4RTOA

Complex of escherichia coli dna adenine methyltransferase (dam) with sinefungin and with dna containing proximal pap regulon sequence
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
268
structure length
249
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSKKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
total genus 78
structure length 249
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtoA01
1YFLA 1NBIA 3GRYA 4OQEA 1QYRA 4GOOD 1UFKA 4PYQA 5ERGB 5FQNA 3T7RA 2H00A 3KPYA 1M6YA 3FYCA 2QM3A 4RTPA 2AOWA 2HTEA 1JQ3A 4JXJA 2OY0A 3JWHA 2F8LA 4X41A 4OBXA 3FUXA 3P9IA 5FQOA 5T64A 4DKJA 3PFGA 1PJZA 1WXXA 2PJDA 5E9QA 4DCGA 5K0NA 2JJQA 4EKIA 3UJ9A 1O9GA 5EVJA 4C07A 1VIDA 3R9XB 4GEKA 4M7RA 2EG5A 2AVNA 4Z2YA 2QYOA 2HNKA 4DM3A 5LQKA 2AN3A 1KIAA 2JHPA 2ZWVA 1I9GA 1XDZA 4QTTB 3KQSA 1YFJA 4QQNA 3ELDA 3LX6A 5EQJB 2AR0A 5CVUA 2PKWA 4A6EA 5F2OA 2OXTA 5KS2A 2OB1A 1RJEA 2FK7A 3OZSA 3DULA 2P40A 4XUDA 3KR1A 4YUZA 2UYQA 5CVEA 4QVGA 1U2ZA 3OPNA 4WXHA 1KP9A 1JG2A 1SQGA 3CJTA 5DSXA 3HCDA 3O7WA 3SM3A 4WVLA 2GH1A 4RTKA 2DPMA 3S68A 4CKBA 3G8BA 4RTJA 5K0EA 5KQRA 2IP2A 2FPOA 2O57A 1RJDA 1I4WA 4PWYA 3HM2A 4PIMA 5GINE 4P58A 1D2HA 3KQYA 5HIIA 3K0BA 2IBTA 2VDWA 4PONA 5DWQA 5EIWA 2O07A 1WS6A 3HVKA 3EVCA 1QZZA 4FP9A 4C06A 5ICCA 1YUBA 3OZRA 4GC5A 4P7JA 5FHQA 5ICFA 3RW9A 3SXJA 4M38A 4EQZA 5ICGA 2QE6A 5EKUA 3B7PA 4DZRA 2BR5A 1ORHA 5CM2Z 4A6DA 2P3QA 3AWIA 3B89A 3MHTA 2ERCA 2VS1A 1NT2A 2V7EA 1ZGJA 2P35A 4KWCA 2PV0A 3FZGA 1NW7A 2XYRA 3G2QA 3NDJA 4PGGA 3Q87B 3KPVA 2YX1A 5DM0A 5EMLA 2EX4A 4QDKA 1L1EA 2PX4A 2B25A 4BLVA 4E33A 3I9FA 3BGVA 4QVKA 3KQWA 4R8SA 1P91A 5E8JA 1QAMA 2JHAA 1X1AA 1V39A 4Y30A 5FHRA 2ZCJA 5DT2A 3FUWA 3DOUA 1R6AA 4XUCA 3SR4A 3OE4A 1G55A 3AXSA 2UZ4A 1Q0TA 3SVZA 4E2ZA 2FHPA 1R8YA 2B78A 3B3JA 3EVZA 3KPWA 2PBFA 3R24A 2ZIEA 3VSEA 1X1CA 3UJAA 2UYHA 1MHTA 1KPIA 3KQOA 3FTCA 2HMYB 4GBED 1EAMA 1KXZA 1B42A 2G71A 3UZUA 3FPFA 3TKAA 1FP2A 2P8JA 3KR0A 2AOUA 3ORHA 8MHTA 1TW3A 4GQBA 4R05A 5E1OA 4MWZA 4YV0A 2QY6A 1XDSA 2YUIA 3G89A 4MIKA 1NE2A 3DMFA 3GRZA 3SSMA 1BHJA 4BP1A 3G8AA 3GDHA 3OU6A 2OKCA 4RVHA 3JWGA 4O29A 2G8NA 3TRKA 5FTWA 1NV9A 4YUXA 4CTKA 2G70A 2OB2A 4BLWA 3KR2A 3NDIA 5DX0A 2I7CA 3DLCA 3G2PA 3GRVA 4DMGA 3MQ2A 5CVJA 5FULA 4CKCA 5FUBA 4GC9A 1EIZA 2ZIFA 4OQDA 4RWZA 4X63A 2ZZNA 1R00A 2ZBQA 3M4XA 4FT4A 1JTEA 5CUQA 2Q41A 2CL5A 2PX8A 3A7EA 3HVHA 4MHTA 3KQMA 3GJYA 5HIMA 3DLIA 2PVCA 3CVOA 3OFJA 1KPGA 2NXNA 3MCTA 3PTAA 3PB3A 1ORIA 2ZZKA 3PS9A 2ZSUA 4X60A 3UJ6A 5K0GA 4RVGA 5FA8A 2G1PA 1WY7A 3B3FA 3KU1A 4RVFA 2VDVE 3QOWA 4C03A 3KPJA 3CJQA 2IH4A 4AZWA 5JUWA 5G02A 2YXDA 2PSSA 4KRGA 5K8VA 4P7FA 4OA8A 3REOA 2PX5A 1RI4A 3GCZA 1XCLA 2WK1A 3BXOA 3I5UA 3I64A 4OBWA 5K01A 1OR8A 1XJ5A 3O4FA 5K03A 4E2YA 5K0BA 2NNWB 2IH5A 1JG4A 3M6UA 3A26A 1WXWA 4IKPA 4FZVA 4HC4A 3EEOA 2BM8A 3TKYA 1D2CA 2CKDA 2PT6A 3ELUA 3NTVA 4ER0A 1IXKA 4HGYA 5BXYA 2YQZA 1DL5A 2AOUB 3HP7A 1F3LA 2I6GA 3LL7A 3M70A 5FADA 3BWCA 1HNNA 2XVAA 3A7DA 3G88A 2B2CA 3CC8A 3KQQA 3SGLA 4AUKA 2YXLA 5E2BA 3BWBA 5EKXA 4PYMA 1VE3A 2ONYA 3EVGA 4DF3A 5DTRA 3EPPA 3EVAA 1P39A 2G72A 10MHA 4NECA 1L3IA 2Y1WA 3WSTA 2P1DA 3FUVA 4F85A 3UWPA 4XCXA 3LHDA 2PLWA 3A27A 2UYOA 3QOXA 5JR3A 2IDJA 1RI2A 2HV9A 1ZGAA 2NXEA 3VYWA 5IKMA 2VDUE 2ZWAA 1HMYA 2K4MA 1YF3A 4PCLA 4B17A 4FT2A 1JQDA 3LKDA 3MERA 3BGIA 4QDJA 1TPYA 5EHGA 3TPZA 4CTJA 4F86A 3NMUF 1RJGA 5GWXA 4HTFB 2ZLBA 4KDCA 1SVUA 2WA2A 4OA5A 4R6WA 5EMJA 4EMSA 1L3CA 2XBMA 1N7IA 4P7GA 4KDRA 1O54A 4Y2HA 5CVDA 5E1MA 3KKZA 1SG9A 2R6ZA 3KPUA 3T7TA 4KIFA 5GM2A 4ER5A 1EG2A 2ZVJA 4IV8A 3LPMA 5DTQA 3TLJA 1XVAA 2EFJA 3NWEA 5K0JA 4GOLD 5DXAA 4IV0A 2FYTA 2H11A 4KW7A 3DMHA 4LWPA 5EG5A 3C6KA 2OYRA 1INLA 3HTXA 4GOMD 1R8XA 2QRVB 2XYVA 2ZTHA 1EJ0A 3MTIA 3QV2A 4V0RA 3T7SA 4ZTBA 4E2XA 3TQSA 4YMGA 4R8RA 4MTLA 1XXLA 3C6MA 2GS9A 3B5IA 1VBFA 2AZTA 4RTNA 5C9ZA 2R3SA 2GB4A 3LBYA 4GUAA 3ERCA 5KQSA 3TFWA 3ER8A 3E7PA 3UJCA 1JSZA 1DUSA 2ZBRA 3ELYA 5GIOE 1TW2A 1P1BA 3P97A 2OO3A 3PFHA 2AOVA 2VZ9A 1T43A 3LKZA 4GF5A 1IY9A 2NXCA 1NBHA 3SMQA 3OU7A 4YV1A 3F4KA 3IYLW 3EGIA 4AZVA 4P7KA 4PYLA 2JH9A 5KVAA 4PYNA 1G60A 1F38A 3GXOA 3Q7EA 3ME5A 4RYLA 2P3OA 5H02A 2P7IA 3UA3A 4C4AA 3BKWA 3MTEA 5BP7A 2ZIGA 4RV9A 1Z3CA 1X1DA 5LQJA 3KHKA 1FPQA 3C3YA 2ORED 1JG3A 1ZHFA 4PYKA 3FTEA 2HR1A 3BZBA 2PWYA 3R6TA 5T6BA 5E9WA 3FTDA 3TM4A 3JWIA 4L7VA 2XVMA 2ZW9A 5K0LA 2FRXA 4PINA 4E31A 3ER9A 1AV6A 3CJRA 2EJUA 2O05A 4U7PB 4HG2A 4HGZA 3BT7A 5DSTA 3BKXA 5LSAA 1EJ6A 1XCJA 3SSNA 5D1NA 5HIKA 4RTQA 1AQIA 2B9EA 3GU3A 3IHTA 3FRHA 5EMKA 2ONZA 4PNEA 3TMAA 1RI3A 3FPEA 3AXTA 1VP3A 3DR5A 1VL5A 2KW5A 3HA7A 5FWDA 5EMMA 4YMHA 1JG1A 3H2BA 5LQCA 3FUTA 1Y8CA 4BP3A 4FGZA 3LSTA 2QRVA 3OCJA 1VPTA 3OE5A 4LG1A 4K6MA 3HVIA 4R6XA 5K05A 2YTZA 4YV2A 2UYCA 5EZSA 2Y1XA 3NJRA 3C0KA 3E23A 1SQFA 2A14A 4H0NA 3HNRA 4QQKA 5F2KA 4UOEA 3E8SA 3KQTA 5CVVA 4PIPA 3EVFA 4HRAA 3LECA 3HA5A 2PXCA 4LECA 2Z6QA 3UA4A 2LD4A 2BR4A 1QANA 5CCXA 9MHTA 2OPBA 3D2LA 3EMDA 3GWZA 5EC8A 5E2AA 3HEMA 1G38A 2AOTB 4FSXA 5FA5A 1R74A 3OU2A 4FSDA 2CWWA 2C7QA 1NW8A 2PGXA 1P1CA 2NP6A 3TM5A 3ID6C 3KQVA 3LGAA 3MAGA 1PRYA 5DXJA 4AX8A 1NW6A 3EGVA 4RSRA 1BC5A 3FPHA 5HILA 5K09A 1RJFA 3R3HA 4M36A 3UFBA 3RIEA 4GOND 1JR4A 1SUSA 5LR6A 2ADMA 3DXXA 1M0EA 1KYWA 3I58A 4ER3A 5CIYA 2PT9A 3G5TA 4AZTA 1G8SA 2B3TA 3M6XA 1YZ3A 5DRTA 4ATNA 2ZULA 2FCAA 3M33A 5HEKA 2IIPA 1NW5A 3P2IA 1WG8A 3HCCA 4X61A 5DRYA 2NP7A 3C3PA 3PT9A 4YUWA 2GAFA 5BW5A 5ICEA 3NVKI 5U4XA 4IWNA 2O06A 3B3GA 2AOTA 5GP1A 2BH2A 3L8DA 1X19A 3ANXA 3O31A 1SKMA 1ZKDA 3TR6A 1QAOA 5E1DA 2HWKA 4EVIA 5LQAA 3VC2A 5KYGA 2ZFUA 5LQRA 5GM1A 5K0FA 5EEHA 3THSA 4RTMA 1M6EX 1UIRA 1Q0SA 3P9NA 5FCDA 4OX9Y 4LWOA 3M6WA 3UBTA 5EPEA 1KYZA 4XUEA 5D1HA 4PYJA 2XYQA 5BW4A 5CCBA 3DMGA 3X0DA 1BKYA 2EJTA 4CXMA 5B1SA 4F84A 3PVCA 3G2OA 1SUIA 2PXAA 4M37A 4YUYA 5MHTA 3HCEA 1QAQA 1N2XA 1VP9A 3OFKA 3BUSA 3PX3A 1R18A 5FWAA 1H1DA 2Z6UA 2C7PA 2C7RA 2AN4A 3FPGA 3M6VA 5DX1A 5EHIA 5C0OE 4BLUA 1AQJA 2Z6AA 1NKVA 3UJ7A 2IH2A 4FR0A 1RI1A 5GOZA 3SX0A 2GPYA 3GRUA 5DTMA 2IFTA 4PYOA 3GNLA 4FS8A 5F2NA 1WZNA 4YUVA 5EIFA 1X1BA 3VC1A 2NYUA 5LQNA 3V8VA 4RVDA 3MGGA 5P8WA 3THRA 4QPPA 3IEIA 2IDKA 3DXZA 4PGHA 3PX2A 1JSXA 5DM4A 1N7JA 2YVLA 3EVBA 3G5LA 3FTFA 2P7HA 2OBFA 3LCCA 1O9HA 2WA1A 2AN5A 3K6RA 5HIJA 4C05A 1I1NA 3G7UA 3HCBA 3E05A 2P3LA 2JH8A 5CD1A 2JHCA 3HCFA 1NV8A 3NVMB 4RTOA 7MHTA 1D2GA 3GIWA 3ELWA 3AY0A 3GGDA 2DULA 1RI5A 4HH4A 4E2WA 3DUWA 3IV6A 3G2MA 3P8ZA 1FBNA 3FPJA 3CBGA 2PXXA 3UJBA 2PWPA 1FP1D 1G6Q1 3P9CA 4QPNA 3GRRA 4E30A 4RTSA 1EQAA 2V74B 5EEGA 4RTLA 1XTPA 3U81A 1KR5A 2JG3A 5DX8A 3LCUA 3FRIA 3PLAE 5T67A 3EMBA 3HA3A 5IH3A 2AOXA 5M5BA 4DA4A 4PCAA 2N47A 5DPMA 3LDUA 3P2EA 2GLUA 4DQ0A 3TOSA 5LQUA 4EK9A 3DH0A 2IGTA 1XDUA 3DXYA 3NWBA 2YXEA 4ER6A 2GA9A 3UJDA 2E5WA 5EZQA 4CWAA 4PYIA 3RODA 3MB5A 1BOOA 1ZQ9A 4KVZA 4EKGA 3SSOA 3OZTA 3EVEA 5C1IA 4AZSA 1IM8A 1FJXA 2BM9A 4U7TB 2H1RA 4X1OA 3AJDA 3HVJA 1JQEA 1UWVA 1YB2A 2AS0A 3BWMA 3EEYA 4HTFA 4CKEA 5GIPE 3P71T 5E8RA 2C7OA 2YR0A 4E32A 3EVDA 4E70A 3CCFA 3EGEA 2PY6A 2I9KA 1AF7A 2ZZMA 1KHHA 4KIGA 2VP3A 3A4TA 3DP7A 3LDFA 4RTRA 5DM1A 1VQ1A 4HSGA 4C08A 4DCMA 3JWJA 2BR3A 2CMHA 4G56A 4ISCA 5DLYA 5HFJA 3FUUA 1JTFA 3V97A 2IBSA 1G8AA 3CKKA 1KPHA 1VLMA 1L3BA 3CGGA 5HZMA 2NXJA 1L9KA 4BY9E 2I62A 3GO4A 2AVDA 3LCVB 5E9JA 4POOA 2IPXA 3T0IA 2BZGA 2FK8A 3LDGA 3KR9A 5HOQA 3BGDA 4QTUB 2O0LA 3FYDA 3P9KA 5E1BA 4MQ4A 1NW3A 4C04A 3NW9A 4RX1A 3LBFA 2PX2A 3DTNA 3R0QA 3MCZA 1DCTA 2OZVA 1ZG3A 2P41A 5K0CA 1MJFA 3BWYA 4ER7A 5DM2A 3A25A 5EOVA 3KQPA 2CMGA 3I53A 5EGSA 3P2KA 4V0QA 2ESRA 3HCAA 1YZHA 3UJ8A 2ZBPA
chains in the Genus database with same CATH superfamily
1FA9A 1HRDA 1VI2A 2PD4A 4RA6A 4JUDX 5EESA 1KOJA 4OJNA 4MP3A 3ADCA 5BQXA 2CFTA 5E6RA 3N8HA 4JI2B 2OCBA 4ZALA 4W1SA 5GZ1A 3ANMA 3G0HA 3K4PA 1W1WA 4EB6A 1V26A 2J5XA 1AIPA 4KIUA 4PXAA 4EJSC 4GL2A 3DBHB 2E5LB 1O9GA 1P29A 1VIAA 1VIDA 3PNMA 3RKUA 3VZDA 3W4IA 4C07A 2FDCA 2DH5A 4MQEB 3JW8A 2AQ8A 1MB3A 2A59A 1K27A 3MELA 3P1JA 4MWSA 2AN3A 4G0XA 1E6UA 4MJXA 4AY4A 4BEVA 1CEQA 2V4MA 4X24A 4QQNA 2PAAA 1GUZA 5EQJB 4QU0A 2WB4A 4TQUS 1GQQA 4BXOA 1OJLA 2A9FA 3R40A 1H2HA 2Y0EA 2FEKA 1A50B 4MSUA 5EZ6B 2UYQA 3OLYA 3CZCA 3RIGA 3ZJ4A 4YUZA 1U2ZA 1NQTA 3PGVA 4D9GA 1Z39A 3O8BA 1UBJS 4J90A 3V4OA 4I1PA 4CQMB 4JL5A 2HK9A 1JG6A 4MCHA 4EYQA 3V7WA 2DPMA 4AG3A 4IUYA 1RVDA 4ARIA 4LDNA 3EIWA 1H6DA 1JAZA 2HA0A 4FHGA 4HH3C 1YZFA 2OQ2A 4PR3A 1D2HA 1K8YB 2AHOA 2CXSA 3JRWA 4GRIA 4PONA 5C8YA 5DWQA 2WNSA 4F38A 4K86A 5HM8A 1Z68A 2ANCA 4NBRA 1MRNA 4P3PA 4W6ZA 1TFRA 1NXXA 2A67A 3A6HA 2J46A 3SXJA 3UO8B 1Z7GA 1S7GA 2GN2A 2ZRLA 2CEKA 3KUXA 4XJXA 4AP6A 1H0KA 4IRMA 1ZVVA 5EN4A 2OQRA 1OHHD 3EUAA 3ETJA 1UR5A 2ZUWA 3ZC3A 1U0EA 3IDAA 5IJ0A 1G2OA 3MHTA 1TJYA 5AMXA 1TYAE 2BGWA 1ZCFA 2WJ3A 1HC7A 2VZEA 3FZGA 3U3XA 5EWJB 2H85A 1QC5A 2DTXA 3CSDA 4IJKA 5DE3A 5BN5A 3NO4A 5B58C 1NMEA 3UCXA 3I9FA 1AE1A 4L5YA 3AIMA 1YH3A 1P5ZB 3L7KA 4DYVA 4LFAB 5CPFA 4L07A 5JJ5A 1JWBB 2YV3A 3VU9B 2DWPA 4G5QA 2I3DA 1KMNA 1XTIA 4XQ9A 4DTIA 3Q6NA 2V7VA 2QV0A 3N2EA 3IMGA 1KMQA 4IHAA 5D2CA 1K2VN 3GT3A 2Q0XA 2TMKA 3PXGA 4RMHA 2VP9A 1DPFA 4FOSA 1I7LA 4TQAA 4KRXA 3EN0A 1XJWA 1RXEA 3CMMA 4PGMA 3QU5A 2GCGA 2J08A 1BD4A 1OHHA 1E64A 2C4KA 2JEZA 2VNHA 1P6XA 4IF4A 3TX2A 2PQMA 4IIVA 1TZBA 4UW9A 4WEQA 3UBMA 1U0SY 2W4QA 5JZ9A 2Q3LA 4A2CA 4JJGA 4A9AA 3PUVA 3ZUGA 2C2BA 2REXB 3WGQA 1WM1A 4JASB 4MS3B 2OHHA 4IDQA 1K4MA 2SCUA 1C1DB 2H9YA 1VMEA 3UK7A 1RKBA 1U98A 3IBYA 3EGDB 3DAOA 3M2TA 3UAYA 4BO0A 1FQKA 4TVSA 2PH3A 3Q7TA 4G1EB 1N6OA 1ZH6A 3JWGA 4J76A 4WW0A 3A6DA 3DL2A 1FRFS 3BTUA 2IXAA 3ENQA 4JUBA 2PSJA 2QSJA 3G5AA 1MNAA 4RMNA 1BCRA 4WCFB 5L8VA 3DLCA 2I0FA 5IWAB 1VL1A 5D3MA 3FKSA 1KI4A 4DUGD 1HKHA 4GC9A 2FSSA 4YP0A 1GNVA 2EFCB 4DLXA 4HLNA 5E3JA 2Z83A 4PSKA 2CL5A 3FHOA 3HVHA 3HJNA 4RV5A 1C0LA 3ZLUA 4FFVA 2XMCA 4WDRA 1DVRA 4EF4A 3K35A 2OCIA 3CVOA 3OFJA 1CQJB 4D9FA 5KKCA 3FROA 3WQSB 4UDYX 3LYLA 2GKGA 4EB6B 4UUQA 3KETA 1S1MA 4EKYA 1DC8A 2VXOA 4G6ZA 4KYVA 1A9XB 4C5AA 1CC1S 4QREA 1IUKA 4C7OA 1KI3A 4MR7A 3JQAB 1YCFA 4AZWA 1NZJA 2UUCB 5C3UA 3RT9A 2JBHA 4GMHA 2AN9A 1FFAA 2XTZA 4TLCA 3V33A 4AJHA 1JFFA 3I64A 3U48A 3VVLA 5C31A 1JZTA 2CEAA 2WFLB 1OY1A 3IUEA 2G3YA 3MK31 2WIDA 4HMOA 1NBAA 5BSUA 3TJMA 4RGQA 2CUNA 4DNXA 1P2GA 1Q3HA 4U7DA 1V8FA 1SVLA 1O1YA 3T61A 1PF7E 2EGHA 4CQNA 4GGOA 5BQ5A 1OXKB 5JROA 3LWZA 3AUTA 1HLGA 2ZB3A 2YQZA 1Z4PX 3AHIA 4N0QA 4WY8A 3SI7A 4DMRA 1OB5A 5TQJA 2DKFA 3G0DA 2AZMA 2B2CA 4CM9D 2BKEA 2O2YA 2OGUA 2WJ6A 3E6AA 3OQMA 4PYMA 4R1MA 2WPDA 2HK7A 3ZLBA 1P1IA 2B4AA 2NV0A 5TPZA 2JL1A 1XEFA 3VHRA 3OQBA 5KCZA 1VYVA 3TDKA 3L1UA 1JQJC 3KL2A 5KJ6A 4Y2RA 3CZQA 2ZWAA 4JJ7A 1HMYA 1O95A 1YF3A 2C54A 4F8JA 6CHYA 4QDJA 5JRJA 1TPYA 4CTJA 4B9AA 1M54A 4ND7A 4B3TB 5EE9A 1EVLA 1AUXA 3ODGA 5IHPA 4HUJA 2VOJA 2OO7A 1DV1A 5C1BA 4PTZA 3CNBA 1MJNA 5GM2A 4E94A 3KV3O 1I32A 4LE1A 4K9KA 5AVUA 2RHJA 3KQNA 4Z3OA 1QX4A 2OD7A 2W2LD 1Z6AA 2GN0A 4OUKX 3L46A 2YINC 4GOMD 1GPDG 2AG0A 3HABA 4KJZA 4O4LF 4W8HA 1RQPA 4LHWA 3WB9A 1AMOA 3WJ2A 1NX9A 2FEOA 1TUBA 1B6GA 2C5GA 2O2HA 3B5IA 4OK3A 4RTNA 4WZZA 5DGCA 3LBYA 4MJ3A 5AKLA 3K6SB 5KQSA 2B83A 2OFPA 4BB9A 3H2HA 4XB2A 1JIUA 2R2GA 2XA1A 5BYBA 1JUDA 4BGDA 5HUQA 1R8JA 3L01A 3OLZA 1NVBA 3T9AA 2VZ9A 2GF9A 1F8FA 1T43A 3OX1A 2QD3A 1KSGA 2ENUA 3UYKA 3WYAA 1P3Y1 1L5ZA 1Q1ZA 1YNSA 5JCOA 2QPTA 1FB5A 3VKGA 4G37A 1BE8A 1CVLA 5KNCA 2J85A 3KZKA 3P20A 2XCIA 3GXOA 5LQJA 1EE9A 2H18A 3BMNA 4ROSA 1W0JD 4Y0AA 3NRJA 4EHIA 2VDMB 2Z2XA 1TAQA 1H94A 2R8BA 1DXOA 3CX7A 3GGCA 1U7TA 4LNHA 5I7OA 1S2DA 2FSGA 2BUCA 4MARA 4BVAA 4FKBA 5KNCD 3ISVA 3EZFA 3V1LA 5AUPB 1V6SA 2IZ0A 3OWHA 2IWHA 3T94A 1MQ8B 3I12A 1MO5A 1X8XA 2X5KO 1Z45A 1AC5A 5HG0A 5SZKB 1S8FA 3NHBA 1J5XA 4PZDA 2IHTA 3PQ6A 3A4MA 5NULA 3IAAA 3L84A 3HO1A 3BKXA 1G6KA 1RKQA 1XIVA 1U8EA 1DNPA 3BS4A 4UVEA 3AETA 3LHFA 4GOXA 1AKEA 3R4CA 2O1XA 1C0KA 1U5CA 2V59A 5A06A 2WTAA 3S2IA 2EJBA 4DMMA 1TCUA 4HGPA 2COEA 4IX9A 1KZYC 2VYND 4WJKB 4ZCLA 3W5SA 5L3QA 3GLUA 3IXQA 1WKCA 2Z30A 4FMDF 1E4EB 1YR8A 4GDMA 4FI3C 3PXBA 3OCJA 4HMQA 1K7CA 2QD5A 1KZHA 3U37A 5K05A 1T0IA 4P33A 4QDOA 1VKRA 4NU0A 3U62A 1EA7A 1XYGA 3GNSA 4X97A 5L7TA 2PUDA 2Q1SA 4UOEA 1TGVA 1G2QA 1PLLA 2I2WA 1C30B 4WFQA 3ZHXA 4ETNA 3S8MA 2HSWA 1Z0IA 1XD2A 1PQYA 1OFHA 2VHEA 2XUJA 3IT1A 2P78A 4RESA 5AVSA 5ENVA 2JB9A 3LIPA 9MHTA 4KQKA 1E1MA 3AH8A 3PWTA 1L0BA 3DZDA 1BDMA 2HCJB 3KRTA 4HWTA 1WVMA 4BPBA 5B1YA 1ST3A 4XLLA 3QKRB 5HF6A 3AV0B 2Y93A 3P0FA 4EHLA 1GTSA 1EM8A 5F77A 4GS5A 1CP3A 3K9QO 2L2QA 4NAUA 1AZWA 1HQDA 3OF5A 4M88A 3EDMA 3UMFA 1DB3A 5TPWB 4AIRA 3LO8A 3OUZA 4ZI7B 3TI9A 1JHVA 3IB6A 2HQRA 3JV7A 2X0JA 1N6RA 1SKYE 2YMPA 3PE4A 4PICA 5LR6A 3AEKA 3G7SA 1UAYA 2CJFA 2CLOB 3REQB 5L51A 5CK4A 3AERB 3SQDA 4BCCA 2BFFA 3ZQ6A 4A15A 1KO5A 4MULA 4TTQA 2J6IA 3SQLA 2Q5FA 3BTSA 2IIPA 3ESBA 3ABQB 1ZJ5A 1M2VA 1Z0KA 2VNKA 5L6LB 2WICA 2VYFA 3S2EA 1TEXA 2VBFA 3HBNA 4ZJYA 2O06A 3NVKI 2YDYA 2A8YA 4Q4HA 1HG0A 4LS3A 2V3VA 5BSMA 3NEAA 1SKMA 4NEQA 1YKFA 3EISA 3OC0A 3TNDA 5F78A 3K3PA 5JECA 3IQFA 5KNBH 1LNZA 2K7ZA 2WM3A 3EQZA 4HH1A 3QW4B 4Z1OA 5JHGB 3I83A 4MUKA 1QFMA 1P80A 3GMTA 4PRZA 3UBTA 4XUEA 4Y9DA 2JRCA 4N01A 4YP7A 1ZBDA 1PR4A 1LDEA 2EJTA 4HJXA 4DUGA 1IXZA 1BX0A 4TVOA 4WGGA 4A16A 2O5CA 2X1LA 4B4WA 5JFOA 3ROZA 1C3VA 1LS1A 4MW2A 3QY9A 3W8NA 1LPPA 1E3WA 4D8UA 4MW7A 1ZGHA 5F9HA 1VLQA 2GMWA 4R31A 1U2DA 4ZVNA 1ODJA 5BY2A 1JDNA 4JT8A 3FPGA 3RKSA 4I6JA 1EP9A 3BSYA 4TM7A 1XAGA 1IEQA 2JGFA 2PTHA 4X84A 1Y7IA 3UJ7A 5MGNA 3VPHA 3CRZA 3EQ6A 5GOZA 1G8YA 2P11A 3H2YA 2PZBA 3ZCVA 3MMZA 4O4IA 4GI2A 3GNLA 5F1OA 1ULSA 3KYCB 2NO5A 4YT5A 5KNDD 3V2GA 1E3IA 4I5GA 4KKXB 2NYUA 3PJFA 5BR4A 5JPCA 4BNKA 5JJIA 4JGIA 3RVLA 2VJLA 2BCJQ 2XGMA 2PH1A 2A2ZA 3U4QA 1V8OA 2GYVA 3HKEA 4DHWA 5CD9A 5A4IS 4MUNA 1W1UA 1G5TA 2V9PA 1K4YA 4LXXA 3H2GA 2PFGA 1USIA 1SQ5A 2CUKA 4BB6A 4INZA 3H97A 1XTBA 3HCBA 4JBIA 3ZGVA 3WLTA 1IZYA 2FW7A 3SLGA 1ZIOA 3NHSA 4OEHA 4BZPA 1US8B 1TX4B 2GRAA 2K2WA 3N70A 2JLQA 4WECA 2XUPA 3P8ZA 2HNAA 2P2ZA 3F5SA 3VH4A 5I47A 4HAYA 4EI8A 1FFHA 1K2WA 2G07A 5IC6A 4WY2A 4N6OA 4DEVA 4XWKA 4WK0B 5CLQA 5FF9A 3CG0A 1HFKA 3JAWA 4QRDA 3HN7A 3DT8A 2IZ1A 1XKTA 3HNPA 4QGBA 4R51A 1BH6A 2PS0A 3G2KA 4KAXA 4PWZA 1TB4A 5DNDA 2WYUA 2ABWA 5DX8A 2VVTA 2HOQA 3BK7A 1P6QA 4RY2A 2EERA 3L7JA 1QGED 3KZ1E 4JOCA 3LP5A 3LDUA 1UBLS 4J6FA 3TXXA 1SUCA 4Q6WA 1EFAA 2RSLA 1Y4ZA 1Y3HA 9LDTA 1UBHS 3KKLA 4M0KA 1AVTA 4V0MA 4F9FA 3QXXA 1ISHA 1LS6A 3FFTA 2NSDA 3OZTA 5YASA 1UPUA 3TXAA 4B44A 5HQ3B 2HMSA 3DMPA 1AH2A 1H2AS 4X1OA 3RS7A 1J6UA 4CGYA 3UAWA 1RABA 4Q47A 1BVHA 5T3UA 3T99A 3P9ZA 1DWQA 2YR0A 1IZZA 4FMPA 2ASEA 2X7HA 3K94A 4E32A 3QQPA 4FHDA 2GVZC 5CU7A 4EUKA 5DNUA 2CWDA 3FBGA 3AKYA 2C2KA 2QJRA 1GZDA 3D7KA 5JYEA 1FRQA 2A9VA 3AUYA 1P7CA 2GTPA 2VPTA 4G56A 1I3LA 5A4DA 1N78A 1G0NA 1OA0A 5K45A 5CA1A 2GD0A 1TEZA 5DGTA 1E32A 4UU0A 1RDFA 1YDWA 1CKEA 2QJFA 1YGYA 4D4LA 3W4JA 5SZJA 4C20A 3I0ZA 5HFAA 4WZBE 3ZZNA 3KQLA 4ZOLF 2XYPA 1PUJA 2VWGA 1II9A 3EZNA 1H0RA 3ZVRA 4AJNA 4F6LA 5KQMA 5A4FS 4YR7A 1A8HA 3G0OA 3H6HA 4L8VA 3NVDA 1Z6TA 2VYQA 4PRLA 5HFNA 4OTZA 4UU1A 5KUTA 4FU0A 2OZEA 1U8AA 3G2IA 2CMGA 4LX0A 1SU7A 5M3BA 1G6HA 3ND9A 3H9CA 3R6LA 1QQ7A 1CS0B 1MX5A 2QT1A 3LZDA 1AZTA 1MV8A 3GRYA 4L2IA 4YPOA 4IFTA 1F17A 2GKOA 3S1LA 4P0TA 4U7JA 1H05A 2DPXA 3A1VA 2ZRAA 5JNUA 1JLRA 4LRUA 2QV7A 3LX4A 2RJ3A 1XNJA 1Q15A 5FA6A 4CMJA 2GPSA 2O6LA 2MWMA 4B47A 1YCDA 3AHEA 3CEMA 1P2VA 3E7WA 2X58A 5EUCA 1AXEA 1NUAA 1PR1A 2CHFA 2XGGA 2X2FA 2UXBB 1JIJA 2VRCD 2A5DA 4EJ6A 3WMRA 1P7WA 4AZ3A 5BVHA 1QR6A 1RCFA 4MUMA 4TTRA 5HCUA 4D99A 2F3UA 3H9EO 4UNPA 4E03A 3Q1KA 5INTA 3L05A 1RJWA 1IY2A 1V4BA 1XDZA 5EUBA 1E3MA 4DR7B 1FP6A 3LX6A 4CNQA 1IOZA 1TPZA 2FKAA 2JLAA 4ZGBA 5WRFA 2OXTA 5KS2A 4G81A 1E9DA 4TXLA 1FFCA 5CH8A 2XZDA 3ST7A 2AFIB 2D54A 4ND3A 3NAGA 3RBXA 1TA0A 1CJBA 2YC4C 1A97A 3T5CA 3T3HA 4BU0A 4M1ZA 5C8YF 4AY2A 1A4XA 1N8TA 2JGMA 3EOBI 2XUGA 4BNHA 3O1JC 3OJCA 4KXXA 1VE5A 3M82A 1MC4A 3HZOA 4IVPA 1M67A 4JR2A 1NQWA 4K9LA 5ALDA 5A9SA 3H4TA 3WYDA 2WVHA 3EA5A 1SIBE 5EIEA 3PEEA 5KQRA 1I4WA 1RM3A 3WNQA 3I2GA 4XX0A 2VDWA 3EFOA 3HVKA 4PV7A 1MXHA 2FZCA 3WQQA 3EPKA 3DPSA 1BDIA 5FWXB 3ICEA 2Z58A 4PRYA 4PZ9A 3WOHA 4HRXA 2COUA 2VA9A 2QE6A 3QQ5A 5I9LA 2AN1A 3JQEA 1D1PA 3G85A 2QHXA 4MGZR 4QU9A 3RSFA 2FUG1 2J6BA 1M9NA 5JW6A 5CG1A 3QHPA 1DXYA 3AWIA 3GMIA 2XHEA 1Q16A 3MTBA 3TKLA 1S2MA 5IXJA 3BFKA 2BKLA 4PVDA 3GLGE 3UMGA 1V5GA 2ZOSA 1E0DA 2P35A 4QUGA 1H66A 4I2NA 1WL8A 2E4AA 1E6LA 3L07A 4ZRDA 2CMFA 5AIBA 5LP6F 2Z5FA 5JQWA 4KLZA 1VKOA 2QK4A 5JSZB 1Z5NA 5IZCA 3WDMA 1JILA 2R44A 1E4VA 2J6HA 4Y2SA 1F48A 3ZDDA 4XUGB 1L9XA 1XZAA 3FYUB 1X1RA 7YASA 3V32A 1E58A 4AUEA 2JLXA 4RENA 1JALA 4OD0A 1FMLA 1PT6A 4P5DA 3K2EA 1B16A 2H1WA 4JYPA 2B78A 3ZDZB 2WHYA 1DJPA 2FZWA 2I29A 5F7ZA 3TTSA 1JMYA 4LF4B 4BKQA 1B76A 2O7VA 4GBED 1YJ8A 6ABPA 1B42A 1GD1O 5JSUA 1P9WA 2JAXA 3X1JA 1F1BA 4PPQA 3TZKA 2WD7B 5LYJB 4GQBA 1T36B 3W5BA 1JL3A 3DCIA 2FQQA 2WV7A 2B5VA 1FBTA 1UUFA 4FYIA 2BONA 1VJDA 4JC4A 4MUXA 3T41A 3OHMA 4D8TA 4C7BA 1HPLA 2PT7A 1OX5A 4O4HA 4IHQA 2QROA 2E6KA 4DABA 5BUCA 4NJEA 5G2OA 3O47A 1SBZA 4J0QA 4ZCQA 3TQRA 2FPSA 1TUGA 4W99A 2B99A 1CRPA 4PCUA 2QMZA 2IYRA 1AMNA 1YASA 3VNSA 2X5OA 3NGLA 1LI7A 2I7CA 5BN1A 1TMOA 1SAYA 3G2PA 5TIIA 4HFJA 3TFOA 3EWSA 3CIFA 2N0SA 5FUWA 2C97A 2AW5A 3FLBA 2Q41A 1X38A 3A7EA 5TGDA 1QPZA 1YR1A 1UFQA 1IAQA 1S01A 3IKJA 4YRTA 3SQMA 4BQEA 3NHZA 1IC6A 3PL1A 3X1ZA 4B6EA 1D8TA 3AI2A 4M89A 2ZYHA 4FN4A 4R8LA 3PTLA 1ZD4A 5L7WA 2K7FA 2WSBA 4I4TB 2PGNA 4A1FA 4RVGA 1RHRA 1PV1A 3D7RA 5F1KA 1F2UB 4XM1A 5I7SA 3D6UA 1ATIA 1JA0A 3JS5A 3DC2A 3MFYA 1M5RA 1AUPA 3DV2A 4OXYA 4UNRA 1IE3A 3WLOA 4RA6B 1QE0A 4P4SA 4FFRA 4I14A 3RJZA 2FDRA 5JLJA 1UMBB 3HJGA 3L8YA 4OOEA 1I2ZA 3NJ4A 4NZ9A 4YIKA 4ZTUB 1JBEA 2PK3A 4QFMA 1IN1A 4CLHA 5DBIA 2OGWA 2A9KA 3SR3A 4IKPA 1VI5A 4HYTA 3AEUB 3W77A 1E89A 1Z4JA 2EARA 1OGIA 1QIHA 2A1TR 3LYUA 4UBMA 3R7DA 2V3WA 5C52B 2I6FA 4G01B 3EMKA 3R7NA 4JQSA 4AFNA 3JQGA 4YC7A 1CDDA 4AKIA 3WLAA 4B0OA 3MIIA 1U9JA 3NC1C 2ZDHA 1DKOA 3BWCA 4G67A 3RWBA 4LDAA 1MB9A 2WTMA 2OAQ1 5SV2A 3IJ5A 4GXRA 2I3BA 1TCVA 3V1YA 1RC8A 4IVRA 2IZZA 2MSEB 2G1AA 3C5EA 4UEWA 5HK8A 3OY7A 5KAMA 4KAAA 3VSDA 4CCSA 4DJEC 4WZAB 1PU2A 2BFDB 3DEJA 4D44A 1ZCBA 2G8LA 1Z8HA 2I6TA 3D3WA 3QOXA 2IDJA 4G1CA 2OAP1 4HUTA 5K3DA 3GPIA 4JR0A 5B1DA 2W4IA 3Q8KA 1D03A 1Q57A 4I1VA 5C81A 1L7NA 2V7XA 3GRCA 3L06A 3NJ8A 1U2SA 2Q6OA 4FHZA 4QGHA 1K9VF 4F86A 4H35A 2QJTA 1QZXA 3PU6A 4OQMA 1DRUA 3SJZA 4PAWA 1GTMA 1R5NA 4R7GA 2WA2A 4M7PA 5EMJA 3VH1A 4UDXX 3TSCA 2D4HA 4J0FA 2WLTA 4KDRA 3RVKA 2BSAA 3ENWA 4TT8A 1Q7EA 4B32A 2PD6A 3V5NA 2VBCA 2GQ0A 2XA9A 4D0RA 2MSLA 2VG8A 2FYTA 3Q85A 1OLUA 3RU3A 4I9GA 4R2WA 4LJSA 1OI2A 1TYBE 1YHZA 3EEBA 4AMUA 1K6IA 4YMGA 3MXOA 4IAOA 4AJOA 1G4UR 1VBKA 4K3VA 4LRYA 1RW4A 4Q7MB 1UFVA 1KK1A 1MOQA 2BMFA 2YCLA 3GA5A 2HJRA 1QHGA 3PJEA 4IXTA 4NK5A 4ZZ2A 4Z7OB 1QE3A 4GKVA 4NI5A 1SZDA 3JQAD 3NKLA 4U9HS 4QICA 2O52A 3PC8A 2YW9A 5LQSA 3B9BA 3EJ6A 2ZGVA 1UBSB 3EIUA 4CU5A 1Z8FA 3LKZA 1Y1RA 1CK4A 5JQGA 4Z49A 2YZNA 3KXPA 4IDAA 2W2TA 3BD8A 4QFBA 4EX7A 5EE5B 4R1NA 3WKDA 4GRDA 2RK4A 5CFNA 3I6MA 1N9GB 2O8CB 4U5QA 3G17A 1M75A 4GX1A 1R5BA 4F1KA 4S1WA 1ZGGA 2O1EA 3H99A 3O93A 3Q7EA 4C3OB 4XRGA 3MTEA 1Y82A 2HXSA 4N8DA 5AKJA 2XGJA 1FNBA 3AUUA 1P2DA 2CJYA 3PDHA 4MICA 3HDTA 2GK3A 4L0CA 4Z8XA 1KORA 3H1GA 3DVSX 2Q2WA 4PIVA 4MDYA 1AK2A 2AHRA 1HQKA 4YDSA 3R9XA 1E1RA 3ZY2A 2C7VA 4FQ5A 4DV5B 4KPUB 2EJUA 1E1DA 4BDSA 1OGJA 5CR9A 4W1RA 3HEBA 1V3VA 2O9JA 5TQ0A 3FDXA 3PL5A 2GBLA 4LC9A 1IPEA 3EAGA 1EJ6A 3N2LA 3SYKA 5LSAA 3SHQA 4V0SA 4M53A 4LXYA 3L02A 1XKQA 1T5OA 4RHFA 4AY5A 4EI2A 3ZUPA 1B0AA 2GZ1A 3DDSA 4MYHA 4YLGA 3CNLA 5AP9A 2QPOA 4IOLA 1C7RA 1P81A 1TJNA 3IBFA 2VUSA 1FS5A 2W98A 2YWXA 3FPEA 3AOEC 1UBGA 3A1DA 4R9VA 5AVOA 3ZDXB 1ODSA 1XELA 4Z8YA 1SUWA 2IXFA 1THZA 1MQAA 5BMVF 1MRSA 4PBSA 4TMYA 4G5XA 1ABFA 4ZO6A 1LK5A 3IT3A 2IHBA 4OGWA 1MEOA 1NDHA 4W7SA 1QQBA 2Q29A 3U6KA 3D4PA 1LDGA 1SQFA 2C58A 3HNRA 1E5DA 4H0NA 5F2KA 1IY8A 3ZE7A 4AN1A 2O0HA 1HR0B 1JXMA 2WW8A 1MCZA 2CVOA 2ET6A 4QTZA 3VPBA 1J24A 1E18A 1TMKA 2AYXA 1KMMA 3AYXB 3WL5A 2Z8YM 4YAFA 2BMEA 1QANA 1XZQA 1LQ2A 5LKAA 3SC3A 2O8BA 3TQFA 4F4JA 2EW8A 2G4CA 1Z0JA 2BIFA 4HY3A 4BLSA 3O94A 1UM9A 1VL6A 2ZIXB 4R2KA 2GCOB 4RLHA 3UMJA 4CN9A 5HR5A 4MCAA 5HZGA 3QX3A 1PGPA 5CFRA 2ETVA 1TDJA 2FVXA 1TKRA 1HFWA 1K1EA 4MGKR 4TL7A 3MWYW 2R79A 1KKUA 4C3VA 4F3CA 5AVQA 1XCGB 1SCIA 2Y1GA 1LDMA 4WA8A 2IHVA 2BGLA 4LSGA 4TVBA 3TOZA 3RIEA 1J4AA 3ANTA 3T5PA 1XK6A 4LW8A 1P4HA 5FJIA 2FG7C 2BRUC 1QU2A 3UPTA 4GPTA 2HJSA 1X8JA 3ACDA 1IB0A 4IGIA 4C22A 1JZQA 6REQB 3DO6A 3BG5A 3IPLA 4TS9A 3OTOB 3EK2A 2BL4A 1BN7A 2XSZD 3OIDA 3H4MA 1NW5A 3ROKA 3I3SR 4KR9A 3VHLB 4E3ZA 2J59A 1XLVA 2O0JA 2P90A 2QI9F 3AYZB 3FSGA 2J3EA 3PT9A 5CK5A 3LLSA 5K1ZA 5TJ9A 3P5SA 3GP5A 5TARA 2DETA 1YNOA 4QGGA 4DBZA 2BMVA 1PTJC 4A2PA 5F7JA 3JQBA 4CR7A 4CW7A 3GVHA 1Y6ZA 5JH7B 5ENZA 3THSA 2D2IA 1ZXXA 3GAMA 2LIVA 3MA0A 2RBGA 3EXG1 1VZ3A 5C8VA 4JCOA 1XCOA 5DVZA 4YJFA 3MMSA 1A9SA 1EFVB 1X7XA 1KU6A 2IX9A 1U7HA 2VHXA 3NFRA 1E8MA 2OBBA 1XAIA 3AVPA 1Z12A 4P36A 5DLEA 5SY6A 4DLBA 3UMMA 1E1LA 2WZCA 1XZIA 1TKBA 2MCFA 3EWNA 4POAA 3HCEA 5JYBA 4MI6A 2P2GA 2ORYA 2NZXA 1GGEA 3KTDA 2GD6A 3NIWA 5FWNA 1S6YA 1JHRA 2ZBUA 4TVKA 3OZXA 5A1TA 3OOWA 4CMAA 3S27A 4BLUA 1JLMA 1GL7A 3OJEA 2WLSA 5FH9A 4Z4FA 3OJLA 1NYRA 5IKOA 1C7QA 3RVJA 2XQVA 3GRUA 3MAAC 4I1YA 2W0MA 4N8EA 4AM8A 3T95A 1NDUA 1OWNA 1OC4A 2O2DA 1XVIA 3EGDA 4BKUA 1CIVA 1RHJA 2SKEA 2Y6VA 3ZW9A 5CFOA 1C2TA 3PQ8A 4GBJA 3GGSA 4DDVA 3BE4A 3MGGA 1T0JB 4NU5A 3N8NA 3F3SA 4FX2A 4X1KB 2C9YA 3W8EA 4B3SB 3WNCA 1ZN9A 4QDTA 2B3DA 2OK7A 2QRZA 4CMKA 3EARA 2D5IA 4EL5A 3W2TA 4JC5A 4V1CA 2W42A 2PS1A 2B1RA 3OECA 3V48A 4Q9JA 1A2OA 4C05A 4CUKA 3DCNA 3WMFA 3BHIA 2E4VA 3BIFA 3FA2A 3QELB 4Q7JB 3TLGA 4B09A 2ZKIA 4S24A 1XMQB 1XHEA 1FLVA 4I9FA 5CW2A 2LDXA 4HZIA 4JIGA 4E2WA 4WV3A 1DKPA 2F8TA 3VAAA 4WN3A 1GZHB 2C61A 3W9YA 4DAOA 1ZGCA 3CH7A 4MQFB 3IUBA 3I2JA 1DQNA 1QVVA 1XLTC 4NZZA 1WD7A 2VF4X 4GM4A 2IYVA 1TQ4A 2AXEA 2Q27A 4EITA 1MC8A 2V74B 5EEGA 2GPAA 2NYAA 2FZ4A 1CEYA 1HH4A 2IZOA 3FVWA 3V9AA 2PEZA 4KQHA 4H17A 1RFLA 1IHDA 2ZTUA 4AJ4A 4D92A 4IJ5A 4UQLA 4H0FA 3E35A 1N57A 5C51B 3IEVA 4M3NA 1PNRA 1UWCA 5JPIA 1LFDB 2JA1A 2M1XA 3FLMA 1QCDA 2ERYA 3TVTA 2YXNA 2IGTA 2YIMA 3JD4A 1UH5A 1R0KA 2XKKA 2CJXA 2PIDA 3DL4A 4TV9B 3H8VA 4WBSA 2VN8A 4LXIA 3PENA 1BMQA 2D1RA 4MUHA 3I4FA 4KN5A 5BVGA 4P4UA 4Y1GA 1YTLA 2GJSA 1ND6A 2G0TA 3D0QA 1K8XB 1AKYA 3V7NA 3NALA 5GIPE 3NWJA 5EPOA 5BWCA 2ZEJA 3AY3A 3CT4A 2FP3A 3VO8A 2Y0CA 1EEHA 2Z2KA 2CL7X 3GGPA 3T5BA 3PDUA 4DJJA 1NP3A 3UUGA 2ZIAA 3CPSA 4MQ5A 3RAPR 3V97A 2IBSA 3B36A 4E14A 9ATCA 4YI5A 2X0NA 3QKRA 4MUJA 1T35A 2GRJA 3CGGA 4G0VA 1ZL0A 3SX4A 4G65A 2AVDA 4TS4A 2P9FA 3FGPA 4YAWA 5L7YA 3ZD7A 1Z0DA 2J9FA 2O50A 1NXQA 4YJGA 3G6KA 1SBYA 3NUZA 3WYFA 1LX7A 2H5LA 4V1CB 2XOKD 1UKAA 4C04A 2KI5A 3OKPA 3PRYA 3DE1X 3TIFA 3NW9A 5AUNB 4W63A 5K8CA 4Z9YA 5FOXA 1IB6A 2HW8A 3COVA 2FR0A 2RGEA 3S81A 2NQ8A 1MJFA 5EINA 5BYJA 1IH8A 1P2BA 2WI8A 3OZVA 3BCUA 1N4AA 5EJ7A 3H86A 1JVNA 5KI6A 1HK7A 2B1QA 4CIDA 5A05A 4DNPA 4OQYA 2ZRBA 2LUOA 3E53A 5F64A 1L8QA 2EZUA 3VDQA 4PFKA 2GERA 2C5LA 3A6EA 3C48A 4WXYB 2XCTB 4J0GA 2Q4OA 2H00A 4QLOA 1T1JA 4HXYA 5TXGA 4L6CA 1KH2A 3K32A 5KWEA 5HF5A 1XMOB 1JJBA 4DKJA 1JAXA 1RWPA 4EI9A 2IT1A 4GLBA 2PWBA 3ORYA 4OMFG 1O87A 5FB3A 3SC4A 1SIOA 3WMWA 4BMSA 5I4BA 3RVPA 3UJ9A 3E2PA 1M2OB 2PL9A 2P9ZA 3G5MA 4YCMA 5B30A 4ARZB 3NHYA 1EFVA 1YE3A 2DCUA 4GI1A 1LI5A 1AGYA 1J0AA 1EQ2A 3TIXB 5GADl 2W00A 2QYHA 1ITZA 1GDTA 4BNXA 4O25A 2R6DA 4U2FA 1A9PA 1HURA 3MVEA 2VATA 3O3OB 1DO2A 3AUJB 5I9BA 3VTAA 5L53A 4DQLA 3S8EA 3GA0A 3ITEA 5COBA 1K5DA 2WVGA 1I0IA 1O97C 3IUPA 3OZSA 3P2OA 5H7XA 3HDVA 1T29A 2PDAA 3IOMA 4UCFA 1UZLA 2D4AA 2NPIA 3NYWA 3P0HA 2D0DA 5DSZA 2CCGA 1BXGB 1EUDA 1PTKA 1XHLA 2TYSB 4FCCA 4BFZA 1Z25A 1FS6A 4PC6A 1LB1B 1CERA 2O14A 3NONA 2CLFB 5ALSA 5A0FA 4RKQA 4KXNA 2VJDA 3KALA 4R7TA 3V00A 3VUEA 1J97A 5GINE 4BUCA 3E4CA 3UCEA 3ZDCA 1F6DA 1QWOA 1ENOA 3KC2A 4JHXA 4D9HA 4MVXA 2HXYA 2L18A 3C3XA 3HB4X 3K8ZA 1T8YA 1KJZA 3PHBE 1T4CB 3LKVA 1CX9B 4P7JA 4QDUA 4AF7A 3VM6A 3RU7A 1ZW1A 2RHGB 4ABYA 2FXVA 2FSUA 2IELA 4KN9S 1XAHA 4JLJA 5A3JA 1G1MA 5D7BA 4IGFA 2VWPA 4O2AA 2VHTA 2C7GA 4BV3A 3CO0S 4HDSA 4QWWA 4BCBA 4CM9A 3HJAA 3LUGA 1XEWX 1DDIA 5EJGA 3RC9A 3I8XA 1OD6A 1WY5A 4H7KA 4V2IA 3AVWA 3Q7RA 4PGGA 3LRPA 1VMAA 3NDJA 2B8WA 1PL7A 4URYR 1QZ3A 3R7LA 3WJ7A 5G4LA 4E33A 2YJ4A 4KOAA 3F3YA 4ZCRA 1GL3A 2ALJA 3UK1A 2W0SA 1O2DA 2JHAA 2FF7A 1B0UA 1C41A 121PA 6LDHA 1EVIA 1JA9A 3LO5A 1L7XA 2HLNA 5KJ1A 2YXPX 4DR6B 2IUYA 3AXSA 1H6BA 1U6IA 1V7CA 1ZU5A 3PBKA 3KLOA 3UTCA 4FN5A 1E99A 5B3JA 4CMCA 3R24A 2R00A 2XDQA 2QTMA 1KDTA 4HDMB 1ZD5A 2PZKA 3EC1A 3WJ1A 2BFCB 5MGBA 1N5JA 3JARA 1KPIA 1L4EA 1L5HA 3SBXA 3UWKA 4CUJA 4ZT3A 1AV7A 3T12A 2UVDA 1KVTA 4RK7A 4LQLA 4WOBA 1IONA 1PT5A 1QO0A 2R6GA 3WK4A 1R0BA 1H1LA 2FR8C 3FZYA 1KE2A 3PNSA 4CCWA 5GY7A 1V7QA 3HH8A 4C5CA 2ZYGA 3ZHCA 1W34A 3DLAA 4D8VA 1USUA 4TWBA 4FZ5A 4RD1A 2IHYA 2PQ2A 2H2HA 3BE5A 4JOSA 2B7CA 2JNWA 1M0TA 1OH5A 1ZXLA 4RJTA 2HK8A 1MUUA 4DR1B 5E0KB 1VKJA 1QIMA 1RC1A 3EW7A 4F9GA 2G36A 1QR2A 2QYTA 4I19A 5EQDA 5H4HA 3EQ7A 1FSFA 3SCZA 3ZE6A 3PIIA 3HGTA 3VC3A 5KYXB 2ZBQA 2B1JA 1I3OA 4GG1A 1UK6A 4Q3KA 1QQAA 1NPTO 2F1HA 2V5UA 4QNRA 1BHQ1 1O6GA 1Z4NA 2J1LA 2ZR7A 2N75A 1IBMB 2ETXA 5IF9A 2DR2A 3SS9X 1ZICA 1CRQA 3URKA 3PXXA 5KO2A 2E5FA 1J2UA 3ML1A 3PITA 1Y6RA 2PKXA 2VEDA 5AOVA 1S02A 1YR7A 4NEHB 1XZJA 3KU1A 4CM5A 2EW2A 2W6QA 1HFJA 1LQTA 5D3MB 3M89A 3KQUA 3PYLA 1GZSA 4IH9A 2PMCA 1KVSA 2ZYUX 5ECGC 3RWOA 3CT6A 4IEEA 1FTWA 4L4UA 1NN1A 3PRJA 4OI0A 4QYWA 2W8BA 2W6OA 3SN6A 1USWA 3HV2A 1QF7A 1WIWA 1Z62A 3VV3A 4GKAA 1VG1A 4MQMA 4ZGGA 1VB3A 1WXWA 2UZ1A 3U13A 4DPKA 1UBEA 1U80A 5ESDA 5SZHB 2BM8A 4GOKA 4NQRA 5B4TA 1DP4A 5BN4B 3W6OA 4CLOA 2WU1A 1T36A 3BRCA 4HGNA 4ZFNA 3D5EA 2OT3B 1YUMA 4OHBA 1U4OA 1FSZA 4TGLA 3NXSA 3DE7X 5DLQC 2W90A 3SGLA 2M9MA 3N0VA 5HRCA 1G3QA 4Q1EA 3VPDA 1HDZA 2GN4A 4O4IF 4CNBA 1T0UA 3U1BA 4JAVC 5DTRA 1TCAA 1RE0A 3FDZB 1IVNA 2FOLA 4OHYA 1IM5A 2CV1A 3IQWA 4ZAYA 2PO5A 3LRTA 3FUVA 4AJ2A 1L1QA 3DBRB 3H9UA 1H2ZA 3P2JA 1SELA 2BISA 3I45A 2H4WA 3ZVMA 2RGGA 1XD9A 4DG9A 4Z6KA 1HYGA 3B6JA 4B6OA 1M34E 2XE7A 3FFAA 4ETMA 3QFHA 2OD9A 2NXWA 3BL8A 1W9MA 5A2QA 1JQDA 3WR5A 4Q39A 1PR6A 4KXVA 1DBIA 3MWJA 1N2IA 1AKVA 1OAOC 5FR2A 3GYBA 5FPSA 1BX3A 2WINI 5FOWA 1B15A 3ABZA 4G1MB 1ZP6A 2B4QA 2GTIA 5CVDA 2GRUA 1B1CA 2I67A 1C4XA 1VGRA 4ZQFA 5IMBA 4E5KA 4M1KA 2E4WA 4UULA 4F11A 4GXNA 5JY6A 3TLJA 1J9ZA 1K3TA 1VRCA 5FXMA 5JBNA 1ZD1A 2XD9A 2HSGA 1TT7A 4A92A 3S2FA 4JEUA 3PFBA 4R54A 4YLEA 2X5XA 4PO1A 3I2HA 2V45A 3C6MA 3JQFC 2WWRA 3QVKA 4TS3A 2XDYA 2GB4A 2AYYA 2II6A 2VDKB 3BDVA 2E55A 1NQVA 2Y8EA 3ENVA 4IJWA 4PQGA 1C50A 2VBGA 2PU7A 4WSOA 4UFPA 3QPAA 3I0NA 1M6HA 3FH0A 4MINA 1DIBA 4ZU3A 5MDHA 4NPCA 1O6ZA 2OHIA 5FO0A 1C0PA 2QTFA 2PMDA 4JT9A 1X7WB 2G80A 2COKA 1UM8A 1O4WA 3O21A 4FJ0A 2XRZA 1UJCA 3IYLW 4ZJZA 2F3PA 4YIHA 1YQGA 1TJ3A 3B48A 1DELA 1F38A 2XQJA 4RYLA 2PBRA 4UATA 1RKXA 5BV8A 3EXEA 3LT0A 3OLVA 4M2LA 2J32A 3FOCA 1PVOA 1DIGA 1N3BA 4UKDA 3WWEA 1JEDA 1PN3A 4AG5A 4D81A 1ZJ4A 2H7XA 4GQAA 4EY3A 5BNTA 5KQPA 1EK0A 3VSCA 3MW8A 4KC0A 1XC7A 1LPNA 1ZCZA 5T6BA 3U56A 2BV3A 4PC1A 3R3UA 2DT8A 1JB1A 4KFTA 4KLCA 1NJ5A 2XZLA 1VOTA 3FF4A 2NAFA 4M0CA 4EW1A 4EUEA 2R8YA 4L51A 1PJBA 3GP3A 3UV6A 3BT7A 3PIDA 4K81B 2O8NA 1OKKA 4F7WA 1KXJA 1E1CB 1XCJA 1DBSA 3QWFA 3OO0A 4KI7A 2BKXA 3L4BC 1E3QA 1Y8QA 1A9OA 1O0SA 1J2YA 2CLSA 3PZBA 3NI2A 3TBFA 4K9MA 4EVQA 3L4SO 3LUFA 1AOXA 5GQSA 3HA7A 1U1DA 2W2MA 4BO3A 4CQMD 3V55A 3X2SA 2JAPA 3VNAA 4Y7DA 1VJRA 4FGZA 1RBMA 3EHDA 3RB8A 1VPTA 2YWBA 2P9EA 3OE5A 2Q5OA 3SC2A 1T3LA 3VYVA 1C3OA 4EENA 3PDJA 4KO4S 4BO4A 2CE2X 2D5BA 3PGA1 2CNNA 4GYJA 1TF7A 8LDHA 1YD7A 2ZJ0A 1Z7BA 1Z5OA 3EVFA 4B3CA 4QGAA 5FI1B 4C4XA 3C5CA 2DHDA 3E9DA 3TG8A 1E9VA 1DAEA 1GEEA 2F9FA 4P4GA 3EQ9A 4Q48A 1W29A 2D13A 5EKSA 1KI7A 2OZPA 1QC5B 1XRMA 3D2LA 4XQGA 2CDCA 1JDPA 2ZR0A 1JYEA 1XZKA 3HEMA 4OHCA 4NMHA 5GV8A 3H1AA 1ISJA 3OU2A 5F4BA 3F6EX 4CODB 2NT3A 2Q3FA 4TT3A 3Q9NA 2QUAA 1U7WA 4Z4IA 1K0UA 3Q9SA 2H07A 1GVNB 3KCNA 4MX8A 1GAWA 4OB6A 3HSYA 1YULA 2YIJA 4R8KA 1U3CA 4MQ6A 2JJ2A 4O8CA 3THWA 2XX3A 2AEJA 3PFWO 3WE7A 1B23P 1FU4A 3O2QB 1XQ1A 4L8FA 4U2GA 3UFBA 1E3JA 1P1KA 2FMHA 2EWVA 2PRZA 2EGGA 2PWZA 3KU4A 5FBZA 2WYVA 3UAOA 4B6QA 3VPFA 2WV9A 3ZCXA 3EIEA 8ATCA 3DBOB 1OFIA 1IEXA 4HCJA 4S1NA 2IPLA 1YOVA 3OURA 3IAS1 4LRSB 2J09A 1YZ3A 3ESDA 5HEKA 5JAOA 4IIBA 2FUCA 3AEUA 3EXFA 3LXUX 5LPNA 2FPKA 3HCCA 2NSJA 4RETA 3E58A 1OROA 3QGMA 1RYBA 1I30A 1RAGA 3CRQA 4V02A 5I4IA 1T3SA 3DFMA 4IWNA 1GT6A 1Y4SA 2Q1YA 4MLZA 2Y68A 2X3YA 1FXUA 3TZEA 5JSHA 1Z0ZA 3T52A 5C4GB 5BXQC 4JYCA 4H60A 2ZFUA 1E5TA 5JZVA 4J0IA 4DLNA 1DRKA 4W7IA 1Y80A 3DBLB 2QLBA 2AXPA 4JLKA 4WX2B 4EO4A 1XDGA 5UKDA 1E9BA 3TJZA 1P45A 4ACAA 3CR8A 3H13A 5BW4A 2CHQA 1EM6A 1C7FA 3H04A 1C3XA 4HAUA 1WOYA 4BRZA 1QK3A 4PW0A 1TQDA 2P65A 3RTAA 5JNRA 2FB9A 4ML3A 3ED5A 3CLUC 3FM9A 2GXSA 1M5TA 1CXZA 1MX9A 3PNLA 3SBEA 2Z6UA 1DE0A 3CF4G 4CKCB 2Y2UA 4A5OA 4XQCA 2C9OA 5C0OE 2A3NA 2WQ7A 2H2DA 3PNBA 1DADA 3RS2A 1QFJA 2H2IA 3CFYA 3FFWA 4A0GA 1R12A 3NOOA 3WSVA 1KI9A 1RNLA 3NWPA 4Y6RA 3T1HB 2BEKA 2JCGA 2DWUA 2HJGA 2I4LA 2ACVA 2IYSA 2H5EA 3KKMA 2V8BA 4ZVSA 1MF7A 5FIUA 3KFLA 3VC1A 1PWXA 2NU7B 3EAFA 4JJIA 1JAHA 1YU6A 3E70C 2IOFA 3FFBA 3L9XA 4IKEA 3WYNA 1TO2E 1BVYF 1X6VA 3DXZA 1NJ6A 3TD2A 1COZA 1KDRA 1NYLA 2QUBA 3QBTA 4MPTA 3PRKE 1T5DX 3CINA 3NNNA 4DOMA 3WP0A 3L77A 1LU9A 5DIZA 1XDWA 3NYQA 3WB0A 4OXRA 5I7FA 5FPPA 4AKGA 1P5HA 1QU3A 2R85A 4JGBA 5FPHA 5A71A 1FU7A 3MBOA 1X74A 4DAEA 3LOUA 3GLFA 1QH1B 2BVNA 3C74A 2KS6A 1ZU4A 3ANYB 4Z7JA 3N05A 1KEEB 1NBMD 4C4RA 4TYPA 1VCIA 2WFMA 2VSXA 2TS1A 5BSVA 2PWPA 4QPNA 3ZNNA 2XKAA 1EX9A 2ZP1A 3QVXA 3KUUA 1DIOB 1CUUA 3E9CA 3WIEA 1XTPA 2JFWA 4H1TA 4ZO4A 1ZJJA 3VJLA 4X7MA 2HCRA 1O5IA 4TX1A 4IM7A 3KD2A 1RZ3A 3FB1A 2FY8A 3ASVA 3LKBA 4I1UA 4NF2A 5M29A 5M5BA 1EVEA 1ZD9A 4I55B 5EXEA 1V43A 2PSDA 4ZAWA 3TOSA 3I28A 4ZICA 1U9CA 4YWHA 2QTCA 3SZUA 4UBLA 2O5RA 1YVDA 4BB0A 2ZI7A 4KVZA 4YRIA 4KPEC 3K6KA 3PD1A 3NVAA 5K99A 1QVRA 3D6VA 3DQQA 4J7XA 2V65A 1UJBA 4KIWA 3CRW1 5AXBA 3RJMA 4CF4A 1YB2A 2QP4A 1KGSA 1CTQA 2C07A 4IO0A 1GL9B 2H1CA 3DF9A 2JJ1D 4RMIA 2ZRIA 1ENZA 3DZKA 3EVDA 3JX9A 4PFJA 3ETGA 3SKXA 4RY8A 5E4YA 4WXMA 2FEAA 3V4SA 4KTVE 3QKIA 3F7NA 1KHHA 2RB5A 2XCSB 3AG5A 4TLEA 4G5FA 4JBYA 3B9RA 1HNWB 4EJ2A 3D3WB 2CMHA 3PI7A 4GOJA 5J2TF 4DILA 3KYDB 1G8AA 5I7UA 1KPHA 3QUTA 4D43A 3R76A 3U3MA 1MTOA 3QK7A 2I62A 2FXIA 4WY5A 4N65A 3QELA 2V1UA 1J49A 2R1VA 1HYBA 1IJKA 2WF8A 2VH5R 3WXBA 1GCOA 2BHLA 2W2NA 3L8EA 5DNWA 3WVNA 1D2NA 3DPUA 4RKEA 1OPRA 3AJAA 3I09A 3S44A 1M2KA 4WKBA 3DTNA 4TTTS 1SCNE 3HKCB 3G02A 1F8GA 3E8MA 2OZVA 5CMLA 3WIDA 8AT1A 2MR5A 2NU7A 2OM2A 2XJ4A 4P5PA 4UNSA 1QXSA 3TL2A 3GX1A 3JZAA 221PA 3QIAA 4OQLA 1MT0A 3A8TA 4KVFA 4LCJA 2P9YA 2AD1A 5AJXA 1E8DA 4BQNA 5CTAA 2I80A 4P3NA 4E1BA 4RLSA 1EFPA 1NMZA 1QYRA 1UFKA 2O1SA 3I2FA 1DKRA 2GK4A 2YICA 3L6DA 2R84A 2R1TA 1R27A 1Z88A 4NBWA 2HNBA 3ZY6A 4MWBA 4DMKA 1PQPA 1POXA 5C46F 4R1SA 1D1QA 1YJBA 3IKLA 5F5NA 1DC6A 3KYIB 3TIVA 2D62A 3SHVA 3ZHQA 4YMUA 4HNAA 1WW3A 3NB0A 4A3SA 1OU0A 3I2KA 3DV0A 1S9HA 3UCFA 1QG4A 3HGQA 1ZM3A 2ONKA 3LQKA 3FNQA 2X19A 3GW8A 4PE5B 1U0NA 3SMVA 1OU4A 3DEYX 3SNKA 1QPBA 4XYBA 3QXHA 2YBDA 1JWLA 5K3OA 3LW7A 1E3TA 5CFQA 4V0NA 1A9TA 3KCQA 1FZQA 3ORRA 2VDLB 2OOKA 3HXKA 4EHFA 4REOA 3OTIA 4YH1A 2Y77A 2RKBA 2OV8A 3F3KA 1GR0A 3FBWA 3MF4A 4WFKA 3H2KA 1XALA 4RM2A 4U3JB 2W2XA 3HCDA 2AMJA 1HWYA 2PZGA 1FTSA 1ENPA 1NQAO 2NADA 1GRRA 3NKFA 4HDRA 4MS3A 4WVLA 3VZBA 2JKYA 1U6KA 3R9KA 2FU5C 5A3VA 3OTWA 4IDDA 1J2TA 4OX9B 1XQYA 5K4HA 3TW8A 2R4TA 3K1AB 1L8OA 3PVZA 1GHTA 1T25A 3NNDA 4FP9A 4X90A 5FTNA 5A2GA 3OCXA 5JBQA 5KEIA 2RGYA 4GC5A 4BWFB 3I2YX 4D8XA 1DU4A 2LKDA 2VH1A 4HQNA 1Z75A 2XQGA 4D6YA 3HZZA 2HJWA 2I55A 2ZJ4A 2ZQYA 1KU0A 3QBJA 4TTSA 1M1YE 3WRXC 1EM8B 1Y1QA 3CF0A 1JKFA 1G7SA 2R8ZA 1BW9B 4B4OA 2IS4A 4D0SA 2VSNA 3G9TA 4FILA 2DP4E 3UT5A 621PA 5CNMA 4I5EA 2JIDA 2YYSA 1TAHA 3I39X 3KTAA 2KLHA 4GYYA 3W90A 5EIAA 1Q14A 2IYYA 1KC1A 1Z5UA 4TN1A 2G25A 4EZIA 3RAEC 4FINA 4RIIA 2DFTA 5DFAA 3UT5B 4R2MA 5D86A 3FXAA 4ACBA 1N5IA 4FCVA 2ZI4A 3LWBA 3G1UA 4H1UA 4WEOA 3VR2A 4A8HA 3WDKA 4DG5A 5BQFA 1FDIA 1BFKA 3SVZA 3DJYA 3S28A 1GPJA 4Y9UA 1S2IA 4E4RA 2B92A 3L0IB 5IUNC 3F9IA 4UBOA 3GEMA 2X6TA 2BP7A 1PE0A 2FQXA 3AU8A 3AP3A 2CGEA 4BO9A 4NIMA 3AQ4A 1NI5A 3D31A 3DOOA 5LQDA 3N07A 2QAGA 1P4JA 2YJ3A 3A6ZA 3D3QA 2AFIE 4MVJP 4OQXA 4TN5A 4XDZA 3HQ4O 2BGNA 2EFHB 1C14A 1HE5A 2VPZA 3BOSA 4DLLA 3LE8A 4DUZB 5HRAA 1DCKA 1Y3CE 5AW0A 4KV7A 1F51E 2CFRA 3GY0A 3ZTYA 2C5SA 3L8FA 4QLBA 2PG3A 4Y9SA 3IQDB 4RZ2A 4UNIA 5EIOA 3TB6A 2XD4A 2IEDA 4LHZA 3TRKA 4TXHA 5BV1A 2O3UA 5IG2A 5T7BA 1S2LA 2C0QA 3DDNA 4DA0A 1JKJA 3KR2A 3NDIA 4P2GA 4QTYA 3SE7A 5AK4A 5B5SA 2W22A 3MWFA 4DY4A 1QF9A 1WKVA 4X20A 3UJNA 5HTOA 1LK0A 1XXHA 3RQIA 4Z5XA 2WZBA 1WMEA 2NTNA 3DTYA 3COPA 1NC1A 5CFMA 5HXAA 2G4VA 1KI6B 4GZ6A 2XT9A 1ORWA 4PQFA 4QXPA 2A94A 4FMCF 4G5YA 3G9ZA 1TKAA 1T5SA 2IDMA 2IZ5A 2O2SA 3R7SA 3ZV4A 1EMDA 1MVOA 1AQ6A 2HB6A 4BTLA 4LJ7A 3B3FA 3O74A 4EFNA 3KJHA 5BOSA 2VDVE 4RW0A 3WX0A 5F3DA 1DQYA 4BJ1A 3PGKA 3QPDA 1BCRB 2YXDA 3DA8A 4RPHA 3WLSA 1C1HA 1NUTA 3N8GA 4JELA 4PFSA 1Q7BA 5HX7A 3IIMA 1U1FA 1U99A 4D9NA 3ZCPA 4B4UA 3WB1A 2AJCA 5J2UF 3M6UA 3ZGOA 2C3YA 3Q5GA 3U7JA 3C24A 6YASA 2WDPA 3DCYA 1FDUA 4L22A 4BO2A 4O3MA 4YCJA 4JDPA 3A4VA 1R6BX 1Z47A 3G8YA 4EDHA 4PG7A 4DNFA 4ID3A 2HQOA 3UMSA 2FHSA 4R9NA 1MFZA 5BXYA 4DIDA 1RRPA 5ALNA 3E1KA 4BOYA 2OFOA 4O4LB 2PX6A 5F3WB 3CC8A 5ERXA 4I6EA 4PZZA 1CZKA 5IT0A 3BWBA 1E66A 1F5SA 4HWRA 5IUKC 1XWFA 4MVWA 2F48A 4EA8A 5CDFE 5HWSA 1I51A 3FOAA 1QBGA 4ZYLA 1VG0B 4GR9A 4IDHA 4JHLA 4UHHA 2O0MA 3PFKA 4F1JA 4Q7LA 4QBHA 3KDSE 2LRHA 1TA9A 5J5VA 1NBMA 3HV0A 1ZITA 3BZUA 3EULA 3QEOA 4PZCA 1CP2A 2EBUA 3OLCX 2K4MA 3PQ5A 4C0QC 3BGIA 2Q6TA 3WTBA 1RJGA 1WULS 3ENNA 4BN5A 2XNCA 3BM5A 2ZLBA 4DKXA 1TRHA 4HYEA 3VTKA 1DBRA 3WNDA 2IODA 1O54A 2Q8NA 5E1MA 5BRAA 2Q4RA 4J75A 1TK2A 2R6ZA 3C7TA 3AW9A 3K20A 4ER5A 2Z56A 3NPMA 5H70A 4P83A 1E7RA 3KHTA 4FS3A 4TV9A 4ENSA 4KW7A 3I52A 1UADA 1H1TA 5HM6A 1GTZA 1WX1A 2QAJA 4V0RA 2WTXA 3M5CA 5KTNA 1O94D 1M2WA 1GGKA 3EXAA 3BGWA 1H5QA 1XXLA 5AK6A 5AVYA 5AXAA 4EQ6A 2F55A 3A2LA 1Y3DE 3ER8A 4ALMA 1MDBA 1ECBA 1ZIDA 3AEYA 4H08A 1KF0A 1XRQA 4L72A 2OO3A 3K2QA 3ZWOA 2WJWA 4KXLA 1C3LA 1RRGA 1ECFA 1EYZA 3W2IA 3PPYA 3SIPA 1QIIA 3ZU2A 1JW9B 3JQBC 2X4DA 2GWRA 1AQUA 2JFQA 4Y2VA 5TGTA 4YV1A 5A7GA 3K1YA 3L43A 3F46A 4P7KA 3AP2A 3I9LA 4PZLA 4PYLA 2JH9A 2JAQA 4CBVA 4EO7A 3L4EA 4L6IA 1IHXA 1WDWB 1LF0A 3BXFA 5AXDA 3ZWBA 1VLVA 3D8RA 4RV9A 3UEOA 1YS2X 2L17A 4BQOA 2CF5A 1FX0A 2WSMA 3ONNA 3DE6X 1DAPA 1UBOS 3PXDA 2VJNA 1W0CA 4S0XA 1GWNA 1M1XB 1W4LA 2ZW9A 5U4QA 2BFNA 4WD3A 2GAIA 2VTKA 1QYVA 3T7DA 1CUXA 2O2JA 3CU5A 4PHHA 2JGRA 5KWIA 3E3NA 3FETA 4H6XA 1UKBA 3KFVA 4ITRC 5A9SB 5A4KA 1ZNWA 5SYNA 4HLUA 3EUEA 3SSNA 1AKTA 2TMDA 2EL9A 2AEFA 5D1NA 3GC6A 3WRXA 5B64A 4RDXA 4QVIA 1KEWA 1AQIA 1XVUA 2IOQA 1IHPA 3PC7A 2DFDA 4JT4A 2ONZA 3I9KA 4XD7D 3QF7A 4ZT4A 4U2BA 2I3AA 2OCPA 1U3WA 5BSGA 1IBCA 3Q3EA 1NHGA 1P5RA 5AH0A 3MINA 4M9CA 3W2FA 4DIFA 4YMHA 1J5EB 4OLBA 2XH8A 2VAVA 4R84A 2DLDA 1E7MA 2J9XB 3ZDBA 2AUTA 4DV4B 1J39A 3G23A 1HDOA 4XEUA 3MWEA 1SZCA 5CYPA 2G9UA 3FWYA 4I6GA 4PAMA 2X8BA 4ZJUA 3C1TA 3HJUA 4WZAE 3RK1A 3KQTA 4RVNA 3SJCA 1PT9A 1WPQA 3IE2A 4JP8A 4P7BA 4EUFA 2FP4B 1TM5E 3F74A 3S2ZA 4Q9DA 3HCPA 3OWXA 4OBEA 1ECPA 1YBMA 2REQB 3HHEA 1ZVKA 3NKVA 4RH3A 2OXIA 3D8SA 1CU1A 7ABPA 4ETWA 5J3JA 1E9FA 2VJCA 1F12A 3ILYA 4TRRA 3TTTA 2AOTB 1UIMA 1N7HA 3BZWA 2AI3A 2A1UA 3RWMB 1NSYA 4JL8A 4ND2A 4TKVB 1M2JA 2ORIA 2Q45A 3F6SA 1H6CA 2V9ZA 2GZAA 3DBRA 4XKJA 4KV9A 3SE0A 1G41A 1QIEA 1RTKA 2Z2JA 4RFSB 4CHGA 1KSHA 1SG0A 1O5TA 4Z0HO 2OUKA 2GESA 4Z3KA 1GU7A 3I9V1 4LHVA 4ZOEA 2ZSFA 4RHUA 4MJ7A 2I8LA 4EPRA 2W6PA 2JHGA 4MV3A 3EGOA 4NBUA 4HNRA 3Q3CA 1XEXA 2P77A 1PKXA 1B74A 4N5DA 3RH0A 1B41A 2EIXA 3UWSA 4YJ2B 5DHAA 4F3KA 5AW5A 3MJVA 1U9IA 2XXAB 4DIEA 3QI7A 5LU9A 3ZE8A 1CPYA 2PD3A 2C4TA 3DOCA 4WNAB 1ZK0A 3K0CA 1BXGA 1EUDB 1RWQA 1SWVA 2TRSB 3OSZA 3QVJA 1Z15A 3RR2A 2XUFA 1GV0A 3SVTA 1GPMA 4TXNA 1PR9A 3ZZ0A 1I3KA 3OWOA 4GGPA 4JBXA 3KE9A 3R41A 4M9SA 4QFCA 3ND5A 4DSAA 3ANXA 2Z4SA 1NC3A 2ZRFA 4WN9A 3TR6A 2KLBA 4OQ4A 1V6CA 1A2KC 1KVUA 1RM4A 2DVMA 2X2OA 4MB6A 1WVGA 4M9UA 4REQB 2ZUFA 5EEHA 1MIOB 3AY6A 3O1LA 2RAFA 1OVGA 2WJIA 5KVCA 1YZKA 5FCDA 2VBIA 4OX9Y 1CFZA 4XWGA 4HDNA 1R2QA 4LTDA 5A4MS 3NP7A 4CM1A 4G23A 3SXUB 2QBYB 4QUKA 1ANKA 4M0DA 4Z4GA 3DE4X 4EG5A 4HO1X 3EVTA 4RACA 1GN9A 3G8DA 2PXAA 4M37A 4PLZA 4X3OA 4BNLA 3O8RA 1N2XA 3K09A 1BFUA 1QBKC 5HKLA 4WJLA 1H1DA 4NU8X 3CLRC 4CF3A 5KX5F 1YCGA 3OESA 5KJEA 1XTTA 3HG7A 1U7UA 3PGMA 4IIDA 4WK6A 2J4FA 4W5TA 1P4SA 3HUEA 1O08A 1UKYA 2JATA 1NYQA 3COSA 1VCNA 1DBPA 4RD2A 1CZOA 2HA4A 3NUQA 3BB1A 2F3SA 2EWMA 2WTEA 3T1NA 5JT1A 4F3YA 4GM0A 3ETDA 1OZ0A 2ZETA 1E62A 3M6FA 2JFYA 4Y2JA 3OQPA 4LGCA 3T0GA 4WWHA 4XYLA 1Q2XA 2CFCA 3ZH2A 4OHMA 4AS1A 4D41A 3OOEA 2IDKA 3H6GA 2D1FA 2WJGA 3OZGA 3PDIB 5BSEA 4QZVA 4HPWA 4DBVO 2M6LA 2HZBA 1NF2A 1I94B 1Y5NA 1ZS9A 3LTNC 4G86A 2J9FB 4ZVRA 1OXXK 4G41A 3RG8A 2JDID 3FI0A 3IIEA 3NVMB 3VVBA 2O7RA 1PS8A 2IIVA 3QFSA 4IZIA 1YR2A 3DZGA 2ST1A 4R16A 1JI3A 4OXIA 3ZN2A 3WRYC 3AL2A 2WWXA 1UMDB 2HHCA 3SXUA 2QBYA 1TK9A 3PCTA 1Y1PA 2ZJZA 5DM60 3L7DA 4AKEA 2P5UA 2YHAA 4FE4A 3UATA 2GXQA 2IQIA 2ZU6A 3HPRA 3PYXA 2IYFA 3KX2A 4MUAA 2Q5IA 2IUTA 3IX7A 1EQAA 3SJAA 4ESOA 1A9YA 1GSIA 1I3MA 3R5SA 4UMDA 3HEAA 5BW6B 5D3KA 3IUQA 1E79A 4DFDA 4E5UA 2QVCA 2W6ZA 1G0OA 1KAQA 3FFXA 3O84A 1XTSA 5CH3A 4DDTA 4K0KB 2DJ5A 1CZRA 4YNBA 1XLWA 2EHDA 2BGGA 4EATA 4K6KA 3RLIA 4P4LA 1IBRA 1P0IA 3D59A 3WHPA 3WWYA 4KZPA 1W35A 2CDNA 2IEAA 2VUTA 3X1WA 1EK2A 3ZZTA 3ZCTA 4FWTA 4CWAA 1RLJA 4E15A 2D1SA 1EE2A 1YKSA 4V2UA 1V2HE 5IJXA 4TUYA 2IUFA 4JUFA 3LD9A 3GLGB 2HA7A 1GG9A 4I99A 4PG4A 1PDVA 1WU7A 3VGPA 2ZPTX 4IS3A 4Y7CA 4J2TA 1Z4IA 4KMOA 1T4DA 1D8AA 2QN9A 5LA6B 4JFRA 4X45A 5D5PA 3T7EA 1E4OA 1GGVA 2V0GA 2HGZA 1R6DA 1R9GA 1QCCA 1BXZA 2AA3A 2HUNA 4HDRB 3TNLA 1CZLA 4EYGA 2R11A 2IPNA 4JVNA 2GJKA 3L7BA 4JVOA 3TAHA 4AF6A 1W52X 2ZWIA 3JVUA 3CPJB 4LCBA 4YP9A 4UOZA 3GEHA 5E3IA 3WNZA 4QPDA 3WK9A 4QOGA 2HRZA 4OREX 1Z83A 5E9JA 3VKWA 1XJCA 2XMBA 1ILEA 1D4ZA 2EW1A 3BGDA 2XRMA 2O0LA 3P9KA 2XLCA 3RS5A 4XVUA 3ET4A 4YQFA 5KX5B 1E1KA 1Y5IA 2QUKA 4TOIA 3IP7A 3C4QA 4YRPA 2DAPA 3JYQA 4ZQCB 2V1XA 1EE1A 2CLLB 3N6RA 5F35A 4CHTA 4P08A 3DE2X 5DNAA 3KJIA 4LZLA 3K70D 1F2VA 3I53A 4FKZA 1H2WA 1QJCA 2IYOA 4XTRA 4J4TA 4YMVA 1DJMA 2RC6A 3QP9A 4L85A 5FX2A 1THGA 4KFCA 2VAMA 3TLCA 4TLLB 5L3ZA 3FRJA 5GJCA 3O3MB 5FQNA 3QTBA 1GN8A 2YV5A 1DOAA 4EG7A 5HKAA 3FYCA 2EFYA 3EZLA 4MRVA 1C8LA 1BIFA 2AOWA 2ATCA 4WLOA 5CURA 3W7VA 1JQ3A 2AT1A 1W44A 3HGMA 4GZ3A 5HKBA 2CT8A 1Z2NX 2FEXA 3FUXA 5JCZA 1YDEA 2DFNA 2GBPA 1HZJA 5K0NA 4J43A 1C5KA 1YB4A 1UJ6A 3AUSA 3H8JA 4ZYWA 2WKQA 4LAFA 5EVJA 5LQUA 1NULA 1WUHS 3HADA 2P2DA 3HUUA 4RF2A 4RJIA 5ALUA 4ZV7A 2HNKA 5J63A 4DM3A 3WQBA 3RK0A 2VTBB 1GZ5A 5GAJA 1I9GA 3SEFA 2CBXA 2QZ4A 1PK8A 1UXOA 2ZVPX 3TMKA 3SKYA 2QLMA 4AP9A 4CM8B 4LOAA 1WZUA 1JVBA 1FJ2A 3K5PA 4FDUA 3QFCA 2ZXUA 1EDDA 2P40A 2JFVA 1BSVA 3FVVA 3RSCA 3TIIA 1J2JA 3THYA 1DJOA 2GAOA 1P77A 3PGJA 1G59A 5JMPA 4NBVA 2C1XA 5FRDA 2GUGA 4YBRA 3RRBA 5TV2A 3B9QA 2HWXA 3Q7QA 4YRCA 5LP6C 1YS6A 3UIEA 3V1TC 4C29A 1SHJA 2XTNA 4G9GA 5JAHA 2P67A 1SCBA 4ND8B 1QYIA 3AJRA 1ZCAA 3RYIB 1RQ2A 1LBEA 2J9ZB 4CIAA 1C9KA 3EVCA 1PVVA 4UXIA 4XM2A 5DWVA 1DX6A 2ZRNA 4ALIA 4EQZA 4KXQA 1HNZB 2XQKA 1MX3A 1ZM4A 5ICFA 1BWPA 2XE4A 1U8CB 3TXYA 4RWEA 3F2IA 5LN1A 5A6VA 2QTVB 1YQDA 4ARUA 4DZRA 1ULZA 4BFUA 4AXBA 1YJQA 1H2FA 4EGFA 1S9DA 4B1FA 1W93A 5ALVA 3NS7A 2RD2A 1JEYB 2AUNA 3OPYB 3TB4A 2QSUA 3GHYA 3EH2A 3KKOA 5AHWA 1NLYA 3MXTA 1Q11A 1JXQA 2GJ8A 2AEMA 5CAEB 4JI8B 3MIZA 3C85A 5L4SA 1VSTA 4UTVA 2TSYB 1MPTA 4O2AF 2CZQA 3L4JA 2C83A 4R8SA 2Z4RA 3CV3A 4WLNA 4ZO7A 2ODWA 3VX3A 2B20A 1CZNA 2QN1A 3FUWA 2V5VA 4JLSA 3FCXA 2LE0A 4R8VA 3TTUA 2WAOA 4X71A 2UZ4A 2IU4A 4B7UA 3PUIA 1GGMA 1RLTA 1Q22A 1ZEJA 2HQ1A 3MCVA 1WF3A 4F4UA 2RKOA 5C32A 4CG0A 3NV9A 2JJ1A 2ILTA 4E6PA 4J9UE 2XBUA 1USGA 4QXMA 4UUAA 2NU6B 3AR8A 3DOJA 4BPRA 3K9FC 1UPBA 2R8RA 3RYIA 2CDAA 1IWOA 1TOAA 4G2TA 1YB7A 3HLKA 2XT6A 4C4PA 2YRWA 4R05A 1ABBA 4Q3CA 5AI0A 1D2AA 2X8WA 3QA9A 2D2VA 4Y2QA 3DC7A 2EL7A 5ADVA 5I7HA 2IHKA 1C9DB 5LZ2A 1JBKA 3QI2A 5CVCA 2ATEA 4JKOA 2VPIA 4M9RA 1T4MA 4BGVA 2OKCA 1L8LA 5HZKA 4IINA 4TMWA 3IEMA 3FLEA 4HXGA 3GUVA 4MKGA 2UUOA 5LFAA 4INJA 5HJ7A 1YS9A 4YWJA 1TUIA 1RQLA 3V2HA 3D3JA 1EZ4A 4W8OA 1N92A 3W34A 1CUSA 4JI0B 1C2YA 1FYWA 4OB7A 3RASA 4E09A 1I3CA 3GLHE 1KP3A 3GRVA 2BEWA 1YWGO 2KPOA 2MJLA 4DGSA 1LNQA 4ICIA 4BVHA 3SXPA 1TF5A 3F7MA 1YFKA 2HIAA 2FQWA 2GFHA 1OA1A 3GJYA 1F1JA 5ITZB 1ZOLA 3KVOA 3LF1A 2QRGA 1Z2PX 2LDBA 4I55F