 1OVPA 4LA3A 3AJYA 2D98A 1J84A 3BODA 4FT8A 4GB33 3ROUA 4O65A 1UZWA 2R1BA 5F3IA 5BPXA 2ZOEB 3O0VA 3V0BB 2CAUA 1VBC3 2BP6A 2D6KA 4JHTA 5JSOA 4W6WA 3OB8A 5EQUA 5FPXA 3GZUC 5GM0A 4M00A 2VQTA 5FPBA 2W3JA 3FUQA 5LEKA 2LUWA 3WR0A 1RMU3 2YUEA 2GNTA 2JDAA 3FX3A 4QMAA 4D8MA 2VQ0A 1LOBA 4AK3A 3MICA 4KBBA 2CSGA 3NQHA 2W1SA 1WCUA 3POJA 4FOQA 4GMP1 5A6ZA 2J1SA 2WNVC 4ISRA 1MPXA 2GNDA 3P5BA 3BI3A 3AZWA 4KU7A 5GLTA 5I0UA 3CJIC 2Y6KA 1W06A 5JR7B 2VUJA 3MIHA 4CDWB 1Q8QA 1QHDA 2ZKNA 4CVUA 5BNNA 1G8WA 5AC93 2TNFA 4CPBD 3WP6A 1RHI2 3UJOA 3J8F1 2JDUA 2VZQA 4IERA 2A70A 2ATFA 2W87A 2HWF1 5IVYA 4AFDA 3BCWA 2Q5TA 1YI9A 4LLOA 4ET7A 2F4PA 1SFNA 1Q5OA 3WHTA 5J09A 1CAVA 1PK6A 3B02A 1H9WA 3ZFFC 5FPUA 4M3CB 5JAXA 1LECA 4XW3A 2WYSA 3PUSA 2D6OX 4LOTA 5FP9A 3USSA 1S1AA 2IXIA 1XPWA 2HWE3 1IZ3A 4YFZA 1HQNA 1L7RA 5CVRA 4P5YA 5I8TA 4QXCA 4E4ZA 4JQRA 4XURA 1COV1 3J4UH 3RPQA 1REDA 1W8TA 5I0RA 1OD3A 2D93A 1WW5A 3AC0A 3SCHA 3J9SA 2AGSA 2XWBB 4CCCA 3WW3A 4UW3A 4YLZA 5FP8A 1NE6A 1IS3A 3DYMA 4NUBA 1C4RA 1OURA 3ZXDA 1K5JA 1BLZA 3I2KA 4EN0A 4QU1A 1V9U3 1X33A 3AKPA 4PDWB 3AYEA 5JMOA 4FOVA 4Q26A 2WNVA 1UL9A 1Y3TA 2QTWB 5GLWA 1RUE3 1XC6A 3BALA 5A7SA 2ARAA 1W8FA 1WUVA 4DO0A 3CJIA 1DG6A 1LKNA 3MFAA 4H7MA 4IE0A 3OJBA 5F3GA 5LA9A 4TZDA 3W21A 1QJU3 1C57A 1R1A3 1O4YA 3TEWA 1VJ2A 1X8MA 1S0GA 3H3UA 3JB4C 4XQWA 5FZ1A 2W1QA 2OPWA 4CDUA 3I2DA 1RVF3 3ZFFA 2DTYA 3O0WA 5B4XA 2XHNA 4LKDA 5CKMA 3B9IA 5FZEA 4CSWA 3H8RA 3D4KA 5TSWA 5IW0A 1R092 1SQ4A 4GKXA 1UPSA 3K51A 3LA3A 3LIHA 1GOFA 1IQDC 1MZEA 3M3QA 1XNDA 1ZYBA 2RS31 3A23A 1HB2A 2GC0A 2VZRA 4QQLA 2ZEXA 5FWJA 4IEUA 1IS6A 1ZREA 5T3NA 2BOIA 4BQ3A 2DCYA 3JUUA 2NN8A 1ENRA 2V72A 5F7UA 3MW4A 4Z2WA 2WZR3 3THCA 1NCQC 3V65A 2XKOA 4W50A 4ZY9A 4NOTA 1J3PA 1FT9A 1XYNA 1ULEA 1W9WA 3ZYJB 2WFPA 2W91A 4P9WA 3E5QA 4A42A 2ZEZA 1QJX3 4MOAA 4N53C 3ZN5A 1QH7A 1HV1A 2JJ6A 5C71A 3BIWE 1F9KA 3PVEA 4KG8A 1D2QA 2Q1MA 1AR93 1FNYA 2GSYA 2ZMLA 5F5IA 2WNOA 3WCRA 1PZ8A 4DIQA 1F8VA 1VLNA 4WZFA 1LNSA 3APBA 3DEMA 1OPOA 4PHZA 2BUKA 1R083 4KGQA 4DMIA 3TEZA 1M06G 3D82A 5K8SA 3PVOA 4A7YA 2A6XA 5IK7A 1F15A 1H1MA 1PGW2 1VBB1 5G04L 3CZJA 4FVVA 4NPMA 4BLIA 2R49A 4CZSA 2RM23 1UXXX 5D2AA 1UD1A 1C5HA 4N7IA 4Q5OA 2JG8A 3QACA 3RWKX 3J7NA 3WG4A 3GCXA 4Y22B 2YDEA 1HJGA 1OFNA 4Y1YA 2WNUB 1DGRN 4XBLA 2B46X 5D21A 4FOYA 4Q4W1 1SLAA 5FQ0A 1O6UA 4Q4X1 2V4VA 3VBSB 1US2A 2DUOA 2I07B 2RE9A 2J1AA 3J8F2 3UGHA 1G86A 2J22A 1QIQA 4A3XA 5FO8B 2W9XA 2OIIA 1SCSA 2XMLA 4BMBA 1UY1A 2RR13 2H6BA 4GH4C 2Q1FA 1G6NA 2W95A 2HWD1 4AI9A 1O4TA 4QHZA 1VBD2 4K6BA 2D6NA 1DDLA 1Q8OA 4CXWA 1OA2A 2R043 3O1RA 2E63A 3VD7A 3O1TA 4EV0A 3FL7A 4IGQA 2HEVF 4A41A 4KU8A 1VRH2 1I5ZA 3VDBA 3BTXA 3JD71 4LIUA 1VR3A 1ND3C 2D43A 3NV3A 2CHHA 2R072 2YC4A 4QXHA 5DAQA 1PMHX 1YRZA 2VMHA 5EZWA 1YQCA 3D3AA 3MHZA 1EPZA 1Q8SA 3FWEA 4MGSA 3S57A 1J83A 2IXJA 1JODA 4UW5A 3KQ4B 5FZ4A 1PO21 4NHYA 5FMCA 4DB5A 2I45A 5LB6A 1NZCA 5GKAC 3H1YA 2XDVA 1UOJA 4LMFA 3WF4A 1AYM1 4AAPA 4SBVA 2X09A 1MEC1 5FYZA 3TN92 3POGA 4RL7A 3RYPA 1APNA 4DRRA 5FYCA 4H2AA 1TMF1 5KXBA 3H8UA 1VE0A 2QQOA 2XJTA 5KWRA 1GWKA 2WLQA 3FC0A 5FXXA 2PELA 2G9ZA 5EWSA 1S2KA 1RUI1 1FNZA 1JYWA 2VXJA 3FBYA 4B7KA 2PHLA 3NAPB 1UU4A 1HQLA 2VU9A 3OY8B 3OBZA 5C9AB 4XF1A 2VCCA 3AZVA 4GH4A 3A4UA 4BQ5A 1XJAA 3IDEA 2Y33A 4K3UA 3ON7A 3H8OA 1OLME 1SFYA 2JICA 4BDVB 3RI9A 4NIIA 1N3QA 3WSOA 3ZSMA 3D5OA 1AL23 4Y20A 3SLIA 4YZ3A 5DN2A 5I0TA 2WZEA 5LK7B 2FZ2A 2BU9A 3LFMA 4FQZA 4P9IA 1UXZA 3ZKUA 2BVBA 3IN9A 4MSVA 2TUNA 4EWEA 1ND3A 1CZTA 1FATA 5F39A 5T54A 3VDDA 1HXS2 1JH5A 5EJZB 5FUNA 3KV4A 4AEDB 1GP6A 1H8TB 3CQOA 3HT2A 4XFHA 5GALA 3ZXGA 1NUKA 3GNEA 3PUAA 5FR3A 4H55A 4NO4A 3NV1A 3RI8A 2ZAAA 4CEWB 1NE4A 4RGAA 3B69A 4MO3M 3UKTA 4BLJA 2OXBA 3WF3A 3DKQA 2YU1A 5FRAA 2QQPA 2P3KA 2XQXA 2VL4A 2YPDA 2QZ3A 4Q0UA 4LJHA 1QNWA 3WEZA 2CGOA 1NYWA 1LU1A 2JIJA 5K0UB 3VGIA 1WW7A 4ATEA 3M2MA 3OUJA 5E88A 5FZ3A 4PQ9A 1HJFA 1PX3A 5KC5A 3ASIA 5BY5A 1EPWA 1BVP1 4A6SA 5GLUA 2WQZC 3MO4A 3VBFC 5BUVA 3JXSA 5FY5A 5JLVA 3VHOA 2CL2A 2O14A 5IATA 3O7OA 3KM5A 1Z7S1 2BV4A 4FPKA 1F4HA 3M4FA 4CXXA 3RZGA 2VVFA 2YMZA 2ZGTA 1H2MA 1S0DA 4IEOA 3H42B 2C6SA 1DQ1A 2UWAA 3LEGA 5A33B 1CIYA 4IXLA 5I0DA 4CU6A 2VCBA 2IUWA 4CDQC 3UGFA 1BBT2 1UOFA 3WF1A 5FZOA 1W99A 2UY9A 4DUWA 2FDJA 4CP9A 5IAVA 2C0ZA 4GKYA 3UKNA 3INAA 3S30A 3ECQA 3HOBA 1DGRA 4QKBA 1KD7A 2EXHA 4I3GA 5L7OC 3SQOA 5A32B 4JAAA 4Q4W2 1NLQA 1GBGA 3VBHB 4ZZ5A 4Q4X2 3RGBA 5A3UA 2JDKA 4QKDA 3LDKA 1POV0 4JRLA 1VBA3 1SLTA 3B01A 3DPRC 3CMGA 3POWA 4JKKA 4QDQA 1F35A 4TLGA 2LALA 3MGUA 5GZGA 1JU4A 2X5IA 2HWD2 3N9MA 1H1AA 2XJSA 3AP7A 2C24A 3AXDA 1WMEA 1YNAA 4CEYB 4Z8BA 1LHOA 2PN5A 4ISQA 2JDYA 4AQTA 4LPLA 4F8AA 5FPLA 4OMCA 5A3TA 2L9LA 1V00A 1UU6A 5ERLA 5C8CC 1OQ1A 3CKHA 3KZ4C 5FZ7A 4A7KA 1MQTC 2EIEA 4YM1A 3TEXA 5FXVA 4QGNA 5EXOA 4CDXC 1PVC1 3VBFA 4NR1A 2B39A 1Y4WA 2PLV2 3PU8A 1GZTA 3LF7A 3Q8AA 1LHVA 4B4PA 5CG8A 5AFBA 4MXWA 1US3A 1RB8G 3ES1A 5F5AA 3M70A 4YGDA 5L9BA 4B1LA 4HBNA 4PCRA 3WNOA 4B4QA 5HBAA 2UWBA 2GC3A 2GN3A 4CCOA 4AF9A 2DVFA 1OLMA 4LBOA 4ZXEA 4CU9A 5FWEA 2WIIB 1HN0A 1CX1A 2A3XA 1S0FA 5FJKA 3PMSA 5JXHA 4CDQA 4FBFA 4XTPA 4CPBA 2ZGPA 5I0SA 1TMF2 5C3OA 4XXAA 2IXHA 1NG0A 2VULA 5GZEA 5L7OA 2MNGA 2VM9A 1AR62 1QF3A 3OG2A 1W8WA 4RFT0 3WCSA 1RUI2 2DUQA 3CZUA 3DPRA 2H6CA 3VBRC 2ENRA 4Y1ZA 1AX2A 4D7YA 4J1XA 3I2FA 3K2OA 2QZ2A 4P9JA 4Q4V3 3GYDA 4D6SA 2XGXA 5FZ0A 5FP4A 4UAPA 2N7GA 2WJSA 1JUIA 5ABJB 1NY71 2DBNA 5FMDA 5JXJA 1E57A 3IPVA 4NHKA 4FFFA 3WG1A 5C8CA 3SITA 2XBO3 3C3VA 2B45X 2GMEA 3AK0A 1HRV1 4WM8C 1MQTA 2VMEA 4E2QA 3VB9A 3MLKA 4EJRA 1YFYA 3DYPA 1GQPA 1K5MB 1RXFA 3OF1A 1ND2C 1ASJ2 4CDXA 3BOPA 1PIV2 1B35B 3NVCA 4BYYA 2JG9C 2LRPA 1K45A 3VD5A 3WP5A 2YG0A 2Z4FA 1WMXA 3FE5A 2A71A 5DUUA 3BGAA 5HCBA 4FPYA 1HRI2 1U5XA 4FPLA 2XH6A 5ACA2 1UKGA 4KGGA 4NIDA 2R32A 2ZX3A 4PF5A 3AMNA 2ZGSA 1RUF1 3PU3A 1QJY1 2J7MA 2VW1A 3BU7A 3EYPA 4G4FA 4XF3A 4AQSA 1NXMA 2KD7A 5F1RA 5DAWA 2XJUA 1NCRB 2DVAA 3N7KA 2RS52 3LSEA 4DS0A 4L0PA 1UKRA 1E5RA 5A3LA 4WM7C 4AAXA 1GYKA 2WN3A 5H9PA 2ZGUA 3VHPA 3ZFEB 3PMEA 1RITA 4K7JA 3VBRA 2AUYA 4OHWA 1Z7S2 5A7WA 1PZ9A 4BA6A 5FIXA 3VZJA 4GMP0 3BUCA 2IFRA 4XBQA 4NIAA 5A3MA 1W0NA 4N9HA 1V6LA 4KWLA 3ZMNA 5L36A 4X8NA 3ZPOA 4QQ2A 1LTEA 1F4AA 5EYYA 3NNFA 5ISLA 3KHCA 4BZ4A 2W46A 4MGKE 1RUD1 5JWPA 4K8FA 1ND2A 2RDNA 3B7MA 1QOSA 2JG9A 3RYKA 5JMCA 4OI0A 3AFGA 4XE9A 4DFSA 2VUDA 3J26N 3PLQA 2ORZA 3WDUA 4BQYA 4XQDA 5SV5A 3ZIWA 3ZYRA 3PUQA 4YVWB 4BPZA 4LK6A 3DF0A 1JYXA 5FLHA 4LTAA 3OTFA 2AACA 4YW6A 1CZVA 1VPHA 4NPRA 1JUHA 5A7PA 3MLLA 1QU0A 1J59A 3DECA 4CCDA 1AYN1 3I3DA 4FPHA 4LKEA 4RR3C 3KCCA 4XFIA 3O5SA 3ZR5A 2LS6A 4XTMA 4WM7A 4CRQA 4AVSA 3VLBB 4B4RA 4Q2FA 5CFCC 5CADA 1BXHA 1QMJA 1DYOA 4DUVA 3SCFA 4TN7A 3NW4A 3AZXA 2HWB1 4MADA 4C1WA 4X8PA 1JI6A 1UN1A 1TE1B 2EA7A 4GMP3 4XCAA 3R6SA 4B8EA 1XOYA 2B4KA 4LKSA 1IS5A 1Z78A 1F2NA 2RJLA 4RQPC 2BJSA 2JXAA 2XG3A 5JOWA 3S6PA 4IEXA 2HKXA 2R16A 3OBAA 3VD9A 1O8PA 4PBPA 5BNOB 3ENRA 2VNVA 3MYXA 5DAXA 3ZM8A 4ORFA 1FV3A 4GALA 4IEZA 3J8F3 2VUCA 4XAEA 1O3QA 1CAXB 2K9ZA 2VZVA 1YO8A 1GP4A 3JBG2 2HWF3 4XACA 1O8SA 3CIHA 1AXKA 3GCWA 4FXKB 3T4VA 4RHV2 3MIBA 4OMDA 4FTBA 1V6JA 2FDHA 1RHI1 2BDRA 1WWYA 2PHRA 2YB7A 3E6BA 5A6YA 2ERFA 3V0AA 3ETPA 3E5UA 5APAA 3PNAA 4B7EA 5F2SA 1X8EA 3IAPA 5KHHA 5A1FA 3ZXKA 2BGOA 4DEVA 4AI3A 1POV1 3GF6A 3LIGA 4YVSB 2XLGA 2VZUA 4W8JA 1WLWA 1COV3 4BXFA 3Q9OA 5FP3A 3NRUA 5JCTA 3JQWA 2QUOA 2VTXA 3WUCA 5IVCA 2WAOA 3NV2A 3R4DB 3A7QA 5SV8A 2MEV2 5FO7B 3CHXA 5FZDA 3AL6A 4OUSA 4B3NA 2G9FA 3WW4A 4QPGC 2WZPP 5HCHA 3UNPA 1HX6A 3AL5A 1JZ4A 4XABA 1UX6A 4BU2A 4IEYA 1IG0A 2P3YA 3N35A 4RQPA 3FN9A 3K4AA 1Y7BA 3L2YA 2PA7A 2QQLA 4CCKA 2RDRA 4A6OA 1MS5A 3EO6A 5JDBA 3HT1A 3JU9A 1GZCA 2P6HA 2QKDA 1Y43B 4HONA 4XC9A 5EP9A 5HV4A 2E7TA 3C7FA 3ES4A 2D7FA 4I02A 3KV5A 1UPIA 1UZVA 4FQ4A 2DV9A 5EJ1B 5IK8A 1YIPA 2VMIA 3I54A 1CPMA 1VAVA 1B09A 4RS5C 1ULPA 4XUTA 4QPWA 5A1AA 2VD7A 2GP5A 1ACCA 4INDA 4XFCA 1V6MA 2AREA 5FOBB 5IK4A 2G19A 1AXYA 2BGCA 3EQEA 3RJ2X 2RS33 3DXUA 1MZFA 2X8KA 1ULCA 4LORA 4BISA 4M0NA 3VZKA 2QDNA 2G9GA 1R091 3AP4A 4OHVA 3VUOA 2EIBA 1RUD2 3ALQA 4P14A 2DWRA 5IHRA 1PO12 1S0CA 3LDRA 1ENSA 3MDPA 4IQPA 1UU5A 5FYYA 1D0HA 2VBDA 2Y38A 2WO3A 4QPGA 2VZ1A 4UF0A 3UGGA 1ZBE1 3ILFA 1W6PB 4XUPA 5F9TA 3ACGA 4CUBA 1HB4A 1YEWA 4BQ4A 1D7PM 5BNNB 3VZOA 5EJ3A 5IFTA 2R6QA 2RG4A 3C7OA 2WA3A 2DUPA 2PXJA 3H3ZA 4LR4A 4ZONA 2OYZA 5CIRA 4LBMA 1CAVB 1PK6B 2D6MA 3JCIA 4N90A 4AFAA 4XQ4A 5E1RA 5JPNB 2YU2A 5CFDC 3FHQA 4E8DA 5A3OA 1ZZCA 4J25A 2ZMNA 5KHJA 1JZ8A 4UFLA 2DFBA 4PIZA 5LASA 2HWB2 4O9GA 1IPJA 2CGNA 2LW8A 2P3IA 1VBB3 1S0BA 2QNKA 2W47A 3TB0A 2TEPA 4AI8A 2FZ1A 3VBUA 4LO7A 4EYUA 4EN9B 2YY1A 2ZGLA 3RZJA 4YRDA 1K42A 1SFPA 1JBCA 1RTVA 2SLIA 2WQ4A 3ETQA 3M1HA 4JGYB 4L11A 4Q4Y2 4N9IA 3WP4A 4WVZA 2PTMA 2J1TA 1W9TA 1PGW1 3ABZA 2OA2A 1WBFA 3F95A 1QOOA 4Q4X3 5C8WA 2HH9A 2NZ9A 3HN3A 2VCMA 1YQ8A 2FMDA 4H14A 4HK8A 3AKTA 1FXZA 1H2KA 4IV3A 4HANA 3A0NA 5DPNA 1ZRCA 1FOD1 1KJRA 2WNVB 3LPFA 4GXLA 4PLOA 2HWD3 1A8DA 4QM8A 2Q8EA 1S0IA 2ZX2A 2ZX4A 3CJIB 4LBQB 1ZA4A 5C5TA 3IM0A 3W58A 2XJRA 4P02B 2XJVA 3POEA 3WG3A 5KHKA 4XETA 2GNBA 5FZLA 3JD73 3MPPG 1I6XA 1VBD1 2HWC2 3QH7A 3ZYGA 2P6CA 2IXLA 4CDWC 4CDUB 1OHFA 4ZU4A 4ZU7A 4UW6A 4E9KA 4XF0A 5CB7A 3ZFFB 1VRH1 3MPBA 5GZCA 4P9YA 1YI7A 2ZA9A 5HV0A 3SC7X 2R071 2ZGRA 2KM2A 1DCSA 4LKFA 3C8XA 1PO23 1RL3A 3QBQA 4IEWA 1ZZ9A 1OOPC 4D6QA 3OBRA 1DFQA 4Y3OA 1RYYA 5FZMA 1AYM3 5FP7A 5DZGA 2JB8A 1G7YA 3KD4A 2XONA 5FMBA 1MEC3 1QGLA 5K7PA 1TMF3 1UYYA 3WNMA 2BNMA 3NJVA 1GNYA 1QDOA 1DQ4A 3ACFA 2VVEA 1LOEA 4DINB 2A6WA 4YNIA 3TN91 3SNMA 2DCTA 4Y4RA 4F3JA 3T08A 1W28A 3WDWA 1IQAA 2V09A 3WP3A 2QBXA 3PJQA 4HG6B 2E53A 3B93A 2WWUA 4WBBA 4XHBA 1UOGA 2IXKA 2PAMA 1JW6A 3J7HA 3VL8A 4P9GA 1DGLA 2R7EB 5CYYA 5C70A 4A7ZA 3X29B 2D3SA 5DG1A 4FOWA 1LB2A 3I2IA 5KC6A 4FFGA 4HXCA 1IS4A 2LM3A 4XDQA 5GJ6A 3U11A 2J1EA 2NYYA 4YZ4A 1QXJA 2BZDA 2NMOA 5FMOL 1PHMA 4BIOA 2ZAHA 1VAMA 1PVXA 3SISA 3WOGA 4QX8A 1I5PA 3MIFA 1RUG1 4KQ7A 3SH4A 1JOPA 3ZXAC 1Q43A 3FBMA 5M0TA 2PQSA 4JGZC 4YZ1A 1KITA 5CEHA 5FDBA 3ZFGC 3SMHA 3PUIA 5KHGA 2A3WA 2DDUA 1VMFA 2VH9A 5F3CA 5AVAA 1HXS1 2D44A 2JG8B 2O1QA 3FFQA 4B1MA 1LESA 1OOPA 4ZU5A 3CDZB 2CY6A 1ZBE2 4R4ZA 4GAZA 1JYVA 3IB3A 4Z07A 1AX0A 2XWJB 3I2GA 2RJKA 5DZEA 3AP6A 2Q0AA 2WNEA 5FQ0B 4AEMA 3QD6A 4AVCA 3NJYA 2OZ6A 4D7SA 4FAGA 2E31A 3HQRA 2A73B 3RJRA 3KS7A 1BEV1 1JOBA 1VBE2 1PNGA 1HV0A 2B9UA 5JSPA 4NMIA 2WS91 1ZZBA 3N9QA 1UCXA 4CCLA 1NX9A 1RUC2 5FYBA 1UY3A 2WUHA 4BE3A 1U5YA 4S2HA 3T1MA 5H9SA 1W0PA 2J42A 1O59A 2KR2A 5FYSA 1N1VA 1IGOA 2VZSA 4QHOA 3CLPA 4S2FA 1I1EA 1XYPA 4YW2A 3D6EA 4BQ1A 2VJXA 4A44A 4WVMA 3M8LA 3USUA 1W9SA 5FZBA 3O1OA 1MS0A 3GHNA 5FV3A 5FY1A 4IE4A 1PGSA 2GAUA 3TBDA 3S5AA 4BJ0A 4QX3A 1H4HA 4WZCA 2VC9A 3POIA 4MV2A 1YC61 5FCCA 4QWNA 1WLCA 4R9BA 3RZZA 3E97A 2XOMA 4CXYA 1XRUA 4KBZA 5LK5A 4NE9A 2E51A 2EICA 4JGZA 1BBT1 1KGYA 4N43C 4D69A 1FMD2 3U4SA 2WFF1 3I4IA 3ZFGA 3B3QE 3NNMA 5FO9B 2Y6LA 1RUNA 3EB7A 4XUNA 1I3HA 2BERA 1OKOA 1FOD2 4COYA 2BW8A 1EAH1 3O1SA 3T2PA 2V5YA 3SXWA 5D8AC 1W90A 2DFCA 3N7LA 2WAAA 3OUHA 1NCQA 5FYUA 3UESA 3B94A 1W03A 1CAUA 3FLTA 4GULA 3ILRA 3J7MA 2V5DA 3OBTA 3I3MA 2PFWA 2W08A 1IHMA 1O91A 1PVC3 4GH4B 4N53A 1NLRA 5DDJ1 5C6CA 2J1VA 4Q29A 3TNQA 1DP0A 1RUJ1 2VW0A 1O4ZA 4K21A 2CNAA 1Z0HA 2CWSA 2EALA 4Y20B 1O3TA 4OUEA 1W2AX 3D0SA 5EHDA 4OHYA 2PLV1 4DY5A 1VIWB 1T6GC 2RV9A 2YPJA 3CNAA 3LEIA 4UFJA 1ULDA 1ND3B 1U0AA 1W8OA 4IE7A 4IEVA 3VDDB 3ZSEA 4CUCA 1PX4A 4HVQA 1LEDA 1SHWB 4QGLA 2Q4SA 2ET7A 3N7MA 1GMMA 1AVBA 2ZKLA 3C7GA 5FZFA 3E6DA 4N43A 4EWDA 2EAKA 1JOJA 4OZOA 5LW9A 4YARA 1CAWA 3ZKYA 1QDCA 4KWJA 4COVA 1GZWA 4IE6A 2Y26A 1OKQA 3DYOA 2VNRA 4G3YC 3H8XA 5JXIA 3O1MA 1AR61 4XJUA 4CUGA 1YJKA 3AZYA 2A5ZA 3KVBA 1L7LA 5D8AA 5J37A 1CJPA 4XIKA 3KV9A 5IVVA 3ZOIA 1ZBA3 4LOSA 3HN1A 4GZ9A 1UNBA 2VCAA 2JDPA 3AKQA 2PHDA 1GWLA 2D3RA 2JE7A 1YQ6A 2YHJA 1HRV3 2VY0A 1RUG2 2ZMKA 3LWCA 4AG4A 1W05A 2GDFA 2QQIA 1DU3D 3GZTB 2Y6FA 4HPKA 5FKBA 3VBOC 4LXLA 4LO8A 4DEQA 4PIXA 1C3HA 3NAPC 2Z2SB 4LBJA 5C9AC 2TBVA 4CDQB 3GM8A 5FZOB 1ASJ1 1RUE1 2R30A 2EIGA 2GNMA 1PIV1 1X7NA 1SCRA 4CP9B 1BCXA 2DVBA 2GH2A 3O1UA 3ZLIA 3H1MA 4JX0A 3ZO0B 4PLMA 2ZACA 1RUF3 1QJY3 1TEIA 2FHRA 2O8OA 2XXZA 3OGRA 1J58A 2WRAA 3KMHA 3NMBA 4QDSA 1HRI1 5BNPC 4Q0QA 1R1ZA 3HWJA 1BEV2 5FBJA 1TNRA 5ACA1 3MIEA 3BTAA 2X29A 1RJ7A 2JDMA 2WS92 4AEDC 1QNYA 1W04A 4JDMA 1H8TC 2DURA 1OVSA 2X5IB 5J96B 4ARYA 3O12A 2D5FA 3A22A 5DAVA 5I8SA 3WT3A 4BK5A 4F7ZA 1X50A 2JWPA 1AHSA 2RS51 1O3SA 2RDQA 4LT5A 1SDDB 3N4MA 4I2OA 1LOGA 4I0WB 3IBMA 1RUH2 2R0FA 1R64A 1FPN2 2ZHNA 1SACA 1GOGA 5FLJA 4CU8A 1LHUA 3ELNA 4YM3A 2JD4A 4EE2A 1QY4A 1S2EA 1DGWA 4XFAA 4OFGA 3CF6E 4HKOA 4Q0SA 4W6YA 5K0UC 1QXPA 2VUAA 1HKDA 2XJQA 1PGL1 2P37A 4MXWB 4Q0VA 2YBSA 2VTXJ 2CWMA 1RUD3 4RYDA 4KWKA 1YJLA 2KXLA 5FZ6A 3VBOA 4ZS2A 2AEYA 1J3RA 1W6QB 3RQ0A 4LK7A 2HBTA 2WFF2 4ASLA 1FV2A 4QPIC 3HAGA 5C3SA 2E7QA 4R4XA 3LAGA 4XZPA 1DGWX 4Y1UA 1TME2 2AH2A 4IV1B 5DQ0A 4ES9A 5C9AA 5HCAA 4CCNA 1WW6A 2BGPA 1AR72 2VOVA 3VZLA 3QOPA 4AE2A 1UOBA 1VB2A 4UYBA 1EAH2 3I7DA 4OQ9A 2W39A 3MEPA 3I8TA 3H7YA 4GB32 2WKKA 1GSLA 4XUQA 5ANQA 2BEOA 5GZFA 5L7OB 3FLRA 4COUA 1STMA 1XNAA 3HBZA 1XXNA 1AYN3 1BHGA 4PI0A 3TWIA 2Z5WA 3U1XA 5BNPA 1IOAA 3H50A 1DQ6A 3DPRB 4LITA 1W6OA 4QX0A 3SCGA 2DCZA 1RJ8A 5FYMA 5JUVA 1RMU2 2UYAA 3VBHC 1YFXA 2E33A 5DDJ2 1W39A 5IVEA 5LZ6A 3EHKA 1RUJ2 3M3OA 4LIVA 3IT8A 3NNLA 4DNYA 1JYNA 2HWB3 3MUZ1 1REEA 1UY0A 3IPVB 5JOXA 5LEJA 2VXRA 2W52A 4NAMA 1ENXA 2BQPA 2ARCA 3LD8A 3MIDA 4ONUA 1JZ6A 4CYDA 2R1DA 4XJ8A 3HQUA 3DGTA 3FZ3A 1SLIA 5FPVA 5E8AA 4CDXB 5K0UA 5AC92 2YBKA 3K4ZA 4EQVA 4CCEA 3BTZA 1YIFA 3LCPA 4XYXA 5FTTC 4P9XA 1H2NA 3LFIA 3MF6A 3KB5A 3PUHA 2VECA 2DVDA 5C4WC 5IVFA 5AFEA 3VL9A 1ENQA 4IDZA 4QPIA 3RS6A 1XE8A 5BV6A 3RMXA 2NLRA 3GDBA 3IDBB 3N3HA 1RHI3 3OPZA 5LRRA 3T0AA 3JBG1 4MHUA 5LA2A 2JDHA 5FFOC 1YQ2A 4XFBA 1BMV1 2OUHA 1Q3EA 4RHV1 1YUDA 5EFUA 4U36A 1DF0A 1POV3 4YM0A 3FHAA 3ZXJA 3VD4A 1UAIA 1WCSA 1W2NA 4CCMA 1QWRA 3AXEA 3NL1A 5A7WB 5A32A 1DIWA 4LO5B 1W3XA 2Y60A 3BOWA 1DLCA 2ZX0A 3I3EA 2QJVA 2IFWA 1GLHA 1OH4A 3Q8BA 5F5QA 3PTRB 1V9U2 5GLVA 4QQOA 1TG7A 1OFSA 1H8VA 5LY2A 5K4LA 1UMHA 1RUE2 1AR81 1W8HA 1RXGA 1GANA 2MEV1 3DUIA 3RRDA 2WQ8A 5DMYA 2DTWA 4AHZA 5ABJC 4DXTA 4FP2A 1ZX5A 1ND2B 1HLCA 4AFCA 2ZX1A 1N3OA 3ORJA 3VKNA 2ZJCA 2JG9B 3OYWA 1CD3G 2FD8A 2VOKA 3O0XA 4ZXKA 3L2HA 2ZEYA 2FDFA 5C4WA 3QLQA 1K5MC 1X36A 2VOTA 1B35C 2PHTA 2WL1A 2XQRA 1PM7A 3AYDA 3NJZA 1XU1A 4TYSA 5FY7A 3RYRA 3ZVXA 2QQKA 3WV6A 4JRAA 2CYFA 4RSUA 4UOJA 3PHMA 2A6YA 1LOFC 2ZABA 1E5HA 1GNZA 1GOHA 2R0HA 4BM8A 2HEYF 3WNNA 5HCFA 3PTYA 2CGPA 2WO7A 4NIHA 4YG3A 2Y8KA 4XFFA 1WCDJ 3P3PA 4WM7B 3B5LB 1H6XA 1K12A 4EN8B 4AI1A 3ZYFA 4MX3A 1UIKA 1NCRC 3T4HB 1PGL2 4EN6B 3U14A 1R093 2PYTA 1TZOA 2G4IA 4JQTA 2WZR2 4GA9A 4C91A 3W5NA 2XJPA 4Z92B 3ACHA 4Q0PA 3LB9A 3NV4A 1DBNA 3GGLA 3TOJA 1F31A 2IVJA 1QQP1 1AJOA 1URXA 3ZFEC 1YCIA 4WM8A 4NAOA 3T30A 4GWMA 1GFF2 1WBLA 1KDKA 1UYZA 1QJX2 1U5ZA 1ZBE3 4TTGA 1PO11 4M01A 1GQGA 4MGTA 4R9DA 2IC1A 4QPYA 3F2ZA 3WDVA 4XJAA 2EVXA 5FOJB 5J3UA 1AR92 1X82A 1LGNA 2XLFA 2ADEA 2EIDA 4QKFA 5FUIA 5H9RA 5LATA 3LA2A 4QX7A 4H7LA 3WF0A 1A34A 3RZKA 1R082 1ZA7A 1K5MA 3V0AB 2Y64A 1AX1A 2JE9A 4FI9A 5JXGA 4KWUA 4KL1A 1IKPA 1XB9A 3P1IA 4UFHA 2HLEA 2WBKA 3DL3A 4GWIA 2E9QA 2B5HA 4HK9A 1OH3A 3HMYA 4URTA 4XIOA 1DYPA 2VZOA 2SBAA 4Q1RA 4F83A 3A0KA 3DV8A 4GWJA 2AENA 4RGGA 2XLAA 3HBKA 3KCYA 1JHNA 3LZZA 2RS11 2JKXA 2Q1ZB 1LULA 1C8M1 2XHKA 2Y0OA 3RFRA 4FFHA 2JECA 4Q4Y1 2W68A 5JZGC 2WC2A 3ZN6B 2RR12 4LHLA 4AWDA 5DAPA 5DUXA 1JZ5A 5FYTA 3ZFEA 4AGGA 4MG2A 4TXWA 1FOD3 3GHMA 4CP1A 3WD5A 2RMU1 4RQPB 1D4M1 1LRHA 3N9LA 3H9AA 3WQ1A 5C5UA 4R9CA 5CBLA 1W8NA 2H0VA 2ZBJA 1GWMA 2FBEA 2VZPA 3UKVA 1BMV2 5JIAA 1CESA 2BNOA 4AHYA 2C1FA 5HPOA 3OGSA 4R9AA 3ACLA 3IMMA 4DXRA 2FCVA 5L9VA 1PMIA 3GBGA 3TAYA 4AHXA 1VBD3 1NA1C 3SKJE 1GUIA 1UZZA 2YBPA 2P17A 5BNOC 3E5XA 2NP0A 4DOUA 3T2OA 3W5MA 1VRH3 2JE8A 1GR3A 5F37A 2VG9A 4FP3A 2HWC1 3S0MA 5CAZA 5FXWA 2R073 2IZWA 4J1WA 4RR3A 4W65A 2VNGA 5JOZA 2BFUL 2F4LA 1MS4A 1N1YA 1OPMA 2CU5A 3POBA 2Y6JA 4NN0A 4UBHA 4EWAA 1JZ3A 1XSRA 1AR82 2C9KA 5CFCA 4YG6A 2W1UA 4DUXA 4NRMA 2GH8A 1GV9A 2OS2A 3U78A 3IKWA 3K46A 2E7AA 3B9CA 1ONAA 3OPWA 4E27A 1JYIA 1ZRRA 4YVSC 4BQXA 5G05L 1H1IA 1MS1A 1YFWA 1OBNA 3T0BA 1MR5A 4MVTA 5KHIA 1ZRFA 3WUDA 3TN93 3MBWA 3TNPB 3UT0A 4AFBA 5JZGA 4UF0B 2YC0A 5FUPA 3OEAA 3OGVA 4LLFA 1W6NA 4BMEA 1ZM1A 1JTZX 2LROA 4LA2A 4QX5A 5E6HA 3OCPA 1AZDA 3NJXA 5I8YA 1HIXA 5T5LA 3U4XA 3BN6A 3IIAA 5EIYB 2Y6GA 4QAWA 5GLZA 4AHWA 4Q27A 3LOBA 1NA1A 1RUG3 4XF4A 3RVHA 3HQXA 2ZHMA 3H7JA 4LBNA 5IT6A 3WNKA 2QQJA 5LA0A 4XCBA 3RZMA 1RINA 4H3WA 4HLTA 4DXSA 1OUSA 2GMPA 4QDRA 4RA0A 5B2GB 2E26A 4FCAA 4JDOA 3PVBB 1VMJA 1QQP2 4LUMA 3VBUB 3POSA 1HXS3 4KMQA 5F8PA 1YLLA 2VR4A 1RIRA 2Z79A 4BXSV 5C33A 4XMIA 3KQRA 2CAVA 3ZYIB 5C7GA 2WT2A 5C3QA 1ODNA 3VKLA 4UW4A 1NLSA 3VN4A 4M4PA 3I59A 4FXGB 4AI0A 4D0QA 2FQPA 4FPJA 1AF9A 3KV6A 2ZGMA 2G1MA 2YZ4A 1BEV3 4GJYA 3AP9A 2Y34A 3RMYA 1CGPA 4IV3B 1BYHA 4HOOA 1CR7A 2WS93 3KHBA 5I91A 2FMYA 4HETA 2A75A 4QXBA 1YYNA 4NROA 2VE1A 3WY6A 4OI1A 4AW7A 1F5FA 3KT4A 1AL0G 2JD9A 4YFWA 1VBE1 3LPGA 3FMGA 3OEBA 3NNGA 4XDPA 5IFPA 4YW5A 1RUC1 1CVNA 3EMRA 2MPFA 3MFCA 3CL1A 1SPPA 2FDGA 1T2XA 1KFUL 2WN2A 3VDAA 4BIFA 3Q8FA 1H30A 4OZXA 4RGKA 2YROA 2DF7A 2W92A 3KT7A 4M3CE 1DZRA 4ZZ8A 2XPJA 1A78A 2WT0A 4RS5A 5FY0A 1UY2A 4EROA 2RS12 2X10A 3PIGA 3RG0A 4ITCA 1C8M2 1VBA2 2WZ8A 3ATGA 1BBT3 4Z2AA 1EV11 2RDSA 1ULOA 4PI2A 3BIEA 1L3JA 2WFF3 4FSJA 4PQQA 1YXWA 1JYCA 2C9AA 3B00A 3ILNA 4BHPA 2Q8OA 4O61A 1WA6X 1KQRA 2BBAA 2B8MA 2WT1A 4W4ZA 2A1XA 1H6YA 5F6KA 2RMU2 4Q4W3 1WD3A 3TEYA 1D4M2 1EAH3 4XUOA 1FMD1 1VAKA 1TNFA 1SBFA 4RN5A 5LA1A 4NWWA 5GZDA 3OPTA 1V6KA 3LOIA 5J1XA 3UV9A 1A6CA 1LCLA 1W6MA 1UF2C 2IVIB 4JCKA 3QCWA 4JGYC 4LHNA 1YQ5A 3HEIA 4LHKA 3WHUA 1IG3A 3WNLA 5IVJA 1QJZA 4C90A 3BVCA 3FJSA 1C1FA 1UYXA 4DXZA 5H9QA 3E6CC 5DDJ3 1RUJ3 3AYAA 4XDOA 3D0JA 1X9TA 4FPOB 4I30A 1RC6A 2WO2A 4K9SA 4GD4A 1BVVA 4QU2A 4LE3A 2PLV3 4IEPA 3MW3A 4UFIA 4KH9A 1W6PA 4DPNA 3BKZA 5CFDA 3UL2A 2VOXA 4AI2A 3KF5A 3LA7A 1KXGA 1OA4A 1KS4A 3ME2A 1JZ2A 4YZ5A 4HKWA 3IAQA 3WVJA 5HXVA 4DRVA 1QKQA 1C8NA 5FZKA 4CP2A 4ES8A 1WD4A 2H0BA 1ZRDA 4X6QB 2QQMA 3RWNA 4CDUC 4GIQA 2D6LX 2W0XA 3SH5A 3LEMA 2ZXQA 4ZS3A 1OOPB 2XL7A 2ZTNA 5AVPA 4Q4V2 4LNVA 5L73A 3PURA 4BQWA 4TLFA 4N7UA 1DYKA 1AR63 1S55A 2QFEA 2PMWB 3V0BA 2UYBA 1VB4A 3W20A 4XJWA 4Y5TA 1RUI3 5CKQA 3I3BA 3H0OA 2BBVA 2GC1A 5IK5A 4M3CF 1G9FA 4NWVA 2XBO2 5J7MA 5BXXA 5DZFA 3FLPA 4JGYA 1ZVFA 1FX5A 3LDBA 1QXRA 2PHUA 3LKJA 1LHWA 2AR6A 3UYJA 5LY1A 1ZZ7A 3MUY1 4HMZA 5ANNA 5A3NA 5J36A 1H9PA 4PDWC 1KDMA 1J1TA 4GWNA 1MZ6A 4CA9A 1E5SA 2ARBA 2AZ5A 2W1WA 3NO8A 4WVMB 3V56A 3USUB 1DQ0A 1KRIA 2PAEA 1V0AA 4MLOA 3E1F1 1N47A 1G9CA 2VPVA 2WWJA 5FMOS 1HDKA 4CDWA 5CA6A 1REFA 5A7OA 1ASJ3 5FZ8A 2F6BA 4DZGA 1PIV3 5JR2A 5KXDA 1C28A 1EUTA 2CV6A 3MZHA 4O7XA 1D2SA 4AGVA 4LBQA 5DXDA 1W2UA 3T0DA 1V6IA 3AMQA 1KS5A 1UZ0A 4PLNA 3WINE 2ZGOA 4K8RB 5LBCA 4JGZB 3FFZA 3VV1A 1HRI3 2Q30A 4L9BA 2WABA 3G7DA 4M3CA 5LBFA 3ZFGB 4HSLA 5ACA3 1QH6A 1DZQA 1NXD1 1E5IA 5FZIA 3OGJA 4QD2A 2WSUA 4YZ2A 3ZPYA 1UY4A 3ZYBA 2XVKA 1QEXA 3K75B 2RS53 2C4XA 4V2WA 1BJQA 1GNHA 3W59A 2QQNA 3I97A 1NCQB 2JG8C 3VKFC 1EY2A 4AVTA 1CAUB 2DVGA 4HL0A 2BRTA 2E32A 1OQEA 1UMIA 1Z7S3 2OQ6A 4OI2A 5FKCA 3O1PA 3C7HA 4QB6A 3I3QA 2NPIA 4N53B 4XILA 2R061 3HD8B 1A3KA 1LOAA 1RUH1 4M4RA 4Y1VA 3ITQA 2P3JA 1FPN1 1GQHA 4PDWA 3M7AA 4S2DA 2JB4A 4XAAA 2D5HA 3U07A 4JHZA 4DQAA 1LAJA 4UI9L 1EV12 4NHLA 1JHJA 1T6BX 1OLQA 3WW1A 1LJ7A 4B29A 1XQNA 5I93A 5CKNA 1XNCA 4HVRA 5CNAA 5A7QA 3ZDVA 4P9LA 3SEPA 4PBOA 4Y5Z0 4COZA 5LWBA 5KXCA 5FZGA 3ACIA 3TRSB 5DUWA 1LENA 4UXAA 3U10A 1TME1 2HEWF 3PL0A 1OMIA 3FUOA 4XPVA 1AR71 2HYXA 1GU3A 4N43B 4MXVA 2OZJA 3WX5A 1CAWB 1LOCA 3VHRA 4GB31 4PIYA 1OC1A 1GZWB 1NZIA 1Q56A 1UWWA 1D4VB 1ZRIA 3GBWA 4YW3A 3WNXA 4AGRA 3NSTA 3I2OA 2PHFA 4Q1PA 4BK4A 4YWAA 2A6ZA 3JQXA 3K3NA 1VBC1 1Y9MA 3MW2A 4UT5A 1FAYA 3KF3A 3N9PA 4AXOA 3KGLA 4OI4A 5D8AB 3ZXEA 1MS8A 2WNUC 1UMZA 5F2WA 1OA3A 1ST8A 1RMU1 3RZHA 2BWCA 3IIIA 3VBSC 5A6QA 4N8MA 1LODA 4E8CA 3N9NA 4IW3A 3IZOA 1PNFA 5T52A 1ULFA 1C1LA 4HPKB 1VRBA 2IXCA 4Z1VA 3BYWA 1SDWA 4UWDA 4YW1A 5EYXA 2HWF2 1O3RA 1OSGA 4XJZA 3SKVA 4YGEA 1HN1A 2Z42A 2BPA2 2CDPA 4BQ2A 1UW8A 5AC91 3AZZA 2ARXA 4MH0E 4AEJA 3O1VA 2VBPA 1Q8VA 5T55A 4IE5A 3AVSA 4QB1A 5J48A 1VP6A 2JDZA 3JBG3 3L9JT 2YC2A 4NPLA 2UY8A 3RDIA 3K48A 3WF2A 4D3WA 2V73A 1COV2 4IETA 4RHV3 3ZXFA 3VDDC 1GICA 2HYKA 1W0OA 2ET1A 2WDBA 2HWE1 3M3CA 2WR9A 4Z82A 2NQYA 4Y33A 5A3PA 2JX9A 1AUYA 5FPZA 3WQ7A 1PZ7A 4HVOA 2MHFA 5F6LB 4AQ6A 1G9AA 4BH9A 1DLLA 2ZEWA 4NRQA 4LBLA 4RFRB 5C3PA 4Y22A 2VGDA 3EBRA 4L92A 2PHWA 2AYHA 1BK0A 4PJYA 2PQQA 1NQDA 2WNUA 5EPAA 2QQWA 5FY9A 3VBSA 1AR83 1N3PA 3GXUA 4C8DA 2MEV3 5FK8A 5FY4A 4ZHNA 4NRPA 1QJEA 3C7EA 3PIJA 4Y1XA 4Y4YA 1V9U1 4K40A 4UFMA 3VBOB 3D8CA 3SH3A 3ZXLA 5L19A 4A45A 4QX1A 1NT0A 5HXMA 4LO4B 1DHKB 2P5BA 4HZFA 5CU1A 1IPSA 5T50A 3WDYA 3N7JA 4AVBA 4AZZA 3C2UA 1LU2A 2JIGA 2QVSB 3CO2A 3NKTA 1G9BA 1QJU1 1R1A1 1YFUA 4XOGA 1WKYA 3OOXA 4K1YA 1W9YA 1W8UA 2VAUA 4MGIE 3WLUA 2KA3A 4HN0A 4OULA 4QGMA 4E4DX 2ID4A 4LE4A 1H2LA 1Q8PA 5LBBA 2XVGA 2ZGQA 2DBIA 1W2TA 1RVF1 1WCQA 2HBUA 5BNPB 1POQA 5JSRA 2NM1A 4C0BA 1W6OB 2RS32 1AJKA 4OLLA 3ZDSA 4BB3A 1OT5A 1XNBA 3AFKA 4W6XA 4FAHA 2R062 4CEWC 2VMGA 2ZHKA 2XL9A 5T5PA 2Q8CA 3IMNA 4A2UA 3V64A 4YGCA 1MZ5A 4WVVA 3Q8EA 2ZS6B 3UK9A 1UZYA 2X5IC 4FTSA 1QQP3 2VQAA 3VBFB 3SEEA 2P2KA 5A6XA 1SG3A 1BKZA 2Y0IA 3AMHA 2W94A 5FZAA 1FI2A 2DYCA 2HJIA 2WZR1 3THTA 4QQPA 5JOYA 2OVUA 3GZAA 3HNYM 1PO13 1NKGA 4META 4Y24A 3WDTA 2W2IA 3POYA 4XBNA 4PF1A 3LGRA 1OLRA 2GC2A 3NAPA 5F5CA 3OY8A 2LTNA 3EXUA 4NIGA 4TSVA 1PMJX 1QJX1 1RGSA 4QPIB 2EXJA 5A3WA 3PDQA 1U5IA 1UO9A 1JN2P 2BYVE 4OCTA 1AR91 4SLIA 4XJ9A 2CDOA 2JENA 1VBC2 1EP0A 1XNKA 3HIFA 4EN7B 4LQRA 2RVAA 5C3RA 2QE3A 3ZYHA 1VBB2 1XBFA 2O8QA 3AKSA 4IV1C 4AFMA 1S0EA 4QT6A 1R081 5FREA 4AEDA 3BPZA 5JPMB 1H8TA 3AX4A 1S0JA 3NNJA 4ATFA 3OGGA 4XVHA 4FPEA 5KXEA 2D6PA 3OD4A 1YHFA 2AC1A 4CUAA 1SLCA 2RM21 1RUOA 1LGCA 3IWZA 5FY8A 4CE8A 4CEWA 2RS13 4YM2A 2OW4A 5C8CB 5FZCA 1C8M3 4NHXA 4R8HA 3I2JA 2P34A 1DZTA 2IWGB 3R4SA 4MZUA 4WVWA 1CX4A 4Q4Y3 1MQTB 3CJXA 5L9RA 3ZIXA 4A3ZA 4CEYC 4E2GA 4L2NA 1MVEA 3U0ZA 1WCKA 4E4SA 2YXSA 4CTEA 3THDA 2VOWA 3AYCA 2RHPA 1H4GA 3ZYPA 4DY3A 2PAKA 4WV8A 4D6RA 2RMU3 1H0BA 2EXKA 1D4M3 3K77A 5DABA 2J1RA 2OPKA 3UETA 1SLLA 1TQ5A 1WMDA 4AVVA 5KR7A 1G9DA 3BTYA 1C5IA 3LE0A 2K46A 2RR11 1MVQA 2YV8A 4XHXA 4ASKA 1JYTA 3OYWB 3JD72 1N1SA 4OHXA 3GJAA 4GJZA 5IAXA 2R041 3RNSA 5C4WB 3I49A 3MI8A 1CPNA 5FPAA 3VHNA 4LHSA 2HWE2 3Q8CA 1WW4A 4UFKA 3KWVA 5LRSA 1D0GA 2GMMA 4IEQA 2FCUA 5A33A 2FDKA 4I0AA 2RJ2A 5T5OA 1S4CA 2EXIA 2DU0A 4NHMA 5DUVA 1W6QA 3BU0A 1PO22 2HWC3 2BWAA 4CCJA 1BQPA 5FXZA 3WW2A 1SZBA 3KSCA 1AYM2 4IV1A 5A80A 2Q8DA 3VBRB 4EZ4A 1GKBA 1NAEA 1MEC2 1KEXA 3R0RA 3S5QA 3VBHA 2Z69A 4C1XA 4XZUG 4YW4A 1I9RA 2YGMA 3EJKA 3K3OA 5IJRA 1BK1A 1CQ9A 2JDNA 3CU7A 2XUMA
chains in the Genus database with same CATH topology
4IESA 5D1IA 3AM2A 3PJYA 2B7YA 1Y9QA 4NVPA 1CONA 2YYOA 2A7AA 1J3QA 3MIGA 4WM8B 4AQ2A 4CEYA 4JVAA 4X6RB 1QJU2 1R1A2 2QDRA 3LSDA 4FO9A 1KJLA 4LBQD 1DQ5A 1ZBA1 4L8QA 1RVF2 4MGZE 3VZMA 1CIWA 3TYJA 2UWCA 4QXKA 2UU8A 1SBDA 3KGZA 3CEWA 2JEMA 1AL21 2ZHLA 3AMMA 1ULGA 1NQJA 4QHBA 3JZVA 3AB0A 1CN1A 1V6OA 1M4WA 3VKOA 1IPKA 1SLBA 2I74A 3KCXA 2WLPA 4HT1T 1HQWA 5IUQA 4LO6B 4YGBA 1CJDA 1MS3A 2DCJA 4QQHA 4MUVA 5E16A 1WLDA 4MYEA 4OUMA 4S2GA 4Y26A 2GZWA 4BOWA 2ILMA 3AKRA 2ZZQA 2GN7A 5K9YA 1N1TA 2CTVA 1O5UA 3NWKA 3DKWA 1EYBA 4L99A 5FLIA 5ABJA 4YSFA 4JC1A 4I01A 1GZ9A 4IL7A 1VBE3 3ZSLA 1MS9A 3M3EA 3R4UA 5BNQA 1RUC3 4COWA 3RSJA 3PVNA 1B35A 5HI0A 1DQ2A 3WZ1A 1OI6A 3WG2A 3SHRA 1XU2A 1YWKA 1V70A 1UIJA 4GQ7A 2RM22 1LOFA 4RD7A 3O14A 2A6VA 2BNNA 1LR5A 5BYNA 4YYOA 4RR3B 4J6GA 2D40A 3H1WA 4M0HA 4YVWC 1EV13 1ALYA 1SBEA 3P3NA 3HR9A 4LBKA 3S7EA 3ST7A 5E89A 5CFCB 2GALA 1NCRA 2ZGNA 5T5JA 2QCSB 1VBA1 2WSVA 1FMD3 4XEZA 4QM9A 2WINB 1HW5A 1J1LA 2BTVC 3UJQA 1IKQA 2OUJA 3JB8A 4JTNA 2VW2A 4HKLA 4U2AA 2R042 5JZGB 4YG0A 4JDNA 1PVC2 5KBFA 2A3YA 4FPGA 3M3IA 4UBGA 1W6NB 4FPFA 4LEJA 4KG0A 4R52A 1WA4A 4OVEA 4C0HA 1O7FA 1S2BA 3ZX7A 2XKPA 5JI9A 3KLSA 1XE7A 3MF9A 1NA1B 3ZSKA 5JIUA 2D97A 1OQDA 4Q8KA 4V1PA 3W9AA 1WMFA 3OD0A 5J98B 3QH6A 2YGLA 4YVWA 2EF6A 1V6NA 2BFUS 4AYUA 2EAAA 4I09A 2ZPXA 2ZZJA 4ASMB 1O5LA 4K20A 1U12A 2O0OA 3GALA 2K2SA 2XVLA 4FPCA 3I59B 1XYOA 1NY72 3AP5A 1ZBA2 4QPGB 3AJZA 4LULA 1A8MA 5JVVA 2JKBA 3NKGA 4E2SA 2BVVA 4Q4V1 1HRV2 1ZZ8A 4BWOA 2ZCWA 2NMNA 1AL22 1KFXL 2GU9A 1BZWA 5CG9A 4AVAA 4BCUA 2XB6C 2UURA 2XBO1 3N36A 4JTOA 1LHNA 2D3PA 3ZN6A 4FTEA 3WXPA 4HFSA 4L97A 4AEKA 1ZZ6A 4OHZA 1AXZA 4I3PA 5BNOA 3MLJA 4I0BA 2VVDA 4D7TA 1RUF2 2WA4A 1QJY2 4O9EA 3THPA 1CAXA 4JV4A 4RS5B 4MGYE 4TWTA 2DU1A 3WDXA 4ZKTB 3KT1A 5DG2A 2PHXA 4HN1A 3G6JB 3VKMA 1ZNPA 4CP0A 5FBZA 3FHIB 1VALA 2ES3A 2ETEA 1MACA 1WGPA 5EV7A 4YVSA 3VBUC 4XFGA 1W6MB 4K1ZA 1NOVA 1SMVA 3ZN4A 5JI7A 3AMPA 3VZNA 2X53S 3ZMOA 3URFA 1F5JA 3GBFA 2R063 3R05A 1RUH3 3BB6A 4P5HA 2C5DA 4KNCA 1FPN3 1LEMA 3T1LA 4IV3C 1FYUA 1OD5A 3IDCB 4XMAA 4Q8LA 4LUKA 2DCKA 3S7IA 3ZSJA 5BNNC 2K0GA 4XXPA 5CFDB 1WLTA 4G9SB 3DN7A 2ZGKA 2VNOA 2E6VA 5FAXA 1SEFA 1PK6C 2WWSA 3T2TA 1AYN2 4HSJA 2I2SA 1JXNA 1TME3 4XF9A 3WQ0A 2B42B 1QOTA 1AR73 1LGBA 4LA3A 3AJYA 2D98A 3BODA 4FT8A 4GB33 3ROUA 2R1BA 5BPXA 2ZOEB 3O0VA 3V0BB 2CAUA 1VBC3 2D6KA 5JSOA 4W6WA 5FPXA 3GZUC 5GM0A 4M00A 3FUQA 5LEKA 2LUWA 3WR0A 1RMU3 2YUEA 2GNTA 3FX3A 4QMAA 2VQ0A 1LOBA 4AK3A 3MICA 4KBBA 4FOQA 4GMP1 2WNVC 4ISRA 2GNDA 3AZWA 4KU7A 5GLTA 5I0UA 3CJIC 5JR7B 2VUJA 3MIHA 4CDWB 1Q8QA 1QHDA 2ZKNA 5BNNA 1G8WA 5AC93 2TNFA 3WP6A 1RHI2 3UJOA 3J8F1 4IERA 2A70A 2ATFA 2HWF1 4AFDA 3BCWA 2Q5TA 1YI9A 4LLOA 2F4PA 1SFNA 1Q5OA 3WHTA 5J09A 1CAVA 1PK6A 3B02A 1H9WA 3ZFFC 5JAXA 4M3CB 1LECA 4XW3A 2D6OX 3USSA 1S1AA 2IXIA 2HWE3 1IZ3A 4YFZA 1HQNA 5CVRA 5I8TA 4E4ZA 4JQRA 3RPQA 1COV1 3J4UH 1REDA 5I0RA 2D93A 1WW5A 3SCHA 3J9SA 2AGSA 2XWBB 3WW3A 4UW3A 4YLZA 1NE6A 1IS3A 1C4RA 3ZXDA 4EN0A 1V9U3 1X33A 3AKPA 4PDWB 3AYEA 4FOVA 4Q26A 2WNVA 1UL9A 1Y3TA 5GLWA 1RUE3 3BALA 1WUVA 3CJIA 1DG6A 1LKNA 3MFAA 4H7MA 3OJBA 4TZDA 1QJU3 1C57A 1R1A3 1O4YA 1VJ2A 1X8MA 1S0GA 3H3UA 3JB4C 4XQWA 4CDUA 3I2DA 1RVF3 3ZFFA 2DTYA 3O0WA 3B9IA 3D4KA 5TSWA 1R092 1SQ4A 4GKXA 1UPSA 3K51A 3LA3A 1MZEA 3M3QA 2RS31 1XNDA 1ZYBA 1ZREA 2GC0A 4QQLA 4IEUA 1IS6A 5T3NA 2DCYA 3JUUA 2NN8A 1ENRA 3MW4A 4Z2WA 2WZR3 1NCQC 3V65A 2XKOA 4NOTA 1J3PA 1FT9A 1XYNA 1ULEA 3ZYJB 2WFPA 4P9WA 3E5QA 4N53C 1QJX3 1QH7A 1HV1A 2JJ6A 3BIWE 1F9KA 3PVEA 4KG8A 1D2QA 2Q1MA 1AR93 1FNYA 2GSYA 2ZMLA 3WCRA 1PZ8A 1F8VA 1VLNA 4WZFA 3APBA 1OPOA 2BUKA 1R083 4KGQA 4DMIA 1M06G 3D82A 5K8SA 3PVOA 4A7YA 2A6XA 5IK7A 1H1MA 1PGW2 1VBB1 4FVVA 4BLIA 2R49A 4CZSA 2RM23 1UD1A 1C5HA 4N7IA 2JG8A 3QACA 3WG4A 4Y22B 2YDEA 1OFNA 4Y1YA 2WNUB 1DGRN 4XBLA 2B46X 4FOYA 4Q4W1 1SLAA 5FQ0A 4Q4X1 3VBSB 2DUOA 2I07B 2RE9A 3J8F2 5FDBA 1G86A 4A3XA 5FO8B 2OIIA 1SCSA 4BMBA 2RR13 2H6BA 4GH4C 1G6NA 2HWD1 1O4TA 1VBD2 4K6BA 2D6NA 1DDLA 1Q8OA 1OA2A 2R043 2E63A 4EV0A 2HEVF 4KU8A 1VRH2 1I5ZA 3JD71 1VR3A 1ND3C 2D43A 3NV3A 2R072 1YRZA 2VMHA 5EZWA 1EPZA 1Q8SA 3FWEA 2IXJA 4UW5A 1PO21 4DB5A 2I45A 1NZCA 5GKAC 3H1YA 1AYM1 4SBVA 1MEC1 3TN92 4RL7A 3RYPA 1APNA 4DRRA 1TMF1 5KXBA 3H8UA 2XJTA 5KWRA 2WLQA 3FC0A 2PELA 5EWSA 1S2KA 1RUI1 1FNZA 3FBYA 4B7KA 2PHLA 3NAPB 1UU4A 1HQLA 2VU9A 3OY8B 5C9AB 4XF1A 3AZVA 4GH4A 3A4UA 3IDEA 4K3UA 1SFYA 2JICA 3RI9A 1N3QA 3ZSMA 3D5OA 1AL23 4Y20A 3SLIA 4YZ3A 5I0TA 5LK7B 2FZ2A 4FQZA 4P9IA 2BVBA 3IN9A 4MSVA 2TUNA 4EWEA 1ND3A 1FATA 5T54A 3VDDA 1HXS2 1JH5A 4AEDB 1H8TB 3HT2A 4XFHA 5GALA 3ZXGA 3GNEA 4H55A 4NO4A 3NV1A 3RI8A 2ZAAA 4CEWB 1NE4A 4RGAA 3B69A 3UKTA 4BLJA 5FRAA 2QQPA 2P3KA 2QZ3A 4Q0UA 1QNWA 2CGOA 1NYWA 1LU1A 5K0UB 3VGIA 1WW7A 4ATEA 3M2MA 5E88A 4PQ9A 5KC5A 3ASIA 5BY5A 1EPWA 1BVP1 5GLUA 2WQZC 3VBFC 5BUVA 5JLVA 3VHOA 2CL2A 3O7OA 3KM5A 1Z7S1 4FPKA 3M4FA 2VVFA 2YMZA 2ZGTA 1H2MA 1S0DA 4IEOA 1DQ1A 2UWAA 5A33B 4IXLA 4CDQC 1BBT2 2UY9A 2C0ZA 4GKYA 3UKNA 3INAA 3S30A 3ECQA 1DGRA 5L7OC 1KD7A 2EXHA 4I3GA 5A32B 4JAAA 4Q4W2 1GBGA 3VBHB 4Q4X2 1POV0 4JRLA 1VBA3 1SLTA 3B01A 3DPRC 3POWA 2LALA 3MGUA 5GZGA 2X5IA 2HWD2 1H1AA 2XJSA 3AP7A 3AXDA 1WMEA 1YNAA 4CEYB 4Z8BA 1LHOA 2PN5A 4ISQA 4AQTA 4F8AA 1V00A 1UU6A 5C8CC 1OQ1A 3KZ4C 4A7KA 1MQTC 4YM1A 4QGNA 5EXOA 4CDXC 1PVC1 3VBFA 4NR1A 2B39A 2PLV2 4B4PA 5CG8A 1LHVA 5AFBA 4MXWA 1RB8G 3ES1A 3M70A 4YGDA 5HBAA 4HBNA 4PCRA 4B4QA 2UWBA 2GC3A 2GN3A 4AF9A 2DVFA 4LBOA 2WIIB 2A3XA 1S0FA 3PMSA 4CDQA 4FBFA 4XTPA 2ZGPA 5I0SA 1TMF2 4XXAA 2IXHA 1NG0A 2VULA 5GZEA 5L7OA 2MNGA 1AR62 1QF3A 4RFT0 3WCSA 1RUI2 2DUQA 3DPRA 2H6CA 3VBRC 2ENRA 4Y1ZA 1AX2A 4D7YA 4J1XA 2QZ2A 4P9JA 4Q4V3 3GYDA 2XGXA 2N7GA 2WJSA 1JUIA 5ABJB 1NY71 1E57A 3IPVA 4NHKA 3WG1A 5C8CA 3SITA 2XBO3 3C3VA 2B45X 2GMEA 3AK0A 1HRV1 4WM8C 1MQTA 4E2QA 3MLKA 4EJRA 1YFYA 1K5MB 3OF1A 1ND2C 1ASJ2 4CDXA 3BOPA 1PIV2 1B35B 3NVCA 4BYYA 2JG9C 3WP5A 3FE5A 2A71A 5DUUA 5HCBA 4FPYA 1HRI2 1U5XA 4FPLA 2XH6A 5ACA2 1UKGA 4KGGA 2R32A 2ZX3A 4PF5A 3AMNA 2ZGSA 1RUF1 1QJY1 2VW1A 3BU7A 4G4FA 4XF3A 4AQSA 1NXMA 5F1RA 2XJUA 1NCRB 2DVAA 3N7KA 2RS52 3LSEA 4DS0A 1UKRA 5A3LA 4WM7C 1GYKA 5H9PA 2ZGUA 3VHPA 3ZFEB 3PMEA 1RITA 4K7JA 3VBRA 2AUYA 4OHWA 1Z7S2 1PZ9A 4BA6A 3VZJA 4GMP0 2IFRA 4XBQA 5A3MA 4N9HA 1V6LA 4KWLA 3ZMNA 5L36A 4X8NA 4QQ2A 1LTEA 5EYYA 4BZ4A 4MGKE 1RUD1 5JWPA 4K8FA 1ND2A 3B7MA 1QOSA 2JG9A 3RYKA 5JMCA 4OI0A 3AFGA 4XE9A 4DFSA 3J26N 3PLQA 3WDUA 4XQDA 5SV5A 3ZIWA 3ZYRA 4YVWB 4BPZA 3DF0A 5FLHA 4LTAA 3OTFA 4NPRA 1JUHA 3MLLA 1QU0A 1J59A 1AYN1 4FPHA 4RR3C 3KCCA 4XFIA 3O5SA 4XTMA 4WM7A 4CRQA 4AVSA 3VLBB 4B4RA 4Q2FA 5CFCC 5CADA 1BXHA 1QMJA 3SCFA 3NW4A 3AZXA 2HWB1 4C1WA 4X8PA 1UN1A 1TE1B 2EA7A 4GMP3 4B8EA 3R6SA 1IS5A 1Z78A 1F2NA 2RJLA 4RQPC 2JXAA 2XG3A 5JOWA 3S6PA 4IEXA 2HKXA 2R16A 4PBPA 5BNOB 3ENRA 3MYXA 4ORFA 1FV3A 4GALA 4IEZA 3J8F3 1O3QA 1CAXB 2K9ZA 1YO8A 3JBG2 2HWF3 1AXKA 4FXKB 4RHV2 3MIBA 4FTBA 1V6JA 1RHI1 3V0AA 2PHRA 3E6BA 2ERFA 3E5UA 3PNAA 4B7EA 5KHHA 1X8EA 3ZXKA 4AI3A 1POV1 3GF6A 4YVSB 2XLGA 1WLWA 1COV3 3Q9OA 5JCTA 3JQWA 2QUOA 3WUCA 3NV2A 3R4DB 5SV8A 2MEV2 5FO7B 4OUSA 4B3NA 2G9FA 3WW4A 4QPGC 2WZPP 1HX6A 1UX6A 4IEYA 4RQPA 3N35A 1Y7BA 3L2YA 2PA7A 1MS5A 3EO6A 5JDBA 3HT1A 3JU9A 1GZCA 2QKDA 1Y43B 2E7TA 3ES4A 2D7FA 4I02A 4FQ4A 1UPIA 2DV9A 5IK8A 1YIPA 2VMIA 3I54A 1CPMA 1VAVA 1B09A 4RS5C 4INDA 4XFCA 1V6MA 2AREA 5FOBB 5IK4A 1AXYA 2BGCA 3EQEA 3RJ2X 2RS33 1MZFA 2X8KA 1ULCA 4M0NA 3VZKA 2QDNA 2G9GA 1R091 3AP4A 4OHVA 3VUOA 3ALQA 1RUD2 4P14A 2DWRA 1PO12 1S0CA 1ENSA 3MDPA 4IQPA 1UU5A 1D0HA 2Y38A 4QPGA 1ZBE1 3ILFA 1W6PB 5F9TA 5BNNB 3VZOA 5EJ3A 2R6QA 2WA3A 2DUPA 3H3ZA 4LR4A 2OYZA 5CIRA 4LBMA 1CAVB 1PK6B 2D6MA 3JCIA 4N90A 4AFAA 4XQ4A 5E1RA 5JPNB 5CFDC 1ZZCA 2ZMNA 5KHJA 2DFBA 4PIZA 2HWB2 4O9GA 1IPJA 2CGNA 2P3IA 3TB0A 1VBB3 1S0BA 2QNKA 2TEPA 4AI8A 2FZ1A 3VBUA 4LO7A 4EN9B 2YY1A 2ZGLA 4YRDA 3WDYA 1JBCA 1RTVA 2SLIA 2WQ4A 3ETQA 3M1HA 4JGYB 4L11A 4Q4Y2 4N9IA 3WP4A 4WVZA 2PTMA 1PGW1 2OA2A 1WBFA 1QOOA 4Q4X3 5C8WA 2NZ9A 2FMDA 4H14A 4HK8A 3AKTA 1FXZA 1H2KA 4IV3A 4HANA 3A0NA 1ZRCA 1FOD1 1KJRA 2WNVB 4GXLA 4PLOA 4QM8A 2HWD3 1A8DA 1S0IA 2ZX2A 2ZX4A 3CJIB 4LBQB 1ZA4A 3IM0A 3W58A 2XJRA 2XJVA 3WG3A 5KHKA 4XETA 2GNBA 3JD73 3MPPG 1I6XA 1VBD1 2HWC2 3QH7A 3ZYGA 2IXLA 4CDWC 4CDUB 1OHFA 4ZU4A 4ZU7A 4UW6A 4E9KA 4XF0A 5CB7A 3ZFFB 1VRH1 3MPBA 5GZCA 4P9YA 1YI7A 2ZA9A 2R071 2ZGRA 2KM2A 1PO23 1RL3A 3QBQA 4IEWA 1ZZ9A 1OOPC 3OBRA 1DFQA 1AYM3 5DZGA 1G7YA 3KD4A 1MEC3 1QGLA 5K7PA 1TMF3 2BNMA 1QDOA 1DQ4A 2VVEA 1LOEA 4DINB 2A6WA 4YNIA 3TN91 3SNMA 2DCTA 4F3JA 3WDWA 1IQAA 2V09A 3WP3A 3PJQA 2E53A 3B93A 4WBBA 4XHBA 3VL8A 2IXKA 2PAMA 4D94A 1JW6A 4P9GA 1DGLA 4A7ZA 3X29B 2D3SA 5DG1A 4FOWA 1LB2A 5KC6A 1IS4A 2LM3A 4XDQA 5GJ6A 3U11A 2NYYA 4YZ4A 1QXJA 5FMOL 2NMOA 1PHMA 4BIOA 2ZAHA 1VAMA 1PVXA 3SISA 3WOGA 3MIFA 1RUG1 4KQ7A 3SH4A 3ZXAC 1Q43A 3FBMA 4JGZC 4YZ1A 1KITA 3ZFGC 3SMHA 5KHGA 2A3WA 2VH9A 5AVAA 1HXS1 2D44A 2JG8B 2O1QA 3FFQA 1LESA 1OOPA 4ZU5A 2CY6A 1ZBE2 4R4ZA 4Z07A 1AX0A 2XWJB 2RJKA 5DZEA 3AP6A 2Q0AA 2WNEA 5FQ0B 4AEMA 3QD6A 4AVCA 4D7SA 2OZ6A 4FAGA 2A73B 3RJRA 3KS7A 1BEV1 1VBE2 1PNGA 1HV0A 2B9UA 5JSPA 2WS91 1ZZBA 1UCXA 1RUC2 4BE3A 1U5YA 4S2HA 3T1MA 5H9SA 1W0PA 1N1VA 1IGOA 4S2FA 1I1EA 3CLPA 1XYPA 4YW2A 3D6EA 4BQ1A 4WVMA 3M8LA 3USUA 1MS0A 3GHNA 3TBDA 1PGSA 2GAUA 1H4HA 4WZCA 4MV2A 5FCCA 4R9BA 1WLCA 3RZZA 3E97A 1XRUA 5LK5A 2E51A 4JGZA 1BBT1 4N43C 4D69A 1FMD2 3ZFGA 2WFF1 3I4IA 3B3QE 5FO9B 1RUNA 1I3HA 1FOD2 4COYA 2BW8A 1EAH1 2V5YA 3SXWA 5D8AC 2DFCA 3N7LA 1NCQA 3B94A 1CAUA 3FLTA 4GULA 3ILRA 3OBTA 2PFWA 2W08A 1IHMA 1O91A 1PVC3 4GH4B 4N53A 1NLRA 5DDJ1 5C6CA 4Q29A 1RUJ1 2VW0A 1O4ZA 4K21A 2CNAA 1Z0HA 2CWSA 2EALA 4Y20B 1O3TA 3D0SA 4OHYA 2PLV1 4DY5A 1VIWB 1T6GC 2YPJA 3CNAA 1ULDA 1ND3B 1U0AA 4IEVA 3VDDB 3ZSEA 4HVQA 1LEDA 4QGLA 2Q4SA 2ET7A 3N7MA 2ZKLA 1AVBA 3E6DA 4N43A 4EWDA 2EAKA 1JOJA 4YARA 1CAWA 1QDCA 4KWJA 4COVA 1GZWA 2Y26A 1OKQA 2VNRA 4G3YC 1AR61 4XJUA 1YJKA 3AZYA 2A5ZA 5D8AA 5J37A 1CJPA 4XIKA 1ZBA3 3HN1A 3AKQA 2PHDA 2D3RA 2JE7A 2YHJA 3LWCA 1HRV3 2VY0A 1RUG2 2ZMKA 4AG4A 2GDFA 1DU3D 3GZTB 4HPKA 3VBOC 4LO8A 4PIXA 1C3HA 3NAPC 2Z2SB 4LBJA 5C9AC 2TBVA 1ASJ1 1RUE1 2R30A 2GNMA 2EIGA 1PIV1 1X7NA 1SCRA 1BCXA 2DVBA 2GH2A 3H1MA 3ZO0B 4PLMA 2ZACA 1RUF3 1QJY3 1TEIA 2FHRA 2O8OA 1J58A 3KMHA 1HRI1 5BNPC 4Q0QA 1R1ZA 3HWJA 1BEV2 1TNRA 5ACA1 3MIEA 3BTAA 2X29A 1RJ7A 2WS92 4AEDC 1QNYA 4JDMA 1H8TC 2DURA 2X5IB 5J96B 3O12A 2D5FA 5I8SA 3WT3A 4F7ZA 1X50A 2RS51 1AHSA 1O3SA 4LT5A 3N4MA 4I2OA 1LOGA 4I0WB 3IBMA 1RUH2 2R0FA 1FPN2 2ZHNA 1SACA 5FLJA 1LHUA 3ELNA 4YM3A 2JD4A 1QY4A 1DGWA 4XFAA 4OFGA 3CF6E 4HKOA 4Q0SA 4W6YA 5K0UC 1QXPA 2VUAA 1HKDA 2XJQA 1PGL1 2P37A 4MXWB 4Q0VA 2CWMA 1RUD3 4KWKA 1YJLA 2KXLA 3VBOA 1J3RA 1W6QB 3RQ0A 2WFF2 4ASLA 1FV2A 4QPIC 3HAGA 2E7QA 4R4XA 3LAGA 4XZPA 1DGWX 4Y1UA 1TME2 2AH2A 4IV1B 4ES9A 5C9AA 5HCAA 1WW6A 2VOVA 1AR72 4AE2A 3VZLA 3QOPA 4CDQB 1VB2A 1EAH2 3I7DA 2W39A 3MEPA 3I8TA 3H7YA 4GB32 2WKKA 1GSLA 2BEOA 5GZFA 5L7OB 3FLRA 4COUA 3HBZA 1XXNA 1AYN3 3TWIA 5BNPA 2Z5WA 1IOAA 3H50A 1DQ6A 3DPRB 3SCGA 1W6OA 2DCZA 1RJ8A 1RMU2 2UYAA 3VBHC 1YFXA 5DDJ2 1W39A 3EHKA 1RUJ2 3M3OA 3IT8A 4DNYA 2HWB3 1REEA 3IPVB 5JOXA 5LEJA 2VXRA 2W52A 1ENXA 2BQPA 3MIDA 4ONUA 4CYDA 2R1DA 4XJ8A 3DGTA 3FZ3A 1SLIA 5E8AA 4CDXB 5K0UA 5AC92 1YIFA 3LCPA 4XYXA 5FTTC 4P9XA 1H2NA 3MF6A 3KB5A 2VECA 2DVDA 5C4WC 5AFEA 3VL9A 1ENQA 4QPIA 3RS6A 1XE8A 5BV6A 3RMXA 2NLRA 3IDBB 3N3HA 1RHI3 3OPZA 5LRRA 3JBG1 5FFOC 4XFBA 1BMV1 2OUHA 1Q3EA 4RHV1 1YUDA 5EFUA 4U36A 1DF0A 1POV3 4YM0A 3ZXJA 1UAIA 1WCSA 1QWRA 3AXEA 3NL1A 5A32A 1DIWA 4LO5B 3BOWA 2ZX0A 2QJVA 2IFWA 1GLHA 5F5QA 1V9U2 5GLVA 4QQOA 1OFSA 1H8VA 1RUE2 1AR81 1GANA 2MEV1 3DUIA 3RRDA 2DTWA 4AHZA 5ABJC 4FP2A 1ZX5A 1ND2B 1HLCA 4AFCA 2ZX1A 1N3OA 3VKNA 2ZJCA 2JG9B 3OYWA 1CD3G 2VOKA 3O0XA 4ZXKA 3L2HA 5C4WA 3QLQA 1K5MC 1X36A 1B35C 2PHTA 2WL1A 3RYRA 1PM7A 3AYDA 3NJZA 1XU1A 4TYSA 3ZVXA 3WV6A 4JRAA 2CYFA 4RSUA 3PHMA 2A6YA 1LOFC 2ZABA 1GNZA 2R0HA 4BM8A 2HEYF 5HCFA 3PTYA 2CGPA 4YG3A 4XFFA 1WCDJ 3P3PA 4WM7B 3B5LB 4EN8B 4AI1A 4MX3A 1UIKA 1NCRC 1PGL2 4EN6B 1R093 2PYTA 4C91A 2G4IA 4Z92B 2WZR2 4GA9A 2XJPA 4Q0PA 3LB9A 3NV4A 1DBNA 3TOJA 1F31A 1QQP1 1AJOA 1URXA 3ZFEC 1YCIA 4WM8A 4GWMA 1GFF2 1WBLA 1KDKA 1QJX2 1U5ZA 1ZBE3 1PO11 4M01A 1GQGA 4R9DA 2IC1A 4QPYA 3WDVA 4XJAA 2EVXA 5FOJB 5J3UA 1AR92 1X82A 1LGNA 2XLFA 5H9RA 3LA2A 4H7LA 1R082 1K5MA 3V0AB 1AX1A 2JE9A 4KL1A 1IKPA 3DL3A 2E9QA 2B5HA 4HK9A 3HMYA 4URTA 4XIOA 1DYPA 2SBAA 4Q1RA 4F83A 3A0KA 3DV8A 2AENA 4RGGA 2XLAA 3KCYA 1JHNA 3LZZA 2RS11 2Q1ZB 2Y0OA 1LULA 2XHKA 1C8M1 2JECA 4Q4Y1 2W68A 5JZGC 2WC2A 3ZN6B 2RR12 4LHLA 4AWDA 5DUXA 3ZFEA 4AGGA 1FOD3 3GHMA 4CP1A 3WD5A 2RMU1 4RQPB 1D4M1 1LRHA 3H9AA 3WQ1A 4R9CA 5CBLA 2H0VA 2ZBJA 2FBEA 3UKVA 1BMV2 5JIAA 1CESA 2BNOA 4AHYA 2C1FA 4R9AA 3ACLA 1PMIA 3GBGA 3TAYA 4AHXA 1VBD3 1NA1C 1UZZA 2P17A 5BNOC 3E5XA 2NP0A 4DOUA 1VRH3 1GR3A 2VG9A 4FP3A 2HWC1 3S0MA 5CAZA 2R073 2IZWA 4J1WA 4RR3A 4W65A 2VNGA 5JOZA 2BFUL 4NN0A 1MS4A 1N1YA 1OPMA 4EWAA 4UBHA 1AR82 5CFCA 4YG6A 2GH8A 1GV9A 3IKWA 2E7AA 3B9CA 1ONAA 4E27A 1JYIA 1ZRRA