4RTNA

Complex of escherichia coli dna adenine methyltransferase (dam) with adohcy and with dna containing proximal pap regulon sequence
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
249
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSKKVDELLALYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 81
structure length 249
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtnA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtnA01
3FYCA 1RI4A 3HA7A 3THRA 1WG8A 5GP1A 1L1EA 2BR5A 4DCMA 3P97A 3SM3A 3PB3A 1VBFA 2C7RA 2FYTA 3KR1A 5CVVA 4AX8A 4RTPA 5E1DA 3P2EA 10MHA 3LECA 1BHJA 2YXLA 2ZTHA 3X0DA 2O0LA 3B5IA 4DKJA 3I58A 2O06A 7MHTA 3IEIA 2PWPA 3EVDA 1VL5A 2PX5A 2DPMA 4BLUA 4RVHA 5GIPE 1B42A 3BGIA 4X41A 4CWAA 2IH5A 2I7CA 3PLAE 4GOLD 4MTLA 4EKIA 3P8ZA 1G60A 3GJYA 4F85A 4XUEA 2GLUA 2JHCA 2G70A 3I53A 2P3QA 1X1AA 5DX8A 2ONYA 2UYCA 3PFHA 5P8WA 5KQRA 3MTIA 1FPQA 4PYIA 3KKZA 3EGVA 3C3PA 3GO4A 2GAFA 1ZHFA 2P40A 3E05A 4IWNA 1JG4A 1KR5A 5K0BA 4C07A 2CWWA 3OCJA 3Q7EA 2HV9A 2O07A 5E8JA 3DUWA 1FP1D 3B3GA 3EVAA 3C6KA 5EHGA 4F84A 4FT4A 3ANXA 4EQZA 2IIPA 1P1CA 1SKMA 1G8AA 1JQDA 4FT2A 2K4MA 4P7FA 1RJFA 4RTJA 4ATNA 2C7PA 1D2GA 4R8RA 2UYQA 8MHTA 1L3BA 3P9CA 1R6AA 1IY9A 2I9KA 5BW4A 3LPMA 5E9WA 1AQIA 4X61A 2NP6A 1NBIA 2QM3A 3TR6A 5K0JA 3BZBA 3B7PA 3UJ8A 2IBSA 2XYQA 4HGZA 2JH9A 4EK9A 1SUIA 5CVJA 3P2KA 3AJDA 5HIIA 2Z6QA 4GOMD 5LQNA 3LL7A 5KYGA 2YXEA 1YB2A 1XCLA 2XYVA 3R0QA 4WXHA 3G2OA 1OR8A 4QVKA 5E8RA 2I6GA 3TMAA 2AOXA 2XVMA 3CCFA 3RW9A 3HA5A 3DMGA 4KW7A 2JG3A 1G8SA 2AVNA 4ER6A 5GM1A 2ZZNA 5C0OE 4C04A 1KIAA 3SVZA 1XJ5A 3ID6C 2BM9A 3LDFA 2ZFUA 1RI5A 1NW6A 4PYLA 3KPYA 3UA3A 3GWZA 1RJEA 1SQGA 3BXOA 3NWBA 4HGYA 4AZTA 3ELDA 3K6RA 3DXXA 2C7OA 3PFGA 3TKYA 1KHHA 2ESRA 4OBXA 2JHPA 3R6TA 2PY6A 4R6WA 4R6XA 5GWXA 5FQOA 5ERGB 1XCJA 1NV8A 5HILA 2B78A 1G55A 4OBWA 5MHTA 4GEKA 5B1SA 4PWYA 3V97A 5CD1A 2C7QA 4XUDA 4RSRA 1BKYA 3MB5A 3NMUF 4Y30A 3GRZA 3CGGA 2AOUB 3OZSA 3P9KA 4O29A 5JR3A 1VE3A 4AZVA 3CJRA 1YUBA 2B9EA 3DP7A 4RTLA 3P2IA 3QOXA 4QVGA 1KP9A 2AVDA 5EGSA 2ZIEA 3SMQA 3UJBA 2ZULA 2JHAA 3T0IA 3K0BA 5EMKA 5K0GA 2GB4A 2H1RA 2Y1XA 3JWGA 3FTDA 1R74A 1YF3A 1JQ3A 1Y8CA 2YTZA 5FULA 4KVZA 3THSA 2R6ZA 2ZSUA 3E23A 2AZTA 4AZSA 4RTQA 1N7IA 2BZGA 1I9GA 4DF3A 1VLMA 3EVGA 4EKGA 5CM2Z 1EQAA 1N7JA 3EMBA 5HIMA 1BOOA 4CKEA 2B25A 3T7SA 1NW5A 2IH2A 5CUQA 3VSEA 3BKWA 5LQJA 2ERCA 5DTRA 5DM2A 3S68A 4BP1A 4UOEA 3KQOA 4RTRA 5K0EA 2V74B 5DM4A 4PYOA 2OB1A 3KPUA 5E9JA 1U2ZA 3B3JA 2P35A 1QAOA 4HC4A 5FQNA 1EJ0A 4RVGA 3UJ6A 2CL5A 1NBHA 5T6BA 5LQKA 5C1IA 3HA3A 4E2YA 4C08A 3HP7A 2NYUA 5DX0A 2N47A 3GCZA 3HEMA 2PXXA 2P8JA 3A25A 3PX3A 1I4WA 1MJFA 2NXEA 3A7EA 3BWMA 4CKBA 5BXYA 5M5BA 5C9ZA 4RWZA 3GU3A 1AV6A 3HM2A 1KPHA 1O54A 5ICCA 2FK7A 3KR2A 3R24A 3GXOA 4IV8A 3PVCA 4DZRA 2P41A 4LECA 4E31A 4PYQA 3O4FA 5EQJB 2FCAA 1M6YA 4ZTBA 5KQSA 3QOWA 4ER5A 3BT7A 3TQSA 4MQ4A 4LWOA 5DT2A 3MAGA 4X60A 4E2XA 3GDHA 2IBTA 4M36A 5DSTA 2AOVA 3NVMB 1FP2A 1VPTA 2OB2A 2IP2A 1O9GA 5EIFA 2O05A 2VS1A 2IFTA 1VQ1A 3OPNA 3KR9A 2O57A 2PVCA 4HTFA 1YFLA 1WY7A 4C4AA 5F2NA 2B3TA 5EMMA 3M70A 1EG2A 2GH1A 2GPYA 3M6UA 4E32A 1MHTA 1Q0TA 2PT9A 1R18A 3C0KA 4FR0A 1TPYA 1X19A 4CKCA 2HTEA 1XVAA 4YV2A 3HCCA 1F3LA 3LCVB 3FTCA 1M6EX 2WA2A 2AOTA 5D1HA 1G38A 4BLVA 4C06A 4YMHA 3PT9A 3RIEA 4KRGA 3DTNA 1P91A 3M4XA 3QV2A 1JTEA 5D1NA 4U7PB 2Z6AA 5EG5A 3P9IA 2QYOA 3ME5A 5EKUA 3C6MA 4XUCA 3TFWA 3EVCA 2EG5A 3REOA 4HRAA 2PSSA 1VP9A 3BKXA 4RX1A 5KS2A 5ICGA 2NXNA 5LQUA 1YZHA 2EJUA 2PV0A 3DXZA 3G88A 3IHTA 3UA4A 4DM3A 5EKXA 1JG2A 4FZVA 5LR6A 1D2CA 5EHIA 5FHQA 1BC5A 1ZKDA 5CCBA 3KU1A 4RVFA 4RTOA 3UJ9A 3FTFA 3CVOA 2JJQA 1EJ6A 3EVEA 1XDZA 1NW7A 1QAQA 3TM5A 3UFBA 3FPEA 1R00A 2P3OA 1NT2A 2VDVE 3KQVA 5E1BA 3G2MA 2B2CA 2ONZA 2OY0A 2XYRA 1H1DA 2H00A 4PONA 3M6WA 4QPPA 3LGAA 2FPOA 3M6VA 5HIJA 5FUBA 4POOA 4GC9A 2G8NA 4FP9A 5HEKA 5F2OA 2NP7A 2EFJA 3I64A 1I1NA 2CMHA 3B89A 3FYDA 1JSZA 2YX1A 3FUXA 4E33A 1KYZA 3HVKA 4KDCA 1AQJA 3GRRA 4PYMA 5EC8A 2OKCA 2Q41A 5H02A 5K09A 2ADMA 4PIPA 1PRYA 1WS6A 3GGDA 3MCZA 3ER8A 3O31A 4GOOD 1X1BA 2YXDA 2IH4A 5LSAA 3UWPA 2GS9A 2ZBQA 3OE5A 1NKVA 3HVHA 3BWCA 1X1CA 5E9QA 1JG3A 2P3LA 3E7PA 3NDIA 3O7WA 5EZQA 1KPIA 3NWEA 4DA4A 4YUZA 3I5UA 2IPXA 2VZ9A 3OFJA 4A6DA 2NXJA 3I9FA 4RTKA 3V8VA 3ERCA 2OZVA 3G5TA 3BUSA 3TM4A 3FZGA 3OZRA 2IDJA 5CVUA 5E1OA 2P1DA 5T67A 1QANA 5DRTA 2PXCA 3AWIA 5DM0A 4YV1A 4A6EA 3U81A 2CMGA 2Y1WA 1WZNA 1INLA 3DLCA 2V7EA 4G56A 4LG1A 1R8XA 3EGIA 4K6MA 1UIRA 5DSXA 1TW2A 3DH0A 4E2WA 2P7HA 4FSDA 3NW9A 5HFJA 4DCGA 1JTFA 4Z2YA 2ORED 2UZ4A 4YUYA 1XDUA 3UJ7A 2PWYA 2PT6A 4RVDA 3JWJA 2YUIA 3TOSA 3D2LA 5LQAA 4X1OA 2R3SA 1X1DA 3BWYA 1T43A 3GRUA 3DULA 2PX2A 5KVAA 3KPJA 2FHPA 4OA5A 4CTKA 4YUXA 2ZCJA 2JH8A 2QRVB 1RI1A 1P39A 1AF7A 4NECA 4RTMA 2PX4A 4YUWA 4GOND 1XXLA 3DOUA 4MWZA 3KQTA 5EPEA 3VC1A 4KIGA 4M37A 1NW3A 4OQDA 4RTNA 5K0NA 5FWAA 3LBFA 1XTPA 3C3YA 3EVFA 4EMSA 2BR4A 5IH3A 5E2BA 1DCTA 2EX4A 3FRIA 3LDUA 3FPGA 3PX2A 3FTEA 4M38A 1VP3A 3FUTA 2F8LA 3DLIA 3CJTA 2VDWA 4P7JA 3G5LA 3HCDA 5EMJA 2OO3A 2ZZMA 5EEHA 2AR0A 5K01A 4YV0A 2ZW9A 3GRYA 1VIDA 3LBYA 4PCLA 5FADA 4FGZA 5EZSA 2AN4A 2PKWA 5E2AA 2XVAA 1JQEA 2VDUE 2AS0A 2YVLA 3EMDA 3EVBA 2PJDA 3NDJA 4AUKA 4PYNA 4HH4A 4V0QA 2ZWAA 5ICFA 3FUWA 1L9KA 1QZZA 3R3HA 1Z3CA 3M33A 3UZUA 5JUWA 3CBGA 1EAMA 3E8SA 3EEOA 4ER0A 3CC8A 1RI3A 2G72A 3L8DA 3MCTA 4LWPA 4RYLA 3FUVA 5DWQA 5GINE 2H11A 1L3CA 2HNKA 2LD4A 2UYOA 1ZGJA 3OU7A 4PYKA 2UYHA 9MHTA 2QY6A 3EEYA 2PLWA 2OPBA 5EIWA 4R05A 3SR4A 4E2ZA 2PBFA 3R9XB 1SVUA 4OX9Y 1KYWA 2IGTA 3OFKA 1SQFA 4QDKA 4HG2A 5CVEA 3SSMA 4EVIA 3LCCA 4M7RA 2HR1A 3T7TA 4E30A 1YFJA 1XDSA 5U4XA 3LCUA 2I62A 4P7KA 5HZMA 3A27A 3FRHA 1NW8A 4QDJA 3DXYA 1ORIA 4IKPA 5HOQA 2G1PA 5DTQA 3FPFA 4RTSA 3IV6A 4U7TB 3SX0A 3BGVA 3NJRA 4P58A 1G6Q1 5EVJA 4DQ0A 5DPMA 1NE2A 3HCEA 3CJQA 1WXXA 4B17A 4FSXA 2DULA 5K03A 3MHTA 2AOUA 5CVDA 4ER7A 1WXWA 3HCAA 3LDGA 4AZWA 1SG9A 3IYLW 3PTAA 2NNWB 3KQWA 5FHRA 5EMLA 4PGGA 3RODA 3AXSA 1N2XA 3GRVA 2WK1A 5DTMA 5DXJA 5K0LA 1EIZA 3NVKI 3A4TA 3KPWA 3CKKA 4GC5A 4XCXA 1SUSA 3DMFA 1RJGA 2QE6A 4F86A 5K8VA 5GIOE 3P9NA 2EJTA 3B3FA 3PS9A 4KIFA 4QQKA 3SSNA 4PNEA 3WSTA 1ZG3A 3OU6A 1QYRA 3H2BA 5FWDA 5DXAA 4PCAA 3UJDA 3G2QA 1IM8A 3T7RA 5K05A 5ICEA 5K0FA 5K0CA 3EVZA 2BR3A 3EPPA 4R8SA 1RI2A 1NV9A 3KQMA 5GM2A 5CCXA 3UBTA 3OZTA 1UWVA 2QRVA 3LHDA 2ZWVA 1D2HA 3G7UA 4QPNA 4V0RA 2HWKA 3A7DA 3ELWA 1L3IA 5DM1A 5BP7A 1DL5A 5IKMA 3KQSA 4OQEA 3HCBA 2G71A 2ZIGA 1ORHA 3GNLA 3KHKA 4BY9E 4L7VA 3LKZA 4H0NA 3TKAA 5HIKA 4HSGA 5T64A 3NTVA 1JR4A 1P1BA 2NXCA 2P7IA 4FS8A 1O9HA 2OBFA 2KW5A 2VP3A 3A26A 3MQ2A 4GQBA 4HTFB 4X63A 5EEGA 4MIKA 1QAMA 2FK8A 3ELUA 2FRXA 3MTEA 4KDRA 4PYJA 1UFKA 3AXTA 4BP3A 4GBED 1M0EA 2AOWA 4P7GA 2Z6UA 3F4KA 3LSTA 3SXJA 5GOZA 3BGDA 4PINA 3EGEA 4GUAA 3G89A 2ZBRA 3KPVA 2AOTB 3KQYA 4Y2HA 3G8AA 3VC2A 3LKDA 4QQNA 4ER3A 5G02A 1HMYA 4YMGA 4C05A 2AN3A 1TW3A 2ZLBA 3DMHA 3G2PA 3BWBA 3M6XA 1PJZA 3TLJA 3HTXA 3MERA 3HVIA 3GIWA 5EOVA 4JXJA 5LQCA 3ORHA 2IDKA 3JWIA 5F2KA 3TPZA 1FJXA 1KPGA 4ISCA 4PGHA 3ER9A 4BLWA 3VYWA 2CKDA 1JSXA 3OU2A 5LQRA 3KQQA 2A14A 3SGLA 3HVJA 2ZBPA 4C03A 2ZZKA 5BW5A 3KR0A 2ZIFA 4QTTB 2GA9A 2ZVJA 1DUSA 2BM8A 4QTUB 2OXTA 2HMYB 4GF5A 3TRKA 4E70A 4DMGA 1Q0SA 3DR5A 1ZGAA 1R8YA 5DX1A 5E1MA 2YR0A 5FCDA 4YUVA 1IXKA 3ELYA 3OE4A 1RJDA 2PX8A 3SSOA 2BH2A 1FBNA 3FUUA 3FPHA 5FA5A 1JG1A 4PIMA 4CXMA 1HNNA 2XBMA 4RV9A 3MGGA 1ZQ9A 4MHTA 3Q87B 4CTJA 2PXAA 2E5WA 3FPJA 3HNRA 1KXZA 3JWHA 3P71T 3UJCA 3HCFA 3LX6A 1YZ3A 5DLYA 5CIYA 5FTWA 2WA1A 4IV0A 2AN5A 3G8BA 5DRYA 2PGXA 3UJAA 4KWCA 2YQZA 3AY0A 5FA8A 1V39A 1F38A 4WVLA 3KQPA 4OA8A 2OYRA
chains in the Genus database with same CATH superfamily
3BDIA 3QFSA 1NBAA 1R2QA 1U0GA 2JFOA 5B2EA 3WK5A 1M2VB 1F2TA 1H2WA 5AESA 5JQGB 4YCCA 2AF4C 1Y3CE 2DQKA 2UU9B 2GEVA 5THKA 2DPHA 3ANMA 4DMFA 2WJPA 1FU7A 1XMPA 1FSFA 2YRFA 3RUAA 2CJXA 1A5BB 1Q20A 2FB9A 4J03A 3I58A 1PEDA 4DBLE 5CDTA 2Q1TA 4CT5A 3LF2A 5G0SA 3WOVA 3BSSA 2DPMA 1WP4A 4V38A 4AYTA 3A10A 4TTQA 4ZQHA 3C1UA 4CIWA 2CXRA 4F9EA 2VYVD 1E6EA 1OYYA 4IHAA 5TB5A 2GHIA 3SEAA 4G1EB 1G5RA 3FFXA 3ETNA 3GP8A 1EVKA 1XZAA 3DTYA 1J0AA 4GGMX 3EC7A 4L0QA 4H0CA 1C1XB 3JAKB 3FFTA 2ZDHA 2GEUA 1RMQA 4X85A 2FEAA 3GHYA 1Y1LA 2HRQA 1TYDE 2B1GA 2YINC 1AGNA 3DE4X 3K0KA 3RWBA 1VKZA 5H0IA 3TVTA 3A4NA 4B35A 1LVHA 5CFQA 5C1DA 5K0BA 2WJHA 3AFHA 2I6TA 1O94A 3A1WA 2G6TA 3FJ1A 5BO5A 3E22A 5LBTA 3Q7EA 3V80A 1SG6A 1K66A 1TEXA 4WINA 4GU5A 4D8UA 2GHTA 2NO4A 3C6KA 1Z4IA 4OV6B 5LDDC 4LYEA 3LZCA 4ICIA 5TQJA 4JFRA 3V33A 1JQDA 1RJFA 2Q6IA 3F6RA 5JADA 5KYKA 1PGOA 2OLEA 4J9VA 3SDBA 1A3CA 1L4LA 3PD7A 2J4FA 1QONA 2NLOA 3H0CA 4GP6A 1IBMB 1UFVA 2YW2A 2JF0A 1V4BA 2BGTA 1R6AA 1IBLB 2FVYA 2O3RA 2AUTA 3FWYA 4LC0A 4BGIA 5BUSA 4H1TA 3B52X 1UKAA 3RT1A 5EXXA 1Z0ZA 1ZBQA 2Q1XA 2YIJA 3BZBA 3CLUD 4W82A 3HJHA 4DTIA 4EY7A 4ARIA 4DC9A 4O1HA 1WDLA 3PDIA 4K9QA 4AO7A 1XDGA 5CFNA 3P2KA 1OD6A 2Y0PA 3L05A 1HE1C 1LXCA 4YWHA 4N5IX 3UK2A 3TW6A 1T6ZA 4JJFA 4YRRA 2IS6A 3B70A 4ESHA 3TMAA 1IQRA 2GASA 3W5UA 3IBCA 2DHCA 1LLDA 1WE2A 1Z5VA 2H2DA 2O4CA 4IL5A 1Y9ZA 1QLHA 3IAHA 4C3VA 3LLUA 1I1QB 3CCBA 2YIMA 3H1PA 4LPSA 1KMQA 4OL9A 1W4LA 4Y98A 7ADHA 5JECA 4GPD1 3QFRA 4M8NE 3SF8B 3WRYA 5DGCA 3M1IA 4HJXA 4Y9DA 3HO8A 3TZEA 2Q5LA 1C1DA 2ZFUA 2L2QA 4HGQA 4BKMA 4E7OA 4FB5A 3D6AA 1VIAA 4UOZA 4HZUA 4QFCA 2YY7A 1LBEA 1KDVA 1SD2A 4JKOA 1GAJA 4TXMA 3LQKA 4O25A 4PZCA 3ESQA 3IQGX 4TVKA 1T8WA 4TYWA 1NKTA 5FNVF 5LDHA 5IDWA 3AEKB 2OD7A 2RGYA 3Q8XB 1GSIA 4PZZA 5ERGB 1RPAA 1GGVA 2FOLA 5JNLA 3ZZ0A 3G2KA 1W0KA 3QPAA 1VXRA 1ZA1A 3CGGA 3QBDA 1LTHR 2XBUA 3ZWPA 3PL5A 4B3DA 3CJRA 4PW0A 3DDHA 4WFQA 3M9LA 3UJBA 2YZ7A 3F6EX 5ELMA 1N6IA 4XD7D 4EFLA 3DL0A 4MP8A 1P8AA 3VPHA 5A5EA 2VTBA 5CA1B 1EMDA 3D6UA 4NMWA 4NJOA 5IZ4A 2GM9A 2I0FA 3WFJA 4AZSA 1N7IA 3N2EA 5AOCA 3AMVA 3UFXB 1RXSA 4ILKA 3ZWOA 4Q05A 5AT1A 4PX2A 4UE3S 3KLOA 1NW5A 1KYTA 3DLPX 5HW0A 2OQ2A 2ISSD 1LX6A 2ERCA 2QZ9A 3DAGA 4H7EA 3W9UA 3WWDA 4RFLA 1QQ5A 2I2AA 3QVJA 4J43A 2FZEA 1EJ0A 2C8VA 2C2WA 2QUKA 4RVGA 3M1LA 1SBTA 3TINA 1TFRA 2HMWA 1WULS 3DO5A 2WJ6A 5C1IA 4TGLA 2BVNA 1A4RA 3SIXA 4DR1B 1BVYF 1UQRA 2FAXA 4I4TB 3TB4A 1J49A 5AFSA 4FCWA 2FRDA 3M8KA 4YJFB 1REQA 3LQRA 3L0SA 4I1IA 3AUFA 5ICCA 2PRJA 3D3KA 1YB5A 4KDEA 3L1VA 4RMGA 1H66A 4EY8A 3NHJA 4IX9A 4N8DA 3WLRA 4E31A 2A4KA 2XXJA 3O4FA 4MMYB 4ZT5A 1M6YA 1H5QA 1U0TA 1I4LD 2X3UA 4JC5A 3RWMB 2Q5OA 3HABA 1TLTA 2EX0A 2I8AA 4LHEA 4QYXA 1T1RA 1U3TA 1H23A 1E7WA 3C1OA 1SR8A 3KCQA 1RAGA 4HNGA 2VWGA 4CM7A 4UARA 4AICA 1OLSA 3NPAA 4IQ8A 4II7A 2VWHA 4R84A 1R4AA 1AH2A 3ZGOA 5LOVA 1H6BA 3WISA 1I3LA 1ZAYA 4Q37A 2GH1A 2NSLA 1UDCA 2IXFA 3ZJYA 4CG0A 5KSOA 1Q0TA 3PLRA 5F73A 1M8KA 1QZXA 2QAGC 3VDQA 2ZS9A 3PG5A 3ZDYB 4RA9A 2ZE8A 1T0BA 4GWGA 5EP3A 4CKCA 4RGQA 1A98A 4JUDX 3S70A 3H5OA 3WQRA 1XP5A 4BO8A 4ZHQA 1TE2A 1TKCA 2QR5A 4BNGA 4NCJA 3N07A 1AUXA 1O0BA 3M4XA 4I50F 2YZGA 4HRXA 4MRAA 3CS3A 3L93A 1FFGA 3KT3A 5TMBA 3E9EA 4MI3A 4BO9A 1SVNA 2BMWA 3EVCA 5CH5A 2JZCA 1IY2A 2HADA 2HIGA 2XQIA 1S6YA 3WYCA 5JSFA 1SKQA 4FHZA 4DM3A 1FXWA 2F9FA 4X1KB 4CCYA 1QIJA 5AHWA 1NYTA 3OE1A 5F3RA 1SWWA 4N40A 3TLGA 1IQPA 5HKKA 1JA1A 1FUKA 3GX1A 3KV3O 1A95A 1KVSA 1QIFA 2BM0A 4FGSA 3GR6A 1PX2A 3GLIA 4DV6B 5HP4A 3PFFA 4QUGA 2AX3A 2XYRA 1O95A 3IULA 1KSGA 3NUZA 4DNFA 4AK9A 4I14A 1R4ZA 2EZTA 2DAPA 3DJYA 2G8NA 3O74A 3U56A 4G5QA 4IFTA 2WY2D 3QX9A 3JZFA 1CIJA 3N0XA 1G5PA 1HKHA 1G1AA 1UBNA 1GQRA 4P4SA 2IELA 1AKEA 1S3IA 5AVJA 4Z2AA 1AQJA 1PQYA 1MKYA 2BYTA 2QN1A 4B3RB 3IPXA 3GN1A 5K2MA 3BMQA 2P0AA 2AV6A 4I36A 4KXWA 4O6VA 5JI2E 5JLJA 2D59A 4WZAA 2CL7X 4MW1A 4MZDA 2JFQA 3W5HA 4ZCRA 1G9TA 3E7PA 5AM1A 5JDCA 1UR5A 2P6RA 1E1RD 2OV8A 5IFKA 1RADA 1S01A 1S8NA 5COBA 5LMNB 1G8FA 3IJ5A 2LNDA 5EKTA 4CQMA 3C3AA 3OHSX 5AI9A 4QPCA 5K6RA 3USCS 1TM2A 3EISA 2HYIC 1U0EA 3NH9A 1XEWY 3K9HA 5BSEA 2XF8A 2ECQA 1SN7A 2GVDC 5AUPB 3EBLA 4MVXA 2FZ4A 1MEEA 2QPOA 2VLIA 5BWOA 1GTRA 1R4MA 2AH5A 2W2KB 3NM4A 2A0FA 3GZNB 4G56A 1JFFA 2GKSA 2ORYA 1PVDA 1VCMA 2G0NA 2VWQA 2XKBA 4ZO9A 4DIDA 1K5GA 3F8SA 2VTKA 1E7RA 3FBGA 2GNOA 1Z12A 1L5QA 5FOQA 3OP4A 4EJMA 3OM8A 4IMRA 4TT8A 1F12A 2FQXA 2IYYA 1PIWA 4OK3A 3RQIA 4PAMA 5L4NA 5ECWA 5DNVA 5AJYA 5H3LA 1EDBA 5SY4A 1KI6A 2PS3A 2V7TA 4LDNA 1P9LA 1X1EA 2GN1A 2H65A 2XBLA 4J76A 3QKUA 1VE9A 1W1IA 3MLEA 4J7CA 2RAFA 1T4CA 1KFEB 1N9ZA 4YRJA 4QHTA 2IYOA 4G5OA 1PTJA 4MW7A 4IIHA 1PEKE 4PSUA 3EHDA 4C78A 5CM9C 1CUBA 1X2BA 3FGZA 3E8XA 1GPAA 1JP7A 4HD8A 3TOCA 1LVUA 1MW9X 1XO1A 1WKBA 1AUQA 1L7MA 2WJGA 3T95A 3RDPA 1GKLA 3CJTA 9GPBA 4CL2A 5TX7A 3F1KA 1CJMA 3FKSA 3F9IA 4I1VA 4MX8A 4PG7A 2C7GA 3RV4A 4D46A 4F4UA 4YV0A 2V7VA 1ZRMA 4DV1B 3E5HA 4A3SA 1C8BA 1E69A 1RP1A 4MUKA 5FADA 4KXUA 3VR3A 2X77A 4DIBA 1YZTA 1SM4A 2ZRHA 4PR3A 3B1WA 4QXAA 5CLGA 1U99A 1A2QA 4PLCA 3UHJA 3V1NA 4N01A 4V1CI 4W1SA 3R7BA 3NHYA 1SURA 1XK6A 3R3HA 4P0TA 3S2IA 4U6NA 1B3BA 1EB8A 1EAMA 2GZ2A 2RAVA 2ZXEA 3LCJA 8OHMA 4DR2B 2QYSA 4HPJB 4YQFA 1DQPA 3VU9A 2HBYA 1T3LA 3R7WA 2H1SA 1OGYA 3NBAA 3Q3CA 5DYIA 2HNKA 1MORA 3L8CA 5CFRA 1I36A 6PFKA 4KBYA 3CRNA 1BEZA 2WSSA 4XFJA 2R1UA 2GD0A 1Z8DA 3R6DA 1N2CA 2EKPA 2EKZA 3EIFA 1KBZA 1TD9A 2JIMA 1NVWQ 1WZCA 2XNDD 3NHUA 5E7MA 3WFIA 1UQUA 4WOBA 5A3SA 3PKJA 3QVWA 2PKQP 3MILA 1EVQA 4Q4DA 4HQOA 1ABFA 1O58A 5EAIA 4TN1A 1PFWA 1E6CA 3W6OA 2BEWB 2JGDB 3K09A 1MG5A 2HIHA 4RACA 2Z3VA 2ZKIA 5BR7A 5AJWA 3N87A 1APBA 3HJRA 4WFIA 2OCDA 2ZJYA 3F6YA 4FFWA 4UHCA 1BH6A 2DY1A 2EV9A 3N8IA 3OFVA 3TLKA 4EHDA 4KR7A 3HMQA 3SE7A 2FW7A 4ZAZA 2AUNA 3EW9A 1N9GB 4N5MA 4A0QA 5HCUA 2Y2UA 5EMLA 2O8CA 4PGGA 3PDCA 5HE8A 3A32A 3ENZA 2YNMA 5E6RA 2QN7A 3GRPA 3NT2A 4IW3B 3DC2A 1Q6ZA 3K8OE 4YRDA 4AMVA 3AVOA 1A7KA 1GQQA 1IYZA 2BONA 2C88A 3IIEA 4KIFA 4H35A 4PAOA 2MOKA 3WGMA 5BPFA 1PZHA 1US8B 1CJCA 2MT9A 3NPMA 5FWDA 3HKCA 1J24A 1KAGA 4B40A 2NWQA 5TPZD 3PC3A 4HFRA 5G53C 4BNMA 2GAAA 4O3FA 4R8SA 5GM2A 1QH8B 1UWVA 2ECKA 1M1YA 1BDIA 3QV1A 3IOCA 3SZ3A 5IKMA 5IJ9B 3IE2A 3V4OA 1RRVA 3RHTA 4DTCA 4CVNA 3ENWA 1MG0A 3ZI4A 1AK2A 5EE5B 3HDJA 1O77A 4TWIA 1JR4A 2EKDA 4JLBA 3ZGLA 4QVIA 2CE2X 4CLXA 3T3MB 3ND5A 5EWJA 3E15A 2Q07A 2FFHA 5LZ2A 4B3SB 1D5CA 3ZOZA 3HRKA 4MDEA 3JATB 4WNAA 3HHPA 3DF9A 1JZQA 2CHUA 2ID8A 2XD9A 2GR9A 3L1UA 4RIIA 3VPCA 3W34A 4A16A 4E5UA 2GRJA 5B37A 3GJRA 5T41A 5CM8B 2PFGA 5SZHB 4DVGA 1X0VA 2WB2A 5I9MA 1PFUA 2AOTB 2QEQA 1RQXA 1LBTA 1UK8A 3H7AA 3JQ6A 2MINA 3K1AA 4HDMA 4L8GA 2BTOA 2FLWA 4DEXA 1QF9A 4EGJA 1VFNA 1NRWA 3G2IA 3ZIAA 5JZ9A 4A10A 2PUFA 5B1HA 3ZHQA 2DR2A 3GJ6A 1PK7A 4MRNA 2WM9B 1Y8QA 3G2PA 1JV2B 3M6LA 2ZRMA 3OWXA 5EYPA 9LDBA 1DUIA 1E2IA 3KJIA 1OLOA 4YASA 1QDUA 2PLRA 4JI0B 2L17A 3JWIA 3GFQA 3EG9B 2O5RA 3AI2A 3BBLA 4HDOB 3RJ9A 1RJ9B 3FPAA 1YJAA 2O8FA 1I9CA 1PR6A 1FW8A 3B2QA 3DBLA 1D6MA 1U8ZA 4YDQA 4ND3A 1ECFA 2ZBPA 1A9XB 2V5AA 1POXA 4BEJA 3ZD9A 2RGEA 5AW7A 2ZOSA 3K0FB 3KE8A 3DCNA 4BL5A 2PWAA 5TXGA 5C35A 1UBJS 5EP1A 1XKXA 4FTWA 4F72A 1W87A 2VJNA 3QWIA 4BEVA 5ALNA 4ALIA 1PJ3A 3EOZA 1U80A 1VE6A 4MKRA 4A0GA 1WSAA 4MP6A 4QATA 2ORIA 3WLIA 3WXBA 4DLWA 5GJBA 5IPFA 1E3SA 2Q9AA 2RGDA 2O3TA 1SQ0A 5BR1A 5DWVA 1I3MA 3K71B 3RNOA 1Q2UA 2BZSA 2VRCD 3THYB 3LY9A 2JIZA 4GIBA 1OB2A 1XZPA 2KX7A 3PNVA 5JZOA 3EW7A 4EGFA 4X1YB 5C7LO 3SZMA 2Q3HA 1XKQA 2YYYA 3OT1B 1MZPA 2AN5A 1CY8A 2F1RA 5DRYA 1QIGA 3WGQA 5AKKA 1RKQA 1ZMOA 4MGEA 4OK6A 4IGKA 3IFSA 4BRUA 2QA5A 1JHMA 3HBLA 3ORSA 4WFKA 3V7FA 3ADDA 2W6ZA 1ISSA 1S7GA 2A0WA 2WPDA 4J8PA 1N2IA 2BZ1A 4CF4A 4MR7B 2RK4A 3R3JA 5J4VA 3F90A 2R48A 1ONOA 3ZDDA 2BR5A 3HR4A 4UTZA 2ZWMA 3I6BA 2WWFA 1EBBA 3W9YA 1B8NA 3ILXA 5CVVA 4AX8A 5COQA 5J5CA 3Q41A 3QYPA 3GYGA 5D5HA 4DYVA 2GYUA 4RHYA 2NSYA 4JLPA 1SPXA 3AVVA 1CKEA 3AVWA 2JLQA 1BIFA 1PR5A 2J3EA 2VPIA 1LV7A 4BV3A 1YJ5A 1E20A 4U0JA 4ZD6A 3ZBUA 2QTGA 5F9MA 4R8MA 1I1OA 1P72A 3IGFA 2P77A 3U4AA 3JPYA 3KTDA 1HT0A 3GLHA 4QGSA 1XNGA 3JQFA 2VJPA 3I04M 1NHGA 3GEMA 2QDXA 4J2TA 5F5NA 2GF2A 3OZFA 4JEHA 4HNTA 1K9VF 1N7GA 1RABA 3DHNA 1HG0A 1X9IA 4WN9A 1X6VA 4G86A 4QPDA 2A1IA 3OE7A 4ZA2A 2V6IA 2W4MA 4C07A 4P1ZA 4TTIA 3NTLA 2O07A 2X8JB 5E8JA 4KGZA 1FP1D 2EJCA 4XIIA 4CR7A 4IIVA 2XCQA 4QRHA 4M46A 2W2MA 3W05A 2OV2A 4KKXB 1WUYA 1X38A 3AUYA 3HPRA 3NXKA 3O3OB 3P9ZA 4M83A 4ZN6A 3Q3HA 1T2UA 3P9PA 3GLUA 5CXXA 1CQPA 3PFNA 3G5MA 4HQRA 3UC9A 1HH4A 3FXAA 2HK6A 3AETB 2C9CA 1ILWA 4HBGA 5DBIA 5F51A 5KYXB 2PKQO 1K7XB 1NVDA 3EZ6A 2VWPA 4UBMA 1R6BX 3S2FA 2IHZA 2OZPA 2EZUA 3HYLA 4EX7A 2CV1A 4OGWA 3QQPA 1Z17A 4EATA 1N3BA 2GBPA 2VHEA 1AQUA 4RZSA 4PN7A 2XADA 5TQ0B 1T0PA 2F55A 2FPPA 3CUSA 4RJLA 4GLOA 4WK2B 3DL2A 2IEDA 1OREA 4TXNA 1SUEA 1AKQA 1Z2OX 1Z34A 2RHCA 3R0QA 1RC1A 1ID1A 2QTZA 1KNQA 3KV1A 3D4IA 1VA5A 1XZNA 2JFBA 2W6PA 3R7DA 1CY2A 1DFIA 3O90A 4D0LB 5G0VA 4WBNF 1MIOA 1R66A 1O0CA 2JG3A 1YRHA 3JQBC 4LMAA 4QBTA 3I04A 2AYYA 2HK8A 3C3WA 3ZW7A 4U8GA 5HQ3B 4YHHB 2ZZNA 1KIAA 2FW9A 3SVZA 1ADGA 2N0SA 4LKOA 4JN6B 4MROA 3FIJA 4M1KA 3BXOA 4C1BA 3PNQA 3C3CA 3DV2A 4FE7A 1KNXA 1YOVA 4Q3OA 5JY6A 3PGLA 3UAWA 4EYOA 2E49A 3M6FA 4NHEA 3PSHA 2CLIB 5HILA 5JLAA 3JCZA 1QZUA 5B1SA 3V97A 3UK0A 2P78A 2ZUUA 2WU4A 2PJZA 4GKVA 5CDYA 5SZJA 4P92A 3KZVA 1J8VA 2AVDA 1L1RA 2BP7A 3GC6A 5A06A 1OX4B 3AUJB 3X1XA 5LC1A 1NR5A 1O4WA 1RJWA 3LS2A 1R74A 1XF1A 3RRFA 3VR4H 2G40A 1W4ZA 2NO1A 4QOFA 4TKUB 7ABPA 2I7XA 1FQJA 4DLPA 4IDQA 1EEHA 4TXJA 1FC0A 5L3QA 2OG1A 4BHTA 3MRSA 2NU6B 2B25A 2PEYA 3AY3A 3UMVA 4C5CA 1KRXA 3SSAA 4YDRA 1VPEA 1V71A 2J6CA 2MYUA 5IDXA 4RULA 4G6ZA 4ALNA 1CUGA 1E1QD 2AC2A 1IONA 4ERNA 3N5KA 4FXPA 4S3MA 5HQJA 2P9ZA 2I7DA 4L5JA 2QUHA 2X7HA 2Y0BA 5F98A 4KG7A 5AJZA 5AM3A 2CLLB 1SA0B 4AJKA 1XAHA 2WV9A 1GP2A 2PAAA 4C08A 4GMGA 4X6YA 5FOWA 2HLNA 3M34A 5F3DA 3LUDA 3KYBA 1MJFA 4V39A 3QKSB 3ET5A 4HXGA 4FB4A 5FWXB 4RF4A 2VXOA 4QOEA 5EHZA 5GV8A 3OIDA 5E7QA 4ZTZB 3E5MA 4S1OA 3ZX5A 1S9HA 3BIWA 4MZXA 1IJKA 3RYHA 4D6PA 1IN1A 5B3AA 3V1MA 4ZTBA 2EZ4A 2VHUA 1FNCA 3BT7A 4ZI7A 5KYNA 5G4KA 5HHTA 1BX1A 1PZGA 4E2XA 4ZARA 3RRYA 1Y6ZA 1PZMA 1RLMA 2OZKA 1TA0A 3NVMB 1U5AA 1UT6A 5A4FS 1EYZA 3EXHC 1FTNA 3BE5A 3RAGA 1SD5A 2VS1A 4YAUA 3ZD7A 3SLGA 3HYNA 5F7OA 2JIOA 4BU0A 4KODA 3GOQA 4F5DA 2O9JA 4HDRA 4DSAA 4I5GA 3ZNPA 2EL7A 3HA2A 2CZQA 2AJLI 4WERA 1W6RA 4UTXA 1ETHA 1TUEA 2VAPA 4X95A 4ZRDA 1JECA 1XVAA 4HH3C 5CYOA 1UP4A 2IX9A 5EKSA 5D6NA 1Q83A 1UADA 4KR2A 3PNLA 4KTTE 4U1RA 2D5IA 2A9QA 3KLMX 1NVTA 4FJ1A 3N6RA 4R3UC 3F74A 5REQA 1FQWA 1I24A 2QTHA 3ME5A 3PJDA 3QUSA 3C6MA 2AFIE 1SO8A 2RHWA 3YASA 3S44A 5KS2A 4E07A 2I7TA 4LE1A 1P18A 2NXNA 4HB2A 4YQEA 5KAMA 1U2PA 5ICGA 4N8EA 3AHEA 1H4SA 4XVRA 1JG2A 4FZVA 5D3ZA 1W7AA 3UJ9A 4CBVA 1YNOA 2Z98A 2RBKA 3D3WB 2QLLA 2VBIA 3IALA 4Y6OA 2P3OA 3O26A 3L79A 2QD1A 1P3Y1 4BPBA 4MULA 1VLQA 2B2CA 5I4KA 5JBNA 4LYJA 1M75A 1NXOA 1XMXA 3A11A 1ONSA 3U3XA 2FPOA 3M6VA 5HIJA 2VP5A 1CDZA 1DRJA 4KRXA 4LYGA 1VI6A 5TLSA 2XUZA 1JR3A 5HEKA 3AHIA 4R7GA 5J5VA 4HDCA 4DLYA 1QHGA 3MINB 1WVIA 2J3QA 2NZUG 2EERA 2I2CA 2Y05A 2YX1A 3A2LA 1ODFA 3BH7A 4GE3A 2PR2A 3ON5A 3IBGA 4MGIR 4MUXA 4V2UA 2H16A 1F2TB 4QASA 5CXQA 4Q9JA 2NAPA 4PIPA 1PRYA 3MCZA 1DBRA 3DBOB 3RS3A 5E0KB 2SBTA 4GT1A 1H4TA 2QV0A 1Y3BE 3VHQA 4AJOA 4XI9A 4CT0A 4B8WA 4MUFA 3L4BC 1UK6A 1KPIA 1I01A 2JAXA 2VDQB 4DXHA 1FRVA 2IEAA 4E3WA 5JANA 3S2UA 3NTOA 4N7RA 1ONPA 1C4XA 3G5TA 5JI3E 1PW5A 3R7FA 5LZ8A 2W90A 1OU4A 1V16A 2DG2A 5CW2A 2X4LA 4DV4B 4ZDJA 1T6YA 3CXRA 3Q8WA 4KPUA 4HNAA 3W06A 1ESMA 1INLA 1NP6A 1XFAA 5AK3A 4B7XA 4XQCA 1NJ5A 1WBJB 3E8MA 3MJEA 3B82A 1ZN9A 3DUFA 3NC1C 1F8FA 1RBYA 5G3YA 4B0OA 5ITZA 3WKBA 1OVMA 1PNRA 2Y1KA 2BFBA 4XH9B 2P7HA 4II3A 4ZOEA 4PLVA 4HGNA 5I3CA 2BHNA 1JTVA 2YS6A 3WL8A 5KYYA 2HJVA 4M3NA 5LKAA 1NQAO 3E22B 4IJVA 1FTSA 1LI5A 4MOWA 5L3ZA 6LDHA 3H0KA 1YK0A 3D5EA 4RVDA 4K3VA 2GSDA 3Q7IA 1G9SA 2R3SA 3GDOA 1E1CA 4ZYYA 5FP0A 2JPDA 2DBQA 1TF5A 1VJRA 2VNHA 4RVUA 2I3ZA 1QBKC 3DKPA 3LVFO 3N8DA 3U39A 5KVCA 5IBRA 5CA0A 1KGDA 3DLAA 2GCIA 1NVAA 2B94A 1G1MA 4MARA 3LQ4A 2WTUA 4YUWA 3GZ4A 2JI9A 1YONA 1OW3B 1RT9A 4MWZA 3VAYA 5K3FA 2DFNA 3SVTA 1TA9A 3I6IA 4KN6A 2J7PA 1F4VA 1GGMA 3H6GA 2OFWA 4RFSA 3SKYA 1JWLA 3PDIB 5CT5A 4G09A 5AKHA 5H68A 4EYSA 2IS4A 2HRRA 5JJIA 1R12A 1DS6A 3ESRA 3ZWKA 4MW2A 4MUGA 4FC7A 1E0AA 9LDTA 3LYUA 4JLKA 1PGJA 2DWQA 4BKPA 4H15A 4BQOA 4DMRA 2ZBVA 3FOCA 1L4NA 3OT4A 1IN7A 2UZ3A 3LKVA 3RFCA 4M9SA 4UAUA 3NATA 3UJHA 4B1FA 1JQEA 1PD1A 2VK8A 4AYXA 2IOFK 1JWBB 3DE2X 1C1DB 4GR9A 3R3VA 1HT3A 5FNZA 4BUJA 1FOEB 2V9ZA 5ICFA 4HZUB 4CE6A 1NMSA 3GLTA 1OVGA 1HTTA 3EEOA 4ER0A 4D4HA 4PFKA 2B1IA 3F8TA 2JJ2D 2WSBA 4QUKA 2QN6A 2P5SA 2A8YA 3D0QA 1C0KA 4L8FA 2ST1A 4GFDA 1N33B 3ASYA 2YYSA 2AI3A 3HKEA 3ETDA 5FEUA 4U9IS 3Q8LA 1RYNA 5AUNB 3VR5A 1N5MA 2OPBA 3KEQA 3AL3A 4AZ3A 1OLXA 5JJKA 3GUZA 5AKZA 3IHWA 3HY4A 4Y9RA 4E22A 4RXMA 1YFJA 1ZOSA 2CFCA 3R5XA 5JNRA 3VX4A 3ZDZB 3H2JA 3HXPA 4HUQA 3FRHA 4YJ3F 3M6IA 4G9BA 3FD8A 2VTBB 1CUWA 3ESDA 4DAOA 5J40A 1KI3A 3NJRA 3UK7A 1TD1A 1A88A 5B6PA 3C14C 1DC6A 4AP9A 4MIYA 4R5MA 3WYBA 3ZK9A 1SU4A 5LZ9A 2I67A 3A0UA 3FPSA 1HY3A 4DB2A 2G3YA 2DB3A 4GICA 1HYHA 4BNWA 3SEQA 4OBBA 1J2RA 1BO6A 1SXIA 1W5AA 3A9VA 4MVCA 3GCDA 3Q7TA 5DNDA 1IN5A 4ZT3A 2GN6A 3CX4A 3I09A 1XZ8A 5IMBA 3AF3A 2W2VA 5KTNA 1TA4A 4F2DA 4ZCPA 3ED5A 4L6CA 1MRSA 2XB6A 2C96A 2QMQA 1PL7A 2AF3C 6ADHA 3RAEC 4HNVA 5B5SA 2KMLA 4R2XA 4V2IA 3TECE 1RW4A 4WGFA 3ZS9A 5BMVF 3BGWA 1REQB 4COOA 2WKQA 3G2QA 5EL0A 3TK1A 4AO8A 2Z2YA 3AVTA 2WMOB 4FOOA 1RHJA 2AK3A 3B7WA 5I4BA 4ZCLA 1MGPA 3R5TA 1Q1BA 2Z08A 4MCJA 2XY4A 4CIDA 3DFUA 4KXNA 1H9AA 4EG5A 2F67A 1J1ZA 1U2GA 1T3GA 1UJCA 3MQ4A 4N0MA 5ISMA 3JTMA 3HCBA 3JZDA 2IVZA 4CFZA 4Q1EA 2A2ZA 1DOHA 1FSGA 3PJFA 2XNJA 3OTWA 1K86A 1OLSB 1QHNA 4Z99A 2BFAA 4HF7A 4FS8A 5J9FA 3K05A 3NG1A 4O1MA 5D7NA 4K46A 5LOVB 1AKUA 4BOYA 5JMWA 1YTUA 2K7FA 2YIVX 4EJ2A 2RFLA 4G1VA 4AY4A 4ARBA 4GBED 1CUDA 2AOWA 3EZFA 5A3JA 3C6XA 4CKCB 1MOSA 1CF2O 1P74A 3PFCA 4MS3A 5HNKA 3KJEA 4QHSA 3SZOA 3W9BA 2ETVA 3R7LA 1TIBA 2HQRA 1GQOA 2HA5A 4ZHQB 1Q0LA 5K3SA 1W5BA 3ZNQA 4WKGA 4J16A 4M0EA 1ZJWA 2ZWPA 4Y2QA 2RGNA 4ZP1A 4KSBA 4K03A 2ZUEA 3LT1A 2G25A 3AR6A 1RCTE 5AUQA 1N5OX 1FDWA 2I76A 3NUGA 3R3WA 3BFKA 2HDNB 3CMCO 1IWBB 2D06A 4HI0E 5F2KA 3KOUA 3KUUA 1Z0DA 3ANTA 4CCYB 4PGHA 2GPJA 4PQYA 3OFND 3DG9A 2B8JA 3DVSX 5IRCD 2Q99A 5C46F 3HL4A 2DY0A 2ENWA 2Y9MB 4GNRA 2NZJA 2EIXA 2X5JO 5L3RA 3GLIB 1TLLA 1Z7BA 2O19A 3RIYA 1GPYA 3M4JA 4EFDA 3OLQA 1VYVA 4YUVA 1FBNA 4GI7A 4PPNA 3W79A 2D2EA 4R8KA 5AUOB 2G9VA 1GYQA 1X8JA 5FUYA 2W83A 1NSTA 3BXGA 1LDNA 2FPIB 2TYSB 1L9XA 4HQ0A 4O4HA 1V26A 4PRZA 4BNLA 4C0WA 1LLFA 2WHPA 3EZXA 1QK3A 4P4SB 1KBOA 5D86A 1MVNA 1GZ4A 3W78A 4QULA 2YV3A 3BMQB 5K3BA 4ZT2A 1I6MA 1ZIXA 3FPJA 3P71T 1CDEA 1PBNA 3D7LA 1ZSVA 4ZVVA 4WZAB 1R9NA 2VDOB 3FYSA 5IXJA 1E4EB 2BBOA 3IOMA 4XFKA 1LPNA 1NN0A 2HZ7A 2OOKA 3KDPA 1FDTA 4FOSA 4K40A 5FTJA 3ZY2A 4XW2A 3HY6A 4P3PA 2C07A 1TI7A 3UJAA 2BT4A 5IK2A 5BN5A 5KTTA 4OFWA 3WQHA 2X0RA 4CQMB 2XE6A 1K68A 3L84A 3M5WA 3UNXA 1Q0QA 5ALOA 2FSPA 4JQYA 2OYRA 1MPTA 4LXXA 1D3AA 2FZ5A 1B26A 8GPBA 2GD6A 3OZBA 3MRVA 5HUHA 1ESZA 4NG5A 1P5JA 5SY9A 4DREA 1IOVA 1XKTA 1R4MB 1JXOA 4OJKA 4TLMB 5JH7F 3E9YA 4XYBA 4CMAA 1JFFB 4Q3DA 5KC9A 2MSEB 2B5VA 2O0LA 3ETJA 1U3GA 1DBQA 2NZ8A 4TQ9A 1W59A 2OQRA 4QYIA 1TMKA 3TYXA 3P20A 3EASA 3NR2A 1J4AA 1C3JA 4UUMA 3CRMA 1Z15A 4LZLA 5AW1A 5HSGA 1M1NA 2RGRA 5FL3A 5DI9A 1VDMA 3R0VA 3I5YA 4YJGA 3EA5A 4YMIA 1SUAA 3ZY5A 4XUEA 2V7BA 2GLUA 2K7ZA 5EJIA 4U5XA 4PS0A 3ZXUB 1XMQB 1KI6B 4LGYA 3PJGA 2FP4A 4C0AC 3KE9A 3Q3EA 2O59A 4DDVA 1QGUA 2DU8A 3WGUA 4HEQA 3RVKA 3AF1A 4CTNA 2DPGA 4ESEA 3WE7A 1ORVA 3QI7A 4W9NC 1FYEA 1T4CB 2GAFA 3MJFA 1G66A 2C59A 4B7ZA 1JG4A 4DLXA 4E12A 4BFWA 3PFWO 1UT5A 1Z6YA 3WI7A 3DUWA 2BH9A 1HLPA 2ERYA 2VSYA 3B3GA 3C3MA 1F6BA 3PNKA 4DUZB 1JQ5A 4HY3A 3BCUA 1X9HA 5CGQB 5IAAA 3TMYA 3TVYA 1PW7A 5J59A 1HF3A 3HDHA 1YZKA 1KO4A 1DX4A 1JUDA 5B30A 1QCYA 3C5HA 3X2SA 1CR4A 1NPDA 4UTOA 3LT0A 4MVJP 4KO4S 2PZMA 3ED1A 3GMSA 2HBQA 5LJLA 1JMKC 2CZGA 2P4QA 4X61A 4CV2A 1BD4A 3L1HA 2OAEA 3HWSA 5M04A 2ZTVA 4NDNE 4RIHA 5CLQA 3DFIA 3PXAA 2WHRA 1UKYA 5FIUA 1AMOA 2CLOB 2UYGA 3LUJA 4PZ9A 3A6FA 3HCPA 3O2SB 4G41A 2OXCA 4ZVMA 4JJEA 1MR3F 4U9HS 4F6RA 1KJJA 2XTZA 3VU9B 3ESZA 3LPDA 3MRXA 3R7WB 4AJJA 4KW7A 1PT9A 4Q4LA 1Y4UA 2GZHA 3KZKA 3RYCA 4ER6A 1XMSA 4ETIA 4QICA 4JQSA 2AHOA 3ASZA 5C0OE 1C7EA 4C04A 1G9XA 3C87A 2P6PA 3G1UA 3AK4A 3CWZA 4NZ9A 4P4TA 2X0DA 1RI5A 2G6BA 2GZRA 4FFRA 1Y42X 4MNTA 4BN5A 2HZBA 4JODA 3OEHA 4G23A 2YOFA 5D8DA 3WMGA 2YZMA 4R54A 5HMLA 1Z4LA 4P3OA 4NL4H 4YNBA 3U9LA 3KSMA 1RWPA 1GPH1 7YASA 2I03A 2DPLA 1NV8A 4MHOA 1J90A 4L2IA 2X42A 4LXUA 1C9KA 4RSRA 1BKYA 3KKPA 4MYHA 1DAKA 4JVSB 1BRTA 2OV1A 4MVWA 3WLLA 5F4ZA 1YUBA 1JDBC 4C0LA 1IEQA 2ZRAA 4UXHA 1GPWB 5HJ5A 1LPSA 1OH7A 2H1OA 2O8CB 3FKJA 3O93A 5E6RB 1VSUA 5FULA 4LHVA 1Y8CA 3B9QA 4F4IA 1BG6A 3K9QO 2ZSUA 2WBLC 1I6LA 1FYXA 2J8ZA 3LPAA 1I9GA 4RGBA 1B6TA 1GL7A 1PG5A 1FS6A 3FCYA 3QWFA 4JBIA 4M87A 3PC8A 3WKCA 4BMDA 4EKGA 2V6GA 3BMCA 4ENRA 5I4CA 4P31A 5JD4A 4I4LA 1DAHA 3EPJA 5EJFA 5JWOA 1F17A 2C5EA 3QU9A 3ZU4A 4UOEA 5DM2A 3VNQA 1SC6A 1KY5A 1PS0A 2ZJBA 5DM4A 2OHHA 5JVDA 3WNCA 1N36B 4C4YA 3WGHA 1JVSA 1U8EA 1YQXA 4YXWD 1M0TA 2VN8A 4LTDA 3ROXA 3DW1X 4HYEA 1GFSA 2G1UA 4I66A 3FF1A 1BVUA 3S2YA 1L4MA 1ODJA 1L5HA 4HEA6 2CWDA 2CSUA 3AJRA 2YVAA 2QVXX 3OM1A 2W2LA 3FOAA 5FYQA 3IMGA 3SYMA 4I1RA 5H80A 5C9ZA 2WMNB 5EWJB 1E4VA 4D4IA 5JXIA 4X6LA 1IPHA 3AV3A 4KRYA 4RZQA 3VZCA 5GADl 2ZI4A 2VUUA 4DZRA 1N6OA 4WOJA 2ZYTX 5I6DA 2F00A 3E61A 3HU5A 4Q9NA 4RF2A 4R01A 5BUZA 1N34B 5ER9A 4ZJYA 4MQ4A 2JLYA 3GBPA 4LWOA 1AO0A 4TUYF 4CLOA 4ZYVA 3LBHA 4PSDA 1CXZA 3I9V6 5AVWA 1ZLYA 2NNLD 3RC8A 2YL2A 1FDIA 1Z25A 2OC9A 3VO1A 2GHRA 4HDMB 3K1AB 4MEBA 1IEVA 3VZPA 1V5GA 4D9JA 2LRHA 4KR3A 3Q4GA 1GAQA 3OPNA 4JHXA 4HTFA 1NONA 2Z58A 3JXEA 3PQCA 2NTNA 3HWRA 3TR0A 4A5SA 1LSUA 1EG2A 1FFEA 1Y8QB 2VEDA 4OHWA 2J41A 2P4UA 3DMNA 3FDJA 2SKCA 4MUHA 1HE3A 1AN0A 1C2YA 2R1VA 5BQ5A 2XDYA 3KVOA 2C84A 4FR0A 2HTEA 2PG3A 1P4HA 2O8FB 2Q3JA 1MBZA 3A9UA 3DBLB 3HFJA 3RVPA 4DMHA 3BGSA 5AVTA 3UJNA 1WTCA 2AG5A 4PPQA 1Q1QA 1VLJA 1S9DA 1IJBA 5JJBA 1GTVA 4KRGA 4L76A 3LUCA 4A1OA 2F43A 4EB6A 1YQWA 3F6SA 5EKUA 4EA8A 2XDAA 1FNMA 2I3BA 2J9RA 3TFWA 1VYTA 3RVOA 3V55A 4KXQA 2A88A 1A7JA 2PSSA 1VP9A 4PEVA 4QWMA 2QRLA 3ROMA 2RJOA 3DXZA 3IHTA 4MUJA 1J1UA 1NNEA 2GKOA 2BLNA 3L6BA 1ZKDA 6NULA 3KU1A 1RACA 4RTOA 4OHZA 5FPKA 3IT2A 1UK7A 2YWRA 2FDXA 5FOTA 1H2ZA 1C0EA 3H5IA 2P9BA 2O3JA 1M7HA 4U2DA 5E1BA 1MENA 3BHMA 1PGPA 4HEHA 2R8BA 1MB0A 2Q27A 2CFTA 1BJRE 1U8YA 5F5XA 4G0UA 1FMTA 1K5DA 1PD0A 3Q7QA 4QPPA 1LCIA 4NBVA 1R15A 4F6LA 3O8NA 2V03A 4RMHA 5CIWA 1ZZEA 5AHOA 3OCWA 2OT3B 3N75A 5AYVA 4J3NA 5ELXA 1E4YA 1NNI1 5B3JA 3FUXA 5KEIA 4NBRA 1B6SA 2WWWA 4AJIA 3AOEC 1FFXA 5ALEA 4IJUA 1A7UA 1ZH8A 5DF1A 1I33A 1CUVA 1X1BA 3BFPA 1ZMTA 2GS9A 4MXDA 1KO8A 1DV2A 2QSZA 3D6MA 3WGGA 1P9OA 4ZYXA 3CF4G 4PHGA 5E9QA 4YMTA 5ITSA 5KSZA 3JQRA 3O7WA 3QELA 4M1MA 4W1RA 1JKMA 1XALA 2UYYA 3H9QA 4B4VA 1KFKB 2CNDA 3I5UA 4JVLA 2CK3D 2PN1A 4PX9A 3RS5A 4A6DA 2YWXA 4ECAA 1EUDA 3NVAA 1B1CA 4LX0A 4RTKA 1D2AA 5CD9A 2OZVA 2XAUA 4IG4A 4WZZA 4BX9A 3OZRA 2FI1A 1KI8A 2OK7A 4KXFB 1DJQA 1ZPDA 3ZZUA 4O4JF 2YHAA 2AKYA 3GLHB 4N0EA 1SCBA 4E5DA 4AY2A 2XGMA 1ZONA 3DLCA 4HGPA 4KAXA 4CUJA 4DLLA 4LG1A 1NI5A 3ICOA 1LGYA 3Q0TA 2CLEB 4IDPA 4OEHA 4RMNA 5EJ2A 2GWRA 1IWPB 4QAQA 4ND7A 1TAHA 4KUEA 2ORWA 3AR2A 3WNQA 4D8YA 3K70C 2V7QD 1PQWA 1Y9JA 4GXNA 3GBSA 2WIGA 1VJCA 4YUYA 2RAUA 4K3UA 2CEKA 2ZRJA 4YA6A 1T9HA 4LRWA 1F6WA 3QKWA 3AR9A 2R6DA 2I2FA 3ORYA 3WJ7A 4DQDA 3ZDFA 2QRUA 3AIOA 4O2AA 4QOIA 3TUJC 2DLCX 3KQNA 2ZBEA 2XUHA 2G28A 1DHRA 5K2OA 1J2UA 3E2MA 1EVYA 2JH8A 1H8HD 4IMIB 3CEHA 2PYZA 1AF7A 3H05A 1YRYE 3RTBA 3VC1A 1MB9A 2ZJ2A 4XTRA 4M37A 1KOGA 1D2MA 1EWTA 2X86A 2WF6A 5K0NA 1Y6QA 3DZBA 1LB1B 2FPPB 2F3RA 1S4MA 2I4MA 2E2WA 3TJRA 2YQ4A 2BR4A 3IAUA 5E2BA 3ECAA 3KOXA 4HAOA 4BQRA 5JZSA 3FUTA 4TLAA 4ZO4A 3T0FA 1YJQA 2OO3A 2VZ8A 4JSTA 1AD2A 5C8YA 1ZCBA 1MIOB 3DKIA 4PCLA 1SQSA 1JAXA 2BFWA 3OF3A 5HRCA 1EVJA 4N03A 2PBRA 2YJ4A 3S1SA 4CDNA 2EFDB 4RIEA 1MAWA 1Q92A 1NI3A 3EC1A 3RHZA 4HH4A 3H16A 4MEJA 5DP1A 1Y8RA 1CDOA 1CC1S 2AQIA 3QPWA 3RNLA 5BWCA 1HOTA 2Q2OA 4BASA 1UWLA 1ZGZA 2NVUA 3CBGA 4K2AA 5FBZA 1YOVB 1SCJA 1TCUA 4EQ6A 2EW8A 1C30A 1XZCA 1YZQA 2W4IA 3TGPA 4IKEA 4U0KA 3SXPA 3H2ZA 3VUFA 1JL3A 1U5CA 3GXBA 4M9CA 3WFZA 2Q9UA 2C97A 1XWIA 2QMYA 4Z9YA 3Q6IA 1OKKD 1LS1A 2H52A 1OASA 2PJUA 3NAZA 1JSRA 5F21A 2WT8A 2B21A 4W63A 3N9IA 4ZO6A 1DBIA 3DMRA 1K5HA 3T7TA 5L45A 2BP7B 5IWAB 1OWNA 3LVBA 3G9UA 3ZCVA 1ZITA 2C5AA 3LCUA 1AX9A 2H59A 3ONDA 4DM7A 1R3DA 5EIXA 1NBMA 2X1VA 4TV9A 1IOWA 3QG5A 5ECGC 3FPFA 4U7TB 4DSNA 3V9AA 1O96B 4CKWA 4RHFA 3MA0A 5JW6A 4MV8A 3OIYA 5KTMA 5L3QB 4UFOA 2ZUDA 3GVIA 5DGDA 3ZE2B 1STOA 4KO1S 2YHSA 3CJQA 1JIIA 5AIAA 2ZJ7A 2KHZA 1F6DA 5B7GA 3E1KA 2RH8A 4QGBA 4TYMA 3RODA 3PA8A 1QGOA 2OLKA 1BYUA 1T15A 1DBWA 3DLTA 3IVCA 4MIOA 5AVUA 1I7NA 3JSAA 3I4FA 3A4TA 4ZZ2A 1CEEA 1WXQA 2PK3A 1J0BA 4J1NA 4BV9A 5KMGB 5KKCA 3JQ9A 3P9NA 1QQ6A 2GA8A 4HLUA 4P53A 5JRJA 2X4IA 3WSTA 2EW2A 2ZSEA 3LRPA 3D6JA 5G41A 4E21A 5BWBA 4WZBE 2C31A 3HG7A 4N7JA 3FHTA 2PMDA 4WAUA 5B7NA 3WV4A 3EPPA 1R6UA 1NV9A 1SUCA 2QXYA 3LX8A 3RYHB 4N48A 1PEAA 4V03A 4EFKA 4ZANA 3UT0A 2WD9A 1IMOA 3UMBA 3ZHBA 4KJZA 1S7CA 3DM5A 3ORRA 4ZI7B 3DKKA 5G4KB 1L8QA 5DU2A 3PNOA 5A4DA 1G63A 2Y93A 2ZIGA 3ITEA 3PIDA 4Z9FA 3UHOA 2DFTA 2DFDA 3CZRA 4R81A 3HN6A 2DWCA 4V0ME 3CNHA 4YRMA 5LA6A 1L5YA 2ID7A 2OBFA 3MQ2A 1JPJA 3JYLA 3FOBA 2AYXA 4J1TC 4KGVA 4D7AA 2QJRA 4PNPA 3DPIA 3IKLA 1RM3A 3LFHA 1ZOOA 4HDRB 1FTWA 1TJYA 1UFKA 3HQ4O 4IDEA 1FUIA 5CT4A 1GSAA 1N9KA 5I9NA 1IDOA 1KI2A 2J9ZB 2QGZA 2R7AA 1HYGA 3ZKWA 4Y2SA 1Z9BA 2WD7A 4GI3A 1QG4A 2IL1A 4S05A 1JN0A 1L7BA 1BW9B 3JQGA 1VKJA 2GFIA 3ND8A 3QOYA 4IZOA 4NZOA 4K2HA 1QV9A 3PUJA 2CB0A 3I32A 2R96A 2ZIWB 5REQB 5HF6A 2VUSA 4OHYA 1D6NA 1M2GA 1P6UA 1R7RA 1H22A 2R8EA 4BV8A 4ECEA 1BEUB 2WSYB 4LOAA 1QU3A 3FB4A 1LRLA 2XT0A 1HG1A 5IMSA 5DISB 1DG9A 5EWLA 3WLOA 5F7XA 4WESA 1N2CE 2JEYA 3MAAC 4ENWA 4G5SA 1BOFA 1W4BA 4J0IA 5DT9A 3USES 3T54A 3BA6A 3Q3JB 4UNPA 4Y7CA 3HI4A 1X7WA 4JEUA 4W5HA 2O5VA 4FYVA 4Q7LA 1FTQA 2WP0A 1J0EA 3NB0A 1B23P 3G5AA 4R4JA 3VBCA 3CSUA 3I9OA 4JA0A 4MV7A 4EUEA 2A0XA 3IC5A 3H8JA 2BH2A 1MW8X 1ENPA 1VHLA 3EUAA 4LVUA 3WK8A 4KV7A 4GQAA 5GY7A 1M66A 2KYRA 4EIWA 1RTTA 1Z56C 3T5BA 1DMRA 2DTDA 1R88A 2JA1A 2G08A 4JC8A 3KJGA 4UEKA 3EWAA 4DYHA 1AKRA 3CONA 4B45A 1TZKA 2E5WA 2VH2A 3QVMA 4HFJA 1ZXLA 3LBAA 4LOKA 3U17A 4QSMA 5A7GA 3DF7A 4WX2B 2B7LA 4XLZA 2ZWIA 2HSZA 2WJAA 3C5EA 3IOBA 3LQ2A 1WZ2A 1ZO8A 5JS6A 4HDAA 4OMUA 3MT8A 1A1VA 3IPLA 4G36A 2DGDA 4TRJA 1IY0A 1BX3A 1KFBB 1HSOA 2IPNA 1WXIA 2B4RO 2OBMA 2A67A 2WFMA 4M1SA 4RPLA 5A6SB 3ZWVA 3KHTA 1V16B 1M1YE 1R0WA 3OZXA 2GKGA 4DCMA 3KKLA 3KB8A 4YRFA 5A5GA 5IBPA 2Y2VA 4KPUB 3VU0A 1CK4A 1PJ8A 1UDBA 1DXHA 1E5TA 3R20A 1OXXK 3RVRA 5JATA 1BHJA 2E82A 4KPFC 2YCLA 1ZMBA 4LK2A 4QT4A 3A1FA 3B5IA 1FJHA 5ITZB 2J0UA 4MAAA 4S0XA 3O47A 3CYFA 3RSQA 2BMEA 2HHHB 1AKVA 1XP8A 2XZOA 4BLUA 5GJVC 2GBLC 5A02A 3VAAA 4AJLA 5CDFA 1GKKA 3I2GA 2SNIE 2H85A 5DVZA 1TJ5A 2BHLA 5TGZA 3ILSA 1XNHA 2DKNA 3WBJA 4D3YA 1ZC3A 3DJFA 1F5SA 1E1CB 2H63A 3F7TA 4YRNA 2EYQA 4E13A 3LUGA 1UXGA 4FYXA 3ANNA 3F1LA 4J0GA 3KKZA 4R5HA 5CA0B 2PIDA 2R65A 2D0DA 1UH5A 1TVEA 2CXSA 3SZGA 4X94A 1YH3A 2I4LA 4B44A 1EHYA 3DCJA 5IT4A 1GAEO 1KHTA 5K3FB 3DOJA 1PZFA 3PQ5A 1XQ1A 1LI4A 3UEOA 3UH0A 3KXIA 2HLDD 4A2WA 1XKLA 2KPOA 2DFKB 5EHGA 4DABA 4G37A 4EQZA 5C2JB 2QVGA 4K7JA 5D51S 2VQ6A 1EKXA 5THXA 4INAA 2B98A 2Z2KA 1LLQA 3HBMA 4JZKA 3N76A 4WHMA 1JAZA 2I4OA 5JSZA 2HEIA 5H82A 3FNQA 2NG1A 1E77A 1O6ZA 4I9FA 2WTAA 4R9UC 4X20B 1IY9A 4YMUA 4DLVA 2QNRA 4EY5A 4FOLA 3FDZA 1KYXA 3M3HA 4KKVA 4N49A 1J2TA 2GO1A 2QL6A 2J48A 3R4VA 3TBFA 2G36A 1WW3A 2CHVA 2IRWA 3CPJB 2PZFA 2ZRKA 3KB1A 1TIPA 1J2JA 1L8XA 1QWSA 1Z2EA 3D8BA 2DH6A 1NJSA 4HGZA 2NUBA 4TZTA 1JGTA 4UULA 3WYNA 4RL4A 3H42B 1MD9A 1JKIA 2PRSA 2PH7A 4WXHA 5KYGA 1H0RA 4XR9A 4QAJA 2C2MA 1OA0A 1BS2A 5DGHA 4E94A 4HLDA 4P84A 3L82B 1BMTA 3PA6A 3ZU3A 4BJHB 3IUQA 5FLXA 2EHDA 3H9GA 3HKEB 1TADA 1HL3A 1KY4A 4X7RA 5AM4A 4DCCA 4XPIA 5C52B 4AZ3B 4BNUA 3THXA 1OLXB 1E18A 4ZV7A 4IOMA 3IPYA 3LSYA 1OBHA 1NAIA 1CNFA 1XD8A 1G41A 3KP1A 1F51E 1JFLA 3NWBA 4LYDA 4AZTA 5FBVB 1M1UA 4Q34A 4UE2A 4HUQB 5AI4A 2IHJA 3U48A 3MJSA 4LFBB 3VMMA 1U7PA 4MQLA 4MH0R 5AOAA 2IUTA 2W4QA 4R6XA 2GN0A 3ICCA 1M54A 4DDHA 2BGRA 2Q2NA 1VJ5A 3LLCA 4IP0A 5DXFA 1GPMA 3B36A 3UG7A 2JLZA 5MHTA 4AUMA 1YI1A 2Q6KA 2F1HA 3GRZA 4JQZA 1YS4A 3P9KA 4Y30A 5TQVA 3FIUA 5DW3A 2ZYDA 2JIBA 4F0JA 3TSAA 2GCPA 1I2ZA 2C20A 2DVMA 4FSHA 1GDTA 4CMEA 4C22A 4ETMA 5FA6A 1HBJA 2Y1XA 4UHBA 3JWGA 2JFXA 4Q19A 3C7AA 1JQ3A 3DQQA 4KVZA 1THGA 3I2KA 1UBEA 2GXAA 2J0VA 2X76A 4L07A 4NLLA 4NRDA 2LBPA 1VLMA 2OAGA 1EQAA 2D13A 5ALVA 4US2R 1OFTA 4M99A 3WOHA 2WIKA 4JT2A 1WLYA 1Z36A 2F8TA 3O84A 2AT1A 1G0OA 1K97A 1E1RA 1ZU5A 1CRZA 3PQFA 4I4IA 2G82A 1J9ZA 4EYGA 3EE6A 4YRIA 4EUSA 5CU7A 3ESYA 4JKYA 3U4DA 3N05A 5JFTA 2IHNA 1H5NA 4YIHA 1DVRA 1A8IA 1W5SA 4CEHB 1EFVA 3EC2A 5EJ9A 5KX5F 1RE0A 2V7WA 2P8JA 1DBPA 2ZP1A 3D6FA 3A7EA 1OI7A 1Q7CA 2Q6TA 1RRGA 2ETXA 2ZR9A 3WLEA 4DPKA 1EWVA 2D5LA 3R3XA 2XTJA 3CUKA 4R1NA 4WW0A 4CF5A 3PVCA 3PIRA 1EX9A 3GNSA 4NAUA 4BQPA 1KVUA 4R1SA 3OM0A 2Z4TA 4UAVA 1M2HA 2D74A 3MRTA 3LC2O 4MS3B 5JTUA 2WJ4A 1E5XA 3ROGA 4BNYA 1UXKA 4FHCA 3N7UA 1PVVA 2WJWA 3WV5A 2BJHA 2WHYA 2PS1A 3SQXA 1H42A 3DOCA 1C7RA 3QPCA 3DMYA 2BD0A 1M7BA 4DUGA 4BVHA 2ZJ3A 3O3NB 3QE4A 1QFZA 1K6EA 1GA4A 2PVCA 1SELA 3ULKA 2R00C 3L02A 4EHBA 1DC5A 1YE3A 2DBVO 4QNMA 1URPA 4GHWA 4X3CA 2P1ZA 5EMMA 3U09A 2W98A 2JBWA 2YFQA 2IXGA 5EHNA 4D4KA 4WJLA 2WAAA 1O5OA 2MMGA 3HB4X 1EJBA 3NC0C 4IJKA 4RO0A 5JNSA 5SY6A 4Q7KA 4DT1A 1M6EX 1W48A 2RG1A 3LXXA 5D1HA 5BSFA 2YWGA 2ZRBA 2ISQA 3DTNA 3BFXA 1GRRA 3SAJA 5CAEA 2YJ3A 1JTEA 2Z6AA 3DPUA 4DE5A 1T1EA 1ZJ5A 2FX2A 3I12A 4NWIA 1JNXX 5EG5A 1ID8A 4DNPA 3E0XA 5MFZA 3V8PA 1QOPB 2CCKA 3BRWD 1VSBA 3P2OA 3GIDA 4MKGA 5C4GB 2IODA 4PPFA 4BPRA 3O94A 4HXFB 1NU8A 2UZAA 4NYIR 4O2BA 3FPBA 4O4HB 3CM0A 2O8VA 3I2IA 4AY3A 4OSOA 2WHPB 2JCSA 1UAGA 2R5NA 4GZ6A 4UVGA 3EVEA 1U31A 1T9CA 1CVLA 4WV3A 2QN3A 3FPEA 4UCFA 2WINI 4TZKA 1T9GS 1NT2A 1UOOA 3D81A 4V0LA 1G2QA 4CYMA 1YU9A 3UKOA 3I73A 3QBTA 5I5GA 4LIPD 3T15A 1TTTA 1RLOA 1B0ZA 5IAJA 4A6PA 5BN5B 1PR0A 2HBRA 2IOFA 4IDOA 4LF8B 2NP7A 2G9UA 3FYDA 4HGRA 2DRIA 1ZR4A 1BEEA 4LDQA 1VHTA 2Z5FA 1SBHA 1U3VA 1LI7A 1IUNA 1F60A 1T8SA 3GGDA 2IZ7A 3BDVA 2FXIA 3KEFA 3TXYA 3Q7SA 1VE7A 3OE5A 3T6KA 4RM3A 2VDKB 1E99A 3L07A 4L5BA 4ZQFA 2PXHA 3TRHA 3NEYA 3RLIA 4E3ZA 1QP0A 5EZQA 4NU5A 1DAGA 4BO7A 1ZMRA 4FYIA 4QYIB 5C1BA 2IPXA 5ILOA 5LD2C 3VOAA 4FFVA 4GL2A 4X7BA 3LWDA 4ZDIA 3OEED 2IXBA 4NEGA 1CQJA 5IC5A 4YJGB 1GG2A 4IHJA 1EH5A 3OUTA 3R8XA 1F4LA 2AE2A 2C04A 4HUJA 5JHGB 3ZHYA 2FP4B 5MDHA 1QGUB 4K6MA 3HSYA 1HDZA 2JGKA 2JGLA 3L8FA 4KWIA 1YIDA 2FPMA 3C7CB 3IKTA 3O92A 3DH0A 1Y81A 3NW9A 2HJWA 3RU9A 4B3GA 1XC7A 4BTEA 3AU8A 1E1LA 1J5EB 4N12A 4WI1A 5LZ5A 2PZ8A 1JW9B 1NRIA 2IU4A 2WYHA 3HN2A 1FK8A 3GUYA 3P27A 4IXDA 3GLGA 5JPIA 2ODTX 2JVJA 5KVAA 5CFPA 5AVOA 3IP8A 4KYTA 1DELA 1DAEA 1IWOA 3I5AA 4KOAA 2D1FA 4LHZA 1GRVA 2KS6A 2YWCA 3RSLA 4Z4HA 2QRVB 1KY3A 1RI1A 3D02A 5HM8A 2C1ZA 1TM7E 4IVPA 4LF7B 2ZT6A 3GAZA 3QE2A 2F3PA 2VQDA 1Q50A 3G9XA 1CS4C 5ILQA 1P19A 1UFOA 5CX1A 1ZKMA 4XVQA 2EW1A 4H1HA 1UJ6A 3EXEA 5BSGA 4EMSA 2Y71A 3W3AD 3J81k 4RKWA 2EX4A 3EGCA 3B7GA 3FPGA 3FRIA 1A69A 1Z3IX 4DBLC 2QTCA 4QJBA 3FZNA 2ZPTX 3A6JA 3HU3A 4P7JA 3GRKA 4F6RB 1JU9A 1O8CA 3L7CA 2EWWA 3OTQA 4FEAA 4EVQA 5K01A 1OF1A 2R6GA 2ZW9A 3R44A 3W0LB 3N2YA 4CUKA 4YJ2A 4RZIA 2EBWA 4GYKA 1PL6A 2PKWA 5DN6D 4AURA 3GZTB 3ZV5A 4IQ4A 4A0HA 1YR3A 4DLBA 1RRMA 4XWGA 4DR5B 1ZHOA 5L53A 5E4YA 1JR3E 4F5YA 1YMUA 2E4ZA 1DCMA 2PS0A 4GSKA 5FR1A 3EQ6A 2ZWOA 2OENG 2X2EA 2JFNA 2ABWA 3ZQJA 3PWKA 1E79D 3I61A 3V32A 4KJXA 4JLAA 3FF4A 3FAKA 4L8YA 4L2IB 1W1WA 4E46A 4IZIA 1JPVA 2XA2A 5AXAA 1X86B 4E5VA 4E2ZA 5JSYA 2HCRA 3ZGVA 1JEAA 3AIIA 1U3WA 5FF9A 3L1IA 3LCCA 4ALJA 1Z2DA 3PZBA 4BUCA 4RJTA 2Z3WA 1N2SA 1P2GA 2OFFA 2Q50A 3H6KA 4RDIA 3H19A 5BV1A 1QFYA 3VH3A 5EJGA 4ZVPA 3QUQA 1XIVA 2B6HA 4NYJR 1SC1A 2WFAA 3BMCB 3AVXA 2J33A 2HCJB 5DBGA 4KNYA 1QPGA 1TM4E 1GZ5A 3EF0A 1XZEA 1D1QA 4U02A 2Q0SA 3H4VA 4H2DA 1E2LA 3VHLB 1QVWA 2VAVA 2ZUWA 2UUOA 3PCTA 5JVDB 1ML4A 1DWPA 2QX6A 3OZ7A 1C7IA 1N0VC 2WK1A 4A9AA 1EQUA 1KH3A 1SUWA 2Z9CA 3H9BA 4MPPA 4NAHA 5D7BA 1RWMA 3X1JA 3Q8MA 5I9SA 4BFXA 2OAQ1 4TTRA 1F14A 1N32B 1DEHA 1EK0A 4XR4A 1FMLA 3B3FA 4QUHA 4I9GA 4S12A 1XEXA 5IUKC 5BXQC 1ZG3A 1QYRA 2GPWA 3IBSA 4PC6A 3HDVA 1L4KA 5EQFA 3T7RA 3WLMA 3RU2A 5TIIA 1QJCA 1OI4A 1RZRA 5K0FA 2ZB3A 2ENUA 2D2FA 4O4LF 1CERA 1OUMA 1MPXA 4TQAA 2JHGA 1JA9A 1NMXA 5C31A 2XKAA 3HLKA 4YLEA 4BQIA 3DZDA 2BGWA 2FDRA 1Z0KA 3EGOA 3ADOA 3OIFA 1L3IA 4J4BA 3F97A 4D3XA 4Q4CA 1XYGA 1OAKA 2O1XA 3OQBA 4P86A 1LW7A 4DWOA 4BV2A 4PHTA 4E15A 4UHDA 3GLVA 1VRCA 1YFZA 1XTSA 4BZZA 4EUKA 2R0QC 4HTFB 1DMSA 1BCSA 1BQ3A 3RUEA 2ZJ1A 3K72B 1E89A 2FZLA 3HB1A 4INPA 3ZE9A 2JJ8A 3GJQA 5GGXA 1P2TA 1QJ4A 4Q3AA 2R1VB 4Q7QA 5BYAA 3BC1A 4PNZA 2WIDA 4JENA 2LGJA 1OTXA 4BE9A 4JXXA 2MR5A 1XLVA 2SECE 4MV6A 2NZXA 1H9CA 5EZYA 5CB0A 2LKDA 1GN8A 1X7XA 4CIXA 3DEHA 5HTKA 5KOHA 4LUCA 4GECA 4EGQA 3K0SA 2JGAA 2F43B 1I6KA 2Z1DA 2D3WA 5B3KA 1M2NA 3O03A 1XA4A 2Z43A 4NP6A 4OKNA 2AWNA 1PQ4A 1LJ8A 2QAGA 3OQ1A 4MKFA 3K1TA 3COYA 4MV5A 3U44A 3ZKAA 4E5KA 1E3IA 1U94A 1VE5A 1KY2A 3CT6A 4DR7B 4OHRA 4YGYA 3W8RA 4ISCA 4PSCA 4W99A 3U5ZB 1E5DA 2NTEA 3E3AA 2HY7A 3ACDA 3AUAA 3RS7A 3KQQA 4D9EA 2C8LA 1F0NA 4C03A 4K8OA 1KA9H 2FWNA 3N58A 2ZGVA 3V4LA 3OIUA 4MQFA 2R7LA 4GR5A 5D3MA 4DOMA 4FHFA 2VHJA 1V1MA 1IHYA 4XSHA 4B3CA 1IXKA 3QP9A 2ZUSA 1C5KA 1Z38A 2QG4A 2VT2A 4DCNA 3TH5A 4H60A 1YC5A 1CRWG 3FWZA 3UB3A 3IS3A 1YZUA 4TWZA 5A04A 3M3PA 3RFVA 5ALJA 5FPHA 2ZM6B 3GDFA 3HY3A 1UAYA 2B37A 3IP1A 1UPCA 1DV1A 3EH1A 5HA5A 1FFXB 1KXZA 3EUWA 4L3WA 2BE7A 2G4VA 1YIOA 2ASVA 3PI7A 4A6XA 1I7PA 2ZYRA 3TTSA 4CEIA 3AB7A 1JVBA 1QO0A 2WW8A 3RVLA 1XTQA 4BDSA 2NUAB 1OBVA 2TMDA 3QELB 3TOZA 5TGDA 3CF4A 2XOXA 4QYWA 5E9AA 1I8TA 1XYYA 4DDKA 5CYFA 4W6ZA 4MGHA 2PBZA 1GG9A 3F9RA 4RQTA 2QS9A 3QVXA 3DAOA 3MMXA 1O94D 2BKUA 2BCEA 5EZ5A 5IJWA 3EQ9A 2WKWA 4NV3A 1EFKA 1WHSA 3QBVA 2E87A 2PS9A 4RE5A 5DBEX 4JI6B 2JGMA 1KEUA 2CNBA 1BDBA 2Q29A 1TEHA 4H3VA 4PTYA 3P0EA 4NMLA 3LH5A 4OJYA 4CMIA 1R5NA 4PLTA 2X2FA 3JQDA 2ZDGA 3NBMA 3KJFA 3DMPA 3ZIUA 4G26A 2H9IA 2JFPA 1VECA 1QLJA 1WV0A 2WAOA 4X41A 5D6OA 5B53A 3VRHA 2IH5A 3NYRA 4GOLD 4MTLA 5IW8A 3R5HA 4RZUA 4ZGBA 2AI2A 4H7IA 4O2AB 2ISCA 1QQTA 5EI5A 4BGUA 4D98A 2ZS8A 3EBPA 4ZVLA 2ONYA 5ICMA 3IEMA 1G8GA 2DFLA 3RK4A 2Q3LA 4MI6A 5H8WA 2IHTA 1I5RA 5CA1F 3TL2A 1AC5A 4Y2UA 2JS7A 3WAGA 5GZ3A 4EO7A 5ITVA 2V0NA 4ON9A 3P1JA 3CZ5A 2Y8EA 5A9TA 3K92A 1TT5A 4G65A 4IVNA 5KQGA 2CZCA 1LTKA 4GWLA 4KYVA 5MGBA 1U7DA 3MMPA 4URWR 3QEMB 1SKMA 5K6AC 4MI1A 5JJCA 5DNUA 1E9EA 4L7QA 3TD2A 5CDGA 4N1AA 2NQ8A 2UYQA 5DHAA 3O0TA 3GFOA 5C8YB 4QD3A 4LQDA 4HZIA 4FGWA 3WGZA 1IOLA 2QD2A 2P2GA 3B1ZA 4I4TF 4ZU6X 4X92A 2HPAA 2VUHB 3G0BA 3I52A 1KKMA 1RYBA 4CKXA 1W0KD 4H6VA 3TSZA 1XTRA 1SUIA 1Y8RB 4IH1A 2L19A 4B2PA 2J07A 3MNFA 3NHPA 5D3KA 4B76A 2WTMA 1EX6A 4F7DA 2NVUB 4OQLA 3JASB 2FETA 3G2HA 4UBJA 4UUBA 1P0PA 1NR7A 1Z4OA 4PTZA 4EQ6B 5CDSA 1C30B 1HX7A 3KD2A 2UUBB 2NZVG 2O6HA 5J5AA 5EIEA 2I29A 1XQYA 4ARCA 1G8SA 2I6UA 1JBEA 1JYSA 4FMPA 2H3EA 4DLSA 1II9A 1KETA 1M6NA 3LC0A 2XHEA 4P9NA 5J43A 2HYDA 3TZQA 3MPUA 5HZHA 3LDFA 2VP2A 3ZGNA 3SBEA 2A33A 3ZVLA 3MTDA 1ACMA 1CQIA 4DRZA 1F0KA 1UXIA 4PM4A 3ELDA 3H0EA 3GD5A 3MVEA 4WKBA 4Z4GA 1R37A 1YGYA 3TQQA 3MWLA 4B6FA 4XSGA 5LVAA 3V8NA 4GVLA 1SXJE 2GTPA 1NF2A 2G09A 4CKWB 1C3OB 1NT4A 1X1RA 1L1FA 1G20A 2P5YA 1EVZA 4KQGA 4FN4A 1Z0SA 4H08A 1EGQA 3MB5A 2ODEA 3HNPA 3NAMA 2WSIA 3QXHA 4M89A 3K3PA 4LRYA 5DBFA 2BC9A 1MVLA 4QVGA 1MRZA 5A4MS 2BMVA 4P36A 2ZIEA 1W0JA 3AF2A 3AZPA 3DMDA 3IQHX 3H1AA 3LA6A 1UFQA 2CFIA 3LNCA 3N2GA 3W5BA 4KK4A 2H1RA 3VTZA 5IM4A 4YMLA 1S2LA 3D3EA 2Z2IA 4JLOA 5JDIC 1NQVA 4G4SP 1E2GA 1E1KA 3BWXA 3EZ7A 1J8MF 2QTMA 4CKEA 1QGAA 1ZNQO 5C37A 2XQFA 2XH8A 5FKJA 4JLDA 1KQOA 4G8DA 4O59O 3SFVA 1Q3HA 4KK3A 1N6KA 1TL7C 4KMMA 3ZTTA 2PRZA 2P2YA 1D8TA 2VIIA 4G5HA 5JWRA 1Z7GA 2BEUA 2V59A 4QXQA 5FXMA 3WSVA 4CDMA 2VJKA 5E9JA 5FQNA 4ZVSA 4DHEA 2OL4A 2PKYX 5J1TB 1V3UA 3Q0EA 3VSDA 3B20A 5JSQA 4XIFA 3TQIA 1KBQA 3BB4A 5HX7A 3WL7A 4ZOBA 5DHRA 2HH9A 4QECA 1YMQA 3GCZA 4DZZA 3D8UA 2EJVA 4WTOA 4F3KA 3V2GA 4MVJI 3PP8A 2XUIA 3SXUA 2JGRA 3M9XA 4N8SA 5LA6B 3X3HA 2R8RA 2F90A 3QNWA 3NZEA 3IAEA 1SHJA 2WTEA 3K6JA 5YASA 1O54A 3MWFA 4C0SA 4KI0A 2J3LA 4F4CA 3R24A 4F8JA 4E1VA 1J0CA 1A9QA 4N6NA 1AA6A 3C8MA 1TQHA 4PYQA 3QEKA 1Y9AA 3L8YA 1BA3A 3IUSA 3ZKWB 2WD7B 3RF6A 1GCOA 3VNBA 4OLBA 1XHEA 5DIFA 3U49A 3GT0A 3OD5A 3JQGB 2A5DA 3C6QA 3ZJUA 4HOYA 4FZ5A 2RHMA 1G7CA 1FP2A 3DM9B 3ABZA 3H18A 4RELA 3W6UA 1O9GA 2VSNA 3CF6R 2EFCB 4ANFA 3ZE7A 5HKKD 1UT8A 4ZFNA 3UENA 4MYSA 1I4DD 1FMFA 4AG5A 3WTCA 2GESA 1O95D 2ZEJA 3KBOA 5EWLB 4U9UA 4WESB 1Q11A 4FDMA 3HCCA 5KYVA 1WY5A 2WT9A 3IIMA 4O5OA 5U4QA 3GAMA 4C06A 4WA8A 1QHSA 2EAUA