4RTKA

Complex of escherichia coli dna adenine methyltransferase (dam) with sah and with dna containing distal pap regulon sequence
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
245
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
total genus 81
structure length 245
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtkA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtkA01
4EKIA 1Z3CA 2WA1A 2PV0A 1X19A 1BHJA 4RTJA 4ER6A 5ICEA 2ERCA 1YFJA 2IIPA 1QAMA 4IV8A 4BLUA 4E70A 5MHTA 3FTEA 1SQGA 1KPIA 4FT4A 3UA3A 2OZVA 4C4AA 2UYQA 3ERCA 1G60A 1NW5A 2ADMA 2NXCA 2ZBRA 3AJDA 5EHIA 4OA5A 5GINE 3SSNA 5FA5A 3UJ9A 2IDKA 2EX4A 3ANXA 4IV0A 3AWIA 1PJZA 1X1BA 2KW5A 1X1AA 3GGDA 3AXTA 3HCBA 3HP7A 5E1BA 4X41A 1M6EX 4PWYA 4IKPA 4E2WA 3LDUA 2C7QA 8MHTA 5ICGA 5DRYA 5K0EA 4DCGA 4FZVA 2PX5A 2HMYB 2IPXA 3BZBA 4OQEA 3HCDA 4PIPA 4Y2HA 3BKWA 4E2XA 1EG2A 2P1DA 3KU1A 3LDGA 2G72A 1RJGA 3LKZA 3NWBA 2HV9A 4RVHA 2QE6A 2PT6A 3A25A 3SM3A 3ORHA 3E8SA 4HGZA 2IDJA 3A26A 3WSTA 3MCTA 3DR5A 1N7JA 4G56A 3NWEA 1NT2A 1KYZA 2H00A 3FPGA 3GCZA 3GWZA 2XBMA 3OZSA 1KPGA 1DCTA 4YMHA 3EGEA 3HA3A 3OCJA 5KVAA 2HR1A 2OB1A 4R8RA 4U7PB 3HA5A 3HA7A 3BT7A 1L3IA 5E1OA 1FP2A 4RTPA 1IM8A 1RJDA 3R6TA 3E05A 3O31A 2C7OA 1I4WA 5EC8A 1M6YA 3EVFA 5CM2Z 4MQ4A 2VDWA 5FQNA 1O54A 4RTOA 1OR8A 3P9IA 1NW3A 4RTMA 4MWZA 3GRYA 4QTTB 5DX1A 5M5BA 3ID6C 1WG8A 2AVDA 3CVOA 3OZRA 4PYQA 4HH4A 5HILA 2E5WA 5EMLA 2IH2A 3KR9A 3NJRA 2AN4A 4FT2A 5BXYA 1R18A 2I62A 2QYOA 4HGYA 1SG9A 3CGGA 3ELUA 3GRUA 1QZZA 4QDKA 3CKKA 4CKCA 3FUVA 3OPNA 2JHCA 3EMDA 4V0RA 3KQWA 2I7CA 5K03A 4HRAA 5LR6A 4E2YA 3JWHA 2ZLBA 1NBIA 4A6DA 3KPYA 4QPNA 1VP3A 1HNNA 3DXXA 3HEMA 3SSOA 2UYHA 3BWCA 1EAMA 2ZIFA 2GAFA 3GDHA 5K0LA 1U2ZA 2ESRA 3HM2A 4HSGA 4AUKA 2QM3A 3P2KA 2PBFA 3FPFA 4QVGA 4IWNA 5K0NA 3OZTA 1QYRA 3B3FA 2ZTHA 4LWOA 4XUDA 5GIOE 1SQFA 5FWDA 3D2LA 3LCVB 3PX3A 4F84A 10MHA 2CMHA 4YV0A 1V39A 3EPPA 5CCXA 3DXZA 4HTFA 3KPJA 2ZBQA 5C1IA 1XVAA 2CL5A 2EG5A 3M70A 3T7RA 1N2XA 2IP2A 3HVJA 3IEIA 3BGIA 5EIFA 3TOSA 5K05A 3QOXA 5GM2A 2PX4A 3REOA 3DUWA 4YMGA 2DULA 3B5IA 4FSDA 5E9WA 2GA9A 5DXJA 5T6BA 3OFKA 4RTLA 5EPEA 5FCDA 3TKYA 3PLAE 5IKMA 1KXZA 5CIYA 3NDJA 2P3OA 2FHPA 5HOQA 3ELWA 3UFBA 2P40A 4P7GA 3P9NA 2PT9A 2PXXA 1WY7A 1SUIA 5IH3A 4FGZA 4L7VA 3SX0A 4EKGA 2Z6QA 3TR6A 1JG2A 2GPYA 4A6EA 3KKZA 5F2OA 5EMJA 3VC1A 4PYMA 1G38A 2OPBA 1JSXA 9MHTA 1IXKA 1YB2A 4XUCA 1XJ5A 4YUYA 3P2IA 4GBED 3JWJA 1KPHA 4QTUB 4CKBA 1VPTA 4PYOA 4Z2YA 4HG2A 1ORHA 2BZGA 3LDFA 2IH4A 3BWMA 2GB4A 3KQTA 1P1BA 4RTKA 2IGTA 3X0DA 3KR2A 2H11A 1RJFA 2R3SA 3SGLA 3KQPA 1R6AA 4DCMA 3NDIA 2NXNA 3DOUA 5FHRA 5HZMA 1R8YA 3GRRA 3BWBA 3L8DA 3FPHA 4FS8A 4PCLA 2VDVE 3P97A 4KWCA 5DSXA 5D1HA 4KRGA 1XTPA 2ZIGA 5EMKA 3TLJA 3M6VA 3Q7EA 3GRVA 4KDCA 1KHHA 1AF7A 3I64A 3NTVA 3HNRA 4KIGA 3FZGA 2AOTB 3FUUA 1YFLA 1ZHFA 5EG5A 5FA8A 1YUBA 3TM5A 4HTFB 4BLWA 3G2OA 1RI5A 2JHAA 4PYLA 4RVFA 1WS6A 5KS2A 1FBNA 1VQ1A 1JQDA 4RYLA 3C0KA 4OX9Y 1XDUA 4LECA 2YXLA 4ER3A 4PYJA 4RTQA 5DLYA 3OFJA 3T7TA 4Y30A 4PNEA 3R24A 2AVNA 5FHQA 3EEOA 2C7PA 3O4FA 3MERA 3FPEA 5BW5A 4NECA 3EVDA 4FSXA 4BP1A 4GOOD 3LSTA 4RTNA 3BXOA 3DMGA 3DXYA 5P8WA 3QOWA 2Y1XA 3UZUA 2AZTA 3LCCA 4KW7A 1TW3A 3C6KA 3I9FA 3UWPA 2NYUA 4X60A 4C07A 3B3JA 1F38A 2Z6UA 3KQQA 2V7EA 5DM0A 3THSA 3TM4A 2G70A 2OY0A 3GIWA 4M36A 1KIAA 1SKMA 4E30A 4OBXA 1NV9A 4JXJA 1HMYA 3G5LA 3KPVA 5F2KA 2AOWA 5FULA 5H02A 5E1DA 4UOEA 2P7HA 2BM8A 5E8JA 4AZWA 1XXLA 1VP9A 2AOXA 4DMGA 5K0GA 4AZSA 1VIDA 4CTKA 3BUSA 3DMHA 1R00A 1VE3A 1N7IA 1X1CA 5E1MA 1RI1A 1YZ3A 3UBTA 5HIJA 4FP9A 1G8AA 3C6MA 3F4KA 4QVKA 5FQOA 4YUZA 2GS9A 2OO3A 5D1NA 5EGSA 3RODA 2AOTA 3HVKA 4GC5A 4PINA 1JR4A 5FWAA 4QDJA 2ZCJA 1JQEA 3DLIA 3OU6A 5CVVA 2YVLA 1FP1D 4CTJA 4ER0A 1MHTA 2AOUA 3KPUA 4RTSA 3V97A 5C0OE 2QY6A 2EJTA 5EEGA 4F86A 3G8BA 5K0BA 1D2CA 2OYRA 1O9GA 2O57A 3FRHA 4PYKA 3EVCA 4R05A 2ZZKA 4E31A 2YQZA 1TW2A 2G71A 1UWVA 2WK1A 3LPMA 3RW9A 3BGVA 4EQZA 1EIZA 1QANA 1RI3A 1AQIA 3FYDA 2PXAA 4GOND 3VYWA 4P58A 3SMQA 2JH8A 4ER5A 4YV2A 3VC2A 4PYNA 1FPQA 3P2EA 4WVLA 4E33A 2FCAA 1I1NA 2YUIA 3FYCA 2NXEA 2AS0A 1BOOA 1YF3A 3DH0A 1Y8CA 3E23A 2Q41A 3Q87B 2P3LA 2ZWAA 5GWXA 3UA4A 4CXMA 3HTXA 3EEYA 4OA8A 5EHGA 1H1DA 1BC5A 2HWKA 4RVDA 3G89A 4YV1A 5KQRA 1XDSA 4R6XA 2PJDA 5GP1A 3CJRA 3UJBA 2O07A 3H2BA 1B42A 2VZ9A 2FRXA 2ONZA 3A27A 2B9EA 4PONA 4X61A 2ZIEA 1I9GA 4O29A 2YX1A 2A14A 2AN5A 4LWPA 2O0LA 2YTZA 4X1OA 5K01A 2G8NA 1Q0SA 3B89A 3G8AA 1JG1A 3MTEA 2CMGA 1SUSA 4P7KA 5DWQA 1DUSA 2LD4A 2PSSA 2I6GA 4OQDA 4RTRA 5CCBA 1TPYA 5BW4A 2P41A 4GOMD 3EVEA 4KIFA 4H0NA 3THRA 3KQMA 2VS1A 5GOZA 3JWGA 3ME5A 3LGAA 3PFGA 5CD1A 2YR0A 1IY9A 2XVAA 3IHTA 4KVZA 5CVUA 3FRIA 2ZVJA 4YUWA 4CWAA 4EK9A 4HC4A 2O05A 3NMUF 1L1EA 2FK8A 3GXOA 2XYRA 3HCFA 3LECA 4DKJA 3NVMB 3UJ7A 1WZNA 3FUXA 3TFWA 2JHPA 3LKDA 4PIMA 1MJFA 1P1CA 2UYCA 3K0BA 5LQKA 1G8SA 3LHDA 4DA4A 3EMBA 4U7TB 3SXJA 3GU3A 3K6RA 4DZRA 2B25A 4RSRA 1WXXA 3AXSA 3MGGA 3LCUA 1EJ6A 3HCCA 4DF3A 1EJ0A 4X63A 4WXHA 4E2ZA 5DT2A 1G55A 1WXWA 3FTCA 3ER9A 1NKVA 3DP7A 5G02A 3V8VA 3MHTA 1D2GA 2AOVA 3M6UA 2BR3A 5C9ZA 3FTFA 4RWZA 3CJQA 5EZSA 3AY0A 4GUAA 3A7EA 3MAGA 5DX0A 1XDZA 3GRZA 2ZBPA 4QQNA 5EKXA 3UJCA 2UYOA 3EVGA 3DLCA 1G6Q1 2ZW9A 1NV8A 3OE4A 3MB5A 5K0CA 2ZFUA 1ZQ9A 2OB2A 1ZGAA 4GC9A 5K0JA 3UJ6A 3EGVA 1L9KA 5FADA 3KQOA 2OBFA 5B1SA 3G2PA 5LSAA 3PFHA 4V0QA 1XCJA 2BR4A 2FPOA 1F3LA 3PB3A 1X1DA 4C03A 1L3CA 3OU2A 1FJXA 1UIRA 5DM1A 3JWIA 5F2NA 5K0FA 3KQYA 3EVZA 2IH5A 1NE2A 3KQVA 1EQAA 1R8XA 5DRTA 4RVGA 5KYGA 2Z6AA 4AZVA 2R6ZA 3O7WA 5LQCA 5K8VA 3BKXA 2GH1A 4ISCA 5LQNA 2HTEA 2WA2A 3ELDA 4RV9A 2P7IA 1Q0TA 1P39A 5JUWA 2C7RA 1BKYA 1NW8A 2B78A 3LBYA 5DTMA 4PGHA 5E8RA 2ZZNA 3B3GA 2ORED 4QPPA 4P7JA 4DM3A 5DSTA 1RI4A 3QV2A 5HIIA 1AV6A 2EJUA 3KHKA 5DX8A 3DTNA 3MTIA 4MTLA 4FR0A 3HCAA 3TMAA 4BLVA 5E9QA 4GEKA 4ER7A 1D2HA 2PXCA 3CCFA 3OU7A 2XYVA 3A7DA 3BWYA 3M6WA 3M33A 1NBHA 2GLUA 3CJTA 4PGGA 2AR0A 5CUQA 3UJDA 5E2AA 3LBFA 4YUVA 2CKDA 4P7FA 2CWWA 4QQKA 3M4XA 5DTQA 5EQJB 5GIPE 4GOLD 3GO4A 2UZ4A 3LL7A 3MCZA 5ICCA 2EFJA 5KQSA 1VBFA 1R74A 5K09A 3G2QA 3PX2A 4MHTA 2B2CA 2VDUE 2FYTA 5EMMA 3SVZA 1JG4A 2K4MA 2ZWVA 4E32A 5ERGB 1ZGJA 3NVKI 2ZSUA 3T7SA 1YZHA 4GF5A 5E2BA 2H1RA 4R8SA 3BGDA 2P3QA 4ATNA 1M0EA 1VL5A 2VP3A 3KR0A 4DQ0A 1QAOA 2BM9A 2DPMA 3B7PA 3HCEA 2PKWA 3I5UA 3P9KA 3KR1A 5HIMA 3TRKA 2PWYA 3P8ZA 3SR4A 3FPJA 4LG1A 2OKCA 5DXAA 2NP6A 3KQSA 2QRVB 1NW7A 2IFTA 3OE5A 3P9CA 2PLWA 3S68A 3R0QA 2G1PA 5EOVA 4AX8A 3DULA 2JG3A 3G5TA 1L3BA 2PVCA 2P8JA 3SSMA 1UFKA 4XCXA 2AN3A 4M7RA 4PCAA 3EVBA 3PTAA 2HNKA 1JSZA 3GJYA 4C05A 2ZZMA 3PT9A 5FUBA 4XUEA 2Y1WA 3RIEA 3E7PA 4B17A 5CVJA 2ONYA 5HIKA 2V74B 5JR3A 5LQRA 4AZTA 1INLA 2N47A 3P71T 5EEHA 3TKAA 1RI2A 1DL5A 2XVMA 2NXJA 5EZQA 4C04A 4CKEA 4R6WA 5EVJA 4F85A 4YUXA 5CVDA 2BR5A 3FUWA 3KPWA 5ICFA 4OBWA 1KP9A 3UJAA 3MQ2A 3C3PA 2YXDA 5T64A 3LX6A 4POOA 1ZG3A 3UJ8A 3PS9A 5GM1A 3IV6A 1KR5A 2P35A 2JJQA 3GNLA 1JTFA 3T0IA 3DMFA 5BP7A 2BH2A 3EVAA 3HVIA 1T43A 1XCLA 3PVCA 3CC8A 4PYIA 5FTWA 1ORIA 3TQSA 7MHTA 1KYWA 5EIWA 2PX2A 3C3YA 3A4TA 3IYLW 3M6XA 4GQBA 3G2MA 4M37A 3HVHA 2PWPA 4C08A 3CBGA 1JQ3A 3G88A 2NNWB 4MIKA 2F8LA 2IBSA 3G7UA 1NW6A 2AOUB 4BY9E 1RJEA 1SVUA 3NW9A 4BP3A 4K6MA 3R9XB 5U4XA 2I9KA 4EMSA 4M38A 2YXEA 1PRYA 5DM2A 4C06A 5EKUA 5LQUA 5LQJA 3R3HA 2PGXA 3U81A 2QRVA 4EVIA 2PY6A 3TPZA 2FK7A 1VLMA 1QAQA 1AQJA 2B3TA 2NP7A 1P91A 5HFJA 3FTDA 4RX1A 5HEKA 2O06A 5DPMA 3I58A 5DM4A 5E9JA 5T67A 1O9HA 3FUTA 2OXTA 3I53A 3ER8A 1ZKDA 2ZULA 1JG3A 4KDRA 5CVEA 4ZTBA 2XYQA 2IBTA 3ELYA 3VSEA 2JH9A 1JTEA 3EGIA 5DTRA 2PX8A 5LQAA
chains in the Genus database with same CATH superfamily
3T7CA 3ITEA 1CJUC 4ZO6A 1YFJA 1RC1A 1THZA 3KTFA 1KPIA 2DWUA 1ORTA 5H5JA 3AJDA 3RUEA 1BD4A 2CYCA 3WWZA 5JZVA 4U2BA 1DQNA 1M1ZA 2FXIA 2NUPA 2XDQB 4TRRA 3MGAA 5EJ4A 2IQIA 2H85A 3LYLA 1X1AA 3DGFC 3HCBA 5AJHA 3SY8A 3R5KA 3LDUA 4TN5A 4TKUB 4WBSA 5ICGA 1NW4A 1LLFA 3V9PA 1KDVA 3UB4A 1W6RA 4DUZB 2G5TA 3HCDA 2AG6A 4UQLA 1I4EB 3SDZA 1WB9A 4WERA 1YRLA 2BHNA 2IEGA 5IM4F 3ADBA 2R44A 2CFTA 3T15A 2ILTA 4M9RA 1IZ9A 5F7OA 1W4ZA 3DLAA 2MT9A 1K86A 2YJGA 2W37A 2XQFA 3VR3D 3NFRA 1CRWG 4TSKA 4AQ7A 4ALNA 4RGVA 3OKFA 2XTNA 1LQ2A 2N0SA 5AVRA 3UMMA 1QUFA 4XQ9A 4IDCA 3HA5A 1IHUA 2EFHB 2Z0MA 4FSHA 1I3OA 3ZHOA 5I7VA 1D6MA 2VTBB 1YC5A 2OHGA 4XSVA 4MVJI 1FUIA 2HRZA 3O31A 2GRAA 5EC8A 4XD7D 3W2HA 3FAKA 1ZUIA 2XMGA 1SA0B 5IX8A 2VHJA 1DADA 3V2HA 3PQ5A 3E18A 4K9QA 1B73A 2AMLA 1DOAA 4QICA 2J4CA 3M4ZA 4PBSA 1F6DA 1SJ9A 1K5PA 1DZ3A 4D26A 1RWQA 5DNUA 2JHGA 2ANBA 1N6KA 3MS7A 4KO3S 3O03A 3QQ5A 1Z7BA 2NT3A 4TS9A 2JFHA 5KAPA 4B4KA 1AQYA 5HCNA 5E6RA 3OZBA 5HOEA 1QRDA 3TLAA 3FUVA 3TL6A 2EBWA 2JJ1A 2VG8A 3KB6A 3VR6H 2AE1A 3VPAA 4QM6A 2IEYA 3RHZA 3D6FA 2W2LD 2LKDA 4RH0A 4S1OA 5D5QA 3DXXA 3HEMA 1CV2A 5ECWA 3SSOA 3L0ZA 4UE6A 2BD0A 3DZFA 3JQBA 3KJZA 4U8HA 3X2SA 2XZPA 5L3SB 3PNMA 3BA6A 2JLRA 3LY7A 4F84A 3SZLA 2Q1UA 2B1IA 3V1MA 3ZGYA 1LUAA 2N1MA 3KZKA 5B3JA 3IR5A 3WK8A 1Y1KE 2GZSA 2BEWA 3OWHA 4OYHA 3HCWA 2FW1A 5LDDC 1U5BA 4Z7OB 2I3GA 1V4BA 2JGMA 5EJ6A 3P4YA 2J0EA 4R3NA 4H4CA 4MI1A 3PLRA 5EJFA 3MWLA 5IZCA 3CPSA 4PSVA 1UC4B 2GA9A 1XI2A 1BCRA 3BD7A 3OFKA 4RD3A 5UKDA 3C15C 3AKCA 3LZDA 3NDJA 3N3BC 1Q74A 4L28A 1T0JB 4LRSB 4XFKA 3D6UA 3WRXA 1BDBA 2DT5A 4DJAA 1I80A 3SZUA 1PFUA 1JVSA 4OI4A 2GVNA 1M3SA 4GDMA 1U8TA 3DBRA 1A9YA 2GPYA 1YE5A 3AEKA 2AEJA 1KDTA 5F2OA 5ITVA 2IC5A 3TQQA 1P1JA 2ID9A 4IIUA 1EUDA 2NZ8A 2RBKA 2A58A 3C3JA 2G76A 3AIMA 4V1CA 2AFHE 5THKA 2IV2X 4EMUA 3DL0A 5DK6A 1S4QA 2X5XA 4ZIRA 1PNTA 4RELA 4YFYA 3COYA 1RJFA 1XDWA 3DZHA 3H18A 2QZSA 5IP5A 4Q1AA 5A02A 1JWAB 4QRDA 5H0IA 2IXFA 5B58T 5KNBH 2DY0A 1AGRA 1IONA 4YECA 1R8YA 3L8DA 4GWKA 1XTBA 2RG7A 3ER6A 2ARKA 2M98A 4GBGA 4N5MA 3VR5H 1LS6A 1KMHA 4U9IS 3R7SA 1XZCA 3S2FA 1YDHA 1KZ9A 1BWRA 3C6QA 5FP0A 2GD2A 2X2EA 4JVSB 4KIGA 1IN5A 2BDTA 3OTGA 3D4LA 4TTPA 3UHAA 4PX2A 1DC6A 2Y1KA 3M82A 3MT9A 1GZ5A 1MENA 2ATXA 2BUBA 2OOSA 1U28A 2Y0DA 3NVDA 3AOGA 3CPHA 3QE4A 3VMFA 2PX3A 4MKIA 4XQGA 2F59A 1PT8A 2PL5A 1DBPA 3RYCA 1SCKA 1GNRA 2YXLA 3BWVA 3N05A 3WA6A 2F67A 2LWIA 5I45A 3GVCA 4BE4A 1NY6A 5K3BA 1T9ZA 4CCYA 4NY1A 1UJ2A 2FEKA 4E4RA 4WFQA 3E22A 2CV1A 4BIMA 1EK6A 2ZJ7A 3KOMA 3HL4A 1R66A 1RYEA 2HCRA 4GL4A 4YACA 3LSTA 3UN1A 3BXOA 2MR5A 2BISA 1UWLA 3N28A 2GCEA 2PCLA 5AO9A 4ZVTA 4B40A 3F73A 1ECBA 3RS7A 3THSA 2OFXA 3A36A 3H5NA 3PR2B 2CNNA 221PA 1W36C 4OUKX 4JL8A 2RHWA 3R8XA 3QI2A 3K8ZA 3VYVA 1EEXB 4A23A 2X9VA 2JCGA 4DA8A 2D2XA 2I4NA 2ZDGA 4IF6A 1U7DA 1L4MA 3A2LA 2PZFA 3A6DA 5CYPA 4IH9A 3W5DA 2V03A 1H2HA 4TUYA 2W2TA 4IMPA 3TSWA 5KB3A 4IUYA 2VC2B 1KWGA 2Z2YA 4B6FA 5BSKA 2OO3A 4HJRA 1C1HA 2CXSA 1T3LA 2MMCA 2V4MA 5FPQA 1FDTA 4MIEA 3ZX5A 3ZTTA 1MOSA 4XUGB 5HJ2A 2E87A 1QHFA 2O7SA 3VZRA 5JSHA 1Z4QA 1RCTE 3FIUA 3WGZA 1KYVA 3D1JA 3PRJA 2ZUWA 4FKMA 4UBKA 3PCTA 3AHIA 1UOEA 3VOTA 2WAAA 2G9UA 3WYFA 1M0SA 3HWRA 3H3JA 5JG7A 1RR6A 2OORA 3MLEA 3NC1C 2X86A 3NUQA 2V5VA 4M9UA 4R05A 1E2DA 3GLHB 3KJNA 4QPZA 1EGVB 5C31A 1XVUA 3L79A 5T6MA 2AFIA 4FJ0A 1RKXA 4RA9B 2JH8A 4YV2A 4RY2A 3UW3A 4LNAA 1HPLA 4BU1A 1VYVA 1YNSA 3L1HA 4J3FA 1GFIA 3GLFB 1WZ2A 3FI9A 5CEEA 1Y8CA 1P7CA 2P3LA 2ZWAA 1M1NA 1NN3A 2G09A 3Q5EA 4I9GA 4IIYA 3EGCA 3JQGA 1L4FA 3COSA 4TVKA 1H1DA 1QQ5A 5JYDA 1NUUA 3W78A 1Z4KA 3FDIA 4S24A 3RSHA 3EXIA 3HP1A 4XYEA 1H2AS 1GARA 4K5QA 3SYKA 3L6CA 2C5SA 2XMCA 4MYHA 3UG7A 4N0PA 2C5HA 2ZIZA 1YQGA 2ZRBA 1YJBA 1XL1A 3BRWD 2XODA 1B3BA 8OHMA 3K6SA 3OIWA 3R3UA 2HQ1A 4JVLA 1TAGA 3KKPA 3WHKA 1K6IA 1RP1A 1TPYA 4MUEA 3H1BA 2FNAA 1A8QA 5LMUB 3U7FB 4BTLA 5INTA 1VRVA 4UUPA 2H5IA 2JNWA 4H0NA 1GTJ1 3LQQA 4RM3A 4UD2A 5JDCC 1NT4A 3S40A 3EPJA 1YQ9A 3LHKA 2ANCA 2HTFA 3GGGA 2VQDA 2QPLA 2X0RA 4FHEA 1KEEB 2A33A 4NL4H 4QHSA 1DBRA 5TJHA 2J5RA 1NRIA 1IBCA 4EK9A 1T29A 1XHLA 1CYEA 2DUNA 2D8AA 1Z7YA 4J7CA 5HJ7A 1KXJA 4DIDA 2XUAA 1Z5GA 3ZWYA 4PIMA 3LKDA 1UZAA 3A1EA 3K0BA 1WV0A 1Y3AA 4UOZA 2ZDHA 3X1ZA 4YJ3A 5ALRA 1HFKA 3G1WA 2H4ZA 4AMGA 2QUJA 1Y3HA 2RBGA 3O2SB 5A2QA 3JXEA 1EEHA 2ZXEA 3THYA 4YC7A 1EJ0A 1NW9B 4WXHA 1R0XA 4XTRA 1SELA 1FFSA 2ZSBA 1WXWA 3L5OA 4I36A 5TMDA 1TE2A 2A0FA 3SXUA 2VHWA 4GE0A 3CEHA 5FTNA 1AX9A 1G4HA 1NDUA 2Q1XA 2Q6TA 2Z1NA 4WXYB 3PXDA 5TEWA 4B6OA 1XCPA 2VPXA 4HVAA 3NKFA 4NBKA 3D2AA 1E62A 1MVNA 1RLOA 1R0WA 2NV0A 3MAGA 1L6IA 3N2GB 1PL0A 1URPA 4P9NA 4TTAA 1AM4D 1W5BA 2Q2QA 3SEAA 3VVBA 3DVRX 4DLVA 3HC7A 3LBNA 5L6MB 4OHRA 2M6RA 4BQEA 2CLCX 2X40A 2Y9MB 3D8SA 2OB2A 2G82A 2RCNA 3S1SA 2P0AA 2YVQA 2IVFA 3I3SR 2IBMA 1PJRA 3OQPA 4PQRA 4K03A 3AEQA 3O4GA 1WHSA 1LK0A 4UHJA 4B44A 2P69A 3PF9A 4F8YA 1OE0A 4ND4A 4UTVA 3IC5A 1OLUA 2OBXA 5CLHA 1U0GA 3R6LA 1JX6A 1THGA 3GGJA 1NR5A 4MMYB 2ZI7A 1NE2A 5DBIA 3DDZX 2GEFA 3LQ1A 3ND6A 3WNQA 3PA8A 1JR2A 1ZJZA 1VSVA 4QT0A 4Y9UA 3JSAA 4Z0NA 1HDRA 4FCWA 1ZYUA 1MV5A 4J4HA 5K8VA 3PGJA 3BKXA 5AM1A 3D4NA 4KYUA 3RRJA 4GP6A 5THQA 1VJDA 1H69A 2DHCA 3RC8A 4LE2A 5F1KA 1CQJB 3PNOA 4MEAA 4P8RA 2PX6A 3U7HB 3I45A 3FCOA 5AVSA 1T8UA 4MKXA 3HO6A 5EJ5A 1F8FA 1WR8A 4UBJA 1UP7A 1RI4A 3GFQA 1NI4A 1Z5UA 3L8EA 1JG6A 2JB9A 3K0CA 1ZISA 5AJXA 5T4EA 2R68A 3RRFA 1UMKA 3CCFA 3LBAA 4XGIA 1U7HA 2OMEA 3GT0A 1Z5VA 2VRWA 5CUQA 3Q41A 4UBMA 3FLEA 3GVXA 5E2AA 4QUHA 4UULA 3QSYA 2PMBA 1W52X 1TCCA 4NEGA 1ONOA 1M34A 1VPVA 4JI4B 5CFMA 1P18A 3Q72A 4LWQA 1Q83A 1EH5A 4O2LA 5BWLA 3LFUA 2HA6A 2R2AA 4DR2B 1A8IA 4FEEA 4KO4S 2HUNA 3F0TA 1I94B 5FEUA 4JBNA 4L16A 2XW6A 1NBMA 1S3FA 4JEUA 1ZD3A 3WGTA 3LC1O 1JA1A 3UPUA 1M6VA 3OQOA 2C9OA 4R8SA 2ZU6A 1CR4A 1U02A 1Y4DE 3F3KA 2NZXA 4RY9A 4ZVLA 3ZQUA 4XIJA 4CLHA 2VEOA 2WJIA 2GBFA 2Q5JA 4FZ5A 4ZQHA 1K9SA 1V1RA 4RC9A 4Z4FA 4LOJA 4ALJA 3E8XA 4II7A 1C9EA 2J85A 5B7QA 5KQMA 2NP6A 2ZE5A 2NVUA 4U9HS 3WDLA 4MDFA 4OATA 2E4VA 3N74A 5ADVA 1OT5A 4AX8A 1S7GA 5EFOA 2PBZA 2PVCA 1Y7TA 2AQHA 5KJ1A 2ZKIA 4DWJA 3OF3A 1JSZA 1Q0PA 2CEKA 3V1UA 3MGBA 2AFRA 2MSDB 5BXQC 3PT9A 4FFOA 5H7XA 2PZAA 3P27A 1MJNA 2C2HA 1RKQA 4URZR 1ZMOA 4CNQA 3FFBA 2V74B 2W6ZA 1JU3A 3EOZA 2QHXA 5LQRA 4OHBA 1QZ3A 2B30A 4WA7A 2Q4OA 5KYXA 1FSGA 2B4QA 2WP0A 3EARA 3K0AB 4GXTA 4J91A 1M2JA 1K7XB 3I73A 3PC8A 3O47A 4I5IA 2BR5A 3FUWA 3FZEA 5B6IA 2XZTA 3TN7A 3NT4A 5ALMA 1E8DA 4QUJA 2R00A 2CUTA 1NVUQ 2Q0QA 1Z4MA 4JELA 3ZU3A 1JTFA 3KUDA 3KV3O 3UMFA 2RD2A 4RJTA 2J6IA 3DEYX 1T8YA 3GG9A 5JPDA 2X5JO 1Q1ZA 5KYUB 1EPUA 3M6LA 3C8ZA 1DCKA 1ICEA 3FF1A 1I7PA 5KVVA 4WLFA 2IYNA 2HYIC 1HZJA 1G8HA 1RD4A 4DW8A 3GLQA 2QR2A 4QXAA 4C3UA 4AJPA 4E6EA 1B8VA 3OHPA 1SXIA 3I6YA 4KBFA 4NBWA 4A5SA 1KL7A 3UK1A 1ZR2A 1Z4NA 1U8CB 2EV9A 5K3CA 1YGYA 2PY6A 1FE8A 3K09C 4L6AA 4H1WA 5JXIA 5HFJA 3GFSA 1N9GA 2B8NA 4F11A 3TRIA 3IQEA 2VA9A 4NDAA 4O1MA 4MVWA 4UTNA 4DV4B 3QVMA 2HF2A 4LF8B 3KXKA 3PKJA 4DCJA 3ER8A 1JG3A 5CVEA 3K3PA 3R41A 1FNDA 4X90A 1TO2E 4I9FA 2IIBA 3VPBA 3GFVA 3PWKA 5MFZA 2LCFA 1WA5A 1AUPA 1OKKA 3ZJYA 1SBQA 1WDLA 4P34A 4UHHA 1LZKA 3MMXA 2BFMA 1P1RA 4RLHA 2BKUA 2IHYA 3ROKA 3T95A 2IU3A 2Z6VA 3EK2A 3IJ5A 3MJRA 2UZ0A 3TOXA 1I2AA 4AROA 1G60A 5M34A 4KXNA 4XJTA 4OA5A 1N5JA 3A6HA 3ZVRA 1RPJA 1NQVA 3HKCB 1G2PA 3ANXA 4R9SA 3C3EA 4RIGA 1DIRA 4YJFA 5LOVA 2VPZA 3EG9A 3ESXA 2JAQA 3S7TA 2ZB2A 4BO2A 2NO4A 1NJ2A 3MBOA 3P9XA 4S2UA 2PG3A 2M6KA 3WB9A 1NF3A 4BO1A 1G1MA 4FZVA 2PX5A 4ES6A 1KYIA 2HYDA 2QL7A 3BILA 3DNMA 4WKCA 1JEJA 5EMHA 2VHQA 3KX2A 5ER9A 2HMWA 1XFAA 3LT5A 5H83A 1F0YA 5TQ2B 4E2XA 4EJSB 2G6BA 5LP6F 4LF9B 5DM70 1MD9A 3CUWA 2PWBA 2W2LA 1KO5A 3BMQA 3N6XA 1GGKA 4UMDA 4D9EA 1SPXA 2H3EA 3G9QA 1I6MA 1XLTA 4O4IB 1DC3A 1Z6GA 3OCJA 2Q9AA 4HWPA 3VTZA 4AT1A 3DOCA 5DN6A 4CXMA 1VFNA 2CBZA 1X86B 1Y4SA 3HU5A 1J42A 2WD7B 2E4AA 3BT7A 1CUUA 1ZK1A 5E1OA 4BC1A 4BNMA 4DQKA 1O8CA 1QS0B 3PQ3A 3R7WB 2WW8A 3F97A 3CNBA 4B80A 4QX6A 5A06A 1BKSB 4PVCA 4ZJPA 4UAJA 1I4TD 2CYBA 4WXEA 5A3RA 1FYEA 4Y2YA 2M1XA 4UBLA 1OV4A 4JC0A 3ZLVA 1BA3A 2HQOA 4RTOA 4A8HA 4GZLA 4M76B 2HC9A 5CDYA 3HVRA 4JUDX 1WD5A 4UEKA 3BL6A 4OU4A 4HH4A 1DX4A 2FFHA 5H8WA 1DINA 1SVWA 2JATA 5C80A 4RDHA 4FOSA 5A7GA 2I2BA 4WX2B 3ZWAA 1EESA 1N2JA 2EWWA 2QZZA 2QUZA 3CKKA 1TLLA 5TQ0B 2QD4A 2X42A 3A37A 3C97A 5B53A 4Y6SA 3KQWA 5DGIA 4BGVA 3EXHC 1J90A 2P78A 5LR6A 1OHHD 2R11A 2ZI4A 3KO8A 5EXEA 3TBKA 4OHFA 3KPYA 2G0NA 1ZJ4A 5GGXA 5B2FA 3W05A 4B4WA 4EELA 1E2EA 2YQ5A 1UKAA 4ARVA 1DEKA 5K0LA 4CW7A 1U2ZA 2JVIA 3HM2A 2QEQA 4L95C 4RD4A 1L7QA 3ZUPA 4B2YA 4RACA 5EAIA 1Z2PX 1CE8B 4QVGA 3KWJA 1BRTA 1LLUA 1SPBS 2ZRGA 3R5XA 1Z6TA 4N7JA 1NYLA 3FPKA 3RSLA 4I5GA 1EX1A 3RJ9A 4C76A 2VLIA 4DG9A 4DILA 1Y6QA 1Z4LA 4TKZA 5LXTF 2XGJA 3MPUA 4CN9A 2WF9A 5L3SA 2J9XB 3QEMB 4F8EA 1TTTA 1D8TA 3ZV3A 4DABA 2P75A 3ZLTA 2F3QA 3OIVA 2X41A 2H1SA 4PFJA 2PZEA 3ZHSA 3RU9A 3TI9A 4ZJUA 1KO1A 3B38A 5K4GA 2ZI5A 3ABSB 3CE6A 1WUJS 2YZKA 3GZTB 5EPEA 2B1GA 3TKYA 2OP0A 4D41A 5HRUA 2BFCA 4F93B 3O1LA 1G21B 4IGEA 4XE5A 2PT9A 3H86A 5DGHA 3PL5A 4LYAA 3HYNA 3N0VA 5CK5A 4QC2A 1IRIA 3TR6A 5IJ9A 1IOWA 3P19A 4QXMA 1ZGGA 1A9XA 5EY5B 4CR8A 2FPGB 2V8BA 4B32A 6NULA 4PYMA 3KYDA 2JF0A 5KOIA 3LYHA 5CGQB 5C8ZA 1E3WA 3K72B 4KQWA 4UW9A 2PS9A 3V8BA 1X70A 3WLIA 4PYOA 3BSYA 3TX6A 5A1TA 1MO5A 1ORHA 1JKMA 1YR9A 1OFHA 3TF5A 2C61A 3GLHA 1V2HE 3Q3IA 2H11A 4H08A 5A05A 3VHXA 5L4NA 1EUDB 1OKKD 3U19A 2DE0X 2QTVA 4P3NA 2P2GA 5FJIA 4DSNA 5ELLA 1N5LA 2YDYA 1J9GA 1C4XA 4RD0A 4EIWA 5DSXA 1LTKA 3MBIA 3DOJA 5CFNA 1PLKA 1U80A 1XRQA 2X3UA 4HOYA 5KCZA 1GSHA 1JJFA 1V37A 4PO9A 2J3IA 1XVVA 2BY4A 2QU8A 2VHYA 1XRNA 3R9WA 1F06A 3I6BA 1JDVA 2VWPA 1Q0ZA 2QQ0A 1E1QA 1XZFA 3AR9A 1HT3A 2UYYA 1RXSA 2BUCA 1FBNA 3F46A 1Z6PA 2RI1A 4MI9A 1FFEA 3A70A 3LQKA 4X24A 1GUYA 2VTEA 4PYJA 3RUFA 2O2JA 1WVIA 1SXHA 1U3FA 1AN0A 1E4OA 1GNVA 2ODBA 2ZRDA 2G8LA 4DAEA 4YONB 4QARA 3F67A 1JYSA 3Q7TA 5JZOA 2BGGA 1V41E 5KYYB 3ABQB 1JA9A 1VLJA 4LYJA 2J45A 4WN9B 2AJ8A 1P62B 2R5NA 4BNVA 2P90A 1AKYA 3LCRA 4MWCA 2ISSD 3EAGA 3KWLA 3FOWA 4J9UE 2ONCA 2X3FA 3AX6A 4RV5A 4TTVA 1QYCA 1LNQA 2R7LA 2OY0A 2GEKA 1QWSA 1RBMA 4RQAA 1UPFA 1O87A 3QZUA 3VVLA 1QB7A 1TIBA 4P4SB 5EE5B 1Z6AA 3RQSA 3CF4A 4JAVC 3TLBA 2FZEA 2PJZA 5K5EA 1T9DA 2WU1A 3D6MA 2IJGX 4KXUA 1CEYA 3FE2A 4K26A 3DMHA 3K92A 1RHMA 1RI1A 5CT6A 3OEWA 5K6TA 5CTAA 1Y7HA 5A3SA 3KU4A 1J49A 2I7XA 2EYQA 5BRAA 3O83A 3UGJA 4HAYA 5EJEA 4WESA 3QKTA 4GM0A 5MGNA 4GC5A 3VSBA 4F21A 2AYXA 2XHZA 4GLLA 1OI3A 2DPLA 2Q1YA 1LW7A 4TX1A 3O5AA 2IWHA 2REQB 3DC7A 3QW4B 2BYTA 3U09A 2DSTA 1JR3A 5JCOC 1XHFA 4PQFA 1MJGM 5AVKA 3QYJA 1R3DA 1HFWA 5K0BA 2DRIA 4MR9A 5U1PA 3WLJA 5COBA 1N9ZA 1QIFA 3EVCA 1QH9A 3A2MA 1ZL2A 4JLJA 5A4FS 3SVTA 1JAHA 1TUBB 3N8NA 2WNHA 5AQEA 1M6NA 1LRLA 1DRVA 1H4VB 1QPGA 1UMBA 1KJQA 3FD8A 2W2PA 3H2GA 3I23A 4MITA 3WDMA 5EHZA 3DDNA 2GBPA 2ZJYA 3EXG2 4O4JF 3RREA 1IOLA 4TXLA 3WRYC 4J90A 4L3WA 2FRDA 2GEVA 4JWTA 2FXVA 4M9SA 4LTMA 4PLFA 2Q7OE 1L8AA 3MLBA 3AL0C 5JCOA 4KKXB 4W5RA 4YP6A 2LE0A 2HWKA 4KUHA 4RVDA 4A1FA 2FCRA 1EM6A 3DT6A 1NTRA 1UFVA 2WIKA 3IE2A 4ZT2A 4C6SA 5F2EA 3THWB 3E0QA 1C50A 2PLAA 4X61A 4KQEA 4BBPA 2QD3A 1UBEA 4E09A 4M0PA 3HI6A 2WQ6A 1LPSA 2QAGC 2W42A 1KVQA 2FPWA 5CT5A 4A2QA 3EX7C 5FEMA 1L5YA 4GX1A 2BSAA 2JL1A 3MFQA 1KETA 3EGDB 1JPNA 4CM1A 4DV0B 1X80B 1E3DA 1GU1A 1V47A 1WQ4A 2X1LA 3MJTA 1LBHA 3CX7A 4PG5A 1NI4B 1Y4ZA 4UZFA 4V0MA 4ZOCA 1M7BA 5IN5A 5J2TB 3AHFA 3A9VA 3QIAA 3Q10A 1D1PA 4ZCTA 1QH8A 4YAOA 3SQDA 1XVTA 1RQPA 4HZUB 3FJOA 1MX3A 2AC4A 4BNKA 3K96A 5BN3B 2DWOA 1WBBA 1V45E 1UANA 4GI1A 1ZD1A 2WFMA 3FNEA 3HB1A 2P9QA 3QOYA 3E7DA 4CG0A 4TT3D 5IT4A 1NE7A 4AN1A 4E2FA 1E94E 1W88A 1XMSA 2ZAGA 4N3AA 1G17A 1ZSNA 1HE5A 2Z8XA 1TLTA 3CT6A 3DEJA 3V55A 4ZEMA 2JHPA 3IUPA 1BG6A 2UYCA 3RLFA 2O8BA 3PDWA 3RS9A 4ID9A 5JC8A 1LA2A 3K6RA 3QWFA 2OT3B 3QVSA 2VUTA 2V6JA 5ALYA 1YQXA 1GG9A 2CXNA 3RQIA 1YBHA 2H63A 2I71A 2W6CX 3F47A 4X93A 4D43A 3SIPA 1I13A 5IASA 1WKVA 2I03A 3EC7A 4M9XA 3ZVLA 4YJ3B 2FWJA 4WKOA 1A7JA 4ALLA 1GR1A 1GVHA 4MYUA 4Q4JB 4PLCA 1H4SA 3HJRA 3NTQA 2MOKA 2XUJA 9ATCA 3B5JA 3UGKA 3M3PA 4PSUA 3VX4A 3T5AA 3CTPA 2WIAA 2BLLA 3K30A 3CU5A 4F3TA 1T5SA 1AK2A 1DG9A 1TB4A 4I3FA 4GNKA 1Q91A 1UP4A 2B36A 3LWNA 3HEBA 1CDZA 4OQXA 5HUJA 2PKYX 1SXJC 1BJTA 2V7QA 4PANA 3RSZA 2EF1A 2IZ5A 1ZGAA 2XUFA 1XU9A 4FFMA 3UAGA 3MTBA 3HN7A 5BQOA 3W1WA 5FADA 5AXDA 4HLUA 1LSOA 4H7EA 2WEKA 4BO3A 2FPOA 1F3LA 3W8FA 2D7CA 3IDOA 3OX3A 2DR0A 4D99A 1X1DA 3M4NA 2VQFB 4PSAA 5KNLA 5IVDA 2P2ZA 3JWIA 2PLFA 3AY3A 4NRDA 4PXAA 4ZODA 2Z5GA 3AQ4A 3OOSA 5IWCA 2XB4A 1XG5A 5AIBA 4A2PA 4JHXA 3JYLA 3L04A 1XZMA 3T41A 3WJ7A 2XMDA 4BNFA 3DZ8A 4AZVA 2R6ZA 1JEDA 1HORA 2CNOA 4UHCA 1G2OA 1SHKA 2R4QA 3F9RA 1I10A 5D6NA 1BH6A 3ILYA 4AIIA 5A6VA 2ZJOA 3EIEA 2OXIA 1BFUA 2XE6A 5AW0A 1F48A 3LP5A 5EERA 3FYSA 5SY4A 4GT1A 3QU4A 4ECAA 3PSAA 4PGHA 5JD5A 2GZ3A 3N0WA 4U4AA 3AVUA 1XQ9A 3HDVA 4WH0A 4WY8A 3WS7A 4DEVA 4MUJA 1MGOA 2C04A 1EBUA 1NYRA 2E18A 3I76A 1W6UA 1AV6A 1SQSA 2LKCA 5CFOA 4OXQA 3H9QA 4YWJA 3T5TA 2VDPB 5KOHA 4OX9Y 3O21A 4J16C 3PXBA 3WMGA 1N2EA 4OREX 1ZD8A 4XVHA 1X8JA 2J0VA 1FDWA 3VRHA 1U0FA 2PBLA 4LGVA 2FPIA 1CUHA 4J7UA 4EHLA 2OSVA 3LL7A 2ZRLA 4PHGA 4WEQA 1RM4A 4A0RA 4EJ6A 1N4DA 5TVGA 1DG1G 1KVUA 1OXMA 4NCNA 3M81A 1CUYA 2O5CA 1HZZA 2V54A 3IAM1 5IM4A 4JLNA 4JIMA 1GZ7A 5KJ6A 2ZSUA 2KLBA 5E2BA 4CQMA 2FGJA 2OORC 4BX2A 1AUOA 4WK4B 3UGQA 1IUKA 5E6SB 1FOEB 3V5NA 1RACA 3IEUA 3KV1A 4Q7QA 2UUCB 2GVDC 2PKWA 4JVMA 1XRMA 4TMXA 3O38A 3PPWA 3U3KA 1L4YA 1V9LA 1TJNA 3U80A 4FFBB 3AEKB 5DXAA 4YXWA 1RC0A 2X19A 2YYSA 3JAKB 4B84A 2FG5A 4M1TA 3ZHBA 5HQ3B 1U8XX 3NKVA 4R8LA 3S68A 2P6MA 2YHBA 3LT1A 4JEMA 4Q1BA 1PZXA 4GYWA 1AKQA 2XWBF 3AMVA 1DMRA 1NP7A 2I1VB 2QN9A 2XOKD 3OWOA 3TZ6A 3UK6A 4B5KA 5KYTA 4S1WA 1V8PA 2XYGA 1Z68A 4C05A 3GJSA 4IDBA 3IAAA 4D4GA 3O9MA 3GBSA 2FKAA 2H1VA 3QXCA 1R4ZA 2YWRA 1MEEA 1UBNA 3PC7A 2PA0A 3TKAA 3ANYB 2P5SA 4NV1A 4LJRA 1DL5A 3ZHRA 4CKEA 3BE5A 3VI3B 4V3BA 5EVJA 3C74A 3UHOA 4L6CA 4HEQA 2C8JA 2QVLA 3NVAA 4CZ2A 3C3PA 1G2IA 1VGVA 2X8JB 3KKKA 2F4VB 2ZUDA 1MXFA 4EGSA 2IOFA 1CUXA 2P4QA 2YJ3A 5ADWA 1XOIA 1C7EA 2PRYA 1JT2A 4XFJA 4RDIA 2I2AA 1BGVA 2H92A 4MUAA 5SICE 1RHQA 3IHWA 2ZAYA 2H0RA 4QXRA 4A16A 2QRJA 1KNXA 3EJWA 3IYLW 1L7XA 1N75A 1T36A 1YR3A 2KX7A 3B51X 3G2MA 4MUKA 1CLEA 2ATIA 4ZO4A 1PD1A 3CLRC 3W8DA 4YLYA 1OX4A 5I4IA 1GZHB 2FFJA 2ID8A 2AQIA 2LW7A 1CXZA 1YZFA 2BW0A 3H65A 4FFRA 2FP3A 1GZDA 1P61B 4TKVB 1M8PA 5HVNA 5BN5A 3O2JA 1QG2A 2IP1A 2XECA 3TJRA 1E1CB 4URVR 3HI4A 1AA9A 1SKQA 1J56A 1YRAA 1ZOIA 1XALA 4KGDA 5EXDA 1EVQA 4R0NA 3X3HA 3E5HA 5BT8A 2PUFA 2NU8A 1P75A 3QELB 4MVYA 1ULSA 2HIMA 4MWEA 3IT1A 4WN3A 1SA0A 1SXJB 2WZQA 1RYMA 2B8WA 1QHSA 1ECPA 3GJTA 3HU3A 3IAS1 3VSEA 4ZYLA 1VMAA 1JTEA 3CH5A 2VDJA 1WX1A 4CKXA 3EGXB 2RHBA 4BFXA 5JZ9A 4LE1A 1GNTA 4MMZB 2IYFA 4BN4A 2BFCB 5ALXA 1HEUA 5BURA 4CEIB 2WM8A 1C9YA 1N3YA 4IV8A 3FTEA 1ZUNB 2PS1A 4DYVA 1ZN9A 4QAQA 5E6RB 1T3ZA 4E11A 721PA 1HKUA 5E2IA 2FPMA 1J24A 1Q6YA 1X3LA 1DAGA 3QBTA 3EWIA 2DQYA 2HU7A 1LI7A 1FYDA 2PT5A 4IO1A 3K2IA 1PP4A 5SYMA 2ROQA 5H70A 1Y8ZA 3F5MA 1P44A 1TC2A 4TVBA 3DKRA 1U2GC 1S2OA 4NAUA 4P4LA 4K6FA 1E32A 3WWDA 4A0FA 4E07A 1KI4A 3WQRA 4HB0A 4KUEA 4WNAA 4J1TC 5DNWA 1M1NB 4YRBA 1E6LA 3WAGA 3RUDA 3CWQA 1W76A 1W34A 2XAAA 4RVHA 1XJQA 1O89A 1DT5A 3N70A 4LVCA 4L5AA 4UVIA 4N9QA 3ZH9B 3RU3A 3KQLA 1GLVA 2H5EA 3IOCA 3OAAD 3K8QA 3KEOA 1GQFA 3IELA 1QGUA 1AA6A 2I7TA 4TS4A 3UUGA 2WFLB 3P0IA 4NYMR 4TS1A 1MVOA 3E82A 2QBYA 3URMA 2GTHA 5KCMA 4TN1A 4PFKA 3PZBA 2LDBA 4A8JC 3ZUGA 1MRNA 3AP3A 1RXYA 5G41A 4OHWA 2WMDA 1H5UA 2I4IA 4FFLA 3EBOA 4KQ2A 1KE2A 2I9PA 2HHJA 3R6TA 3OPXA 4F5DA 1B8UA 2E6KA 5JJ5A 2WNIA 4Q37A 1SUBA 4TLDA 1MTZA 4WINA 1WPXA 1ZJ6A 1ZY2A 4OQMA 3SI7A 3QGMA 4RDXA 3DKIA 2A92A 2WSLA 2YNMA 1JDTA 5EP2A 5I5GA 2HCBA 3OTWA 1KFBB 4B0OA 3JYOA 4GZ6A 3P9IA 4CM6A 2JIPA 2GM3A 3AGQA 3D8BA 4AIRA 5J43A 2ZSAA 3G0BA 2YWFA 5DOVA 1IZZA 2RBEA 2Q5LA 3SKVA 2W2XA 1RMTA 5CVTA 3F6RA 1BDMA 1RYFA 2Q4DA 2I62A 1NMYA 4XDZA 3WLQA 4C5CA 4EB6B 4YHHB 3UWOA 4LGCA 3UOWA 1T4MA 3GRUA 4DOMA 1PJLA 4LK3A 1IWOA 1SC6A 1U0EA 2ZBEA 2XVXA 4C3OB 1H2BA 3P9SA 3EG5A 4RVCA 1GZSA 4LJSA 2KE5A 2D2VA 1NBIA 3K1ZA 5HRAA 2J8ZA 5KTRA 2NAPA 4Q93A 4HQLA 3RS5A 2Y92A 1KZGB 4YQYA 3STWA 1T5OA 3BFXA 4M9QA 3DWEX 3GDHA 4IDPA 1L5HA 5AI4A 1E3IA 4OLBA 2QSJA 1WMFA 2YWHA 4IILA 5TE9A 4CPDA 2B8TA 3B3FA 2ZTHA 5TQVA 1TM1E 1FDUA 5HK9A 3IEPA 3D2LA 3O3MB 4YP0A 3E22B 4ARUA 5JYCA 3TSYA 5AUOB 2YC2C 3UUEA 3L0SA 1AMUA 2BKVA 1QSGA 2XMRA 1NOKA 2QAIA 2IV7A 3ZDDA 3IOMA 5C1IA 4QWMA 2CUZA 1Y80A 4BCBA 4H1TA 2BFDB 3KZVA 5JISA 3GZNA 4PWZA 1YBMA 3DT9A 2PKQP 2G7MC 2LV8A 1IQRA 2BWJA 1TTQB 1LZLA 4IJ5A 2L18A 4MV3A 3HRKA 4AP5A 4NCAA 1MZVA 4W7SA 1FFDA 3DHNA 4YMVA 5IKMA 5IKEA 2A8YA 2Z5LA 4FYKA 4WOBA 3KJXA 4PZYA 4XCQA 4P5DA 1T6XA 3P9NA 5PNTA 1JVBA 2J7PA 3HUTA 3KVOA 4BKUA 5K8LA 2ECKA 1ZRSA 4EKGA 1JFVA 4KR0A 4YP1A 2HCFA 4WBNA 2WUVA 1J0BA 3R1IA 4M1ZA 5D3ZA 5TV2A 1IE3A 3GUHA 1GAXA 2AMVA 3OOWA 1VKJA 4EY4A 5KVCA 1ZCFA 2TMDA 3NETA 5EP4A 1O4WA 2BMEA 5HDQA 4AJHA 2V7VA 3W9UA 2OA0A 1JSCA 1QKKA 4YUYA 3PUKA 3NCTA 1KPHA 2GN0A 1YRYE 2Z2KA 4UUQA 1I7NA 2G4CA 5FWYB 4F06A 4F7WA 5CB6A 1V9CA 2DEUA 3R6GA 3FOZA 2FPGA 2PMCA 4LHZA 1QC5A 1KORA 3RCBA 3H97A 2NQ2C 3OWXA 4XYLA 1YA4A 1D2EA 3DZGA 1T5IA 3NT5A 1TUEA 1LBSA 1UMBB 2R8RA 5SZJA 1R0CA 3DDCA 1DKMA 2RB4A 4B74A 5CDUA 2WP8J 4DUGA 3ICQB 5DX0A 2I2XB 1DXQA 2IY7A 5I47A 3AH8A 1XTPA 1B0AA 3DE2X 4QEZA 4EG8A 1TK2A 1Z07A 3WV4A 4CU2A 3R2JA 3TQIA 3U44A 1S1MA 2A57A 3LKBA 4UHEA 2DBYA 2Y0EA 3FZGA 3HLKA 1QGZA 4XX1A 1KQFA 4JXZA 1H6DA 4EGCB 4O2BA 4QSMA 5EJIA 1IBMB 3OFSA 3K9NA 2FEMA 2LBPA 1MGPA 1YUBA 5TY0A 4AYXA 4BB9A 2O8BB 3ZV5A 2P2YA 3DPIA 5SYAA 1C1XA 3W8NA 1V7PC 2JHAA 1X15A 4ACBA 1GNPA 1YB5A 2B1JA 2YBDA 5KNCH 1PS0A 4DJEC 1FK8A 4XB1A 2XPCA 4HPXB 2O14A 5I7RA 3FR7A 3T7EA 4NMLA 4GSYA 1UBFA 4URXR 3IHKA 2JC3A 3QPVA 3G2HA 4HDRB 3HYCA 1SXGA 4MUHA 5FPKA 2OAEA 5HS4A 4OSEA 3S2ZA 3SXPA 3WNBA 5ISMA 5BRJA 5BW5A 3NPAA 2HQBA 2M9MA 4JBWA 2Q50A 3I61A 4RTNA 1SGWA 2PGLA 2QUIA 4NV0A 3WWOA 3LCCA 4CM5A 4EFLA 1BEZA 1CD5A 4F8JA 1ST3A 3JQFC 1JKXA 2A9QA 2AUNA 1OZAA 1EFLA 3RIYA 3HABA 1TO1E 1E6EA 3LRXA 4B5LA 1JIXA 1Z39A 4UAVA 4P31A 4D8XA 1UM9B 2WV7A 3TZCA 4AFNA 1KC3A 5BNTA 1TK9A 4KXFB 3VNRA 2V5UA 4E5UA 2VPPA 3MW8A 4WZBE 4MVJE 1TZBA 2V6FA 1E79D 3TRFA 1RRVA 1BS9A 1GRVA 3KD3A 3A0RB 1YZ3A 2Z83A 4RKYA 4EG3A 3R0VA 1M7HA 2HA4A 3RYTC 4QYIA 1HEYA 3TOVA 2PPLA 5L3RA 1ZRMA 3W6UA 2AGVA 3PEWA 4BO6A 1AS0A 3E9NA 1DJMA 3CLVA 4JITA 1NNI1 4DJ5X 2X4IA 3LPNA 1IY1A 1E2MA 1P9LA 2J41A 4DNXA 4G41A 4RTSA 4H60A 5HE8A 3ZY4A 1WQ1R 1QRSA 4CDNA 4YAGA 4RPHA 2PMDA 2BBSA 1RDFA 2ZZKA 3T9CA 2GZDA 5ADHA 2YKGA 4LJ4A 4HS4A 4DLWA 2H7XA 4EMTA 1YBFA 1W9MA 2A0WA 1HTWA 2OG2A 3M8KA 4PLVA 2V7BA 4ZOQI 4Q7MB 4BQRA 1T3HA 2HSEA 2KBEA 4Q1FA 4RFLA 4V3CA 5C5EA 3VC2A 1QFYA 1QIDA 3KSRA 2RHCA 5HNKA 1IK6A 4M21A 4K0KB 5A4IS 3NH9A 4FDAA 4HN4B 4L8WB 3VPSA 1K68A 2ZUCA 3NAQA 2BEWB 5GWXA 1STOA 4UPEA 1RIFA 3QFTA 2YFKA 4C7OB 4OJNA 3TXXA 3BMCB 1CQIA 4L0QA 2CLKB 2VAXA 2VJLA 4R6XA 3HUFA 3BRCA 1PEKE 2EZ8A 1N8NA 2QLBA 2VXOA 2ONKA 4FW9A 4ZXPA 4EZEA 2FZVA 1R9NA 1BCRB 5JAQA 4KN5A 4X1OA 4DM7A 2O0LA 4M0CA 2JFFA 4R1UA 2G8NA 2IUEA 1EG7A 5C8YB 1N5MA 2F3SA 2F64A 2IYVA 5K4HA 3E9DA 2CFOA 3AK4A 2PRJA 4GX2A 1UPXA 1VJ5A 4LI3X 3ZU5A 4B6PA 1X1QA 3A1VA 2IQ5A 2O0JA 1PF7E 2BDUA 3VPGA 1FVOA 3THRA 1IPEA 1J20A 3AO0B 3B36A 3I09A 4NENA 3TZLA 1SB9A 2QRLA 1WOYA 5ETJA 3FOFC 4TWIA 2IODA 1J8FA 3Q40A 4C0LA 1OTYA 1QHGA 4KR9A 5BORA 4UFOA 3A4NA 2B5OA 5L7YA 3L7MA 3RVQA 4B3TB 2HMAA 1L1EA 1K92A 1WXEA 1QPZA 3AEZA 2WPDD 2UVDA 1O58A 4HZUA 3DFIA 4G89A 3T52A 5FNVF 3UJ7A 1WUYA 1P1CA 1OZ0A 1C81A 1YS2X 1US8A 4BFLA 1KK2A 3I1FA 4U7TB 3L05A 1X13A 2MSLA 3SC3A 4K6HA 2NADA 4ZQEA 3ZJ4A 1HXHA 4KNWA 3ND7A 4J3NA 5IU6A 2NVWA 2OZLA 1I8TA 1M1YA 1WU8A 1EGMB 2Y68A 2CCJA 5I7FA 4KQHA 1QCDA 1ZESA 4FDMA 5JAHA 5TT0A 1F5SA 1YBAA 4NCIA 1HE4A 2C94A 1N2SA 1S2NA 3NAZA 5BNFA 4ABTA 1GGHA 4X92A 1CUEA 1L5QA 4Y2PA 3DAPA 3ODGA 4ZI7A 3M49A 4MS3B 1KEWA 4CMGA 5BWBA 3W4IA 3BFJA 4GUAA 5GZ1A 4CIVA 1DTWA 4K2HA 4NJOA 3C43A 3EOAI 3LA8A 3ZX4A 2A9FA 2UYOA 4GP7A 2YJ5A 4AXBA 4B47A 5KMGA 1DT3A 4MW9A 1E6MA 1YU9A 3FTQA 5DCYA 4K9MA 3MQ4A 1YUMA 2I99A 4HDSB 1K5HA 1QS0A 4REMA 2PMWB 1RLTA 3ANLA 3Q3VA 4GC9A 4CYMA 3W3AA 4E3WA 1TEHA 2ZXFA 5HSGA 4ETMA 2GKOA 4UNPA 3KNZA 1G9XA 1GSAA 2R8PA 1Y8QA 3ONEA 4N7RA 4AJ2A 4TGLA 3GT4A 4OHYA 1DNPA 4L27A 2NUBA 5AJWA 4AUMA 5BYAA 2NVUB 1T9BA 5K0FA 3SVLA 1SCBA 2IH5A 3WB0A 1DXHA 3IUJA 4GOXA 1R8XA 1T2CA 1QX3A 1HQKA 4HH3C 4OJKA 3U13A 4JLAA 3JRWA 5IYZA 3C1OA 2WYWA 4WBXC 4ILEA 2WD8A 3LUGA 1YI8A 2FOXA 4IMJB 2JDID 4FIZA 1W59A 4M1EA 4UNSA 2ZETA 5HG0A 2D4HA 4JNCA 4WA8A 5DHPA 3DJFA 2WG1A 1BKYA 2X0NA 5IAEA 2VT2A 1Y5IA 3FB4A 3O0DA 1V7CA 3A2NA 1G21E 4P7JA 2H2IA 5BOSA 1XZGA 4L8YA 3IP5A 5BYJA 3FM9A 5CLGA 4FX5A 1VBNA 1OD6A 3L0CA 4MUXA 1G3MA 4DCSA 1U6JA 4K9OA 5KU7A 1G5QA 3UB2A 3A7DA 3MCAA 3ROZA 3OIUA 1G3UA 1VE7A 3DMNA 1E2JA 1HT1E 3HNPA 1FSSA 4GE3A 1WNFA 3N2YA 4HDNB 1BHSA 3Q9UA 2F6RA 4KTVE 3NBZC 1EK0A 3N7UA 4FWBA 4LTDA 2OXFA 3DFKA 2B92A 3N6VA 2J46A 1GDHA 4HQRA 1J97A 4WAUA 3B1JA 1IYZA 4J2TA 3GEHA 2VSYA 3FMVA 3GA7A 1WY5A 5EXSA 3WIUA 4PHFA 4E32A 3IAFA 4LDPA 1QGED 3RS2A 2ZJ6A 4AJ4A 3EULA 3B1XA 3VM6A 1J6UA 1RCFA 3TI7A 2X2FA 2MR6A 3VKFA 1SU6A 1KJ9A 4INOA 3T1TA 3EUWA 4G65A 4XPZA 2VP3A 5CDSA 3IIKA 3QYFA 1KQPA 4NZOA 4QNNA 4UJ5A 3HK2A 3V4FA 3V8PA 1RYHA 4PFQA 4N03A 3OIFA 3VR2D 3GCXA 1C30B 2VKQA 3AR4A 3CZ5A 1A9XB 2YJZA 4AJNA 2REXB 3P9CA 3PJFA 4H3VA 5HKOA 1KKUA 1SCUB 3DQZA 2YWXA 1OFGA 1EP2B 5J9FA 5A4JA 5FOTA 2F3RA 3PC3A 1OYOA 1NULA 4WJKB 3G5TA 1AKEA 4BVJA 2JAWA 2WT4A 2Y93A 2AZXA 2AN3A 1AGNA 3L40A 1K8QA 3K4PA 4IHAA 4YA6A 2IVZA 4JLBA 1DX9A 1NZDA 2QRHA 2GMWA 3E27A 1SXQA 4ZQGA 5BNIA 1NLMA 4JODA 3MJHA 2HKIA 4YRKA 2WUGA 4XQ0A 2XQKA 4DQXA 2YJ6A 4PY2A 3AB7A 2DFPA 4F85A 3G1TA 1VL8A 1MDBA 2GEJA 3JX9A 2C2WA 2P2SA 3MEQA 4IOJA 1U81A 3R6DA 3V4OA 2YXDA 3FNFA 3WWPA 3AVYA 1X7ZB 4KPUB 2O8VA 4H17A 2ICAA 4CKEB 4MQUA 5BP7A 4B8WA 1UR5A 2IEZA 3QFRA 1J2JA 1R0KA 1LBEA 1RPTA 1WHTA 4BZXA 5C52B 1HH4A 1ZM3A 2IEIA 3T7AA 1RIIA 3PHBE 2XF8A 1BDIA 2AKEA 4DR7B 1OLOA 3THYB 2GJKA 3OPVA 5FNVB 1YA8A 2IBSA 4PLPA 1GPH1 4HJXA 5DHRA 3TH5A 3OF5A 4TUYF 5B6JA 3V34A 3BPSA 4UAUA 5DM2A 3TR5A 3CH4B 4PXSA 3SMVA 3JQ7A 3GCDA 2H0AA 3E9ZA 1Q15A 4XD2A 5TS2A 3NJ8A 4OI1A 2JANA 4HNTA 3QBDA 4NMWA 3AEYA 3FTDA 4H7JA 1YR2A 2QIPA 3QFHA 2Q4BA 2O06A 3TAXA 3W2IA 3ZDQA 5DEIA 3DYIA 3KSDO 4YR9A 1VL1A 4ZT7A 3C8HA 4F96A 4BMPB 4V39A 3WYEA 1FSZA 2ZULA 1SHLA 4B1FA 3NYRA 2FR1A 1ECLA 1IQ0A 2VUSA 3GHHA 4LXHA 5E7MA 3VFDA 4R1NA 2Z3WA 3S2EA 1EDBA 4WHMA 1MB4A 3ASVA 4FU0A 1KWKA 1VSTA 2Q4RA 4EKIA 3LRPA 3WHIA 3HU2A 1BFDA 2PV0A 3MC1A 4MWGA 4EHHA 3DAFA 2AJDA 1Z5OA 2AHOA 1T5BA 2RG1A 2GN9A 3JQAA 1V6AA 1NQAO 3JYQA 1E9DA 3A6FA 2ZBRA 4FFDA 4KFUA 1SZPA 3E03A 5H82A 5G0SA 4XH9B 1RMQA 1ZM9A 3HL0A 4IV0A 3QNMA 1QRRA 1X1BA 3HVUA 4S0ZA 3AXTA 3PL1A 4YAEA 2IEBA 2W7TA 4RK6A 5CPFA 1LPNA 1VSBA 3C5EA 2MDTA 1V6SA 3K2QA 4GPD1 4MWTA 4C89A 2VUUA 4RZUA 2BJVA 2ACKA 1IB6A 1Q95A 3MT7A 4FYHA 1V7ZA 1ATIA 4ZVOA 4B9EA 1C7ZA 2H29A 1Z62A 2XT9A 3OQHA 5IG2A 4YIHA 1U6KA 3S81A 2XDQA 5M29A 5ALKA 3K0FA 3DR5A 3JD0A 1XTSA 1LPPA 4Y0NA 3THXA 2VQSA 4JWKA 2XXJA 2YFHA 1T10A 3WYDA 1GAWA 3VOSA 1K8ZB 2OB1A 1F4VA 1G291 4HUQA 5FI5A 1LFDB 4WT7A 1QYIA 4Y6RA 1X92A 5DBOA 3EISA 5GONF 4EF6A 2OZLB 3QV1A 3HKBB 3QF7A 4ZANA 4WGFA 1SCIA 1FLNA 1DGQA 4EL0A 2FOLA 1QWOA 4M6WB 1FRNA 1LBTA 2HI0A 2JGDA 3UNXA 1DDOA 4Q9AA 2FR0A 1ZNYA 1SBIA 2JHFA 3BB4A 3G9XA 2G83A 5LDHA 2GN1A 1DTWB 1LLQA 2G1KA 1U7ZA 4QHYA 3Q2OA 4CMBA 4IHJF 4PZUA 1IEQA 4OP1A 3WGHA 4CR7A 2QRZA 2IZZA 4KWTA 3WDSA 4B43A 2XIQA 2PFGA 5JDCA 3QEBZ 4PAQA 5JXJA 2POQX 1L7DA 3EFBA 1KOGA 2W8BB 3AVVA 3BTOA 1JLHA 1KBOA 2PUWA 4DIKA 1XZIA 5F5LA 1BXRA 2A6PA 5I9NA 3AI2A 4ROTA 3MD9A 2QVXX 4V2IA 1KEUA 2F43A 4IDFA 3AHEA 3O92A 2O6HA 4RKRA 1JJAA 3QEOA 1TZKA 1UBHS 4INZA 5EJ7A 1FRZA 1TMOA 3EFOA 1IXYA 4XUDA 1OBHA 1JIVA 1SQFA 2IF0A 3OO1A 2WE8A 5F7JA 1GTSA 5A9SB 2CMHA 2D0PB 3TAHA 3IKJA 3IOYA 1N2CE 1V39A 3AUTA 4RVSA 5CX1B 1TTPB 3T7RA 2WF7A 1KI8A 4XFDA 4Y1EA 5KHOC 3TUZC 4CMCA 4CI0B 3ZOKA 4PZDA 1FBTA 3D3WA 4INJA 3W2TA 2Q46A 4D8TA 5FOUA 1Y3CE 3ZWQA 2JFZA 1RVV1 1O94A 4QGBA 1WPRA 4OG2A 1UODA 4YJKA 1Q1EA 3R40A 1DWUA 1UBSB 5D3MA 4G0VA 4GU5A 4TMWA 1BW9A 4CF5A 3QKRA 2HRRA 3C7DB 2CL0X 3TZEA 3SX0A 1GKKA 4EITA 3KUKA 4JKIA 3RF6A 4URUR 2WKPA 1PDOA 3QITA 3RK4A 3WZ2A 1EUCA 1HBJA 1I24A 2M32A 2N46A 3BDIA 4IXTA 3EZFA 1L5GB 1CY8A 2CD9A 1R8QA 1WF3A 3I04M 1FNBA 4BPBA 3JARA 1GKLA 2XNDD 2O1WA 2EAUA 4UE3S 1Z75A 2RGCA 4POAA 4B7ZA 2DECA 2V4UA 3A9CA 3GQBA 4OXRA 1A96A 4IFEA 4R41A 5DLPA 3TLGA 4D74A 2MSCB 3L4BA 5T7BA 1XRSB 4DUPA 4IDAA 1BE0A 4ZOBA 3SFVA 2JFVA 5A3JA 1BHO1 2QX7A 2D7DA 3ACCA 4PZAA 2R87A 2XUPA 4PFSA 2A5GA 4DCVA 1H85A 4FYPA 4GR5A 4ALMA 3TINA 5KDOA 3ETNA 3UBMA 4B76A 3PE3A 2WMOB 3CLUC 5BRNA 3ZDRA 2Q9BA 5BN1A 2O2GA 2C5FA 2XIJA 1HDXA 3HP4A 3I64A 3NM4A 1H1TA 1ZKMA 3ZWNA 4OLHA 1GM5A 3CX3A 1FTYA 1XYGA 1Y8RB 2VYNA 4COKA 2P9BA 3HY3A 3LBHA 2XQGA 2MTBA 4TT3A 1XL0A 1AUQA 1Y7LA 2G40A 5KS2A 4XVQA 2NYRA 4X1IB 4ZRDA 4RYLA 3SJZA 2B21A 3OCZA 2I65A 4BMCA 1H0KA 4J0FA 4R40A 1GT91 1T1EA 1AK1A 1U9IA 4ND5A 3RRZA 3ZK9A 4YMUA 5HJEA 4LOIA 2HJHA 2P91A 3G3EA 4F6CA 4BQQA 4QQ8A 2YY7A 3MERA 2G0AA 5YASA 3DHWC 3W5VA 3FSEA 5AXBA 2JD0A 4NECA 1SK8A 4NENB 4LZLA 3RSQA 4GOOD 2XSZD 4LRUA 1PUJA 1CVRA 5LBIA 5P8WA 2XUKA 3NEYA 3SJUA 2FSGA 3FCUB 3DC2A 4ZEXA 1RAEA 3PGXA 4H16A 4OHVA 2XR1A 2GCGA 3D64A 3QI7A 4JJ7A 5LYJA 2A1TR 2ZUSA 2B61A 2QXYA 2D0OB 3QFFA 5TGZA 4KRFA 3GIWA 1JAYA 5T4HA 3SEZA 2Q2VA 4CMIA 2QRMA 4X62B 1U0BB 2C03A 5DYIA 1WZCA 1C3OB 2AJTA 2JFYA 1I0LA 1YIDA 4D0GA 3T3NA 1N0VC 3OZFA 5EZYF 1AKNA 2ZCVA 3EA5A 1XZEA 4LKRA 5DTJA 3HN2A 3MUFA 3E8MA 3GJ7A 5JMWA 3DEKA 4KX5A 4MAAA 1ZK2A 3H7AA 4YK7A 5F98A 2C7BA 2C9CA 1JJ7A 4XD7A 4YUZA 1PE0A 4JL6A 4TV9F 4AI6A 1DS6A 3KEGA 2XRZA 3D4OA 2YXNA 1KEZA 2V3VA 2G17A 1YRQA 5CNMA 1MT0A 1J2UA 1GY8A 3AT1A 4QO8A 2OFFA 3TNYA 3NI2A 5JD3A 4ZGGA 5I9IA 5KHAA 1MHTA 1WEKA 1Z15A 2IS4A 4M83A 1H66A 1YQEA 1ZOLA 1T36B 2AZ4A 2VTBA 2F7SA 4HATA 1TJ3A 3C3MA 3EQ7A 2OYRA 1Y1SA 1H3NA 2C2ZA 3AVQA 3H9BA 4GQIA 3ROGA 4GVLA 3M4JA 4LCEA 4NFSA 4UDYX 1ZNWA 3TD6A 1L5VA 1QXSA 1QANA 5EN4A 2NG1A 3FYDA 1ZN7A 2EDCA 3B9BA 3JQDA 2DHDA 2WHRA 3M9LA 5KWIA 1QP7A 3N7TA 2YYAA 1IVSA 3Q12A 3GT3A 4O5AA 3EZGA 1VHQA 4Q3BA 1ZNQO 2VQ3A 4WOKA 2OV6A 1OXVA 2NUAA 5JJBA 1ZHHA 3H9CA 1L5ZA 4CN8A 4AYTA 4GYJA 2OHVA 3TE6A 2A0KA 4ACAA 1I7DA 3BGSA 1WIWA 1TRHA 1M0WA 1VKHA 2IZOA 2XT6A 4RXUA 2B5VA 1WXGA 3OOJA 3V3TA 3VJMA 3V48A 5IXSA 3X43A 1XQWA 2VWHA 4MKRA 3RB8A 1YAHA 4YI3A 5MN6A 4G85A 4H2DA 1Y6FA 1PFYA 1QGDA 3PRKE 5FUXA 1EXNA 4Z6KA 1EJ2A 1SG0A 5K01A 4A7PA 3AVOA 4UEQA 4FBMA 5DN9A 2G9NA 3U1BA 2C2MA 5H3CA 1AKWA 3MTEA 1NUTA 2CMGA 1REQB 1PQWA 1A8HA 4TQUS 1Z37A 2OENG 4D3XA 1YK0A 3TJMA 5BSEA 1ULHA 4UBNA 3IR6A 5DNEA 5GV7A 4A5OA 1CZLA 3LVFO 3H4IA 2QL9A 4LXGA 3EIFA 4KLAA 3R7AA 4BYMA 3LW8A 1EDDA 1PZNA 2WWVD 4OQLA 1G6OA 3LIPA 4DMUB 1A9TA 2NO7A 2W5UA 2W6ID 2YY6A 2NW6A 2KPOA 3G7SA 4IDHA 7AT1A 2FMTA 1FCJA 4MPRA 1OW3B 2JI4A 4B2IA 4E88A 1IHXA 1RE1A 1NUHA 2Q3EA 3F49S 5HXAA 4TYPA 1V96A 4HC4A 5EQDA 3EA4A 2IU0A 3OAAA 4QO7A 1TQ2A 2AXQA 3NB0A 4H59A 2PV7A 4ZVMA 3V4VB 4ALKA 4DCTA 1WZNA 3TFWA 2HMUA 3H4TA 1NI3A 2AFIB 4C7BA 2ZAIA 3D8TA 3MCUA 4GKVA 4IKOA 4HQFA 4P22A 1E2BA 4PHHA 5A0TA 3D31A 2JZNA 2VQ6A 1CQWA 1E2UA 4FYMA 4N18A 4LC1A 3WL5A 1GA6A 4IRUB 4K9RA 3ZY6A 4IR7A 3NV7A 1J00A 3ROPA 1B3RA 2CLDX 1ZW6A 3VC7A 4AY5A 1HEIA 1V3QE 2X9GA 1LXCA 2P4HX 1O7JA 3WLTA 1P5HA 3DMYA 5CFPA 1NKVA 2VJAA 4R2LA 4BGEA 4EA8A 1NF2A 5LA6B 4DV5B 3PJGA 1IMJA 4U6QA 3RASA 3EAQA 4LTNA 3CJQA 1DWPA 4WIAA 2NU7A 5LD2B 2FLVA 3WIBA 3TIIA 2QR3A 3AY0A 3N5CA 1NP6A 4TV8A 4BFWA 1VJTA 4EX6A 2HPVA 1Z4PX 2J9YB 2R9VA 2YHIA 1LLDA 1Z4IA 2OMKA 3SNHA 3I2JA 4MKZA 3TW8A 3CLSC 1U11A 1P19A 1Z28A 3BDAA 5C7OO 3PXXA 2QQEA 4YREA 5F9HA 3AM4A 3UHJA 4UTRA 4HNVA 1LC3A 5J23A 3FPSA 4NYJR 3KQOA 2OBFA 4G9BA 5IZ4A 2BFNA 3OSUA 4A10A 4JGBA 1ZK4A 4MP6A 2H4XA 2HJRA 1TDJA 1X2BA 4M0MA 4RXMA 4REQA 4Y6GB 1DBVO 5KTOA 1PYOA 2CNLA 3VPDA 1E9BA 2EQBA 5BV8A 2QV0A 1Z6YA 3H6KA 2Z6AA 5A04A 2BMVA 5EA2A 4EG5A 2W6MA 4IDGA 3VNQA 1KP3A 1UOOA 3WRVA 1H8ED 4I4TF 2XUOA 3GJ0A 3ELDA 3GUCA 3NANA 4ERNA 3NEPX 2XKKA 3FMGA 4YR7A 2CNDA 5AK4A 4WWHA 1HRKA 1NW8A 2BKEA 3JQ8B 3K5HA 4BRZA 4YBRA 5F35A 4AUNA 1Z22A 1GGNA 4RQUA 3JQBC 3MJEA 5DSTA 3AESB 5B1DA 2BMAA 1GKYA 1SRQA 2H9AA 3L43A 1SUFA 4ER7A 3DEFA 3TMAA 1Q12A 1XF1A 3IRVA 5J40A 1NONA 1ACLA 1RXVA 3M33A 2H52A 3DONA 1FUKA 3NHJA 4AAYA 4C2UA 3QHPA 1DAKA 1R4MA 3V32A 1JHOA 1Z0AA 5DHUA 3CLHA 2ZJFA 1SOMA 4P7FA 2XWQA 3CSUA 2FN9A 3DR3A 3NBXX 1MR3F 5KSWB 3WIVA 4HNGA 3QX8A 4TXJA 2EEPA 1OFUX 4WNCA 1BWSA 1KI6A 5ALOA 1U7UA 4RF3A 2B2CA 2G9RA 3AB3A 1QFMA 4E03A 2ZWVA 3SDSA 1RPNA 2IOHA 1V25A 2PS0A 3G68A 4FE7A 3U31A 2Z43A 5ALWA 3UT6A 3UWSA 3G0DA 4LK2A 3MCVA 3T7SA 4ZVVA 3RAPR 1U2EA 6YASA 3NTOA 4OO3A 1D4FA 1X1TA 1XK6A 2P6PA 4GWLA 1X8KA 1OASA 3H6HA 5FJJA 3T54A 4CIDA 1JV2B 1WUKS 4RA9A 3TLEA 2DKNA 2Y77A 4D6XA 3A10A 4YMLA 3F3SA 1Y48E 4KEAA 2AJBA 1O8BA 4Y7DA 2BE9A 2X6TA 3LX8A 2FV8A 1BCSA 1YL5A 2JCSA 2FDXA 3I2IA 4UE2A 4H7IA 3FH0A 4JYMA 5EWMB 4EW2A 1GYQA 1QU2A 2R25B 1UQTA 1H0SA 3MT8A 3T0FA 2Y67A 4QUGA 4F4JA 2QJRA 3ZWOA 3ABRB 4IX1A 1YD7A 3C16C 1FDOA 5C5IA 4OF4A 3IUMA 4IFIA 2FEPA 4WPGA 1QIHA 2J9FB 1BEEA 2R5WA 2ZAOA 4YJ3F 5EWLB 1ISHA 2GN4A 5CVJA 3VJLA 1Q7RA 1ORWA 2CJPA 2JIOA 2H54A 3I9V1 4UVHA 2WIDA 3W2FA 2YY5A 2XGSA 3P71T 1ST2A 4KI0A 1ZMRA 5KUTA 5IC6A 4OJYA 3HRHA 3VISA 1XIVA 4GH5A 4R71A 2C2OA 3MJDA 4MINA 2AEFA 4FNMA 3UHFA 1OLSA 4UZEA 4L5IA 1YJQA 4G5RA 5KPJA 1DVRA 4H6XA 4POOA 1L4EA 2OCXA 2CBGA 3QA9A 3Q6NA 2GR9A 4L3VA 3T0IA 1U28C 1ZMBA 1AO0A 3HU1A 2FX3A 5FTWA 3LOQA 4IWXA 2BRUA 1JEAA 2E4WA 3A32A 5C35A 5JBIA 1NLYA 3AETA 1PWZA 2IYAA 2V58A 3T9AA 3DV9A 3DDHA 5G0WA 4C22A 2JJ8A 2VPIA 5BWMA 1CIVA 1RWNA 1NW6A 2Q45A 3VAYA 3QJYA 1YXMA 3JATB 3NW9A 1ICIA 3FF4A 3OOHA 3SBXA 3U3RA 4QFMA 4M38A 5ITSA 1WJGA 5EYPB 4V03A 1RFLA 2GBGA 2WJWA 5C46F 5LQUA 1I2ZA 5AI6A 2YWJA 1CDDA 4EVIA 4RZIA 3PNQA 1G8KA 2QX4A 5CW1A 4Q9KA 2JI6A 2ZU0C 3A6LA 2V1XA 2B98A 5TMEA 2Q5CA 3T7KA 2FSIA 3OFVA 2BELA 1CNMA 1P2DA 2J31A 4IICA 4LY0A 4YMSA 2YWDA 2W2OA 2I6FA 1EFPA 1NZJA 4GRDA 2QU7A 5FOXA 2V1UA 1VGQA 2BTEA 3COJA 2BHSA 3OM8A 2OCKA 3VJKA 5EPOA 2ZE8A 1O95A 1WVMA 4MJLA 2JH9A 3ENQA 3NOQA 5AHKA 5GGYA 4Y0AA 4ZVNA 1Z36A 3DBVO 5KPDA 2SKEA 5CEJA 4S04A 4CTNA 5BPFA 4X54A 4AG6A 2NO1A 3I4FA 2ENUA 5BUSA 1AQ6A 2SHKA 3IP3A 2BSXA 1AOXA 3UK7A 2QVGA 4HNAA 4YAJA 3U7EB 4AZ0A 1BO6A 2FF7A 3HZRA 1I7QB 1MLDA 1XZAA 3L1IA 4OTZA 5FA5A 2N9UA 2EKQA 2HAEA 5KYUA 3PR3A 3HSYA 5AM0A 2I1LA 5FTJA 5G4KA 4BRWA 4PWYA 1P2GA 4CDGA 1FMTA 1QV9A 2XYPA 6GPBA 3UKOA 3EDMA 2HMYB 2IPXA 2R60A 1ZBDA 1FUYB 3BG5A 4Y2HA 3AZPA 4J4TA 3KOYA 4EEKA 1P7WA 4ZHQB 2C57A 3RDPA 1DLJA 1SC4A 3B1YA 1NOJA 5SYNA 4OGGA 3L82B 2O2IA 2NSHA 5EP3A 5EJ2A 2W2NA 4BJ5A 1BQEA 1Y8RA 4Z2AA 5CM9C 3RBAA 2GD0A 1J9EA 3A26A 3HN6A 3T9BA 5JNUA 2Q6KA 3O3CA 1C2YA 4DC1A 1PFGA 2NNLD 1QIMA 1ZH6A 4EFDA 3OY7A 2QTHA 3RSFA 1KO8A 4A8TA 3ESRA 5BNZA 4NWIA 3AUAA 3R20A 5JROA 5ILQA 1V8BA 1GGFA 2CY0A 4CKWA 2WJVA 4BV2A 2X14A 3K2EA 4KQ9A 3CF0A 4M98A 4Y9SA 2YHUA 4LGYA 2NMVA 2MYTA 3NGXA 2IYOA 4CL2A 4F9TA 3DD5A 1J23A 4CV2A 3D6NB 1TKCA 3I1YA 4H18A 4EUHA 4HNHA 2OWEA 3IPCA 5GZ6A 5AI8A 4EF4A 3K70B 3KZMA 1OR8A 3HYLA 5M5BA 4OUDB 4YAKA 1CVLA 3R7FA 1KE1A 1P2SA 3O8QB 4PYQA 3WNCA 1FUUA 2CVZA 1KARA 1VHWA 4MGHA 5DLEA 1M6VB 4N1AA 3GFRA 1BFKA 4NI5A 4BFCA 5BXYA 1XTVA 4PCVA 1CX9B 4M86A 1U2QA 4OIMA 4AJEA 3ANMA 3TXAA 3WOHA 3QPWA 1ZN8A 1NPDA 3B6MA 5ECGC 1PR1A 3KVVA 4XAQA 4WOJA 2JFBA 1AU9A 2GEDA 4N12A 1BE8A 2GHQA 4D81A 2CHEA 2AG1A 4KWHA 2JD1A 4D6YA 4JYPA 1OI2A 1DAFA 5KNCD 1P73A 5IDWA 1EFAA 4MHSA 1T5HX 1TD1A 1U31A 3ENZA 2WR8A 3QMVA 2AJLI 3IE0A 3L18A 1YHNA 5KQLA 2OCBA 1KBZA 5JYBA 3PA6A 4KBYA 1W47A 1QMGA 3VPHA 3PUZA 3S8MA 2E9SA 1K4MA 1S0UA 1Z16A 1SUAA 3AI3A 3T6KA 6Q21A 3ECCA 4EOGA 2H31A 5IAOA 3D3JA 1FSPA 2AW5A 1FZTA 3IVXA 1Z4JA 4FFWA 5ALTA 4FB5A 4YRNA 3FSJX 2ZBQA 1U5CA 1YCFA 5DBGA 8ATCA 2WF8A 2IP2A 5H68A 1ZEJA 4ZZ3A 3HM9A 4FGSA 2XWPA 3BGIA 1BWQA 4MR7B 2J9GA 5JSZB 3QBVA 2PX4A 4AJLA 2C4KA 4RPKA 2SCUB 4FZRA 3S27A 5DGXA 4YHBA 4RMHA 2B34A 4I1YA 5C34B 3AL3A 1FMFA 2VT6A 3KLOA 1NPYA 5CIYA 2FHPA 1P0PA 1SCJA 4P38A 4XSHA 1PFKA 3ETCA 1LF0A 2D6FA 3GDGA 4XCVA 3VH3A 1GQOA 5IH3A 4FGZA 2GCIA 4LXQA 5IJAA 1D2RA 3MMNA 4CR6A 2ORYA 1X74A 1C7RA 4FS3A 4RABA 5L53A 2XITA 4URYR 5H1YA 4YXWD 5TIIA 3CG4A 3U4QB 1ZGBA 2QMYA 3BICA 4JQZA 2QRPA 2ZUUA 4G0OA 5AW8A 3GJ8A 3K1TA 1SD2A 3L8GA 4MGIR 1M8KA 2B99A 1QJ4A 2WB4A 4QOSA 1FDSA 1JQBA 2E5FA 1L7MA 4P4UA 3S28A 4HXYA 4AVYA 2C5GA 2DPGA 2QW8A 2OQ2A 2CFSA 5L3VA 4KO8A 3SGLA 2PZKA 4GI7A 3DOUA 5JSYA 3RC7A 3QXSA 1VXOA 3VZQA 3VR6A 1VHTA 2C5LA 3I83A 3SF8A 2ZIGA 4ADSG 1B1CA 1MRZA 5HTOA 3LC7O 4WW0A 4N4AA 2PO7A 3NTVA 2R86A 2YS7A 4L8VA 4BX0A 3TRJA 4BWGA 3IIEA 4LGMA 1QYVA 3DE0X 4EVRA 4EYEA 4JCCA 4ZGWA 1U0NA 2QENA 1A2BA 3IDQA 5EG5A 3WHLA 2UZAA 5G40A 3A1NA 4DLNA 2ZSEA 3G2OA 5CA0F 1JXQA 2OHXA 4K3VA 1H1LA 1GNQA 1VQ1A 1F9EA 2HWWA 4UMFA 2DWCA 3TOZA 3GOQA 4R8KA 1XU7A 1P5RA 1TK3A 2DBQA 2P9JA 4MX8A 2X58A 3CZAA 4N5NA 4UOQA 3EDRA 5CHYA 3CN7A 4MICA