4RTNA

Complex of escherichia coli dna adenine methyltransferase (dam) with adohcy and with dna containing proximal pap regulon sequence
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
249
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSKKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
molecule keywords DNA adenine methylase
source organism Escherichia coli
molecule tags Transferase/dna
total genus 81
structure length 249
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtnA01
5DT2A 3UJ8A 2UYCA 2WA2A 2NXEA 1KR5A 1FP2A 1VLMA 5KYGA 4AZTA 5C9ZA 2PBFA 4IV8A 5BW5A 1JG3A 3KR1A 2IFTA 2JHPA 2P3QA 3HCCA 1YFJA 4QDKA 9MHTA 3LHDA 1WZNA 1D2CA 3R24A 3FTEA 4ER6A 2QY6A 2FCAA 2BZGA 4PCAA 3VC2A 4FT4A 1QZZA 3CJTA 3UA3A 3HCFA 3G5LA 4ER7A 1N7JA 3TRKA 2CMGA 1JSXA 2QM3A 3M6UA 1NV8A 4PYNA 4QPNA 5E8RA 4ZTBA 2R3SA 2ZBRA 4A6DA 3KPUA 3KPJA 5K8VA 4QTUB 2YTZA 1KIAA 2OKCA 1KYWA 1M6YA 1SUSA 4AX8A 4CKEA 4IV0A 1XCLA 2B3TA 3P9IA 2I6GA 2PXCA 2NXNA 2IPXA 3KQOA 4GC9A 2ZIFA 4GF5A 3BGVA 4EKIA 5E1MA 1ZKDA 3T7TA 3UFBA 5GIPE 3HVKA 4KW7A 4RTOA 1ZGAA 1FPQA 2IH2A 5F2KA 4FR0A 3EVAA 4IKPA 3GCZA 3CC8A 3KQPA 5DPMA 3ID6C 3RW9A 2VDVE 4ISCA 4CTKA 5FUBA 1MHTA 1T43A 2YX1A 3MCZA 3ANXA 4RYLA 1JQEA 5FA8A 5HEKA 3GWZA 4RTQA 2JHAA 2XVMA 3LCVB 5LQCA 1L3CA 3A27A 3BKXA 3C0KA 2BR4A 5U4XA 2GLUA 3FPJA 1YUBA 1EG2A 1JQDA 3O7WA 4GEKA 4RTMA 4PGHA 3UJ7A 2ZZNA 1QANA 2AN4A 3KPVA 5FWDA 4DKJA 1ZGJA 4U7TB 2IP2A 4A6EA 1KXZA 2O57A 3QOXA 4KDRA 5ICFA 2OPBA 4JXJA 5K0BA 1VIDA 4K6MA 1WG8A 2OO3A 2ZTHA 3BKWA 3HVJA 3OU2A 4ER5A 5BP7A 1XVAA 2UYQA 2C7PA 1OR8A 2NXJA 3P71T 3P2IA 2O05A 1JG2A 4HH4A 1TW2A 4H0NA 3FZGA 5E1OA 5JR3A 2FHPA 3K6RA 1R8YA 1X1DA 5MHTA 3UJDA 2AOUB 2ZULA 1L3BA 3EEYA 4MHTA 10MHA 1X19A 3G8AA 5CCBA 3NW9A 1KPGA 3AY0A 2ZWVA 1ORIA 4QVKA 5EG5A 4YV1A 1JQ3A 3B89A 4PYQA 4QVGA 2XYVA 4DF3A 1Y8CA 1VL5A 1DL5A 5T67A 3S68A 2JHCA 3KQWA 3SSOA 2H00A 2FYTA 2ZSUA 3IV6A 3ME5A 1RI2A 4PYOA 3TM5A 4AUKA 3P9KA 3BWYA 5LR6A 4ATNA 3EVZA 2GA9A 5HIMA 3FTFA 3FRHA 3FUVA 4R6WA 5D1NA 5FWAA 3CJRA 3V97A 3CJQA 2XBMA 3KQVA 4R6XA 5EKUA 3BWMA 4BLUA 3I5UA 4HC4A 3MB5A 4PYKA 3RODA 3A7EA 3R6TA 5GWXA 4RVHA 3JWHA 3HNRA 4KDCA 5FULA 2IH5A 2AVDA 1RI1A 5EMJA 5EOVA 1RJDA 5K0CA 2VDUE 2YXLA 3OE5A 3UJ6A 1F3LA 1KPIA 1P39A 3GNLA 5FQOA 1UFKA 5DXAA 5ERGB 3B7PA 3OZTA 4C03A 1VPTA 3NVMB 3T0IA 3KHKA 2P3LA 3KR0A 4QQNA 1BKYA 2PX2A 3EVGA 2IBSA 2NNWB 4OA5A 1EJ0A 1O54A 3TR6A 2HNKA 2A14A 3P8ZA 3BGIA 5EMMA 3I64A 2ZBQA 4PIMA 2ESRA 3M6XA 3P97A 5KS2A 3PTAA 4PGGA 3VYWA 2BR3A 4HTFA 3HP7A 3E05A 4E30A 2XVAA 1R00A 3G89A 3C6MA 4CXMA 1O9HA 3DLIA 3GRVA 3M70A 4X60A 4E33A 4EK9A 5HZMA 2V74B 3RIEA 5LQAA 2BM8A 3C3PA 3DULA 4EKGA 4PWYA 3NDIA 5E2AA 1ZG3A 3GIWA 5C0OE 3JWIA 3GJYA 2GH1A 3GO4A 3LKDA 4YV0A 3EPPA 2BR5A 2P40A 3REOA 3Q87B 3GXOA 3E23A 3BWCA 3VC1A 3OE4A 3OCJA 8MHTA 3FPEA 3FYDA 4XUDA 4RTSA 2VS1A 3LSTA 5DWQA 3V8VA 2PSSA 3HA3A 3ER8A 2PT9A 3EVFA 3TQSA 4ER3A 2ZWAA 4LECA 1G55A 4QTTB 3M33A 2HTEA 3BGDA 3G8BA 1V39A 1FJXA 4RSRA 2E5WA 4DMGA 1NKVA 2PX5A 4RTKA 2P7IA 3D2LA 3P2KA 2IDJA 1G60A 3FUUA 1P1BA 5DSXA 1NW5A 5K0LA 4GBED 1QAOA 1UWVA 2DPMA 3PFGA 2IIPA 4CWAA 2ERCA 2I9KA 5M5BA 2NXCA 5EMLA 1JSZA 4CKBA 4RTJA 3HCBA 4KIFA 2ONYA 2QYOA 3M4XA 1TPYA 5BXYA 2C7RA 3CVOA 3PFHA 1IM8A 2HWKA 3TLJA 4GOLD 1I9GA 2OBFA 2P8JA 3KR2A 1N7IA 4GOND 3GRRA 4FP9A 4PCLA 3KQSA 5FCDA 3UJAA 3DLCA 1G38A 2PVCA 4RX1A 4HG2A 2ZVJA 4P7FA 3I9FA 3MTIA 5EC8A 2YXDA 2PKWA 4UOEA 4RTLA 3TM4A 2P3OA 2ZW9A 3QV2A 2PXAA 4M7RA 4BP1A 4C06A 5F2NA 3TKYA 3GDHA 3TPZA 2AVNA 2G70A 1SVUA 3A4TA 3KU1A 3OPNA 5E1DA 5E8JA 5GM1A 4R8RA 1XJ5A 3OFKA 4AZSA 3HCDA 5CVJA 3G2OA 3HA5A 3R9XB 5GM2A 1YF3A 3OZRA 5LQNA 3HCEA 2P35A 1HNNA 3DUWA 3P9CA 3SR4A 2P1DA 1R18A 4HGYA 2QRVB 5FTWA 5EPEA 2R6ZA 2PX4A 2PT6A 2K4MA 3DR5A 4KRGA 4IWNA 2AOWA 3P2EA 5E1BA 2I62A 1WXWA 3EVCA 3G88A 3HTXA 1NW3A 1X1CA 3I53A 4RVFA 2JH9A 2EX4A 3KR9A 3CCFA 1DUSA 3FPGA 3FUXA 4WXHA 5FHQA 2ONZA 3UA4A 4LG1A 4MWZA 2KW5A 1EJ6A 2XYQA 4OA8A 3LDFA 3UZUA 3BXOA 3ELWA 4FS8A 5BW4A 4F85A 3C3YA 3X0DA 1I1NA 1RJGA 2Y1XA 3LECA 3KPWA 4U7PB 4R8SA 2AOUA 5HILA 4RVGA 2G1PA 3LDGA 5EHIA 3EGEA 5KQSA 2VZ9A 5FQNA 5K0NA 4CKCA 4DA4A 3DH0A 1KP9A 3TOSA 5E9QA 5CVDA 2AOVA 5FA5A 3KKZA 3EVEA 3PT9A 2B78A 1XDUA 4E2ZA 4L7VA 1R6AA 5EEGA 2G72A 2V7EA 3ELYA 1NBIA 5K01A 2HMYB 1AV6A 2H11A 4RV9A 1QYRA 5DM0A 3B3FA 1L1EA 1NW7A 1QAQA 1VP3A 2ZIGA 3OFJA 3ORHA 4YMGA 3TFWA 4KIGA 4V0RA 1RI5A 3EVDA 4C04A 3NVKI 4F84A 3CBGA 4GQBA 5CM2Z 2Q41A 4Y2HA 5CVVA 3B3GA 5F2OA 3G2PA 3H2BA 5KVAA 3KQMA 5EZQA 5CIYA 3K0BA 2C7QA 2JJQA 3DP7A 4PNEA 4PYJA 3MERA 1YZHA 5DX8A 1FBNA 1Z3CA 1PJZA 1M6EX 3IHTA 5EIFA 5HIKA 1B42A 5G02A 2OB2A 2H1RA 2I7CA 5FADA 1L3IA 5CD1A 1EIZA 5DTMA 3AXSA 2VDWA 3Q7EA 4X61A 2OY0A 5DM4A 3EMBA 5EQJB 2ADMA 2DULA 2O06A 1ORHA 3GRUA 3ELUA 4M36A 4M37A 4RVDA 2B2CA 5DSTA 3O31A 5E2BA 4B17A 3OZSA 4C4AA 1ZHFA 1AF7A 2WK1A 2PGXA 4PYMA 3BUSA 4E2YA 2IDKA 5IKMA 3ELDA 4RWZA 4FSXA 4HRAA 3SX0A 5KQRA 2FK8A 5EMKA 1RI3A 1AQIA 4QQKA 2AS0A 3T7SA 2UYHA 1VP9A 4M38A 4X41A 5D1HA 4YUZA 1RJEA 4R05A 2ZZMA 1PRYA 4HGZA 1KHHA 2ZCJA 3M6WA 4FGZA 5HIJA 3SSMA 4C05A 5EEHA 1FP1D 2BM9A 3T7RA 5K09A 3KPYA 4OBWA 2GPYA 4HSGA 2HR1A 1X1AA 3R3HA 2NP7A 1IY9A 4EVIA 3FUWA 1JTFA 1G8SA 5DLYA 2ORED 3DMFA 4C07A 1EAMA 2YR0A 4P7GA 2YVLA 4OBXA 2Z6UA 3FPHA 2IBTA 3IYLW 4E70A 2GAFA 3QOWA 2OXTA 2XYRA 5FHRA 5GINE 4MIKA 2FRXA 1JTEA 2GB4A 2HV9A 5LQKA 1JR4A 5EHGA 1X1BA 3P9NA 5CUQA 3FUTA 1NBHA 1NW6A 2PWYA 2P7HA 3O4FA 4PONA 3GRZA 2NYUA 3HVHA 3UWPA 3SGLA 3HM2A 3WSTA 5ICCA 3PS9A 4E2WA 4F86A 2B9EA 1F38A 5EZSA 4BY9E 3PX2A 3LGAA 3DXZA 1VE3A 3C6KA 4OX9Y 3PB3A 1H1DA 4XUEA 2JH8A 3NTVA 1O9GA 2PY6A 4X1OA 1P91A 3DMHA 2F8LA 2B25A 4E31A 3FYCA 2IGTA 3UJCA 2EFJA 3HCAA 1YFLA 1XDSA 2N47A 1RI4A 5H02A 3PLAE 2Y1WA 1UIRA 1DCTA 3UJBA 3EGIA 3FPFA 4QPPA 2EJUA 5P8WA 1KPHA 3LBFA 3U81A 3BWBA 3MTEA 3NWEA 3MGGA 1XXLA 3GRYA 5DTRA 2UZ4A 2EG5A 2PV0A 3SM3A 4Y30A 5ICGA 2WA1A 2ZBPA 4Z2YA 3LBYA 4EMSA 3G2MA 3G7UA 1R8XA 4P7JA 2GS9A 1RJFA 2EJTA 3R0QA 3GGDA 3LL7A 4V0QA 3PVCA 5K03A 3FTDA 7MHTA 4RTPA 4OQDA 5K0JA 2UYOA 1XTPA 3TKAA 2OZVA 3DXXA 3BT7A 2O0LA 2O07A 3AWIA 5K05A 1MJFA 3THRA 3EVBA 4C08A 4BP3A 1WS6A 1N2XA 5T6BA 2OYRA 4LWOA 3EGVA 2QE6A 5GIOE 1QAMA 2ZZKA 3UJ9A 3LCCA 4AZVA 2QRVA 1SG9A 4PINA 4CTJA 2AN3A 3BZBA 3SVZA 5HOQA 4GOMD 4P58A 3DXYA 3M6VA 3HVIA 1Q0SA 1IXKA 4RTRA 1VBFA 2CWWA 4E32A 3JWGA 1R74A 3OU7A 5HFJA 1G6Q1 1WXXA 1AQJA 4PIPA 3UBTA 2Z6QA 1P1CA 4KWCA 4MTLA 4MQ4A 2YXEA 5DM2A 5DRTA 4OQEA 3I58A 4ER0A 5EIWA 4DZRA 5IH3A 1NT2A 2PJDA 3CKKA 3G5TA 5DTQA 1HMYA 5DX0A 3ER9A 3LPMA 3B3JA 4E2XA 5EGSA 4LWPA 4NECA 2FPOA 3GU3A 4YUVA 3E8SA 2PLWA 2PX8A 3DTNA 1SQGA 1BOOA 2ZLBA 3HA7A 4O29A 1M0EA 2IH4A 3DOUA 3CGGA 1JG1A 1XCJA 4GUAA 4DM3A 5LQUA 2CL5A 3A26A 1I4WA 5K0EA 2BH2A 1L9KA 3AJDA 4GC5A 3F4KA 4YUXA 3MQ2A 5K0FA 2ZIEA 3A7DA 3VSEA 5K0GA 1YZ3A 3NJRA 3LKZA 1SUIA 1JG4A 2PWPA 5GOZA 3B5IA 4KVZA 5T64A 5EKXA 5LQRA 1VQ1A 2G71A 3EEOA 4POOA 5E9WA 1EQAA 4XCXA 2CKDA 4YUYA 3NDJA 3SMQA 2VP3A 4RTNA 4WVLA 3IEIA 1BHJA 3NWBA 5EVJA 1XDZA 5HIIA 3FRIA 3KQTA 4X63A 5CCXA 5GP1A 4BLVA 2OB1A 3TMAA 1WY7A 1NV9A 4FSDA 4XUCA 5DX1A 4BLWA 4DCGA 1Q0TA 2C7OA 4PYLA 4GOOD 1BC5A 1U2ZA 3MAGA 1SKMA 2NP6A 4G56A 2YUIA 1TW3A 3OU6A 4YMHA 4YV2A 1G8AA 2AZTA 5DXJA 1ZQ9A 5JUWA 2CMHA 5ICEA 2Z6AA 4HTFB 5DRYA 2JG3A 1SQFA 3A25A 3ERCA 3LCUA 3E7PA 2AOTB 5E9JA 3G2QA 2ZFUA 3NMUF 4AZWA 3EMDA 5LSAA 2LD4A 1NW8A 3PX3A 1INLA 2YQZA 3JWJA 4EQZA 4DQ0A 5CVUA 3HEMA 3L8DA 3MCTA 4P7KA 2AN5A 5C1IA 1D2HA 3AXTA 3LDUA 4PYIA 4FZVA 2FK7A 3SXJA 2AOTA 3KQYA 4DCMA 3SSNA 5LQJA 2PXXA 2G8NA 3FTCA 3LX6A 1YB2A 5CVEA 5B1SA 3THSA 4QDJA 3MHTA 2P41A 3KQQA 2AOXA 1KYZA 4FT2A 1NE2A 4YUWA 3DMGA 1D2GA 2AR0A 5DM1A
chains in the Genus database with same CATH superfamily
2VJMA 1E63A 2HF2A 4PC2A 2BGWA 4OOFA 2OBMA 1KORA 2WMYA 4LYGA 4F8YA 1H4VB 5C9ZA 5KYGA 3PWTA 4RA9A 3GZNB 4PLZA 1VCOA 1ADBA 1NW9B 5BV8A 1G98A 5JEEA 3QU9A 3ZDBA 5FBWB 3TINA 3AKYA 3L9WA 4G1CA 4JDPA 3ZGNA 4CKEB 4PTZA 3RLFA 3FLBA 4AU1A 3G5LA 4RJTA 1EFAA 4MWDA 1HEYA 4HZUA 3CMCO 2O5RA 3JQFA 2H5JA 2ZBRA 3QE9Y 4H3KB 1W5EA 4B43A 4G0VA 1JKXA 1RWNA 2H4ZA 4XPIA 5FO0A 1CEQA 3MT7A 4EKDA 4JCCA 2I4LA 3SHQA 1G64A 4GSYA 4H6VA 2B0CA 3HJAA 4I4NA 2OHFA 3PQ5A 1D5WA 4X84A 1LWOA 4OQ4A 3D0KA 1JHOA 2D13A 2HK8A 2HRQA 4FCTA 3A4YA 3KQOA 4J7AA 5JV5A 3DKVA 3NHBA 4RTOA 1V37A 2GEBA 2IHUA 2V54A 4JYPA 1T36B 1WV0A 2QL6A 3TNLA 4BOYA 4BFLA 4MGKR 2E4ZA 3WO0A 3C74A 3MWYW 3K09C 4ISCA 1WX1A 2R2AA 3GYGA 5LD2C 1SQ0A 2CZGA 3KZOA 1MT0A 3O8QA 3BTVA 1SCJA 2E2WA 1YCHA 3PNMA 4Q5IA 5AKXA 5GONA 1XTTA 4KBYA 5DP1A 2AUMA 2XXAA 3HYLA 1BMTA 2X5OA 3N07A 2QF7A 3F6RA 4EHHA 4W5HA 3EEIA 1XZPA 3DHVA 3KPVA 2ACWA 4F2GA 4QWWA 4NBSA 1HYGA 3X2SA 2FPSA 1KVUA 4A6EA 3IEUA 1KJ8A 3RHSA 5TE9A 4B3RB 5FNVF 1PR1A 2JGEA 2Z9BA 3WKEA 3RS2A 5BP7A 4ZO4A 1YOBA 3RDPA 2PVSA 1HBJA 3GK3A 3CNEA 4RE5A 4DMMA 2HIHA 4RK0A 3OMXA 5HE9A 1QE0A 4GNRA 4ZGWA 5F9HA 3AGQA 1R8YA 1SD5A 2Q50A 5KC9A 4J0EA 4AK9A 2I6QA 4DZTA 1B6SA 1TK9A 3K9NA 4EZEA 4Z2AA 5AJVB 1FXSA 1X19A 2YWEA 3N8NA 2J30A 4RY0A 1E1MA 2JKYA 1EP2B 1YR9A 2ZJ8A 1IG3A 3KLMX 4QICA 1K6MA 2OP0A 3SXPA 1E2QA 3RJMA 1YRYE 3B89A 2I2FA 3WK6A 1AMUA 2BFBA 1M2VA 1O7JA 2MSKA 2W2OA 3GLSA 1JSCA 4WPGA 4BKRA 4CW7A 1FTNA 4WKNA 2XDYA 2SKCA 3TTSA 1T8RA 1EFPB 1C3XA 4MUXA 2PZEA 5L4NA 2WVJA 3L2OB 3QPUA 5H83A 1LSSA 4GXTA 4BLUA 4FJ1A 3BD7A 5IP5A 2HRBA 4MVJI 3AG5A 5KI6A 1OGIA 1H2XA 3ILXA 1I2DA 2YY7A 1J9GA 2VOJA 4LRWA 3WYDA 1LPMA 1VXRA 3RJ5A 4CBVA 2IBMA 4A4DA 9GPBA 2MINA 2HK9A 3ICOA 3KJNA 5IJAA 3W5HA 3R3SA 4DY4A 2JL1A 5I9BA 3BG5A 4TWRA 1UQRA 4EI8A 2AB0A 3FA2A 4C78A 5JCPA 4L08A 4DCOA 5BT8A 1TUGA 3E22B 1KPIA 1O3YA 3F5QA 4GLBA 3UMCA 1J8DA 1EK5A 4O4IB 4JP8A 2Q9BA 1RPTA 2CVHA 2R6FA 3AW9A 2J3IA 4FCVA 3CZRA 4G25A 3T0IA 1PDOA 4B7AA 5DHSA 4IEEA 5I47A 1QYDA 4JEIA 4KNWA 3SVLA 2DJIA 2GF9A 5SYAA 3ZE0B 3KL2A 4IJWA 4TV9A 1X38A 2BTOA 1E77A 3RS0A 4POAA 3WQQA 1M2KA 1A5TA 2FQYA 1AKTA 4C01A 3PTAA 3DGFC 1RHQA 2OHOA 2BR3A 3WLKX 5AESA 1E1LA 4RSGA 1L8QA 1MF7A 2WUEA 3B1JA 3CUWA 4KUGA 2G1UA 4HGPA 3VAZA 4AY4A 1O6BA 2RGBA 4HNSA 4KK3A 2D4AA 1ZH4A 2QZPA 4N49A 2VP0A 1MB3A 5KNBA 4MDFA 3GJTA 4B3GA 1DAFA 3GFOA 3TECE 5IKPA 1PT6A 2BGNA 1WMDA 1U31A 4KC0A 4UMDA 1LRJA 1WO8A 4ZU3A 3SXUB 3VC1A 4ZK6A 1KBZA 1DWQA 1GADO 1NMEA 4NE7A 1SCUA 4TROA 1Q91A 2OUIA 1TI7A 3VJKA 4AJKA 4KFCA 1VJRA 3CUYA 1VA5A 1Z56C 2ACEA 2ZBEA 3V8VA 5BWOA 2PT9A 3GJRA 4ME6A 4GI1A 4YI3A 5BQXA 1ZIDA 4JQCA 3FWNA 3STUA 4R8KA 1DQSA 3EZ2A 4GWGA 3QTBA 2CE2X 3QITA 2IOFA 4RLQA 3RARA 1P9LA 4HZIA 3IJ5A 1I94B 2JGKA 1E94E 1ZK3A 2ERYA 3C3EA 4L9SA 3KB8A 2VHCA 1DB3A 1Z2DA 1SVLA 5KJ1A 1UWVA 2FPIA 3KYJB 5TT0A 2ERCA 3F3KA 1KAOA 4LJ9A 5IBRA 1CY1A 1UKVY 4WK2B 3C5EA 3O47A 1O6CA 2PS1A 4OGLA 4U63A 4LKOA 1PJAA 1Z38A 2FN4A 5H9VA 2CJYA 4W82A 4TXHA 4YAIA 3PFHA 3WWOA 4JR0A 3K15A 5HMLA 3SBDA 1W87A 4FP9A 4W6ZA 1V9CA 1V2GA 5HE8A 4Z0NA 1KI1A 4TZ0A 2YMMA 3FMOB 4LSGA 4FJ2A 1GGMA 1Y3DE 2VZ8A 4PNZA 2QY9A 4JB0A 3NUQA 2BP7B 3B6JA 4A5OA 2R1UA 3X2FA 4H7KA 3PL1A 2NYRA 4UBKA 4GR9A 3FI9A 3KTAA 3TCXB 1S3IA 2XMQA 4D4KA 3VDRA 3RFVA 2FN9A 1RQPA 1IN1A 1G2OA 2M9MA 2ZI5A 1PUXA 4JP3A 3OX1A 5GPBA 3ICPA 2JFBA 3V2HA 4BB5A 1YT5A 1W19A 1ORWA 4KTVE 3WGOA 2K4MA 1XCMA 2C04A 3OOJA 4C7OB 3QMMA 3GLTA 1S8OA 5EUCA 1MX1A 4AJJA 1JP7A 1YB7A 2I62A 1M9NA 3PHJA 1RQGA 4NZNA 5D85A 2JCYA 4KIWA 5DN9A 3Q9UA 1KJQA 1FRQA 5BYAA 4B3TB 4KR6A 1YDFA 2E4XA 3ZTYA 3W3AA 1C1HA 5EQTA 4YMVA 3RSCA 4PBRA 1L4HA 4URFA 4B3SB 2YDYA 2P75A 3IOMA 5FB3A 3V4ZA 2JK0A 3IIEA 3ASVA 3MS7A 1QCDA 4BNMA 4F85A 5CBPB 1M6NA 5EMHA 4BMOB 4Y2RA 2HO4A 3R6DA 3HZRA 2OQVA 3QUSA 3JALB 4JYBA 1THTA 1SKUA 2C1EA 3DL0A 2FJUA 3BH0A 4HAOA 1GUYA 2FN8A 1CUVA 4FFWA 4R2XA 4WXPA 2YJ4A 4B76A 5BN4B 1YR1A 2PMWB 1I6KA 1J0XO 2AG0A 2WU3A 3BHJA 1PFUA 3FNQA 3NTRA 3NUGA 2NTNA 3ELYA 3OTIA 3T41A 2F3QA 2H2FA 2OORA 1FC0A 1ONPA 3MWDA 1AV6A 1XC7A 3EXHB 2HXSA 2ZYVX 4QHYA 4RV4A 3IUEA 2PH7A 3EOZA 5DHPA 4A10A 4F21A 3KETA 4PAGA 3B1FA 3P0RA 4LDNA 1RQ7A 4IMRA 1OXTA 1XVVA 1Y5NA 1H1TA 2GEUA 2J85A 2VJYA 3FFAA 3HDVA 4FN4A 4ONEA 3A6FA 4DG8A 5L53A 4ZVRA 2HOQA 4JWTA 4JLWA 4PGFA 1ABFA 4P6VF 4F9FA 3DP7A 1EXVA 2HYIC 1DKOA 1NRIA 2Z95A 3G0IA 2KE5A 3TR5A 4F92B 2J0SA 1XVTA 2NSJA 5GONF 3M2PA 3TVDA 1RE1A 1JEYB 2W4MA 4J0FA 3IMEA 2UYGA 4CM1A 1Z4NA 1N2CE 3S8YA 4EA7A 5A02A 3RRJA 1YJQA 4QTYA 3ZQUA 3E35A 3GT7A 3H11A 5DSTA 1HE8B 4RVNA 5E2BA 1S2MA 3W7BA 1H4QA 1DAOA 1HXHA 2WK1A 1SRQA 1Z4IA 3PJRA 2CMFA 3TD2A 2P2DA 4B0OA 3SX0A 4ZAFA 1WXQA 3ZHOA 2X2FA 4BASA 2AS0A 3T7SA 3J81k 3DFIA 4F72A 3TI9A 3FDIA 2JBAA 2IYNA 1KGSA 2Y6UA 4B79A 4G63A 5CGZA 4NBVA 1P0IA 4LRSB 2XCIA 1GGFA 1KIFA 4NHEA 4B8WA 1WHSB 4BMZA 1FP1D 3KPYA 4Y6SA 1NQWA 1X1AA 3D8RA 3RYHA 2QUJA 5HUQA 1G8HA 2HWUA 1JTFA 4W9NA 4PO9A 3C8DA 4JOCA 4IXDA 1XP8A 1TPZA 3JQ9A 5BW8A 1V11A 5AVJA 1QO9A 3NNNA 2ID7A 2YCLA 4IL5A 4DPLA 3SDSA 3FPHA 3QEAZ 2RKBA 3IYLW 3PXAA 4PR0A 5LYYA 5IEJA 2BFAA 5BO5A 4EYEA 1YQ9A 4J29A 4KMMA 4FKBA 3GUYA 3RUIA 1SB9A 3KZVA 3EQ6A 4DWVA 4BGDA 1MZPA 4UBOA 4QU0A 5CAEA 3RIMA 5DNUA 3QOYA 4Q05A 3QPDA 4PONA 3IDZA 4BQNA 4QAQA 4M46A 1PL0A 2WTNA 1V16A 1CY7A 1F38A 4L5IA 3EWIA 1Q1GA 1DG3A 4TRJA 1LPSA 1K5HA 1KQFA 4GKJB 2OC9A 3M82A 4ZRDA 4JI6B 2VA9A 4X1OA 1P91A 2PN1A 3UGKA 1T0UA 2D06A 1Q19A 1AS3A 1W8IA 1NXOA 2B25A 3QVLA 4HDAA 2IY9A 4II2A 3HUEA 1MABA 1UC4B 1AE1A 1WW8A 2AJCA 2Q5FA 4IY1A 5HRCA 1XDSA 5K8CA 1YZFA 2PUTA 3EWAA 4EHIA 2Y1WA 1IN8A 3MBKA 3TTUA 3CW9A 1P75A 3QX8A 2OV2A 3A2LA 4XB6B 4XM0A 3BWBA 3RV4A 1T3ZA 4XWGA 5AKIA 2CXUA 1Q5PA 1IU9A 3LY5A 2GPBA 2WA1A 5ICGA 3UW1A 2RHOA 3NTOA 4TV9F 3H0CA 5SZKB 1U0SY 2BGMA 3RTAA 3TUJC 2R8EA 1ZSVA 1VHDA 3A1NA 3MAJA 5D7NA 2J32A 3VDXA 2C2YA 3VR6A 2YL2A 3L6RA 4L9AA 4OY3A 4P7JA 1Y3HA 2REBA 3I9V1 4Q3BA 3WIDA 2D2EA 1LPAB 1NOJA 2G77B 2QVCA 4CEJA 2PUAA 3TAXA 1XMJA 2HYDA 1TOAA 3O93A 4YI5A 3DXXA 4EPYA 1Z4JA 4I46A 1Z4MA 2O07A 3QFSA 2CGEA 2FN7A 4NNOA 1QYIA 1WTAA 2C84A 2JIBA 1KMCA 1XEXA 2WJ4A 1I33A 1E2KA 1QRDA 2XKJE 3F6SA 4KQWA 4WXMA 2HWYA 4MWCA 1CUUA 4FILA 5KHAA 2ICAA 4F3NA 3AR7A 1ZJJA 4S35A 5JJBA 4BAUA 2OBYA 4MXDA 2Z5LA 3AVPA 1E3WA 3DBHA 1SBHA 3IULA 1E96A 3VZQA 2BI4A 3DBOB 3I12A 3MD0A 3VUEA 1KQGA 4Q39A 4YJGA 3H3JA 3IVAA 1Q15A 3IPCA 4GZLA 2EF0A 4TOIA 3PIIA 4EARA 4GX2A 1B26A 1KO5A 4KBGA 3M0EA 3G5TA 3GUVA 1NJ5A 4R1OA 3X1YA 2C29D 3PL5A 4BE7B 1GU1A 1E6UA 1NJGA 2EKPA 4IHKA 1J90A 3VPDA 4RXTA 4MI3A 5DI3B 2AN1A 4G8BA 5T5QA 1P60A 5LMZA 4ITRC 5K0EA 2R7AA 1F2UB 1X9HA 4N9QA 3SPXA 4I1UA 3GDOA 2FRDA 3A4LA 3ANYB 3U3DA 3Q0IA 2C96A 3O9VA 2JARA 4P2GA 5DNDA 3MBOA 5G40A 3B5IA 2OXCA 3R77A 4IX9A 1ATIA 1I6LA 2AJTA 5K3OA 3O74A 2PX3A 3SC2A 2J46A 2X8AA 2XSZA 3TFQA 1YRQA 4BJ1A 4MDHA 4WNAB 2Z2ZA 4YRTA 2ZCUA 4MW1A 2Q28A 1X8KA 3EYWA 5E6UB 5DNEA 4RM2A 3VR0A 5BPHA 1BXGB 3GJ8A 3HCRA 1GZUA 4WOPA 5LA6A 4C6SA 2NNLD 4D4IA 1YJBA 4B73A 1GCIA 5KB3A 1PDWA 4Z0TA 3DEJA 4CRWB 1VIAA 1DJOA 2RHLA 4BVAA 1GFWA 1Q16A 2J9YB 4WASA 2QL7A 3GCXA 1FUEA 2W2LD 1FLVA 1U2ZA 3GOHA 5ADVA 1AHPA 2YV2A 1U3TA 2BW0A 4EELA 1H3EA 4MLDA 4RHTA 1TIPA 2JJ8A 3GLHE 5IABA 5AJZA 1K7EB 1D2AA 5BVGB 2MSNA 2Q3LA 2QSZA 4MUFA 1CFJA 4QKQA 5MFPA 1YZYA 5CCEA 1Q17A 3F5FA 4YMIA 2ZB2A 3PDJA 3UK6A 2JG3A 1CD5A 3UH1A 1AQYA 3UXHA 1OXXK 1XJ0A 1YRWA 3N8IA 5JO9A 3W4IA 1Q77A 2JVIA 4DJ5X 2ZXEA 4XWKA 3NMUF 1NBOA 5TT1A 5FTMA 3V7UA 3ZWCA 2X77A 2XZPA 2WP0A 4KV7A 4EJSB 4V1CB 5JFTA 1RHMA 3P4UA 5TGZA 1PSDA 1ZUHA 1RXWA 3TW8A 5DGHA 5JATA 2O8CB 2O1EA 5F4BA 4S1PA 2PQ2A 5CXUA 1UH5A 3VU3A 4B3IA 4DRZA 3DDWA 1C7RA 1KYXA 1UFVA 2A1IA 1XAGA 4RNDB 5DCUA 4LUCA 4QDZA 3MHTA 3B7WA 1FYFA 3I8SA 1KYZA 4KFUA 3ZHQA 5CVCA 2H4FA 4YLGA 3KUDA 1KR5A 1A2OA 1JLRA 2QW8A 1XQ6A 2ZAYA 4I1VA 4B3DA 2X2OA 2YRXA 2XUPA 1YVUA 3HZOA 4R1PA 1DEHA 3C4QA 2JHPA 2P4SA 5IN4A 4G36A 3RSHA 3TDMA 1D2CA 4QODA 4XASA 3KLNA 4I1SA 3LG2A 3MWGA 1A9ZA 4N18A 3AMVA 1DQRA 4BNDA 3I1FA 3T3OA 1G8MA 3G9ZA 4OB8A 4L76A 4AWAA 5C7LO 2F3TA 3ZV5A 5KWSA 1PT8A 1H2YA 4JVOA 1IAQA 4CKBB 5K2MA 4ZTBA 1BX3A 4UUQA 4TRMA 5F78A 1DOAA 3TNYA 1LPOA 4G9GA 1KYWA 4RE6A 2UZAA 3X2EA 2EATA 1Q95A 4J4BA 2A5YB 3HQ4O 1FX1A 2KLBA 2B99A 4R2MA 3RK0A 1PQWA 4LRXA 1Z4OA 2PGAA 3PGXA 3ORYA 3TGPA 1I3KA 1T0HB 3D6VA 5AOVA 1UKZA 3SI7A 1XMIA 3FXAA 3RAPR 5JBNA 1GZ5A 5D3KA 1P61B 1YONA 4QOEA 2DETA 2R1ZA 2WHXA 1C0IA 3U3RA 3A2KA 2J07A 3NC1C 4L5CA 4N1AA 4UEWA 5C4GB 5KYYA 3D4PA 1R4NA 4O2RA 1Q1AA 5TDHA 5HVNA 4TPKA 1T43A 2YX1A 4YJ3A 5FTNA 2WWHA 4FEAA 1E79D 1ZSYA 1IJBA 4JB2A 3SNKA 4DLYA 2RAUA 4J0IA 4QFMA 2QRJA 2GZ2A 2W4QA 3AF5A 3C0KA 3LWBA 3B36A 3ZWVA 3ABRB 4NBWA 5AW4A 1MJGA 1T4DA 3QFRA 1TECE 5AJXA 4IJUA 3KD2A 3KAJA 4YPVA 4CM4A 4U7TB 4KE7A 3GQBB 2HQRA 4R1NA 5TV2A 4RQUA 5BW6B 1A71A 3HR8A 4BGIA 5KINB 1A0OA 1GVHA 3HN7A 4E09A 2DZDA 1U5BB 2I03A 3SIRA 5B7QA 4MDEA 1XVAA 4I1IA 5KTKA 2XT0A 3VI3B 3COJA 3DD1A 2HREA 3FUCA 4QGSA 3ER6A 3SZOA 2QG4A 4JL6A 4RGYA 3OZDA 4S3MA 4WLUA 1Q0RA 3NGXA 2HSGA 2ZJ6A 3W6PA 3T12A 4A8JC 1UDBA 1USWA 2GZDA 3OC6A 4UEOA 3P0IA 4GD3Q 1F5NA 4YAEA 1KOLA 2OG1A 1FFHA 3UAZA 3QKTA 3V1TC 5AW7A 1VI2A 1AH2A 1JHUA 2NTEA 3IAUA 4P36A 5CW1A 2IV7A 3SJZA 5IF3A 1DL5A 1D9ZA 1FDOA 1IHXA 721PA 2CNBA 4QXOA 3ME5A 5KTMA 1NUQA 1DBSA 5ITWA 1K27A 4GMFA 1PQUA 5FAKA 5EWJB 2REXB 1N57A 1NVXQ 4M22A 1P3DA 1PN3A 1LKZA 4GXQA 2NZJA 4YA6A 1T2CA 2OMEA 5EKUA 1HE5A 2B8EA 3JAWA 1NW4A 1GL3A 1U2GC 1N6OA 2LCIA 2OD2A 2Y67A 4V2IA 1P5FA 1SPXA 1U9CA 5F12A 4F4CA 1I6WA 1V3QE 4NCIA 4KLCA 3ESZA 3FAZA 3H5NA 4BWGA 4C4OA 2NYVA 1XZHA 3TZCA 4JOQA 1Z5UA 2PMKA 3R09A 1S9HA 4DCPA 3TZBA 3TRHA 2VDUE 1W88A 4I5DA 1SU7A 1Y98A 3EFHA 1U7TA 2IYPA 3IOBA 2XX3A 1W52X 1GZSA 1YQGA 1I0IA 2BVNA 2HO5A 3B7PA 2BJHA 1CY8A 3K7EA 1TTPB 4ZJUA 4QRHA 2B4AA 4AYXA 4XGRA 1Z6XA 1K6IA 4F91B 4CLEA 3QENA 2Q6VA 4B1FA 2AG8A 3OHPA 1F8YA 1MNAA 2P9EA 4LY9A 4KE8A 3RS4A 3A4VA 2G08A 1H3NA 1W36B 3DVQX 4PZLA 1W4ZA 4TTRA 3M3DA 4OO3A 2B61A 1QM5A 1DBQA 3E05A 1RWVA 3L8GA 3MSXA 1ST3A 4CXMA 1VJ0A 1RCUA 4BLQA 5LQAA 3BSWA 3IO5A 3GH1A 1GRCA 3KXKA 4LEIA 1X8LA 2ZT7A 3ZWKA 1LJLA 2AFHA 2MSCB 2XRYA 4M9SA 5G0UA 2W7TA 1DLIA 2X3YA 1KY2A 4WEOA 3EUWA 3ZW7A 3A9VA 1MQ9A 4WLVA 5F77A 2RAPA 1L5KA 1AXGA 4CMAA 3O1JC 4TZTA 13PKA 1N2BA 5D3MB 2DBVO 5FNVB 4LQDA 4Y1EA 3LSTA 1YDGA 1ZDMA 3OX3A 3TLMA 4IGEA 5EKDA 4EYGA 2Z2XA 4JJEA 5IW8A 1T91A 2VJNA 2BONA 2FUEA 1UFRA 1JG6A 3E3AA 4WCFA 3LD9A 5I9LA 1YV9A 4ZTUB 5JOQA 5I7AA 1TTQB 2NV2B 1SVKA 4G5SA 5KHOC 1ZH8A 1U5AA 1MJNA 5KKCA 2IDJA 4DBZA 1SWWA 3H4MA 5DSXA 1XALA 1R0LA 2CXPA 5ARBA 3TUZC 4AULA 1DWUA 2GYUA 5KNDH 5BVHB 4JI1B 1I3NA 1JEQB 1CTQA 1PQYA 3KK0A 3N59A 3HXPA 3TOCA 3U49A 4TTPA 2XH8A 4OVKA 3VAAA 3ZH9B 4CIXA 3GJ6A 3T3DA 3KE9A 2GZRA 1VL6A 3M4XA 4OFWA 1XD9A 4D3ZA 3IV9A 5CDFE 1KKLA 1XJWA 5TS3A 4HX9A 4R0NA 3VC3A 4GOND 3KOWA 1U0TA 1GFSA 2DKFA 2VNHA 2DAPA 4NBNA 3ZWNA 1ULAA 1G9SA 6GPBA 2IV2X 3ESYA 3FNRA 5JCJA 4G1BA 4JLJA 2O1SA 5EXPA 4JBIA 4GVPA 1K9VF 2ZGVA 5E1DA 4DY6A 4PANA 4RHYA 3RUFA 3LCJA 4CV0A 2YHSA 1N1MA 3K6JA 4D0SA 3K70C 5HJ7A 2J0VA 1SXJE 2E4AA 3HCEA 4MEBA 1T9AA 1XWWA 4S0ZA 2PXHA 2QN3A 2VSOA 3HCOA 2H06A 3MIIA 4M0LA 4PG7A 3VGJA 4KPFC 2Q7OE 1A8SA 4BZQA 1L8OA 4NFYA 1V4BA 2HT6A 1DXOA 2KQUA 3PVZA 3W3AD 1K8QA 2VP4A 3OIUA 4UTVA 4QM7A 5EJ9A 1QLJA 4W8OA 1YTUA 1IM5A 4QBKA 5B30A 3RRZA 1SHTX 3MLAA 3KR9A 4WXHA 3L82B 1R16A 1MW9X 2BGRA 1ZONA 2H1WA 1CJCA 1QORA 1IK6A 2ANCA 3NFYA 4TLAA 5GJBA 1O95D 4CG0A 5CH3A 1EVZA 2HXGA 2R7KA 3OCWA 1KH3A 4FS8A 1YA4A 4JY7A 3VHLB 3X0DA 3AJEA 3QEMB 1L1RA 3ODGA 3B20A 1VDZA 2IPNA 3BYZA 4JH0A 2YOHA 4Q34A 4MW7A 3WY9A 5HSGA 5LZ5A 4F4UA 4W6QA 2H5IA 3MK31 1X7WA 1YVEI 2QNIA 2CNWA 2GN1A 4H9GA 4R01A 4RZHA 5KQPA 2RHWA 3HEAA 4YAWA 1RXYA 1W44A 1XDUA 5KOIA 4TSKA 1ONOA 1QPZA 1B0ZA 4GW3A 2VUTA 5DT9A 1N2GA 2F1JA 4H6WA 2UYYA 5EEGA 1VLZA 1R66A 5JBIA 1E3TA 2AXEA 3KAKA 4XIYA 4P5DA 1NW7A 3KLPX 4BNXA 3OFJA 3PHIA 4UM9B 5B12A 4TLLB 4FMDB 1NVKA 3MMXA 4JT8A 3A0UA 2H48A 1Z45A 2OHHA 1ESMA 3KZXA 4FPXA 5EZ5A 5EZQA 4D9BA 5B36A 3PHLA 1D5CA 2MSDB 4IOMA 3RHZA 2D7CA 3H8SA 4PRZA 4RDIA 5U4QA 1M34A 2PO5A 4L6CA 4OQZA 4YJ3F 3NVAA 1FBNA 4Z9BA 4DNOA 4HUQA 3JAMA 1F14A 2FMIA 5JJLA 2I5PO 1XF9A 2AEEA 4HEQA 5ICMA 3HDTA 3NHSA 4H4CA 3HKBB 3Q2OA 2HD4A 2WUWE 4DIUA 4M1EA 5BWBA 3U3ZA 3VKVA 3G2IA 5AOCA 5L9AA 2G0AA 2V9PA 2FMXA 3FYSA 3I37X 3L8HA 4M36A 4WK4B 4B17A 5CT8A 4D92A 4ZKDA 4MRSA 5KPJA 4NZYA 1G7CA 1AF7A 4CIDA 1WKVA 5E6RB 4E2YA 2GN4A 3GT0A 4R1TA 4M8NE 1XLWA 3WGUA 3CUSA 4IDFA 3CSSA 4XVUA 2H1FA 2QVGA 2R7MA 1V3UA 2H2IA 3EOBI 3NBYC 4WNIA 1RJEA 3LCRA 5JHGB 3EPLA 2D1SA 1ZOIA 4X54A 1WB9A 1B8PA 1IB0A 4QGHA 2YMQA 4N40A 5KSZA 3WLNA 3KJIA 4OBWA 4WINA 2MT9A 1G3MA 4GR5A 3R3HA 4ND8B 4JD5A 3CRRA 3O1LA 3EZLA 4D9MA 3CVUA 3LOPA 4D74A 4ZU1X 1OZ0A 4AMZA 5KMGB 1EFVB 3KYDB 4WBNB 2PEZA 2ILVA 4J9VA 4NXMB 4X3OA 2HMAA 2Z6UA 4LV6A 2XOKA 3O9ZA 1RC8A 3SEQA 3BQ9A 2VJMB 1QGZA 3BD6A 2R6DA 4RVSA 3L1KA 4F56A 2PK3A 4K87A 4LHSA 5FHRA 1HRKA 4L16A 3C3AA 3WLOA 4RA9B 1UBRS 4CTMA 4QYXA 1JZTA 3RRNA 1ZRNA 2Z2IA 3HJGA 1SCNE 1G16A 1T5LA 4XR9A 4M1TA 2JIDA 1U0LA 3SGLA 1XQYA 4AY3A 2YBEA 5AW0A 4F86A 5BWMA 1VJGA 5EHQA 1X0VA 2OC4A 1WPGA 2V4ZA 5AVKA 1KTVA 1H1DA 2QL5A 1Y8RA 2FW0A 1A50B 4MR9A 4XPIB 5KYTA 3L06A 2GUGA 1AKNA 1R9JA 3DB1A 3UK2A 4NCJA 3L18A 3S70A 1SXQA 5EHZA 1XZAA 3CRW1 4UUNA 4Z9XA 3OQ1A 3CH6A 1KVTA 3INTA 1DWOA 4E46A 2EJCA 2FCRA 4WV3A 1WCIA 3VR6D 4BNUA 4ZZ2A 3C7DB 1D2NA 3LE8A 3LBAA 2EJBA 3IE2A 3QTLA 1QZUA 1WZ2A 1YC5A 2PPLA 4MARA 3G2MA 1R8XA 1QQ6A 1Z5PA 3JR7A 4N8DA 3O2SB 1HK7A 3O8QB 1GZVA 1RJFA 4OMCA 1R0RE 4V0QA 2XXAB 2TYSB 2RB5A 4DIMA 4EH1A 2XZDA 2IYOA 4BNYA 3O4JA 1W30A 2C9DA 4DKXA 1ES9A 4JBGA 2NUAA 3PNOA 4RIFA 1XMXA 2QD3A 3MJHA 1WNTA 1IBKB 2NAPA 3JX9A 5ITZB 4HYQA 4S05A 1K4YA 3UJ9A 3EXHC 1E32A 3L1VA 1J56A 1L7OA 1PKXA 5A4DA 5CCBA 3RTCA 3G59A 3OY2A 4M9RA 3WHIA 3M6VA 1JAHA 2NO9A 4D9KA 1N2ZA 5BUCA 4QUKA 5JS6A 3JR3A 4OL9A 1M2OB 1PD1A 1KL7A 1POWA 2JIQA 3ZXIA 1ECBA 3KSZO 4MQ4A 4OJKA 2R84A 1OGYA 4NPCA 1R5OA 1RM4A 4N5HX 4RULA 4P0QB 2H3EA 2PNFA 3JW8A 3EIHA 1XHFA 4G0NA 2XITA 1SBZA 2P8SA 3AVWA 4OMUA 1XD8A 3K35A 4BB6A 2RJ3A 4DMLA 2BFBB 1M2VB 1UPFA 4IDPA 4QAJA 4E3ZA 2WTXA 3DOUA 4DM3A 4JBHA 4QE3A 3AEKB 1ZMBA 1HI9A 5JZOA 1E8MA 5K0FA 4EW1A 3LOUA 4ESEA 3EAGA 1P19A 3WYEA 4MAFA 1AGYA 1E66A 1BEEA 2QQEA 3NDRA 3RQSA 3UPUA 3H5IA 3PHCA 3V80A 3WRVA 1YI1A 4EG8A 1FRFS 1GL6A 4YJDA 3WRWA 2H85A 3OZIA 4HS4A 2WZQA 3PP8A 1KZGB 1Y8QA 2OGWA 4LVCA 3W5VA 3EQZA 1EQAA 3EVTA 1S2LA 2MINB 3MLEA 4NE9A 4EHAA 3RTBA 2ZP1A 3BCHA 1F4PA 5B2EA 4RTNA 1R10A 1H2ZA 4J4HA 2HZ7A 4NU6A 2PGIA 2GZHA 1E1YA 2QNBA 3CRNA 4KQJA 4OUDB 3V5NA 1O0CA 4KACA 4MTCA 1ID1A 2B34A 1BMFD 2Z8YM 3DT6A 4KLZA 1QF7A 1W4LA 2FAXA 3AU9A 3EA5A 3FMPB 1MD9A 3DMPA 3K4PA 4KPUA 1P9NA 4O3MA 3AVYA 3EASA 4RD0A 1BN6A 1X3LA 3M5DA 2OSBA 2SCUA 3O0DA 4Q9KA 2DFLA 3MINA 3IR7A 4MINA 1TUBA 4FBLA 5FFMA 3IT0A 1XGKA 4KQXA 3OFSA 3FNHA 2EW8A 2QORA 3P0HA 2JFHA 4IJKA 1MQAA 4K8OA 4TV9B 4LC1A 3CLRD 2X0EA 1BWRA 2QUZA 2WYHA 1QBKC 2ZI7A 4DPMA 3U1TA 1U1EA 2PSJA 4L8LA 2XGMA 4ZEOA 2XY4A 1X39A 3SE7A 1NONA 2HJVA 3OETA 2VAXA 4DDTA 2RKOA 1PJLA 2FF7A 2BGIA 3LQYA 1OFHA 1ZMXA 1Q1EA 1UANA 3UNXA 5IRCD 1ZMRA 3AXTA 3E9QA 2VUHB 4KN6A 1HDGO 3NOXA 1SCUB 1VKZA 3DGEC 2G8NA 1PHRA 5JSZA 2X0RA 2PUDA 6LDHA 1Z2OX 2O54A 5HF8A 1JJFA 1B76A 1DMSA 1VFNA 1GQRA 1PJ3A 2RG1A 4JR2A 4RANA 4UPVA 1R0CA 2C2BA 2EW1A 4ARIA 4DIDA 4WQMA 2Z3WA 4FFLA 4O25A 4E1AA 3UJ8A 5C5CA 1R2QA 2FQ1A 4JLDA 2UXDB 2FR1A 4H6XA 1PT7A 2FV8A 1RZ3A 2YV1A 1KXJA 4OGWA 4P5EA 4HB2A 2BMWA 4R71A 2P3QA 2BCGY 5FRDA 1PIWA 1QG6A 1SIUA 1ULBA 2YNMA 3ZE8A 2FPIB 2X9QA 1GG9A 1A8UA 1OZFA 1PL8A 5IUNC 4PCAA 5KSWB 4HBZA 3AESA 1SRRA 2PGOA 3PGA1 4Q3OA 3PXGA 4KOAA 3LJKA 1K89A 3K6SA 5IZCA 2ODTX 7MHTA 1JSXA 4EZBA 1I8TA 1O03A 4G5YA 5CFLA 4NYIQ 3LUJA 2ZSAA 3WA6A 1KIAA 3L41A 4MRVA 5ALEA 1CKEA 4U5QA 1WU7A 4LWQA 3NBMA 3OKAA 3LO5A 3LXRA 1ENPA 4MIOA 3MAAC 4YHHB 1C4KA 1MMFB 5GQSA 4R9VA 4EYSA 2IPXA 2IYUA 3A6ZA 2AA3A 2VTDA 4KNYA 1NXPA 2W2QA 4MI1A 3UFBA 3HVKA 4U2FA 4CF6A 4URXR 5IG2A 4GI5A 4DW8A 4AQYB 1PVVA 3LT5A 2GDZA 4Y2GA 4DNXA 5JADA 3KTAB 4GFDA 3ZIUA 4DV7B 1TFUA 3RW9A 2ZTMA 4OXKA 4C14A 4YEDA 3PXDA 1SKAA 4XDZA 4D0LB 2WIKA 4IXTA 4WLNA 4CTKA 2G09A 1NI4A 4RKEA 4AUNA 1NSTA 2IXAA 1Y6GA 5AUQA 4DSUA 3K1JA 3WMWA 3BM5A 3C24A 3MUFA 3UMRA 5L51A 1EG2A 1XCOA 5T4FA 3VFDA 2WYVA 3A04A 2W8BB 3W9YA 1QANA 2WV7A 3WZMA 4ARUA 3U4QA 3L7JA 3F67A 1TVCA 1CJSA 4X65B 5J59A 2VF7A 1QP4A 3NVDA 3PC4A 1EEXB 4XSGA 2QOEA 3HMKA 2ECFA 4OJMX 5DLDA 5LC1A 1IMOA 2QT0A 5C5IA 3LQRA 8LDHA 1LVHA 3ADBA 1HR0B 3P71T 4XJSA 3WYGA 1YL5A 1RLUA 1OFUX 4ZI2A 5HGJA 1IXYA 1PZNA 3OTOB 3B1YA 4CQMA 3KSAC 2FPRA 1WZCA 1TMKA 4LOIA 4QX6A 4PPFA 1IYZA 2C3PA 1LLDA 3S55A 3EEYA 3P2YA 1JLMA 3I2GA 4OAOA 4F6RA 3I2YX 2ZKIA 1G1AA 4X8MA 3W6NA 3GNQA 2G83A 3ZLTA 1DJLA 2H7XA 1F8FA 4EEZA 4QVKA 7ADHA 4OMFG 4X3PA 3PDCA 3UHJA 1K08A 1Z4PX 3F5DA 2FEXA 1Y8CA 4HAWA 1UXJA 2I7TA 3KQWA 1U63A 3MWDB 4QFDA 2GNPA 3C1UA 4C21A 2OHVA 2P30A 4BBZA 1U8FO 5LR6A 3H17A 2CXQA 4R6WA 4K5QA 4NCNA 4N03A 3AF1A 2Q6TA 2HA2A 3T1NA 1EUYA 3ZV3A 3MB5A 1F2TA 5K6RA 1MC1A 1SCBA 5DIFA 2QM0A 4ZEMA 1OH7A 1YAJA 2WZBA 1PK8A 4MUJA 4EJSC 2QLFA 1M1YA 1P2BA 2PM8A 2P0YA 3ZOKA 2AVDA 4MJLA 2WM9B 4JJ7A 3SR0A 3DAGA 5FP0A 2KI5A 4RL6A 4AURA 3NC0C 4OL0A 1DQZA 5TVKA 4QFBA 5K0CA 3WBJA 2NV6A 5C7IO 3EMVA 4UD2A 2XKKA 3UJ6A 3GJQA 3IT3A 2H52A 3AOGA 1Z15A 4AS1A 5ERGB 3ZEIA 4FUQA 2Y27A 4UJ3A 4X8LA 5CDHA 5JLJA 1U2DC 1H6BA 2QROA 1Z0KA 2ZKLA 5M34A 2P3LA 3IOEA 4MYSA 3PR1A 3CUUA 1K75A 3PSAA 2JFNA 2JBAB 4E1VA 3D7MA 1R6TA 1H4TA 2KM1A 2FJ0A 3HL0A 1TAUA 2QKYA 3O83A 1WF6A 4X95A 2FZLA 2VUUA 2EQBA 2VBCA 3C6MA 3LBHA 3BH7A 4X60A 5KU1A 1PFKA 1G8PA 4FMBB 3RYHB 1Y9EA 3DMTA 1XV5A 3OZUA 5A7GA 1WKBA 3RCBA 4D46A 4EKGA 2K6GA 1E5QA 3EXFA 4HXEB 3GIWA 2Q62A 5BSWA 3UAOA 5JCXA 2IEDA 3X1DA 3LKDA 3CBQA 3V48A 2P6OA 2OBNA 3PFWO 1SC1A 3BWCA 5CA0A 4Z53A 1TEVA 1ZINA 4BQOA 2C4KA 1XNJA 8MHTA 4AP5A 1KA9H 3ZCPA 3ZHSA 2AC4A 1JWBB 3H6HA 4U2EA 3S3TA 3RTDA 1KEZA 2YN4A 4K2AA 2XVYA 2QTVA 5CAEB 1DUIA 4MRPA 3BA1A 3N2IA 4DLKA 1G55A 1GV0A 3L93A 1T6ZA 1H9AA 2PQ0A 3N76A 4PFSA 3P9SA 1V16B 2ZRQA 1L9XA 2ZUCA 3BGDA 3G8BA 4WDRA 1ZUD1 2QXUA 3E4DA 5DTJA 1PJTA 2P1RA 2JKZA 3LBIA 4TMXA 2GTIA 4CUJA 1ISRA 3D2LA 5A5FA 1L7DA 3C6QA 3NRBA 4G0UA 4QREA 4PGMA 3QYAA 4I9HA 2A30A 3OT1A 1YZQA 4BMXA 1MABB 3GVCA 1Q7GA 2JB9A 3AV0B 3MGBA 2C57A 1URPA 3IRUA 2WJIA 4ETWA 3BOSA 4J0HA 2ONYA 2I1WA 3H2HA 1QNFA 4YCJA 4I4LA 3N8HA 4BC1A 3RGGA 3NIBA 3TOVA 1R9NA 4EHLA 2HWKA 4KGZA 3KOMA 1TD1A 4OG2A 2IOYA 1E5DA 4GOLD 5I45A 1QKIA 5JCJD 4CM7A 5CDYA 2W2MA 3LZ6A 1LBHA 4BFUA 1OX4A 4HG2A 4P7FA 1QVAA 4Z8YA 2ST1A 1WUJS 1CZHA 1QH0A 2AZ4A 2NPFA 7GPBA 4EX7A 1N1EA 3K8ZA 3QP9A 5B6PA 5CU7A 2X19A 3K2EA 1LRLA 2EWMA 3W1VA 3HFRA 1SPBS 3DTVA 4KLRA 4ALJA 2I2DA 3DC2A 4HB3A 1V8OA 3HA5A 5DBIA 4TKUA 1WBDA 3R9KA 3R9XB 4JK3A 3OZRA 1CLUA 1R6UA 3GBSA 1M76A 3RBVA 5JNVA 5CTAA 1IHOA 2BF7A 4RIHA 3TPCA 1PNQA 1R18A 4G0YA 1ODSA 3FOZA 2PUFA 1T8YA 2ZRDA 1U4NA 1BGWA 1E3WB 3DBHB 1QOZA 2GDJA 3V2UA 3DR5A 4B3JA 5IU6A 2AOWA 1RXUA 3PQDA 1OU0A 2WJPA 1NUAA 4EUKA 1GAWA 1C7ZA 1X1CA 4Y98A 4J1TA 1F5SA 2NU9A 3Q1KA 2O8EB 3FUXA 3ZWAA 3WNDA 2A3RA 3F1KA 3DOEA 5IARA 5GZ1A 1L4YA 4XIFA 3WLSA 1XYGA 2R86A 4XCVA 4U02A 4LXYA 1Z39A 3QEOA 3B2NA 3U7QB 2CNWD 5HQTA 4Z4QA 2AQIA 2YN0A 3WQHA 1THGA 2VJKA 1WUIS 1RRFA 2YJ5A 4XVRA 4OSOA 2HMVA 1ENOA 2ZATA 4BNDB 1SNYA 3OG9A 3W77A 2C2MA 2G1JA 2O3RA 4OI2A 4DSNA 3N28A 1YMVA 1Z7WA 3CCCA 2RGDA 3DO6A 4RD1A 3GHHA 3H5AA 4YO7A 2IT1A 2Q5EA 2ZB8A 2P91A 3E4CA 3VC7A 1ACJA 2Z8XA 1NBIA 3F7NA 3IPXA 2PGLA 3HB1A 1KS2A 3NP7A 4AN1A 1T9KA 2RFLA 5C3MA 1DCKA 1TZJA 2RI0A 4FDVA 5EGNA 4GX0A 5H16A 4IGAA 1JA9A 4QOIA 2LTAA 4R40A 4TKMA 4DV3B 4KIGA 3KXDA 2FPXA 2DFTA 3HSKA 3T3PB 2F00A 2V7XA 2C58A 4GPEA 4B9EA 1XU9A 1MTZA 1JYEA 2WU1A 2HMUA 4YH1A 5JS8A 5LA6B 3OZFA 4EA8A 4V0KA 2TECE 1SG0A 2JJQA 1EEHA 3LFUA 1UC9A 3NHFA 3Q5DA 4YBRA 2B69A 3JQ6A 5FBHA 4ZCRA 1KZYC 1L4KA 4LY0A 2ZJ1A 1L2TA 3ZGZA 4AZ0A 3IHTA 1ZD1A 2IF2A 2YV4A 3L6DA 3AKZA 1X9IA 2PLAA 4HAXA 1ZHHA 3C3BA 1JFFA 3Q7EA 4HQOA 4HXFB 5IVIA 4PLFA 3OT5A 2VSXA 3CE6A 1OYOA 3H2JA 3IVXA 5DM4A 2XUJA 3GRUA 5CJ2A 1SJ9A 3MRXA 4RPIA 2KJQA 4AXXA 1SUDA 5KYXA 1U0BB 5AM1A 2G36A 2PGXA 3BZWA 1ZVVA 2HXYA 1A04A 3W4KA 2BT4A 4C6TA 1X80A 2H1VA 2GM5A 2Q4OA 4HNGA 4D96A 3CZ9A 2OYSA 1QE5A 1RI3A 1KDVA 4UOZA 1ZNWA 4PG6A 1JHMA 3HP1A 3T0GA 2PKRA 1E2BA 4X41A 5B58T 3W5DA 2NMVA 1MVNA 4AUEA 4FKZA 2XDQA 3W1WA 3QPBA 3TW8B 4TYPA 5CEFA 3R20A 2XW6A 1TAGA 1S8AA 3VPGA 4OKIA 1S8FA 2B1GA 3V4LA 3LUKA 1YR7A 3N5CA 5JZ9A 2FDRA 3TQRA 5CYPA 1OX6A 2XMZA 3BJZA 2RGRA 2E4VA 4HFRA 1HSZA 4OQLA 5I8PA 4NEQA 2OO5C 1P7CA 4UCXA 3LT0A 5BNZA 1QCCA 1QXSA 2F1RA 3IPLA 1Q0PA 2VKQA 4YXWD 3VZSA 2XYRA 1CVIA 4D8VA 2PBZA 3ENZA 2HV9A 1XU7A 2H17A 1X1BA 3A1CA 4QLBA 4IM7A 3NANA 5CUQA 2MJLA 1T8UA 1GFZA 4S1WA 1QCZA 1TE2A 1B8NA 2GHTA 2O2DA 1JR3D 3BXZA 3HY4A 3MB8A 4O4JA 1VG9B 4WFJA 1RCFA 1S1CA 2YQ5A 3ECAA 3GNTA 2G9NA 4DV4B 3LGAA 2ZAGA 2F3PA 1H2RS 1QUFA 3O8BA 3PRKE 1B8OA 3UTCA 4DANA 1WZUA 4YPOA 2YJZA 3DM5A 1AGXA 1LNSA 1NN5A 4GMHA 5BUQA 1YRHA 1GRRA 1QR2A 1EK1A 1ABEA 3UC9A 3EIUA 1KO8A 4FX2A 4FDUA 4L8FA 1JHVA 1JYSA 1ORDA 3EAQA 5LU9A 2O6LA 4ZOCA 4Z8XA 1DKLA 5T41A 2XB2A 4ARZB 3PLAE 5AMXA 3AEYA 3FPFA 5PNTA 2G63A 4QATA 1OE0A 1N5JA 3MJDA 1WAMA 3PCXA 2HBQA 3KDAA 2NIPA 4QDOA 2GFHA 1CLEA 4MO9A 4MPPA 1EX9A 3KHUA 2DWQA 1Y6RA 4YBZA 3SQNA 5KYYB 5HK9A 4J4TA 2R48A 2GPNA 1XL0A 1MGOA 3HBLA 2WTBA 4LVNA 4YJ3B 5EIBD 3U9TA 1OB5A 1SIOA 1VB3A 4HRXA 1XEWY 1IRIA 3RK4A 1R6VA 4M88A 5ER9A 5HRAA 1JMVA 1A8IA 4OKNA 1XFDA 4MR8A 2QXTA 3B51X 3RSLA 1G5QA 2YHAA 1H23A 2ZRLA 2AI3A 5JJ5A 1MJFA 1DZ3A 1NOIA 1GAQA 4HTAA 5DW3A 4CM4B 5K0ZA 2OYRA 2QP3A 4JCOA 4K9DA 2ZUVA 5CA0F 3FKSA 1VRCA 1ZH6A 1X1EA 2V8BA 5E7QA 5HZGA 2GVZC 2X15A 2GWHA 3H6KA 3NYIA 3TF5A 3OY7A 2OFWA 4YCSA 1ECJA 4JEHA 4ZVTA 1IXKA 2CL0X 3TKLA 1AK9A 3GW8A 3U7IA 3W8NA 6Q21A 4S2UA 1BFDA 5AK3A 1F17A 3C3KA 3CZ4A 1ISHA 3T06B 4KR3A 4ZARA 3RB8A 5FTJA 2HZBA 4X44A 5IH3A 1JPUA 3CKKA 1BOFA 1DPGA 4RF2A 1FTYA 4J0KA 1CDZA 4S12A 3R0XA 4NNPA 3RABA 4QECA 2HN9A 5F52A 5BNFA 3DTNA 3K0AA 1ZD8A 4BO6A 2B4KA 3PKJA 4CDMA 4ES6A 3LLSA 5JEDA 5JYCA 2WTUA 1JQKA 2ZAIA 5JSHA 4G3XA 1KNQA 5LQUA 4DIEA 4JSTA 1L4EA 3QBDA 3B1XA 4E0BA 4IFBA 3OMLA 3RYFB 4XD2A 4RMNA 3U7RA 5TMDA 2ON6A 5JY6A 3GVXA 3ZDCA 1LJUA 3U1BA 1MJ5A 5ARCA 1QWSA 1Z2EA 2CD7A 3F6CA 1NQTA 1XZCA 1BG6A 2IGBA 3PV0A 1K8XB 3EARA 2CBGA 1CUZA 1LW6E 1VQ1A 3X1ZA 3MVEA 4GQIA 3J7TA 2IVFA 4TRNA 2AI1A 2XUKA 3W9BA 3K0CA 5KQMA 5E7JA 3KDSE 3M5PA 4QDXA 5ECGC 4CM9A 3FPCA 3A28A 3F4LA 1G8GA 3HS3A 2NU8A 2WNHA 3I34X 3D3JA 4C0WA 4GLOA 2W0MA 1W88B 5J58A 1OZGA 2G80A 2VDOB 3ORFA 3H99A 1GZ7A 1NLUA 2VDKB 4FE7A 1JAIA 3K2BA 4X63A 2O3JA 4GDFA 3FDZB 4ENVA 4ZV7A 3TW4A 3AOEA 1U3VA 1T8SA 1YD7A 2GNAA 4MQEA 2RH4A 3H1PA 4TMKA 3PVSA 5FBRB 2XWBF 4OJNA 5C8YB 1QX4A 5EHNA 1C9MA 1UQTA 4GMGA 4LF5B 2J08A 3N8KA 4HQNA 4IRXA 3HR4A 3FSGA 3K8YA 4EUEA 5JXGA 4RC9A 1JDJA 4Q4DA 3R75A 4G85A 3W34A 2Z6AA 4P1ZA 1VJ5A 2A3NA 4AMBA 4O1MA 3HI4A 4Z7QB 1GVNB 4WADA 1PNOA 1RRKA 3UT5A 2G6BA 2QIOA 2AFHB 3JQFC 5TMEA 2LD4A 3UHAA 1L7EA 3QFFA 1LI7A 3SKYA 3W2TA 4YQEA 4D9FA 4HRVA 3HU1A 3KZ1E 2CXHA 3MCTA 3PWZA 4HZGA 4P7KA 4R3NA 2I1QA 1ZEJA 2Z1MA 4D45A 5DYTA 1JR3E 4RPHA 2OK7A 2PXXA 1EDOA 2BPOA 3AINA 3OM9A 5JJIA 1ADFA 2BIFA 1VCIA 2VP5A 1I1OA 2AOXA 1D6JA 3T9EA 1GA1A 2W98A 4HD8A 2C88A 2J3MA 4HMQA 4QXMA 3ANMA 1U6KA 3RUPA 5DT2A 1BE6A 1ZD5A 1TF2A 2UYCA 1PZGA 2YNMD 4BVFA 3DEHA 3NM4A 3WP1B 1Q7CA 3VKFA 2FLVA 3KT6A 3RR2A 4P9NA 2FEOA 1TM3E 4X85A 3BGWA 1YFJA 5EJGA 1WZNA 3FFXA 3IELA 3PQ8A 3UHPA 2EFHB 2IVZA 4QPJC 3ZBUA 2DQSA 1J39A 1ZI8A 3GFSA 4OJYA 1F4VA 2ATVA 2ZJ4A 2O59A 4EIWA 2Y1CA 3PI7A 2GT1A 2CMGA 1TC2A 2WIDA 3PENA 3L6UA 1IY8A 3D3KA 5DNYB 1EWYA 2HQBA 3WL5A 3ZJTA 1J7JA 2JCGA 1M10A 4JJAA 4L95C 2Q2VA 1Y42X 4F2PA 3Q7PA 1ODFA 3NNDA 1W59A 4BV2A 3M7IA 3GCWA 2ZIFA 1T2NA 2FFRA 3R2JA 1P4SA 4JKOA 2QGFA 2FX2A 4D9CA 4MV7A 2F6RA 3F5SA 3OUZA 5DYYA 2D3TA 2UVPA 3FCCA 2X7JA 4N6NA 4YK7A 2WB2A 2BKLA 3K32A 2X7XA 1LC0A 2PU7A 2BEUB 1U6JA 1EUCA 2XNDA 3NLLA 5H9WA 1MHTA 4DG5A 1JQEA 2BFFA 2ZK7A 3N2NA 4I8XA 4KAJA 4HAZA 2E21A 4GGOA 1R0XA 1CQJA 1L4NA 3JYPA 4D9NA 4BO5A 2ZPAA 2X86A 5BWNA 1AOXA 5H68A 1DEAA 1Y1QA 2QEQA 3EFBA 3D4BA 4GXNA 4UCQA 3T9DA 1NF9A 2AMVA 4A8TA 5C46F 3PTZA 1UBOS 2Q1WA 2OHGA 3FLMA 3G79A 2F3SA 4PO3X 4BVEA 4ZD6A 1TLTA 1V1JA 1HDZA 5LP6B 1KTIA 1NVDA 1TW2A 4YJFA 2O2ZA 1D3AA 4WZAA 4ZVQA 5AJYA 3KOOA 3IODA 4O4JF 1BWSA 2LPMA 1CF2O 1T3LA 1T2UA 2WC1A 1UPAA 1C0EA 4JJGA 2PH5A 5ILGA 2NTVA 1L3BA 2IYXA 2IHBA 3ETGA 3ONEA 1Z5ZA 1X7WB 4KXMA 2OXIA 1Y6FA 2HA0A 1T15A 3I05A 4YT2A 2XRZA 1O5TA 3DEZA 1QS0B 1ORIA 2FQXA 5AKJA 3NEJA 1N32B 1AC5A 5DBFA 5TX7A 3TFWA 2CLIB 2PNJA 4AUKA 4AZ3A 3FF4A 1TFRA 1ZOLA 4ND7A 4X1YB 3RQIA 1YGPA 3EVZA 3NZEA 3FTFA 3CFYA 1P5JA 5KJFA 4KMRA 5D1NA 2QL9A 5DHAA 1VKNA 4M21A 1TJ3A 3O8OB 1CZNA 1YU9A 4IILA 5B37A 1LPNA 1NLZA 4JJKA 3PQ3A 4UVIA 5AHRA 1DHRA 3R6TA 2H1OA 2X4IA 2ZDHA 1XCGB 1M34B 2V6BA 4RVHA 3K9LA 3GFFA 4YMWA 4DT1A 3ZY3A 5F23A 4HUQB 1NOKA 5F2EA 2IH5A 4F3KA 4WOCA 2AJDA 4M8IA 1C30B 2EKZA 1ZS9A 5AI9A 4ZVSA 1O94A 1OJ7A 2YVUA 2G1AA 2J45A 5FQOA 1ZD3A 4KHZA 1E1RD 1IXRC 2A5GA 4L4XA 4RXMA 5KNDA 2Q4TA 4Q4CA 1ML4A 3QYFA 2ZT6A 1CR1A 1YI0A 3CH5A 2CB9A 4I4CA 1O89A 3LWDA 1J49A 3C8MA 1A27A 4ZPXA 4XRGA 1DNPA 2ZRJA 2VKTA 2WNSA 4YREA 2GO7A 1WSBA 1E6EA 2HNKA 4M0EA 2C59A 3KJZA 4QNNA 1PW5A 5EMMA 3SHVA 5KS2A 3VVCA 1R4ZA 3NBXX 1ZW1A 3K2IA 4LQLA 4CTOA 2OENG 2ZTLA 4JBNA 1LS1A 4V0LA 4Z9YA 1P72A 3QXJA 4MJ7A 3GROA 4UU7A 4RYDA 5EJ5A 3MHPA 3PE3A 2ZXUA 3PE6A 4PEVA 2DWPA 3B38A 1Z0JA 2GH1A 3GO4A 1OW3B 1UP7A 4OBBA 3O9MA 3ZE7A 2WU0A 3T7IA 1P8JA 2CYCA 2PL5A 3B7GA 5CA1A 5KTYA 4K9MA 1IHUA 1NC3A 1XCPA 3REOA 2GTHA 1SH7A 1SVOA 2B3DA 1SCKA 4I50B 3ZIAD 3ZHRA 4UU0A 1TJNA 4U9IS 1XKXA 2R8RA 4Q82A 3A9WA 3KKMA 1M2EA 3KS9A 4IIUA 4AWXA 4PS1A 4AMUA 1KRWA 3O82A 3IVMA 3SEAA 4C2UA 2Y99A 1I0LA 2DQZA 1V4VA 5EP4A 4EJFA 1W5BA 3ZPXA 5JQWA 3FZNA 5AK6A 1YQUA 2WB4A 4F38A 1PFWA 1UEXC 3C87A 4D43A 1PLKA 4IMJB 3FZYA 3I72A 4L6IA 2YWHA 1QC5A 1DIAA 3AH8A 3JZDA 4LX0A 1G60A 1A7JA 1A8QA 5AM2A 3GFPA 4MR9B 2CSXA 1IM2A 2NX2A 2IIPA 2Y66A 3LQQA 4CG3A 5CFQA 4GM4A 1LZLA 5M29A 3OCVA 2R6CA 3UUWA 2HX1A 3PDWA 4KYTA 3HCBA 4HGRA 2EOAA 1AKVA 4R5MA 5LLSA 1OLSA 2FW1A 2D1YA 2QYOA 4WY2A 5FAXA 4ENSA 1L4UA 4KX3A 4M9QA 1WCIB 1ZESA 2IW3A 1I7NA 1UBKS 3KHSA 1GLVA 3L0ZA 3O91A 4DHWA 3A6PC 1NJ6A 3KQLA 1U8TA 1QNLA 1HKUA 4PCLA 1N7IA 3GRRA 2IUFA 3UJAA 5JDCA 2IS2A 4JEMA 4M49A 5FL7A 1GARA 1UPUA 4RTLA 3EY4A 4FYYA 4O2BA 4WUTA 3LP6A 3KV3O 4F4DA 3HXMA 2VOEA 4RGBA 1XPRA 5KYKA 1X14A 4BFTA 2X40A 4DYHA 3ZJYA 3RREA 1DKUA 2F1IA 2D1QA 3IPRA 5KKNB 2NUAB 3AEUA 3WNZA 1HNZB 4C1BA 4RCZA 7AT1A 2JIMA 3ZVRA 4EG7A 2HCRA 5JQGB 2OORC 3SR4A 2XYGA 1AKRA 2H18A 2QTBA 2R6ZA 1JI3A 3F9IA 3KD3A 1CC1S 2NO0A 2QJTA 1C4XA 3FHJA 2GXQA 5AVUA 4AW9A 1ZHOA 2GFIA 4J16A 1RNLA 1NBMA 1WXWA 3IXLA 2AQHA 2HF8A 3QNWA 4HDMA 3VNBA 3HGMA 1J8YF 3FPAA 2IKQA 4N0QA 4GPIB 4RJ2A 2A6PA 3PBKA 3IQHX 1LS6A 1BHO1 4KODA 1BXRA 3QLTA 4NPHA 3S29A 3W0LB 5A2QA 3DBVO 5AKLA 3TIIA 2QTZA 1VCMA 3BXOA 4MJXA 4LE2A 4N39A 3CNBA 4WUVA 3ZYZA 4DWWA 2A9OA 2XKAA 4P4SA 2H08A 3A9UA 4MOWA 3RS9A 4JHLA 3OEED 3INRA 3CEMA 1GPYA 4PQRA 1JSLA 2J6IA 2ABWA 2B78A 4LI3X 2GZ3A 1ULUA 1T4BA 4FIZA 4RWEA 4LF7B 4MYRA 5K01A 1QRAA 1C8VB 3LYHA 4XQ9A 3C48A 1JEEA 3L7LA 1CY4A 1F6WA 1FDSA 2EX0A 3OFNA 3GN1A 3UGQA 4MVJM 4BXOB 1VHQA 3FCOA 4QUBA 2IHTA 3J7AC 2C98A 3ND6A 4BQPA 4YMGA 3ACBA 4MUYA 3KB6A 1QK5A 5LXTA 2VDPB 1Y8QB 5E4JA 2AZMA 4Z49A 3MYRA 3RVKA 4EQ6B 2KBFA 3F6YA 3BK1A 2XGOA 5K45A 5KVAA 2JATA 3RAGA 4AKIA 1YWGO 3WB9A 2HJRA 4W9NC 5BPFA 1GHTA 1KK1A 4DCCA 4H1VA 1A7UA 2D00A 3QY0A 3JQ9C 1Z73A 1WV1A 2D5CA 1OWPA 1WXGA 2LWIA 4TQAA 4Y9SA 5FOTA 4KPUB 4BPRA 5HTOA 2UXBB 2R6R1 2SCUB 2ADMA 5IVDA 2PD6A 3MINB 4IH9A 4M37A 1TUBB 5JS1A 1DC7A 4H1TA 3W5BA 4IHJA 4PW0A 1W76A 1X7ZA 3DFFA 4L57A 3UAXA 3ZEAA 1QPBA 2BL4A 1HEIA 2CBXA 3I52A 4BLPA 4BVLA 2BBWA 2VH5R 3LNCA 4HRAA 2YWFA 3NM6B 5IVKA 5EMKA 3VJMA 4CN8A 1J1UA 5KDOA 4NJEB 4UU8A 4L0CA 4M38A 4B6QA 3TLZA 4HH3C 5DTEA 5CFMA 1DX9A 1DWPA 3F8WA 1EVIA 3AVXA 2DSNA 3CF0A 3GELA 1B8VA 4JQYA 4DUYB 3RRFA 4CT4B 2GPYA 3VZRA 2HCJB 3JQ7A 4GPTA 4HGNA 4B3CA 5A3RA 1FU8A 4H7IA 5JSZB 1QHGA 3AIIA 1J8MF 1IQRA 3DMFA 4IDDA 4XD7D 3W9UA 1SAYA 1YUMA 2NM0A 1Q21A 1EQUA 1RM5A 1VJDA 3H6GA 4HQRA 2RIRA 4K7JA 1XEFA 3UATA 5BQ3A 2RGEA 2IBTA 4KEAA 1OYVA 3TZ6A 2QP4A 1RHRA 2GAFA 4PZAA 3F46A 4RY2A 2GBIA 1ZW6A 4GRAA 4BNJA 3HLYA 4LF6B 5FWNA 2ZBFA 3DO8A 3ZKAA 5DF1A 1C9EA 1CB0A 1OJLA 2JNWA 3A36A 3BPSA 2VF2A 1K8RA 1IJFA 2EZ4A 2ZIAA 4PG4A 4BJHB 2CVFA 3O4FA 4XDHA 2GN2A 2DOKA 3A31A 4BO1A 1B7GO 3U09A 2OWEA 5BUZA 1ZNXA 1PK7A 3KKQA 1NGSA 3GEIA 4LF8B 4WZBE 2GSDA 4V0SA 3RU2A 4QG3A 1GDDA 4XFDA 3T34A 2Z8YA 3KKEA 4AUMA 4WK6A 3OE1A 1JYFA 2PR2A 3A9SA 3KLOA 3O26A 4QPPA 5P8WA 4L28A 3WYNA 5AW1A 4TZ6A 2JGFA 3ASYA 1VBMA 1XDDA 3LX5A 4URUR 3QGMA 4Y7CA 2EG5A 1PX0A 3WADA 1TA9A 3AHIA 3QF7A 4ZCSA 4D6PA 4B8ZA 1XL1A 1RZUA 1ZU5A 3G2KA 3MGAA 2FSIA 3NHAA 1WVIA 1P73A 2D1FA 1J0BA 4LDJA 4Y9RA 3F9CA 3ZZMA 1RQ2A 1ITZA 1T1RA 1A5BB 3RADC 3X43A 3NBAA 1NVFA 2IF0A 3V7YA 5K0JA 2IEZA 4M1KA 3VOAA 3TKAA 4BLTA 4H60A 4E5MA 1V48A 1YR8A 3WSVA 4C4XA 3U4QB 3ZN2A 4UMEA 5CA1F 4MWBA 4RHFA 2FRDC 2R1TA 2X23A 4LWOA 1QQBA 1RZRA 2VF5X 1E0KA 3IIMA 2B20A 3EDYA 3ORRA 3U60B 5U9CA 2IW1A 5ITSA 1GAEO 1YS6A 2P2SA 2HJ9A 1YIDA 1MA3A 3Q7RA 2OLJA 5HOQA 2EDCA 3VKGA 1BU8A 5CT9A 4F3RA 3EC1A 4FONA 4NCKA 4B80A 5KWJA 1FMCA 2HCTA 4CQMB 3EH2A 3CU5A 1DUVG 2J3KA 2C2ZA 3K6KA 5EIWA 3HWWA 3LRPA 3R9IA 1V7ZA 4UEJA 4DZRA 1O96A 2BI7A 4DFDA 3AK4A 2O2EA 2KLHA 2PHZA 1E9VA 2AD1A 4NFHA 5B57C 2CDCA 4QUHA 1J22A 2J6HA 1V8FA 1D0IA 1W48A 4TLBA 3T15A 3A3OA 2X0DA 3OLQA 3TTXA 1VJ1A 4X71A 4ARZA 3DE3X 5DEOA 3EMKA 4EP1A 1I4WA 2I54A 3L05A 2JZNA 4NMLA 4US1R 2IJGX 4GC5A 1VGQA 2MIIA 3F4KA 3PXBA 2ZIEA 4RCYA 2W8ZA 2ECOA 4W9RA 3GAAA 4DMHA 5AHXA 1DPFA 3E5RA 3GDGA 2VQ3A 1F2TB 3BFKA 1TZCA 3JV7A 4K0RA 4CM9D 4TT3D 1XB2A 3S5JA 3E0QA 1VG8A 2XPCA 3LYAA 5IBQA 4E88A 3ZK9A 2TMYA 5HP4A 1XMPA 5DTIA 3EEOA 2C7VA 4O2BF 4F6CA 1EUZA 4ZJYA 1JAZA 2PZJA 2BGUA 4EL0A 4LDAA 5ALIA 2OO7A 4CFYA 4AICA 3FPSA 4HX2A 3RK1A 3JD2A 3OPYA 4C0QC 1QF9A 3IPYA 4KSBA 4YRRA 3SS9X 3NX4A 3V1LA 4AKHA 4MUKA 1TQ6A 2AYYA 4FHCA 2BSXA 1A7KA 3GD7A 4JBXA 4BLVA 5K3SA 3M8KA 4ML3A 4DHEA 5JAZA 1R3UA 1EX6A 1FLAA 2XI4A 3L7DA 3P52A 5KSYA 1X7GA 2Q0QA 4PYLA 5B1EA 5E4FA 5HCUA 3WICA 1CUAA 1F3OA 1A5AB 4YRMA 5L6LB 1CR4A 4MKFA 3L1UA 4YV2A 2QN7A 4OH1A 4QL3A 4CT0A 4IS2A 1R1DA 2IHYA 5I01A 3DBLA 4QDTA 2CMHA 2R8YA 3C1OA 2V0NA 1YK1A 2O0MA 2VRCA 5M04A 3LC1O 4J6FA 2WRZA 1VA4A 2AOTB 4W8GA 4LQCA 2EKLA 4KQKA 4AZWA 1PSZA 3EXFB 3NONA 3BORA 1TQDA 3M5WA 3PX3A 2QMOA 4ECAA 4GI3A 5EN4A 2H1LA 3OPXA 4DYVA 4MA4A 3DCYA 3FHOA 2R4QA 3MWJA 5LKRA 2JH3A 2ZJZA 1ZEMA 1U90A 2Y6VA 1IJEA 1LF0A 1A4IA 2R1VA 3SSNA 2FMHA 1NQ5A 3LKBA 1AHNA 1TCCA 4MVJE 2GWRA 3NKFA 3MZ0A 1FMLA 3OSZA 2V97A 4G9BA 2D7JA 1ZRSA 2FWRA 2QTVB 4K6OA 5IKMA 3ESQA 1S2GA 1SIWA 3WGJA 1ABBA 1JUDA 4QJ3A 1I3LA 3GRKA 3BE8A 2IX9A 3IIKA 5DBOA 1N92A 3H9EO 2WVAA 3RE1A 4UJ5A 2X42A 3WI7A 4OQFA 4DIOA 4RJLA 1YASA 1FTQA 2JIZD 1G3QA 1O4WA 1COWA 4YRAA 3TXYA 2PUEA 3K9QO 1IHDA 3FTPA 1NJ8A 3E9EA 4GGMX 5KVVA 4N3NA 3L07A 3OT1B 2YIMA 3N53A 4HJXA 1Q1ZA 4AF7A 4JELA 2XMRA 1Q7RA 3BX1A 3WKDA 5K8LA 3OC0A 4BNTA 2R3SA 1KJZA 1LSUA 4JN6B 5E38A 5TSDA 5DCWA 4YUAA 1SB8A 4KAAA 5DM70 2P78A 4HDOB 2C8KA 3FNIA 3P4XA 3JQ8B 1DQYA 3DMNA 4X0EA 1FUUA 3BHIA 4O4LA 2X5KO 3MEQA 2HRCA 1GILA 4IHJF 5CM9C 2OQIA 2BLLA 2AZXA 2ODBA 4F8EA 1OX4B 5K9ZA 2CFTA 5B4VA 1N3LA 3OWOA 3L4KA 5DGIA 3K0HA 2WMNB 2ZR9A 2I34A 1CIPA 2YW2A 4GEGA 4Y2UA 4ERXA 3ABSB 3CC8A 4HV4A 2CEAA 1TDJA 3DTVB 2IZZA 3PA8A 1Q2XA 3FB1A 4KR2A 4TKUB 3TL2A 5C3UA 2HHCA 1II9A 1LBQA 2JHAA 3V1UA 4AF6A 1V3VA 1J20A 1M33A 1VKJA 2V5VA 3AR6A 3A05A 4FNGA 4MW5A 4W8HA 1NMSA 4XDGA 4EO9A 2B94A 2IL1A 1BVYF 4TXJA 2A4KA 2AN4A 4F7DA 4NAUA 4NABA 3PQFA 4AKGA 3HI6A 2NWQA 3N3AC 3ZQ6A 3F73A 1KNXA 2YWRA 2QTFA 2VXBA 3DC7A 1YNSA 4LZLA 4NBTA 2XT6A 4CL2A 3DVRX 1Y4ZA 4BNWA 1JKJB 1RQLA 4IHAA 1QHFA 2Q3JA 4MPDA 4U7FA 4YRZA 1V6AA 1C14A 3OM1A 4PNHA 1JHDA 4K28A 3BWEA 3V8QA 2LNDA 3LYUA 2J5KA 2DKNA 4XR4A 4ZYVA 2H4JA 3CG4A 2REOA 3UJDA 2BFDA 1N1DA 1OROA 3RYIA 2JGLA 3O3MB 3NHLA 1RWKA 3TZLA 4QOGA 5H3LA 4GQAA 2ZUTA 3VSDA 1PS9A 2BAGA 3M6MD 1MG0A 4U6SA 4IOLA 2JHGA 3BIXA 2F8MA 3EDQA 4RSHA 4TKLA 4IUYA 3BMOB 2AZDA 2FYTA 1FP4B 3ZI4A 3RT7A 3GZTB 5JECA 3P9QA 4WGGA 1MPXA 1XF1A 3NAZA 3K1ZA 3WYFA 1G0OA 3LTEA 4YQYA 2CLCX 5J5CA 5HIAA 1A76A 1GQFA 3CW2A 2XBMA 3F7OA 3SQXA 5D87A 4D4JA 3A32A 4HC4A 2RHDA 4XEUA 4D2IA 2VHXA 1OH5A 2IYZA 5B6JA 5GWXA 1WDLA 3QJ5A 2P5UA 2OE2A 2HK6A 4YWJA 3RWMB 1OTYA 4AZ0B 1O94D 1DQPA 4Q7EA 5A9TA 5J3JA 4OU4A 4EVQA 1FDTA 2JFWA 3DO5A 4NS4A 3TLEA 5KNDD 1Z3IX 2XQFA 3JD0A 4LGMA 1GUBA 2QJWA 1S3SA 1RVDA 3ZDQA 1CUCA 2OAP1 4FN5A 3Q3JB 4C6TB 2BMJA 2FR0A 2RBGA 3BXPA 1JEAA 3KHKA 3M34A 4WCFC 2ZUDA 4XW2A 4Y6OA 2AFIA 3WWYA 4F46A 4OA5A 5TVGA 4OM7A 5EQDA 4ZCTA 1S2IA 4URWR 2I2WA 4ISBA 3TSOA 1BFKA 1SBTA 2VDRB 4E6PA 1ZQ1A 2OK8A 1LDEA 2V4UA 3EJWA 3FSEA 2HNBA 1GPBA 2BY4A 3HP7A 2WHEA 3O8CA 3G13A 3MS2A 2GPSA 4OQQA 4GBJA 2BWJA 3SHOA 5HZMA 2V74B 2X5XA 4MNTA 4Q7KA 3D6MA 3WDSA 5K0SA 4P08A 1IZ7A 2HA6A 1GTG1 2XB9A 2VEOA