4RTOA

Complex of escherichia coli dna adenine methyltransferase (dam) with sinefungin and with dna containing proximal pap regulon sequence
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
268
structure length
249
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSKKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 78
structure length 249
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtoA01
3GRRA 3GO4A 1AQIA 2O07A 2IDJA 5E1MA 2NXCA 2XYQA 2YXLA 3CVOA 3NJRA 3FUUA 3LCVB 3KKZA 2G71A 5DWQA 3A25A 5T67A 2Z6QA 3OFJA 3LL7A 5ICGA 5E9QA 3TM5A 2HV9A 2PX4A 2G1PA 4XUCA 4V0RA 2PJDA 3DOUA 2EX4A 3ANXA 3KPUA 5GM1A 1DUSA 3E05A 2PV0A 3EGIA 3NW9A 4HH4A 2ZZKA 2IGTA 2OBFA 3AJDA 1BOOA 3HVKA 3SGLA 2EJUA 3KQTA 5P8WA 3HA5A 1M6YA 2PY6A 4RTRA 4WVLA 5KS2A 5K0GA 5LQUA 3KQMA 2NXJA 5LR6A 1QZZA 1O9HA 3FYCA 2Z6AA 2P3QA 4ER3A 2IH5A 5U4XA 1XJ5A 1FP1D 3BGIA 3M4XA 5LQRA 2JH9A 3R9XB 3UA4A 3EMDA 4IKPA 2G72A 4RX1A 5DTQA 5CCXA 1FP2A 3B3FA 3K6RA 2AZTA 3KQWA 4DF3A 4GOMD 3UFBA 1ZKDA 1Y8CA 1EG2A 1SQFA 2H00A 3H2BA 1VP3A 1YZ3A 5DRYA 5LSAA 4PYKA 4BLVA 1JTEA 3FTFA 3BUSA 3BWMA 3T7RA 4PGHA 1RJFA 2ZZMA 2ZIFA 5C0OE 3UJ7A 5FCDA 3UJDA 4K6MA 3B7PA 3C0KA 5CVUA 2OY0A 3DLCA 4RTLA 3DTNA 4RTKA 3P2EA 5EEHA 3LCCA 4OQDA 4AUKA 4F85A 1RI5A 2IDKA 2IBSA 2ZTHA 3FRIA 3LDGA 3KPYA 4DA4A 1D2CA 3A4TA 3KR0A 1XDSA 4LWOA 3HCFA 1F3LA 4KW7A 3EMBA 1JR4A 1RJEA 3B89A 1KYWA 3CGGA 4E31A 2AR0A 3EEYA 2AN3A 3G2QA 5EZQA 2JH8A 3LBFA 3G7UA 4U7PB 1RJDA 3BZBA 2AN5A 3DULA 4PWYA 1YFJA 1P39A 2CKDA 4C08A 5E2AA 3BWYA 4HTFA 4MHTA 5C9ZA 3GRUA 3G5TA 4RTOA 3A7EA 3JWHA 1P91A 5LQNA 1VLMA 3CCFA 1O9GA 2ORED 3LDFA 2PVCA 5DLYA 3FUXA 2ZBQA 1KPHA 4RYLA 3O31A 4GC9A 4PYIA 4PYMA 3IHTA 2QE6A 5EMLA 5FHQA 5FTWA 3VC2A 4QPPA 5HIMA 2P7IA 2HTEA 1ORHA 2P8JA 1JG1A 3MAGA 3MQ2A 4KIGA 4KVZA 5DM2A 2ZVJA 4GUAA 1L9KA 2ZLBA 4P7FA 3VC1A 2OZVA 5EMKA 2CL5A 3JWGA 1G8SA 3PB3A 4P58A 2IBTA 2HR1A 1X1BA 4BP3A 4PYLA 3GRVA 1NW6A 3PVCA 5EGSA 4X63A 4BY9E 4PCAA 1XDZA 2ZWVA 3EVAA 5T64A 1VQ1A 3PFHA 4PYQA 4A6DA 4AZWA 3I53A 3MGGA 4GOND 1R8XA 2PKWA 1RI4A 1PRYA 3GWZA 4P7GA 4R6XA 4U7TB 3UJ8A 2ZWAA 3HA7A 4E70A 5CD1A 3EEOA 1RJGA 1ZGJA 3NVKI 1X1DA 3C6KA 3PLAE 1JG2A 3QOXA 4FP9A 3SXJA 4X61A 3TPZA 1XTPA 4CTJA 5E9JA 5HIIA 1OR8A 4GOOD 2P1DA 1G60A 3DH0A 3KQSA 5DX0A 3EVDA 3ERCA 1EAMA 2PT6A 3LPMA 3UJ9A 3UA3A 4DMGA 2I62A 2PT9A 3P97A 2Z6UA 4ATNA 1NW3A 2P40A 3M6WA 1BC5A 3MCZA 3OPNA 1KPIA 3T7SA 3TMAA 5FUBA 5K0BA 3AWIA 2YR0A 4HSGA 2QY6A 5GINE 4YUXA 5FQOA 5F2OA 4PYJA 3BKWA 3PT9A 4ZTBA 2GPYA 4X41A 2AOTB 4DCGA 3IEIA 3EVEA 3RW9A 3AXSA 5K09A 5M5BA 4RSRA 1VP9A 1XVAA 4FR0A 4ISCA 3R6TA 1YZHA 3BXOA 3DLIA 2GLUA 5E1OA 5DSTA 2Q41A 3Q87B 5CVDA 1U2ZA 4QVKA 2VDUE 4OA5A 3TR6A 3FPGA 4E2YA 3OU2A 3EVCA 2P35A 1AV6A 2V74B 3TLJA 5ICFA 1JQDA 5ERGB 4QTUB 4QDKA 2OO3A 4C06A 3EPPA 2XYRA 1KP9A 1L3BA 2WA2A 3FPFA 2KW5A 2PX2A 4EQZA 5E8RA 2E5WA 2G70A 3SSOA 2AN4A 3BGVA 5K0EA 5HOQA 2I9KA 3KQQA 2ZULA 4CWAA 5IH3A 4OBXA 4RWZA 3BKXA 4MQ4A 3B3JA 5FA8A 3OCJA 2ZSUA 3GGDA 3T7TA 3A7DA 3OU7A 3THRA 5E8JA 2CMGA 1NBHA 2HMYB 2R3SA 3DMGA 3HA3A 3EVZA 3I5UA 2OB2A 2VP3A 3QOWA 3ME5A 3M6XA 4RV9A 3UWPA 2PWPA 1N7JA 2IH2A 3BGDA 2ERCA 2QRVB 2B78A 1IM8A 4AZVA 5EEGA 2BR3A 1VE3A 2FHPA 3AXTA 5ICEA 1WZNA 3ELUA 3G2MA 2ZIGA 2O0LA 3MERA 1AF7A 1SQGA 4KDRA 1R8YA 3I58A 4YUZA 1X19A 2C7RA 2XBMA 3MHTA 2ZIEA 5BXYA 3VSEA 3ELWA 5DSXA 2GH1A 3KQPA 3UJAA 1BHJA 3KQVA 1EJ0A 3OZSA 4CKCA 7MHTA 4ER5A 3G8BA 3E8SA 4HGZA 4M38A 2GAFA 1SUSA 2IH4A 2P7HA 3X0DA 1JSXA 1RI2A 3C6MA 2A14A 3OE5A 3HM2A 4HRAA 5K0NA 4BLWA 4E2ZA 2VDVE 5KQSA 1G55A 5DT2A 5HILA 2H1RA 4PONA 3MCTA 1KR5A 3G8AA 3P9KA 3KR9A 4H0NA 4LECA 5DRTA 1V39A 5K01A 2PXXA 2YXEA 3ELDA 4EVIA 3M70A 2GB4A 3NWEA 4FT2A 1G6Q1 1G8AA 1I4WA 2Y1WA 2XVAA 4DQ0A 4QTTB 2B9EA 5CCBA 2CMHA 2GA9A 1QYRA 3PX3A 5C1IA 2ADMA 3U81A 2HWKA 2BM9A 1YF3A 3LSTA 3TKYA 1NV8A 4GBED 3FUVA 4NECA 5EZSA 4IV8A 5EMMA 3T0IA 4UOEA 5T6BA 3FUTA 5KQRA 1RI3A 4RTJA 3TQSA 5FQNA 3FUWA 2C7QA 2OB1A 4XUEA 1NBIA 5DX8A 2NXEA 2OYRA 4M36A 4Y2HA 5FWAA 3O4FA 2EG5A 3GIWA 2PSSA 3UJCA 3Q7EA 3DXZA 3ORHA 2ONYA 2FPOA 1HNNA 1HMYA 1XCLA 4RTSA 4C4AA 5K05A 3AY0A 3FPJA 5CIYA 1INLA 4HG2A 5F2KA 3CBGA 4QVGA 1WG8A 2IIPA 3GDHA 4EMSA 5CM2Z 3FYDA 2UYHA 4MTLA 5E9WA 3BWBA 1AQJA 2ZBRA 4YV2A 1NKVA 2YX1A 3SSNA 3EVFA 3V97A 1L3CA 1NT2A 1WXWA 2B2CA 2ESRA 3GRYA 1BKYA 3HVHA 3P71T 4KIFA 5DX1A 4EKGA 2VDWA 3KPWA 5BP7A 4IV0A 2FK8A 3HCCA 2PX5A 2UYQA 3B5IA 1VIDA 3M6VA 5GP1A 1VBFA 2OKCA 3P9NA 5GM2A 2YXDA 2WA1A 4RVGA 3G89A 4HC4A 4IWNA 4AZSA 3KR1A 3M6UA 5DXAA 5G02A 5LQAA 1JG3A 2JHPA 3TOSA 5HFJA 5FWDA 2UYCA 2JG3A 5K0CA 4OQEA 4YUYA 1F38A 5HEKA 2EJTA 5DXJA 1I1NA 3TM4A 3KQYA 4XCXA 3DUWA 10MHA 3ER8A 3D2LA 2YUIA 3CC8A 2PLWA 1QANA 5E1BA 4MWZA 2NXNA 5EQJB 3ELYA 4RTPA 3LBYA 4HGYA 4OBWA 4QQNA 3V8VA 1Q0SA 4KRGA 4PYOA 4V0QA 5EPEA 4C05A 5DTMA 3UJ6A 3VYWA 1TW3A 1R6AA 2FCAA 3DR5A 3FPHA 3L8DA 1MJFA 2PGXA 2UYOA 4FGZA 5EIWA 4DM3A 1G38A 3LECA 3OZTA 4YMHA 4LG1A 3ER9A 5HIJA 3O7WA 4ER7A 4OX9Y 1NV9A 1X1CA 4P7JA 1KXZA 1N7IA 3OE4A 5GIPE 1X1AA 1KIAA 1ZQ9A 3FRHA 2C7PA 3OZRA 4YUVA 3KPJA 4R05A 1PJZA 3C3YA 2I7CA 3KPVA 5FHRA 3S68A 4BLUA 5D1HA 3C3PA 3TKAA 3HEMA 4MIKA 2PWYA 2V7EA 3HCAA 1KHHA 3EVGA 4C07A 2P41A 4RTMA 3LCUA 3RIEA 3GRZA 3UZUA 4RVFA 4WXHA 5GOZA 3NVMB 5B1SA 5CVVA 5BW5A 1UWVA 3NMUF 2F8LA 5EKXA 2IPXA 3LDUA 2IFTA 4GEKA 4PNEA 2OXTA 5EHIA 3TRKA 1B42A 1XXLA 3A27A 3HCBA 3OFKA 5KYGA 2O06A 4JXJA 2B25A 3SX0A 3SVZA 2HNKA 2VZ9A 1M6EX 1JG4A 5HZMA 5LQCA 5DTRA 2O05A 5LQKA 2AOTA 2XYVA 3GXOA 4RVDA 3IV6A 3NDJA 3SSMA 1FBNA 2CWWA 3P8ZA 3PS9A 3WSTA 2BZGA 3B3GA 1ZG3A 1WY7A 4PINA 5KVAA 5K0JA 2BR4A 3FTEA 1NW5A 1SG9A 1Z3CA 1FJXA 3NDIA 2R6ZA 3CJRA 4QPNA 1YB2A 4YUWA 2AS0A 4GOLD 4HTFB 4R6WA 4AX8A 2PXAA 2JJQA 3DMFA 3I9FA 5GIOE 3BT7A 4GC5A 3NWBA 2ZFUA 3CJTA 1YUBA 1QAQA 1RI1A 5H02A 3R24A 3K0BA 4B17A 4KDCA 5EIFA 1NE2A 1EQAA 2C7OA 4PYNA 3JWJA 4YV0A 1JQEA 3KQOA 4G56A 3EVBA 5FA5A 3UJBA 4GQBA 2EFJA 2JHCA 3A26A 3HVIA 3LGAA 4FSDA 5FULA 4X1OA 4CXMA 4DCMA 3HCDA 4RVHA 4YV1A 1IY9A 2NP7A 1NW7A 5FADA 4E2WA 3I64A 4PIPA 2AVNA 1JQ3A 2OPBA 4AZTA 4QQKA 1JSZA 1IXKA 3M33A 1UFKA 4EK9A 2QRVA 4E32A 1JTFA 1YFLA 1ORIA 3HVJA 4ER0A 3E7PA 4PIMA 3GJYA 5DM0A 3SM3A 2DPMA 3GU3A 2AOUB 1EJ6A 2ZBPA 4E30A 5K8VA 3DP7A 4FT4A 2AOXA 5CVEA 3P2KA 1SUIA 5EMJA 4M7RA 5IKMA 1XDUA 2N47A 4XUDA 2AOWA 2H11A 5D1NA 2I6GA 1TPYA 3G2PA 2UZ4A 3LX6A 3G5LA 3ID6C 4C03A 3HP7A 2FYTA 1TW2A 5EG5A 2G8NA 4OA8A 3RODA 5DM4A 2FK7A 1R18A 4M37A 5MHTA 2ONZA 2VS1A 4L7VA 4QDJA 9MHTA 4CTKA 2QM3A 2Y1XA 3MTEA 3JWIA 2NP6A 1R74A 4ER6A 1QAOA 1T43A 3HCEA 1ZGAA 3LKZA 4YMGA 5CVJA 1DCTA 1MHTA 3KU1A 3FTCA 3R3HA 1N2XA 3CKKA 5EHGA 5JUWA 3SMQA 4O29A 2WK1A 3THSA 1L1EA 4LWPA 4DKJA 5E2BA 3IYLW 3HTXA 4P7KA 2AOVA 3TFWA 1P1CA 1SVUA 4DZRA 1H1DA 4PGGA 4FSXA 5GWXA 3MTIA 2YTZA 3HNRA 4A6EA 4Z2YA 1QAMA 1KYZA 4RTNA 5K0LA 8MHTA 3DXYA 1Q0TA 3BWCA 4POOA 3FTDA 3MB5A 2LD4A 5CUQA 1SKMA 2B3TA 3P2IA 2IP2A 4EKIA 4RTQA 5DM1A 3PX2A 4FZVA 3PTAA 1ZHFA 3GCZA 5EC8A 3NTVA 3P9CA 2K4MA 4CKEA 5HIKA 2BR5A 3G88A 4E2XA 1I9GA 2AOUA 4BP1A 4R8SA 1UIRA 1WS6A 2O57A 2PBFA 3LHDA 5EOVA 5F2NA 5JR3A 1XCJA 1KPGA 4PCLA 2NYUA 2QYOA 3DMHA 2ZCJA 2AVDA 2ZW9A 1VPTA 2JHAA 2P3LA 5BW4A 1P1BA 5K03A 2ZZNA 3P9IA 2DULA 1FPQA 4R8RA 3E23A 3PFGA 3CJQA 3EGVA 4GF5A 4F86A 1O54A 2PX8A 5EKUA 1DL5A 1R00A 5LQJA 3G2OA 5EVJA 4CKBA 3QV2A 1L3IA 3UBTA 2XVMA 5ICCA 2P3OA 3KR2A 1NW8A 3OU6A 1VL5A 2NNWB 3FZGA 3REOA 2BH2A 4FS8A 3DXXA 3EGEA 3KHKA 5DPMA 2PXCA 3GNLA 3R0QA 5E1DA 3SR4A 1D2HA 3LKDA 4X60A 1D2GA 2FRXA 3FPEA 4C04A 1EIZA 2YVLA 4KWCA 1WXXA 1M0EA 2YQZA 3F4KA 5K0FA 4E33A 2GS9A 2BM8A 4F84A 4Y30A
chains in the Genus database with same CATH superfamily
3ZIDA 4DS3A 5ILOA 4LZPA 1FYFA 4CEIA 4WXRA 3KKZA 4I1IA 2FEPA 2G71A 1E9EA 2P6NA 3CF2A 2ZJ5A 3TM5A 1WUKS 4R3NA 4F6RA 2HFKA 3LUKA 4V0RA 5JZSA 4F97A 2I33A 3KPUA 2WFMA 4L08A 3S8MA 4EG6A 2EFEB 3UV7A 1GNTA 1AGPA 2QTHA 5G1OA 5FLYA 2DP4E 3IUBA 2DT5A 3KV3O 4GD3Q 5D87A 5EJIA 4Z0HO 2Q7DA 1M6YA 1SAYA 3Q41A 4PHFA 5L40A 1LFDB 3NTXA 4HDRB 5LR6A 2GN9A 1LPPA 2XWJI 3QLVC 2ILVA 3RS2A 4F93B 4PQGA 4JI4B 3C87A 4URYR 1Q3KA 1N2BA 4EG8A 1FP1D 2EZ8A 1B0UA 2ZUCA 1ZD8A 5KJCA 3WADA 5AVZA 3L7NA 3A3KA 4RIGA 1U3DA 2CUTA 2WB4A 2P4UA 4HAIA 4JWTA 3S4YA 3VPSA 3T99A 4HTAA 2IUTA 4B2LA 1YZ3A 5EWJB 3M8KA 4JZYA 3ACCA 2ZUVA 4M0MA 2PH7A 2YWGA 1AV7A 5KPDA 4KXFB 3K6KA 4WFKA 4CFZA 1JRLA 1CU1A 1RJFA 1R4MB 1OXKB 5E0KB 4RE5A 2G5PA 3KE8A 5F5LA 7MDHA 2OY0A 1R6BX 3Q5GA 4RTLA 1URPA 4IS2A 1M1NB 2XUAA 3CCCA 4WUTA 5BYJA 3HLYA 1JGTA 1LCIA 1MPTA 4FB5A 4IQFA 2FP4B 1QFYA 2ZTHA 4MKZA 2EGUA 2Q2VA 2ERYA 5DYGA 4HNTA 2OA0A 2HXGA 4LWOA 1ZCBA 5DDIP 3ZUGA 3TSZA 4ETNA 4Y0VA 1YCFA 5HZHA 5LIRA 2V0NA 2VJBA 2YOHA 4UHEA 4J0HA 4O4LA 4HB0A 4K9NA 3VOSA 1NBEA 4TKMA 4YJ2A 4HDSB 4OSEA 2JH8A 3KAQA 3VU8A 1SBQA 3G7UA 1IXRC 3A4LA 3I30X 3ITEA 3WNCA 2TRSB 2CKDA 3AVQA 4XFKA 1DV1A 2Z3WA 1HDZA 3WWZA 3NTLA 4A6XA 2J3EA 4U7WA 2BFMA 4MVXA 3GRPA 4QUKA 4WPGA 4Z3DA 1O9GA 3ELBA 5LBIA 2C0CA 2VLIA 5FTNA 3VR6D 3V8QA 2GZDA 3KOXA 5FHQA 5FTWA 2RGXA 4RMIA 3L7DA 2QM8A 2PUTA 3GGGA 4BJ1A 1K06A 3BA1A 2HU2A 1JG1A 2CYAA 3OIGA 2ZDGA 3DNMA 3L7JA 3L7IA 2ZVJA 2DCMA 1VE9A 4I6EA 4W8HA 5IAJA 2B37A 5CDSA 2YHUA 3NXKA 5EQFA 4DMKA 1EDZA 1RAFA 2BUCA 4PGAA 2MHCA 4R9NA 4YRPA 4EUFA 4J1NA 5BSFA 2IBTA 2PUAA 3DT6A 1UBOS 2AE2A 2FRDA 4KK3A 4Q4JB 4OV6B 4PPNA 2CFOA 2EC5A 1PT9A 4RZ2A 5BUSA 4TWIA 1TK2A 4P35A 4TKZA 3RVKA 1UXJA 2CDCA 4GW3A 2OM6A 1FNCA 1V5WA 3W79A 1ISFA 1CJSA 3X1DA 1YL6A 2RBKA 3R3XA 2WAYA 1TIPA 1FS4A 3ZK7A 2RBGA 4UMDA 1M2EA 2JI7A 4ZJPA 1VHWA 3P20A 3HJTA 4FNAA 3AIMA 3FCSB 4UOZA 1TO6A 2XNHA 4H1WA 4MVJP 4DG5A 1OI4A 1TUIA 2GHTA 2P1DA 4FYYA 5T57A 2P9EA 1EWVA 3EIHA 5LZ8A 1JB9A 4NU0A 3ZDFA 2I62A 3KFVA 3WGVA 2Z6UA 5CK4A 4NNOA 1U3UA 3WIDA 1VYVA 3ETDA 2YR0A 3AL0C 1GZ4A 3VPAA 3QU5A 5DLDA 2ZSFA 2O0JA 2XCRB 3PCRB 3THWA 2GAIA 2AK2A 2AOTB 2P30A 3IMFA 3TLBA 1GRVA 3S5JA 4RSRA 4ZAWA 1XVAA 4G26A 4GE0A 4PG5A 4HFNA 4HLQB 4IV5A 2ZSKA 5E0OA 3DLIA 1LI5A 1DDIA 2AFIE 4JMLA 4DM4A 3HJRA 2J6HA 2PTHA 4B3CA 3DO5A 3MUOA 1H9AA 3DE6X 1TT5A 1L4UA 2I5PO 4G0ZA 4ML3A 3V1LA 3CTPA 1UM8A 3G68A 3VMFA 1NNI1 5K51A 1JL3A 1NG1A 3TIIA 3H65A 4G5FA 3UJPA 3R6LA 2PL5A 3JQFC 4QDKA 4PSCA 5KVQA 2XYRA 3UKOA 2QMQA 1TAHA 1L3BA 1POWA 2XAAA 2WA2A 4CG1A 4QC2A 3KM0A 3RDPA 1VMAA 3NFYA 1XAJA 3DDOA 3D4NA 4P9NA 5JQWA 2XOKA 4MKHA 1PFQA 1OVGA 1BXGB 2AC2A 4FR5A 3HB0A 3FY4A 4BX0A 2HDNB 2HA0A 2YMPA 3L7OA 4DCVA 1L4YA 1LX7A 3GZNB 3KQQA 3ROKA 4UUMA 3NR2A 2Q2OA 2NUTA 2RGYA 1RJ9A 1U7OA 4KDFA 2SBTA 3CUYA 3OCJA 3OQHA 3ROTA 4HVCA 1ODIA 2RMKA 3CW8X 1NBHA 2GBGA 5GJWC 1SU4A 2AC7A 3QSGA 4RHFA 2O0KA 3CX3A 2G0TA 1EM8B 1GTMA 1VYTA 2AJLI 2PJUA 4RV4A 1F4PA 3LKVA 1TXGA 3GLGB 1NMQA 3Q8KA 2F48A 3TMKA 3PE6A 2AJ8A 3QMMA 4HPWA 3V8NA 4BQSA 3AT1A 4NJEA 3I2IA 2VHCA 3TXXA 4P0PB 1XJWA 5SZJA 3D7RA 3PVSA 4KDRA 1JFFB 2RJ3A 3OQ1A 4YUZA 5JNTA 5BRAA 1E69A 3TUZC 1A9YA 4XIJA 2A35A 1J2YA 4ZYLA 3H5LA 2BOVA 1O95A 4MUBA 2QGFA 5GONF 2ZYVX 4I9GA 4LE2A 4Z4EA 2BHSA 2CCGA 1S3SA 1NFFA 1YONA 3D5EA 4PSKA 4Y1EA 5KHAA 3W9YA 1JQLB 5L3QA 1NU6A 1NVUQ 3KYCB 4AIIA 3LYAA 3GMTA 2GDJA 1DC4A 1RWNA 3AJ8A 5K3CA 3TCNA 1WULS 1YB5A 2IZ6A 3VRHA 2WINI 3RE1A 1RYYA 3A1TA 3UAOA 2AZMA 4LBZA 5I48A 3QE4A 3HJGA 5BY2A 3NM6B 3R23A 1XYVA 1WAMA 2GSDA 3VU3A 2FWAA 5K01A 4TRMA 4Y2UA 1FFGA 1FUYB 3GRFA 3IV9A 3MQFA 1JI3A 3TL2A 2IK8A 4LYAA 3S29A 2KPOA 4XWKA 3K70B 3F78A 2X5JO 4P4SA 4U2GA 1D2EA 4LMPA 3L8EA 4QPDA 3NDRA 1T13A 4BQNA 4Q4CA 4CMAA 3GFQA 1CEQA 2OGWA 2RAUA 4OXKA 4JFRA 2WYHA 3HH8A 3PF8A 4BPRA 3EPLA 4HZIA 4BXOB 1FYWA 5CH8A 1OXXK 2ZR7A 3FUTA 1E92A 1JZTA 1KMMA 4X1KB 1KQNA 4BATA 2IRWA 1KYQA 4BLQA 1QG4A 4UPVA 5DNUA 3EZ7A 2DKNA 3ZV6A 1KQGA 4R7GA 2OYRA 2KHZA 3K8OE 3U9LA 1BE0A 1WPGA 3I9KA 4ZC8A 4ZYZA 2V96A 4I19A 4N5LA 1PKEA 5C51B 5JAUA 3BH7A 4YGXB 2WY2D 1YR9A 2OLKA 2CV2A 5ECGC 1INLA 1LBHA 1CERA 2FN7A 3FIJA 3PHGA 3OO1A 4KL8S 4EMSA 4W5RA 3L41A 5HJEA 4G0VA 1V6AA 1ZOLA 4CU2A 1FJGB 1YBAA 1F4VA 4KRXA 9ABPA 3JRWA 3KJEA 2GN4A 2GYVA 1AKVA 2WQZA 3EG5A 3EVFA 2X8LA 2PSEA 1JFLA 4J29A 5I9MA 4A6PA 1WMFA 2VA8A 3GA0A 4GOXA 4KGDA 4CM1A 2Z2XA 4L72A 1GVNB 4JVOA 3T5GA 4FEEA 3LBNA 1BWPA 5E4FA 1VLHA 3X1XA 1XL1A 2YXDA 2NPIA 1SMKA 2OHVA 3PIIA 3ZDCA 1K5GA 4YMIA 4CLRB 1SUWA 1SXHA 4EJSA 2W6IA 2UYCA 2Z2KA 3O93A 1GAEO 4LC9A 4GUDA 4HNQA 2Y0DA 4G2TA 2B99A 4Z2AA 4HAOA 5I7HA 4CMEA 1B00A 5JW6A 2BJHA 3B6MA 3F3KA 4JZKA 3I09A 4RK5A 2FZ5A 4WFQA 5E1BA 3R8XA 3TLKA 4QG3A 1YQUA 3OMWA 3REQB 3V8VA 1RXYA 1X38A 4YECA 3ZYZA 3PDCA 1EK6A 5JI3E 1RLUA 3QWHA 1ZM7A 1T2VA 5DK6A 3ZKWA 3ZD9A 3GFSA 5H82A 4E1BA 3B6IA 3RF7A 4ZV4A 5K0ZA 2AW5A 5ECYA 3Q3VA 1D7AA 1EHYA 1Z74A 3IA2A 2D2EA 1T9GR 3L0SA 1X1TA 4CNBA 1HEIA 3OF3A 1V4VA 3H5OA 3D3WA 4O63O 4P7JA 4TZKA 3NYRA 3NKVA 1BSVA 1PNVA 5FWXA 4AN4A 1AG9A 1ZD4A 3DW3X 4NCBA 1QHYA 3CZMA 4IR7A 4U7HA 3KB8A 2F64A 2UZ1B 1SHJA 4YJGA 5CM9C 4ERXA 1SRQA 4CEHA 4JNKA 2O50A 1E64A 1X7DA 5J4VA 2G08A 1Z3IX 1G66A 3N1UA 1U8UA 1WUTA 3M2PA 2VSOA 3CNNA 1WCIB 3HO6A 3DUFA 2R1UA 3BD6A 3G9TA 3HCWA 4P0QB 5LMUB 2OXTA 3ZZUA 3AL2A 3DTVA 1MTZA 4F8EA 4ESVA 4RIHA 5DSZA 4WDQA 1KWKA 4R9VA 5EJAA 4YXFA 1QNFA 4QE3A 3OTGA 3W9SA 1SOMA 3CRW1 5DTRA 2V6FA 3WAGA 3GNSA 1WMDA 4DA0A 1Y4SA 1CQIB 1FBNA 1DRJA 1T8TA 2P1RA 1IFXA 4ZRNA 2BGUA 4FHEA 4YRBA 2NTVA 3DXFA 1CWUA 4PZYA 1ZWLA 5GONA 2H2IA 2BR4A 5KREA 1SN7A 4WBNB 4UJ5A 2Y4OA 2FWJA 1P19A 1R1DA 4RVSA 5IJXA 3C39A 1KDPA 3FHCB 3WK6A 4DEYA 1YB2A 4DHWA 1W4RA 4Y2VA 5EUQB 1W0CA 2NZVG 4TVBA 3V1KA 4RD3A 4XWAA 3SS9X 4MW2A 4CM7A 4DN6A 1E79D 5BQPA 2JLYA 3DEKA 4IHQA 4CETA 3U44A 3FLBA 1YUBA 1OYVA 4TN1A 4C6RA 3R24A 3GY0A 4GRAA 4IQ0A 4DSUA 3VR1A 4GZ3A 1UBLS 3QHQA 1IN5A 2MJLA 3KWLA 4MGIR 2AK3A 3TIVA 2JIZD 3L8YA 5KYUA 1BCRA 2WZBA 3FPBA 3HB4X 2IHUA 1HFEL 3UJBA 4DCOA 1JU9A 2EFJA 2JHCA 4GPD1 3CHYA 4HGQA 3W8RA 5FULA 3IR7A 1DMRA 1COWD 2JFXA 2Y6VA 3BIWA 3A9WA 3MS2A 1KZ6A 2NUPB 3QXJA 4QUHA 3DTTA 1TZKA 2Z58A 4KR2A 2QIOA 4GXQA 4V0NA 4X62B 1RAGA 3F1KA 4XE5A 3SXPA 3WSVA 1C8KA 1NRWA 3MWEA 4LKRA 2RIPA 2QU7A 3QBEA 2FZCA 5JAQA 5BQFA 2WKRA 3ESRA 1U8AA 4XD7D 4JQZA 5TT1A 4CIVA 4US2R 5IZCC 2JI4A 2NQ2C 1YI8A 3SM3A 5EHQA 3IOCA 3QVUA 4LRYA 2VEOA 3DP7A 1WBDA 3B1JA 3L0DA 5CLLA 3T9DA 4F11A 1ADYA 3EYAA 1VSVA 4GLLA 3P45A 1GNQA 3QFHA 4C4SA 4YDHB 2Y99A 3DOOA 2GN1A 1KDYA 1QX3A 3FA2A 3EULA 1DIAA 4OXIA 4U39A 5GZ6A 5BOVA 5LBUA 4YXWD 2UZ4A 2IE0A 2IF0A 1M34B 2WM9B 5BQ3A 1NA5A 1EGAA 1UMDB 1TZMA 3ASYA 4LI3X 4BVJA 3L40A 5JOQA 5CD9A 3T1VA 2PPLA 2XCQA 4MV0A 2JA1A 4WBXC 3T3OA 1D2RA 4ENQA 2A3RA 1TGYA 3GLHA 4D4HA 1ZD9A 4D80A 3D6VA 3BERA 4WKPA 4MWDA 3RSFA 3VJKA 5IBPA 2IV2X 3TSYA 4DRXB 5DN6A 1JKFA 3E3OA 4JLVA 3MHTA 4BFTA 3I45A 3IT2A 3LVFO 3O9MA 4OU5A 3AYXB 1FDWA 3MPOA 2CLLB 3KKLA 2WSLA 3FYUB 3PPWA 4B7CA 2OGSA 4HS9A 1E62A 3DEZA 1U1IA 3K16A 2DSTA 2ZETA 5ALXA 3ND9A 4MQFB 4MVJI 4QXPA 3BQMB 4RENA 1YB1A 1TRKA 4N3GA 4QPJC 4R0NA 1L2TA 1XX6A 3C3AA 2FPXA 1PQ4A 1U9JA 3NTVA 2CHQA 3P9CA 3F3MA 4XWOA 1Y9DA 4PRLA 5DIZA 5F9MA 1YDEA 3AR5A 5CFLA 1ZEMA 4N0MA 4W63A 1BA2A 3Q3CA 1U2TA 2VDLB 4G81A 5CNIA 4CIWA 3E84A 2QMZA 4NV3A 5CG1A 1JT2A 4JBIA 5LU8A 1BCSB 1XNJA 2E1PA 2QD4A 3QYAA 2X4GA 4TMWA 4XVRA 3DVAA 2RHJA 2PZBA 4DLVA 2EZ9A 3UANA 4PC1A 4PAWA 1RWVA 5I9TA 1M8PA 3H9UA 2DHEA 1P18A 2XA2A 3AHCA 3T38A 7REQA 3RRMA 1TI7A 2P6UA 1VJ0A 3G9QA 1R6UA 5FPTA 4MV7A 1SBTA 2GM5A 3VDXA 2H51A 1HE1C 3AEUA 3EIQA 4HDKB 4S1TA 5SICE 2VNAA 3JQEA 3ICCA 4JJ6A 3LM8A 4RQAA 4WQMA 1WP9A 1DIHA 2EKPA 2FOXA 1GTJ1 1WXXA 4KWCA 2FRVA 3A9UA 1QU3A 1ID8A 1XYGA 2NSYA 2POCA 4WX2B 4HVTA 2O07A 4UUBA 3DDZX 5KIAA 4EI8A 1BDJA 2RC5A 2F1HA 4UATA 3EDYA 1I33A 3NHPA 3RARA 1RAEA 3G2JA 3BDVA 4ND5A 5HKBA 4Y2XA 4RWEA 1N2SA 2VWGA 3H5AA 1A9OA 4BBJA 3IT1A 2G1PA 2Q28A 3ER6A 2CXRA 4X5OA 3LZDA 2LV8A 3KDAA 1WD7A 3TSOA 3UGQA 4EO7A 2EJUA 2QMYA 3QA3E 4P2BA 3WL6A 3HADA 3SZLA 4NU6A 1SZPA 4IF6A 4K81B 3N2IA 1P8JA 1ENZA 1GEGA 4KQXA 1LC3A 2PK3A 3FZYA 2C84A 4HBZA 5G0UA 5L53A 4MQEA 4ZU1X 1Z2EA 1NQAO 2NZYA 1BFUA 4PICA 1OFGA 3B3FA 5KOHB 1A1SA 3UAVA 1ZU5A 3EC1A 1ZKDA 3P7MA 1Z8DA 5JSFA 1RRFA 1OWLA 4ENRA 1M2VA 4PYKA 3PK0A 1QGUB 3WKEA 5JCOC 4AI6A 1OX4B 3QFRA 4XOUA 1EKXA 4K9PA 4CKWB 3WWPA 1JMKC 4HDNB 2ORVA 4K6MA 4RS3A 1PL0A 4RZ3A 4TL6A 1NX6A 1OZ0A 2GVDC 2Y92A 3DTNA 3P2EA 3PI6A 1PFGA 4I1VA 3VA7A 2IS6A 3NHBA 3E82A 4LCEA 5IDVA 1ULUA 3CZQA 1OGIA 3FRIA 2Z2ZA 4UULA 4L6IA 1HG1A 1SKUA 1X7HA 2F4VB 1UJBA 2QQ0A 2VN8A 3A6GA 3BULA 3HV2A 4DIDA 3BIJA 2PZLA 2ATEA 2WD9A 3VR5D 1CZLA 3GUHA 3B89A 1MF7A 2HADA 4DVGA 3BFXA 4BKQA 2TSYB 1WV1A 1W49A 4DCNA 3F96A 4JS0A 4F4HA 3TR5A 1ELOA 1UXGA 3DULA 2NYRA 5B7NA 4A92A 3ZVRA 1KVRA 2OZPA 2GZ3A 4YEDA 3GA5A 1W0JA 4WEOA 5C9ZA 4JOCA 5EL0A 2NU6B 3A7EA 4BJHB 2VTBA 4Q9DA 3OE7D 2VHZA 4X6XA 1PWEA 3W4JA 2BEUB 4FK8A 4LXIA 1AKNA 3CZ9A 4Z1OA 3L6RA 5G3YA 1PR2A 2EW8A 3F2VA 4RYLA 4UVIA 4ZKEA 5B4TA 2OD2A 1K66A 5CLIA 1ZS9A 1E18A 2GPJA 2QE6A 3QYJA 4BO9A 4EKEA 1QGED 3T5MA 2BY4A 3ONFA 4MIOA 1UFRA 2P68A 4JT2A 2OC9A 1STOA 4ARBA 4ZOLF 4F9FA 3WRXC 1DAKA 4L1KA 3QFFA 4M2LA 4PAGA 3TTXA 2QQFA 3IUYA 4PG6A 3CE9A 3OZDA 4C6TA 2X7XA 5ADWA 4WXPA 4C2UA 4FS3A 4LDZA 2ZB2A 1XEWY 3IJ5A 5JVDB 2XA1A 3OTIA 3AUKA 2W0MA 2C3PA 4HD8A 4UHFA 3VYRB 4F9EA 3BWDD 1PRYA 3HBNA 3P27A 3H0CA 3NYWA 5JAOA 4F72A 1QG0A 2GSWA 1ULZA 3AONB 3FDJA 3LY7A 2CD7A 3PLAE 1H0HA 1SBHA 3QLUA 2HX1A 4WY2A 4FP9A 4PLYA 1N9GA 4IKOA 2EZUA 4M8KA 1RWWA 1CY6A 1JH9A 4QHSA 4KH0A 3AEYA 1KI4A 1YMUA 2EBUA 1L5SA 2R6FA 2MDTA 2YJ4A 3B1FA 1L5YA 3C98A 1XMVA 3EQ6A 5C7IO 1LPMA 1YE5A 1NNSA 3DYIA 3IUSA 4OLHA 5FI0B 3FGZA 2H0RA 3UA3A 1PW7A 2YN4A 1ENYA 2IEZA 3U56A 1D1TA 4CEJB 2GZAA 1T2DA 1PL8A 2JRLA 4OAPA 1RYBA 4Y2TA 5CXXA 5BSMA 3CBQA 3BMCA 3A1WA 3CLSD 2QZSA 3D7LA 1G21A 3QBTA 4KYIB 3BQNB 5F2OA 3WGYA 3PNOA 5DJ5A 1N33B 1UM9A 5JANA 1Q2UA 2IXFA 4Z99A 1TAQA 4ZCPA 4PPFA 2VCYA 4UU7A 3HUDA 3MJDA 1FCJA 4MYSA 1SB9A 4DNOA 2VDUE 3PRHA 3CUKA 4Q9HA 2FSSA 3UGTA 3EVCA 3HY4A 3LPAA 6PFKA 9GPBA 2V74B 1T3TA 1BEZA 1H65A 1S7GA 3AUSA 3KOWA 2HU5A 4RD6A 3VBEA 1E4YA 3EBLA 3FKJA 4F1JA 5SV2A 5HS4A 4WUVA 4H17A 1EGMB 3C5VA 5B7QA 2ZIXA 1WZ2A 3WS7A 3HFSA 4ZMRA 2JBAB 4KGZA 3MAAC 3UWMA 1K6JA 5K0EA 2GBLC 1MB0A 1Z5PA 1LV8A 1Q77A 2QGZA 4YRZA 3PNLA 3WGUA 2FY8A 4MARA 3AF5A 1EEHA 1PR6A 3ZD8A 2DLCX 2YNMC 1U7HA 3NASA 1HXHA 4Q9LA 2IZ7A 1RLMA 1PUXA 1V3UA 4RSMA 3TQFA 4CHGA 1FX1A 3PGKA 4WHMA 2EZTA 5IRCD 3IO3A 4R9UC 4X94A 1L4KA 4QLBA 4QJ3A 2EFCB 3J7AC 4U02A 2NVUA 1PSWA 3OP1A 4MW7A 4W5WA 4BMNA 4WFIA 3RYHA 1Z83A 3I9MA 4INZA 4WGGA 1RVDA 4IKEA 2FHPA 4FOOA 4EEKA 1QTRA 3NRBA 2C4KA 4WY5A 1KE1A 1NYTA 4IHAA 3AF2A 4ND8A 2FPSA 4MICA 5AWFC 3ZDXB 4GO1A 5AJUA 2B1GA 1H85A 2J3QA 2GF2A 4L16A 2OG2A 3EIEA 2CF5A 3T4EA 2VDPB 3ZEIA 4EPYA 1R0YA 2VF4X 1W0KA 1XRQA 1KI8A 2GRUA 4AUNA 5AOAA 4DLAA 2O59A 1IN1A 1X9HA 1HA3A 2V1UA 2XGJA 4LJ7A 5LOVF 3N9IA 3EIXA 2R00C 4IFIA 3PNKA 1VMIA 5BN1A 3BRWA 4JP3A 1RI2A 3X0DA 4YV1A 5B36A 4AG3A 1P7VA 3EHEA 1Y7LA 4N47A 5AESA 3TG2A 2XD9A 5DBOA 5JJCA 1Q1AA 1IN4A 5FEMA 4B32A 1NPDA 5DIFA 3AVYA 3EFOA 4KQFA 4NPHA 5FXMA 3U5TA 4WOPA 4UVEA 1O1YA 2R1TB 2VXBA 3KC2A 4NZMA 3WOHA 4CIYA 2QE7D 3TEJA 1TCCA 2ZYDA 3ESCA 4C21A 4MA0A 5J9FA 3U81A 2DQSA 5CNMA 1RM5A 2HQ1A 2W48A 4ZOLA 3JWEA 3OM0A 1QVRA 2HCTA 4UOEA 1X7YB 5A3JA 4KQ9A 1YS6A 3HXKA 2VVTA 2WJ4A 2Q5JA 3GN1A 3I4LA 4CE6A 3U4QA 6Q21A 1F2DA 1P7PA 2RG1A 1TJ4A 5F64A 3RBXA 3GVPA 1YBHA 3IOEA 4MCJA 1PR9A 2WNHA 3A1VA 4U3JA 5T5QA 4AKSA 4DV0B 2WTBA 2C4HA 1TQHA 3ZY5A 4WLFA 1X2EA 2W6JA 3BQ9A 3DWEX 2HLDD 5DGTA 2GCEA 3RSCA 3A4MA 3B2NA 2X6RA 2HM7A 4GECA 4QVGA 5KYXA 3SOPA 3FXAA 3JQBA 1KY3A 2XE7A 2ONKA 1YJCA 5KTTA 1C29B 1AQJA 2D06A 1ORDA 3GJ3A 3LUCA 4HAWA 5T41A 3BG5A 1I4OA 1L3CA 2CLCX 1C0IA 4KXYA 3TGPA 2R8RA 2O4CA 4IOMA 1NR5A 2H1HA 4D42A 4EB6B 3M89A 4FQ7A 1ZH0A 1MFZA 3C3KA 4DLBA 4L3WA 1ZVKA 2VKTA 3UV6A 1QCZA 2BZ1A 4FGUA 3PEFA 4I4LA 4YCJA 4HC4A 5NLLA 4EGFA 4GDFA 5J4YA 2JG3A 3X1JA 4F8JA 5D51S 3HJCA 3K8QA 1OU0A 1XPJA 4KVFA 4HX2A 4HWKA 1XJQA 2QL5A 1Z6PA 4TQ9A 4F2HA 3ROXA 3VR6H 1ESCA 2ISSD 1QANA 1IN8A 1B3RA 2QR2A 3MJCA 2Y1OA 3SIXA 5I4IA 3TXAA 3CNOA 3DG9A 3FPHA 3WRWA 1UZLA 3MT7A 2KYRA 3ECCA 4DFDA 5JSYA 4EHIA 2P91A 3FNRA 5HIJA 1DUVG 4JLDA 2X2OA 1PR0A 5HKKA 1J90A 1P2DA 3I2KA 1MEEA 8OHMA 2I6FA 1KBOA 4A15A 3HYSA 1PJZA 4B2YA 5EZ5A 3T7JA 1JIKA 2OCLA 3Q6IA 3UCEA 4AICA 2F59A 1OAOC 2W71A 1CQWA 5AW4A 1KAEA 3LSYA 4KN9S 4RIFA 4XR4A 1BU5A 4IOLA 3IALA 4BIIA 4TMZA 3W5IA 1DXYA 1R5JA 4K2HA 2WTNA 1BE6A 2C20A 5BW5A 4Z4IA 2V4ZA 1V5FA 1THGA 4J1TA 1AHPA 3IBGA 1W4ZA 4REMA 3CLRD 4U0KA 3VGJA 1ZPDA 2FMFA 3H9QA 3REFA 1SCNE 3VH1A 4EA7A 4R1TA 1NBME 5B5SA 3AV0B 4GMKA 2HNKA 2OENG 4BDSA 1E96A 1IOWA 1US8B 3ACDA 4WK0B 2FXVA 1YHYA 3D7NA 5AW9A 3OF5A 2FSIA 3NWJA 1WD5A 1RYEA 2SKDA 1G5QA 3AUAA 4H7PA 5A9TA 3IP5A 1CUFA 1P0PA 2AI1A 3LY9A 1UAYA 2D7CA 1TK3A 1WY7A 5DO9A 2HCBA 2FR0A 4JB2A 3U4AA 5BW6B 1CUJA 3EXHC 1P1FA 1U04A 2Z2JA 5LOVA 2PU7A 2QT1A 2IYRA 1F9EA 3SZ3A 5LB4A 5A5FA 2BKLA 5FDFA 2XUJA 3ZVMA 1TCBA 1ESMA 2I6UA 4MVCA 1L6RA 1V3VA 3RRJA 1GPLA 3HO8A 1Z8NA 2G4LA 1IQPA 2HQSA 5ALIA 2O3QA 2ONCA 4LFCB 1XA4A 3BT7A 2VLBA 2JJMA 3TI7A 3HDTA 3K0BA 3ITNA 1EQAA 2I6SA 1UMBB 1YE8A 2DUMA 5CK5A 2R4QA 1L7BA 1Y1SA 1M6VB 2C2XA 3GEIA 4HNGA 3QTTA 1CT9A 4G56A 4K28A 4MPDA 4OJNA 4F92B 2BFBB 2H31A 1LU9A 3LA6A 4AWAA 3BE6A 3DZ8A 3DV0A 3Q85A 3R7AA 2JFNA 1RMQA 3KBBA 1OREA 2JAOA 4E2WA 2WFAA 5AM3A 3DGEC 4AZTA 1JSZA 3BC1A 5TPZD 2QRVA 3H3XA 3T6KA 2AI3A 3RRBA 3JY6A 3F7TA 3GW8A 4K8OA 2EARA 4HHEA 1SVLA 2Q5LA 1C0EA 2QPAA 1RQLA 3EZFA 1X7WA 1RDFA 1Z7WA 4BQIA 4YMVA 3OMLA 2JGFA 2YRXA 3S2EA 1U1GA 3T9FA 2JVIA 4A2QA 1KJJA 3WLHA 1QHNA 4IJMA 4M7RA 3PHJA 5EMJA 4OI1A 3TQRA 3PZRA 4BO3A 1JMYA 4IHKA 3DE4X 1TPYA 4LK3A 3LQ1A 3I72A 1XV5A 3LUGA 4OA8A 4EW3A 2OCIA 4C7OA 1SXIA 2VP9A 5L7WA 1U7ZA 3I9JA 2BBSA 2CNLA 3Q7RA 4I5FA 5GVSA 4FLMA 1I3KA 3RO7A 1YZYA 1H6AA 4L5JA 4FFBA 3QVJA 4KXQA 4OAOA 4PCVA 2H2DA 4ZT3A 4M8LA 2OBXA 4M1KA 4YRQA 3CG4A 1UP4A 4QGHA 4EUKA 1OLXB 3INTA 3CKKA 2C4VA 3IDAA 5L4LA 3ENWA 2O23A 1CQZA 4IVPA 1E1YA 3T1OA 5IWAB 1I1HA 5LCXA 2XMRA 4IIDA 5EXDA 5JASA 4DZRA 1C30A 4NATA 2VF7A 1A5AB 4F2PA 2J3JA 1UJ6A 3N3AC 4YROA 8MHTA 1J8YF 2R1VA 3HYRA 3IDZA 3RS5A 3PQEA 3V8RA 2B3TA 1A8IA 1F3OA 1NJ2A 2PV7A 1ETUA 3P2MA 1M1YB 2E5LB 3EEQA 2IY8A 3PQ3A 3G88A 4ZK2A 2IYYA 2QTWB 3QW2A 4XQCA 4BB9A 5CBKA 1ZU4A 3ZWXA 3ZXUB 3T4UA 2B5VA 1IBCA 2PE5A 2DERA 3ZCXA 5A6VA 1G0OA 1FP4B 1Y5RA 3IELA 1A1VA 2JLQA 1BMFD 1GPNA 2P65A 4H35A 1W581 2PQ2A 3M6LA 5CW1A 4N8SA 1P2SA 3GGPA 2B4RO 2W37A 3R0ZA 4FVTA 3E9ZA 4H1TA 1AO3A 1ZD3A 2O3TA 2QTMA 3H11A 1TE2A 3K3PA 4RGQA 3U3KA 1DCMA 4BL5A 4MDFA 3DFMA 2XQJA 2C2YA 4JP2A 4KVGA 4QNRA 1I6WA 4U8HA 1KE2A 1NXPA 2HHCA 3K31A 1N5KA 2HK9A 4NXMB 1FQKA 2RHHA 5AKLA 3QBVA 3IX7A 5LYJB 5EVCA 3WLOA 4KR6A 4TS4A 3GJ4A 3PQ2A 5HM6A 4H7IA 4IL5A 4QEZA 2GJSA 2F17A 2VA9A 3KG2A 5JDIA 2DETA 2DCUA 2ZANA 1DQYA 2NWQA 3QIAA 1I13A 3U7QB 3HKEB 4ALIA 5JNLA 4G0MA 3V4RA 2HAEA 4CYMA 1XTZA 5IM4F 3QZUA 1TNDA 3HCOA 1M75A 3NRJA 4AJIA 3JZIA 4BO0A 4C4TA 1F2UB 1Z5ZA 1A77A 1PJ3A 2JLSA 2ZSIA 3MNFA 3VPXA 1MUUA 2N75A 5TQ0B 1DO0A 1HQKA 1N25A 1GSIA 4ZK6A 3WFIA 1O94D 2BELA 5MN5A 2O8BA 5EZYB 3E05A 1UT8A 3RFCA 1H2RS 1G2PA 1AK9A 1HL3A 2F9MA 3GP3A 4NG5A 4B7ZA 5JRZA 1ZJYA 3HJNA 1HEYA 1EVZA 2O1XA 3D8UA 1V9LA 4MKFA 5JXGA 3UV3A 3T5BA 1UJNA 1JQ5A 2O7RA 3DFUA 1T9BA 4X1YB 2VYVD 1WPXA 5C35A 1MDBA 3VR2D 4FWIB 1Z06A 2H1SA 1XJ5A 2F3PA 2PGDA 3RJ5A 5CM8B 3T7CA 3UA4A 2GN6A 3X44A 1PDWA 3V80A 4ID9A 2D0IA 4ZCTA 4E5SA 1YDWA 2CK3D 2HDWA 3VAZA 1A7AA 3HV0A 1QLJA 4MA4A 3EG9B 4ZAXA 3V8BA 4DR1B 4G5RA 5I7WA 1RRMA 5BPHA 1D04A 1X74A 2CW5A 2ZI3A 2GZHA 1EQ2A 1KO1A 1TZCA 4CGZA 2ZAMA 4AG5A 2IBMA 2J9RA 3L01A 4EVSA 1QORA 3G2NA 4Y1RB 1OJ7A 5KDOA 4X66B 3I1YA 1EWKA 3MBOA 4CRWB 1PK8A 2DFNA 4OQDA 4YAOA 5LJLA 1FSGA 1U4OA 1Y1LA 2H2AA 3QUSA 3C14C 4Q4AB 4V2IA 4I5DA 1SCBA 1CDDA 1M9NA 1PVVA 2BBTA 2IZ5A 3G2KA 4R9SA 3HN2A 4MI3A 1I3CA 5F7XA 2WD8A 3I37X 3C3MA 4ZVSA 2CXNA 1J9GA 1X7XB 1Q1NA 2GEFA 2DR0A 4J91A 2AN5A 1N1EA 2Q3DA 3B6ZA 5KYUB 1RSZA 3A06A 4FYIA 4E22A 1T9DA 1MW9X 2QD5A 4O08A 3KUUA 3EAQA 4IRMA 1VFNA 3KWJA 2VHWA 2B92A 5EXXA 2Y76A 4X44A 1T3SA 2X4DA 3IP7A 2ORWA 4CUKA 3NEPX 3HSYA 1IAQA 1EUZA 1MKYA 5DLYA 1XNHA 2VPWA 2WJPA 3HGMA 4QT0A 1MXHA 3G2LA 1R5NA 3L1HA 4JU9A 2ZJAA 3FWKA 1UBJS 2YOFA 1UJMA 3TZEA 1YZLA 2BI8A 2V9PA 2EKQA 4FQ5A 5AHKA 2HWWA 2NT4A 3DOEA 2CJYA 5B58T 5JS1A 5EUCA 1M8JA 4D44A 3PL5A 1R3DA 2I0FA 1JQAA 2GM4A 5L4SA 3JYPA 4U7JA 1X1BA 1M54A 4L74A 4O4LF 1LNZA 5K6AA 1KP3A 2FP4A 5KJ1A 2OVFA 4KV9A 3BJZA 1U9ZA 4FFPA 2HQBA 1P61B 3DMYA 4HX9A 3TYXA 4F3KA 2WKSA 2A9FA 3KJHA 3KSRA 3T9AA 2FRDC 4U7TB 1RI4A 1Z34A 3B8EA 3UJ8A 3HA7A 1HDGO 1KEVA 1L4MA 2C1ZA 2PQ0A 5JY6A 1GVHA 1XU4A 2OHHA 4BX2A 5LYYA 1QYDA 2G36A 3H19A 1CZRA 3OLWA 2PKQP 2R1ZA 3L5KA 4HDSA 4CV3A 5CH3A 5KINB 4AF6A 3KB2A 1PTJA 1ULTA 2F43A 2ON6A 3CLTC 3PCXA 4DANA 2IY9A 5KTPA 1E3QA 1U8FO 4BX9A 4KBYA 2FEKA 3C6YA 4G97A 1EFDN 4FJ0A 4YP5A 3FDIA 1W48A 3PV0A 4EDFA 2XTMA 3TN7A 4MMZB 3A36A 1ZUIA 2R6DA 2XRMA 3MINB 1SUEA 1N2JA 2VDNB 3EA4A 1C5KA 2CB0A 4HSGA 4OF4A 4QOSA 5EPOA 2DFTA 2VJNA 3HBAA 3ZWAA 2H1IA 1V11A 3IB3A 3RW9A 2X9GA 4LVUA 4W1QA 2ZYSA 5IM4A 3BFVA 1V26A 1P2TA 2OR3A 3F4LA 3H9BA 2DBQA 4QSMA 3VYSB 1UEXC 4PFKA 2ZTUA 4FHDA 1IHOA 1DRVA 5CYFA 4N9WA 2CFCA 1N8SA 4HJXA 2O3RA 1JQDA 3WIOA 1U8EA 2WT8A 1PS0A 2VATA 3OJOA 5DH9A 1J99A 3NH6A 1TM1E 1UBUS 2IUUA 1SXJC 3WRYA 5JFTA 5D6NA 1T9ZA 3FPFA 5IX8A 1L9XA 4AYTA 1N0HA 2A5GA 4HEHA 3M9LA 1YQQA 2B6HA 2XT6A 4US1R 1MCZA 1WXFA 5D7NA 3SOZA 3K9BA 3U48A 4AQYB 4JXZA 1HM5A 5GAJA 3W6NA 3OOWA 4WECA 1HR0B 3BGSA 1OH5A 1IY2A 3OU7A 1XROA 2E85A 2X3UA 4NARA 3AJ9A 3ZW8A 4RZHA 5SZIA 1B73A 2CZQA 4DDHA 1D4FA 4U2EA 2CNOA 3TW6A 4B4WA 3D4BA 4GEGA 4V1CA 4H3KB 1QHXA 3ILSA 2XDWA 4IW3B 3LC7O 3PNYA 4F3YA 5L6LB 1OXUA 1B8UA 3CH7A 1VKJA 3WAKA 1B43A 4C9BA 3K9HA 5E4JA 1HURA 4F1WA 4PGMA 1NWHA 5C8YB 5A9SB 3CZAA 4R7TA 5TPWB 4JKOA 1NY6A 1E99A 1G4HA 1LSUA 4B82A 5DBGA 5BSHA 4BVAA 5BXYA 4IYJA 4WV3A 3LCJA 2IU4A 4HQRA 2I65A 2OV8A 2V3VA 2C8KA 1BS2A 1QZUA 3QX7A 1ADCA 3S1AB 4MULA 3GHYA 1GGNA 5BWCA 4X1IB 3W78A 1NURA 2KLBA 2P7HA 3S8EA 2WIFA 1CXZA 1QYIA 3OZWA 4EPRA 1J9ZA 1TEHA 2IX9A 4HQKA 3VR6A 4BLWA 1K8ZB 3TFQA 5C8ZA 3WTCA 2HOQA 1XCBA 4PPQA 2JJ1D 4EG7A 5I9LA 2ADOA 1Z0UA 2JJ2D 3T1HB 2E4YA 2JFYA 2O2ZA 3I6MA 3GLFE 3K72B 3PDHA 1B6RA 2ZR8A 2SCUB 4MYRA 3AF6A 1BKSB 2D1FA 1G6Q1 1G8AA 3CH4B 3DHYA 2XSZA 4FNGA 4QXQA 3TIFA 4KJZA 2XF8A 5CA1B 1KAGA 4R5HA 4JI7B 1G41A 4HATA 2QSUA 2CGEA 4U9UA 5HKOA 3OIYA 3VH3A 1N5JA 2E18A 2FSHA 1J8VA 4EWLA 3DLHA 1QX4A 4I46A 3QVGA 2FEWB 4MEJA 2A9QA 1JHXA 5IC5A 1BX0A 5FB3A 2OXCA 3W9UA 2OP0A 4UARA 4TSKA 5KYVA 4UHHA 4MXDA 5I3CA 1OFHA 1IVSA 3AZQA 1NIJA 2ECKA 3WZMA 2X13A 3ZBQA 1JB1A 5DX8A 1XG5A 1KL7A 4M36A 2A4KA 5FNVA 3ZI4A 4UD6A 1K9SA 2FGKA 1SXJE 4I8XA 4Q16A 4RF5A 1CJTC 5BYAA 4QWWA 5SYNA 3O2NA 4KQWA 5I8WA 3DHWC 3B1ZA 5KBYA 4E7OA 1XCLA 1SUPA 1VG1A 5CIYA 1MV5A 3I9NA 3E5HA 3QH4A 3R76A 4ALMA 1Z0AA 2Z5VA 2Z4RA 1XLTC 3HN7A 2WAXA 3HYLA 3IBSA 4BZWA 4JC0A 2EWMA 3B38A 1YFZA 4ZDKA 3RRYA 3E58A 4P31A 4MS4A 4BO1A 1QBGA 1U81A 4Y6OA 4AMGA 4AUEA 4XRGA 1WLSA 1DTWB 4XXHA 4KAFA 2WE7A 2E82A 4BS9A 5KNDD 1EVKA 4YS6A 2ODWA 3VR5H 4Q3EA 1QLHA 4EDHA 2DFKB 4AECA 3Q0IA 1E1QD 3K9LA 3LV8A 3FDZB 2C3MA 1CJUC 3KT0A 2HRCA 4RKQA 1HQDA 1VOTA 2HA6A 3PTLA 4U9HS 5G02A 3IAFA 2A5YB 3RTGA 3NPMA 1E1MA 4NXNB 1KRXA 3FD8A 3QTLA 2OSVA 1IAVA 1H0RA 2EJTA 3I9V6 1YGYA 3N7UA 1P3Y1 3ZJTA 3KQYA 5REQB 3VDQA 1E6MA 2OAEA 4Q24A 5LN1A 3H2GA 2IYSA 3MLBA 2PLWA 4W5TA 4RANA 1JFSA 2WM8A 4QUIA 4HDAA 2IWRA 1S96A 1R7RA 1K86A 3K1TA 1MO5A 1NN5A 3LK6A 1UAGA 5J5VA 3URMA 3Q10A 5MGNA 3KXDA 3ZY2A 4KO1S 3AIKA 1DAIA 4LFBB 4YMHA 4KI0A 1NONA 3B13B 4BE7B 4NOMA 4PR3A 2VTVA 4BNHA 3RC1A 2EKDA 3OBIA 1N7IA 1EGVB 4B74A 5GIPE 3DBLB 1ZQ9A 1J25A 4G1FA 4LGMA 4O4HA 1W85A 1W2WB 4GYWA 3LOUA 3KPVA 1NQWA 4MW6A 5C5EA 2NZUG 3RBZA 5EESA 2AXPA 5ES4B 4N40A 3A10A 1UC8A 5KSYA 4Z86A 3U1BA 4ACBA 2NMVA 1DCKA 4BQOA 4EB8A 4DLKA 3GLKA 1JLKA 1KY4A 1CYEA 1N6IA 1S0UA 2GJAA 1Q1EA 2AFIB 5C52B 1RM3A 1EK5A 4D96A 4D45A 2B25A 2WYOA 5TQJA 4A0FA 1AXEA 1E2KA 4D4KA 1T0IA 4ZIRB 1WETA 4YAJA 1T4GA 2B1RA 3HBJA 4GI1A 3GG2A 2BAGA 3LT2A 1NTOA 4ZJZA 3EH1A 4CCYA 2ZRAA 3CNQS 5LQKA 5ALJA 3AO0B 3K05A 3DKVA 1VI6A 4E14A 4V24A 1IIBA 3SNHA 1DP4A 2EERA 1T24A 1QRSA 1I5EA 2WKPA 1KO8A 4LYFA 4GLFA 4B9AA 2WZQA 3LXMA 4QPNA 1G3IA 5AXBA 4IDEA 5HE9A 2PX0A 3B85A 4GOLD 1TGVA 3TSCA 4G5OA 2JJQA 1GCOA 1XQWA 2IDMA 3BHNA 4I1RA 5F1OA 4LOLA 3UXMA 1MJGM 6REQA 3L1JA 1TMOA 3KZVA 5T4EA 4NL4H 4X7MA 3K8YA 1OI2A 1BJRE 5E7MA 4QU0A 1HGXA 3ZY3A 1GU1A 2PQMA 3SZMA 2EFHB 4G9BA 1DXQA 1HE8B 3BJRA 5F2EA 1L1FA 1P2VA 1WCIA 1E4VA 3AF1A 1YS7A 1W87A 3BCSA 4NZOA 5A4IS 2XLBA 1N1DA 2NP7A 4P38A 3M5WA 3ZW7A 3C1UA 4OJTA 4RE6A 2AVNA 1JQ3A 5B2EA 2QNBA 4H77A 2F9LA 3AM3A 5KHOC 2UZ3A 4Z4FA 2AR7A 3K5PA 1FDUA 2OO5A 1KSJA 3FJ1A 2HU7A 3GD5A 4AVYA 2HHHB 2D2IA 2Y0CA 3D6NB 4HRVA 3E7PA 4N3NA 4EHNA 2EQ5A 1TF2A 1Q0LA 4AD8A 5K8VA 1JDBC 2G7ZA 2XMDA 1O6FA 2ZT5A 3I32A 2DFVA 4MYHA 1O7JA 4Q1DA 1EHIA 2W22A 5IU6A 4AQDA 1WZUA 3H1FA 1YA6A 4D0LB 3AM4A 5KYYA 4CM5A 1X14A 2XVZA 2VK4A 3LUFA 4C0BA 1EDOA 3R2JA 3RK4A 1Q0UA 2WM3A 4Y9UA 2EEPA 1M3SA 3ZZTA 5IT9A 1JKXA 3QI7A 1MX3A 2HCJB 4JY7A 4ND6A 1ZGAA 3LKZA 5JG7A 4AY2A 5CVJA 1TMGE 1FW8A 1I3NA 2I8CA 3DAHA 1T8WA 4Z9BA 5EHGA 4LF8B 2WK1A 4QTZA 1FE8A 3DBRA 4OKIA 2WABA 5CNJA 4NYJQ 1R16A 2OHGA 4OU4A 2YTZA 2EP8A 1TC1A 4KMMA 1Q0TA 3BWCA 2O19A 1C4XA 3BXFA 3W2GA 4H1UA 1Z63A 5GJBA 3ZNQA 2AJTA 2QWXA 1KGSA 2OGZA 3UMGA 4DR4B 2B21A 4K88A 4PU0A 2FAXA 1JN0A 4RGYA 3AUXA 3T52A 4F04A 4NP6A 4R98A 4IDQA 4MDYA 5JAHA 4G2NA 4B2PA 3I6IA 1PFKA 2RSLA 5TGDA 3CTMA 1YZKA 4QYTA 5L7YA 1ONBA 1M34A 5B1HA 3FAZA 3KKPA 1P2FA 5J2TB 1NJ1A 1UMDA 3EGVA 1I0ZA 4IOJA 1O54A 1MAUA 3FFWA 4MPTA 1R00A 3SICE 1BRTA 2BE9A 3PNMA 3QV2A 4G1EB 4P83A 3I01A 3GOHA 5TVKA 4M0FA 4P3NA 2C3YA 4IJUA 4M60A 1NW8A 2CC2A 4QTXA 2HJHA 4REOA 3TDKA 3TLYA 3UHJA 4P3YA 5HWSA 3PCTA 5CAEA 3N2NA 4DRXA 5AVSA 2C7PA 3V2UA 5I51A 5CJJA 3GEDA 3IVCA 1D2HA 4ZZ2A 5HSGA 1F8GA 3FPEA 3KT8A 1RMTA 2EOAA 4PBSA 3W5CA 2YQZA 2NNLD 3AC0A 3G9XA 3KFLA 1OKKD 1M67A 3E35A 2REOA 3NNDA 1ZD2P 1RCUA 2WJJA 4KVAA 3VSAA 5L95A 1J8DA 2HO4A 1T6XA 5JWHA 1L8QA 1XD9A 3Q9LA 3COJA 1CEXA 1JQJC 3TB6A 3ZE6A 4L4XA 2KMLA 1WABA 1ONOA 5E6SA 4DCCA 5K45A 3QVOA 5E3JA 2A9PA 3KSBC 1QIGA 5J23A 1E79A 4Z0TA 1PKXA 1I10A 2Y1KA 5MFZA 3IMGA 1W44A 3HBLA 3D4PA 1MVOA 1NYLA 1RHJA 2BGTA 5CPFA 4JI1B 2I87A 2IIBA 2OGTA 4ICIA 5FYDA 1BOOA 4MYTA 1JMVA 5LU9A 1KDZA 4HUJA 1X6VA 4PW0A 3VDMA 2JIZA 2OCXA 4D9KA 1A9PA 2Z6AA 3FYCA 4V0LA 2AQIA 4TVKA 3U0BA 2GBPA 4ER3A 2X3YA 1FRZA 3DBHA 3TZLA 3GLHE 4FI3F 16PKA 1COWA 1VZ2A 4DNXA 2R751 4JI5B 5IYZB 2PS1A 1NY5A 1L0BA 2GPWA 3LC1O 1BROA 4LC1A 2C2MA 2B8JA 4G6ZA 1EG2A 8ATCA 2YJZA 4HRYA 4FONA 1FMCA 1MA0A 2VSNA 3DAPA 1NTRA 3H2BA 1QE3A 2L0XA 4XD7A 4OHZA 3ON5A 4AY5A 1JTEA 2MINB 3WDLA 5ALPA 3RVNA 4DLZA 1U2SA 1N9ZA 3J81k 4PGHA 4V03A 4GS5A 4GPIB 3UJ7A 3C0KA 1NDHA 5C3UA 2ADFA 1D6JA 4RDXA 2V5UA 4XRRA 2PIAA 2PTGA 3DE2X 1P45A 3S70A 4F85A 4LGYA 3WKDA 4WOBA 4C0SA 3CRMA 3GLSA 3PFWO 3SHTA 1QDLB 1OLOA 4ITUA 2F62A 4YXWA 1F1BA 2VXYA 3O8CA 3ICVA 3MWFA 2VT7A 3KCNA 3WWEA 5TGTA 1GUDA 4RESA 1ZEJA 2C9DA 2VT3A 3PJGA 4IIXA 4MJ7A 4OHMA 3RYTC 1FS6A 1Y9EA 2ZR0A 4RFVA 1F48A 2XMBA 4ZZIA 3EWAA 2PCJA 4O0LA 1K3UB 1NRJB 1YACA 5CFPA 3QV1A 3SR3A 2VDWB 1Z6YA 1WPRA 3BZBA 3DMPA 2I67A 4FNMA 2CXSA 1YFJA 1UJ4A 4M21A 3ZNNA 3LX4A 1IZ8A 2G04A 4RUKA 4YBZA 2YZ2A 5CT5A 2A7QA 3MJ4A 4IH1A 4Q3NA 4OOFA 2QZZA 2GJ9A 3KD3A 4H2DA 5EAIA 3H6GA 3WBBA 4B40A 1DV2A 1M76A 3LDFA 3N0VA 4OJQA 4Y98A 1AQUA 3O3CA 4CF4A 1T1JA 5B6IA 1KPHA 4V38A 1BRMA 3STXA 4I2NA 5DP1A 3FTNA 2YRFA 2W6ZA 4GMHA 2PFSA 5EE1A 1OX4A 2DAPA 1TZBA 1IN7A 2FZ4A 1D2AA 3FPLA 3QY0A 4XAQA 5HG0A 5TEVA 1Q7CA 2FPPA 4MVJE 4DLYA 4CKWA 1JHVA 1ZK3A 2IX3A 1PEKE 3QELB 3VC1A 4NYIQ 3ZD6A 2PLRA 4UEOA 1ZO8A 1DQSA 2IUSA 2JFHA 2OHOA 2P2CA 4PYLA 3M4NA 2JLVA 4A1OA 3CQ9A 3IP8A 4LMAA 3GEGA 4R9RA 1HNXB 3EBPA 2BCEA 2YZKA 3M6IA 1GN9A 2WV7A 3O8DA 4GL4A 4Y9RA 4PYQA 3W8NA 3U6KA 4LZOA 1RWOA 3WMRA 4AZWA 2PKWA 2VNJA 3HUTA 4ECAA 1XN1A 5KX5B 3C5CA 3NIBA 5IM5A 1L1QA 5AI4A 4YJ3B 2IYFA 2CLDX 1ZGJA 3IDSA 5CDGA 1LBTA 2UVDA 3NT5A 1XU9A 2V4MA 4IBOA 5B6JA 1R0KA 4NE2A 3WJAA 1ILEA 4CTJA 1KMHB 1OA0A 3FSEA 2JIDA 4ZCQA 5CITA 4TS3A 4BV2A 2JCVA 2M6KA 3DH0A 4N01A 4D8YA 3ASZA 1U4NA 1MG5A 2ZTVA 3A6ZA 4M86A 2FKAA 1U0GA 4KNVA 4NCXA 4YONB 3SR0A 3P97A 4P81A 3HJHA 1FQWA 2NADA 3DEFA 1T6ZA 1ZZEA 3M6WA 1KZ1A 1S3FA 3MPUA 5AVOA 4ENSA 3RS7A 1EVIA 2G4CA 1CY8A 2JPDA 1P1JA 2QW1A 5TJ9A 1REQA 2CEAA 3B5JA 2O0HA 2QMOA 2R0QC 1JTVA 2AL7A 5JHGB 1G6HA 2VNHA 3AERA 2BMFA 1T34A 3VXKA 1NPTO 3C3WA 3K71B 3KFXA 2R62A 4IAOA 4X64B 1G8MA 3DVLA 4JBXA 4TT8A 1EVJA 5DP2A 2BGNA 3PA6A 4MIYA 2GJ8A 1W47A 2PWBA 4KR0A 4E2YA 4JYZA 1UPFA 1AKQA 5DNVA 4ZQHA 2CMDA 3RRFA 3TCKA 4Q93A 2IPLA 1EP9A 2XBUA 3HWWA 2PA0A 4UTZA 4E08A 4M0CA 4FFVA 1Q57A 2O14A 2C00A 1S7CA 3K0AB 4NJMB 2NU9B 2FPIB 3IR6A 4WL0A 1GAWA 3DBIA 2FE4A 4FW8A 1CRZA 4DBZA 1PL6A 2PO5A 4EQZA 4PNZA 1YNOA 4KSCA 4I3FA 2DJ5A 3L6UA 2DPXA 2O6LA 1ZI9A 1FC0A 1Q1QA 3NLLA 1SM4A 3UJHA 3VUFA 5DV9A 2CMGA 2X4IA 2YXBA 4ZT5A 4GBJA 1BAPA 1QVAA 3ZW9A 4Z4QA 1JA9A 1UXKA 3I5UA 2OB2A 2W43A 2ZIAA 4YAWA 1OB2A 3C5WP 2H4YA 4B3FX 1KS9A 4ZQCB 1J6UA 4L50A 1WQ1R 1USWA 1GPYA 3UT6A 3RS4A 1L8LA 2ZB8A 1M2OA 1OGJA 5KWEA 1ZXBA 3ZHZA 5C5CA 4AN1A 3S2UA 2KWIA 2A1TS 5FPHA 1ULHA 2IHNA 3U3OA 5DHAA 4C0QC 4E4TA 5AKJA 1NUPA 1Y6RA 1SQGA 2FN4A 1U0RA 3OQIA 5JYDA 1LSSA 3ISVA 2WICA 3R3VA 3ELWA 5JAIA 4XD2A 1AZSC 3K8ZA 4G8DA 1UFQA 1EFUA 1Z4QA 5BMVA 3EY4A 3ZIAD 1R12A 4YT8A 3C74A 3JQ7B 1ZD5A 1V8PA 3E8SA 2ZB7A 4HNAA 1WNTA 4MO2A 4UBJA 2C7VA 1OXMA 4LY9A 2J0SA 1M6WA 3DZDA 4G23A 2J5BA 1VSQA 3QUCA 1QIJA 1JSXA 2ZIVB 3O0DA 3HSSA 3OE7A 4OBBA 6CHYA 3ZJUA 3FNFA 4C0XA 1Z75A 5H5JA 1SUFA 4B1FA 3C48A 1SBNE 4JJKA 1Y4AE 1KR5A 2MSLA 5CLJA 5AXAA 2OD7A 1II9A 2WBLC 4IG9A 1DBQA 5FOSA 4WNAA 3NDBB 3M70A 1TVKA 4P5EA 4WCFC 4GYKA 3KYJB 3UPDA 1B8VA 2JLCA 2VIIA 4DQ0A 1W1WA 4HYEA 1RXIA 5BWOA 4RA9A 4B75A 2BI7A 4Q0MA 3ZS9A 4TKUB 1Y0BA 2PKEA 3M6FA 3X1YA 4GYYA 1LTKA 1TJYA 2DRIA 3LQ2A 3WVNA 4PN3A 5EMMA 3BXHA 4AULA 1BU8A 3U61B 2A94A 1SZDA 2HREA 3E27A 1Z6XA 2HWYA 5HK9A 5A5DA 3R5FA 3CX7A 3KHUA 1QO0D 2VCHA 3M5CA 2OYCA 3T0FA 4W5JA 1J8MF 3P9XA 3CPJB 3FVWA 3ZWVA 2PNFA 1HMYA 1YR3A 1TAGA 1ZK2A 3BMQA 4S1VA 3TLMA 1IH8A 3TVYA 3GEHA 1TYEB 4EYEA 1QCYA 3CBGA 3KSZO 4Y7DA 1MX1A 3N8DA 3B9BA 4GRIA 4B79A 1JDZA 3SIPA 4H6VA 2BYTA 2R6GA 4UHBA 1LGYA 3V34A 3AWDA 1A95A 5F35A 4PO8A 4I55A 2GKGA 4LQCA 4QOIA 2QX9A 4EKGA 5DK4A 1KSHA 3OFNA 4B3IA 4E15A 4Q03A 4IV0A 1FTQA 4G65A 3B5IA 1RWMA 3OJFA 3E4CA 3I8OA 4U4AA 2QTFA 3RHFA 3SEZA 1J5XA 2WA1A 1JEEA 4RVGA 4KRYA 2FEMA 3HZHA 4D5GA 1FFDA 3O2SB 2JS7A 3RU2A 1A4XA 4KIUA 4YUYA 1F38A 2H06A 5DXJA 1GRCA 4JDPA 4UKDA 5FTMA 4OJMX 2C5AA 3JAWB 3WK5A 4D0GA 1H2AS 4MUXA 1WL8A 2YUIA 2B20A 1NKSA 4L73A 1KNXA 4TLCA 2HJGA 2AKEA 4JYMA 1NJSA 3TZ6A 1F6DA 5DT9A 1MJFA 2PMBA 4GKAA 3G6KA 5FBLB 4XGIA 2ZRFA 4LPSA 4DABA 1FA9A 4ZU3A 4HFRA 3ER9A 5FR1A 4E88A 3I01M 3LLMA 2G1KA 4ASUD 2XDQA 3DL0A 4Q3OA 1KXZA 3FF1A 1IK6A 5JAPA 1X1AA 4EPTA 1KIAA 3ZHBA 1AXRA 4KBGA 3I3SR 4KU4A 5B3JA 3VI3B 1T1IA 5EJ7A 5KNLA 1N78A 1ISGA 4AY3A 1VIMA 4JSRA 2OFOA 3TQCA 1R6DA 5AKHA 3H8SA 4HAVA 4K5QA 4RTMA 3AEKB 3N7TA 5F21A 5H80A 4LNUB 5AT1A 1R9NA 2C92A 2FW7A 4RVFA 2AMLA 2HK6A 3QKRB 3TTTA 1SQ6A 5B1SA 3Q9NA 1IY8A 1Y6QA 5JCZA 1BXZA 1R0SA 3L0PA 4Q7EA 5EINA 2X2EA 3L06A 1ZAKA 1W9HA 4BC1A 2O06A 1K2WA 1U7DA 4GSKA 3RQIA 2HI0A 5HMLA 3UFXB 1QU2A 1JYFA 1CPYA 2LUOA 2SICE 3ZE2B 2HKIA 3PF9A 4ZOAA 1VJRA 3WFJA 1X7ZB 2F3UA 4KWTA 4RVDA 1L5HB 2P90A 1J2UA 3EGDB 4ZVNA 3UPTA 1O97C 1LQUA 1UQRA 2FU5C 2VF2A 3AI3A 4BO7A 5K0JA 2QDKA 4D74A 4ZGGA 1H3FA 1OT3A 3NWPA 1XEWX 1GWNA 3IIMA 1YVRA 2IXEA 2ZJ6A 3LX8A 1A69A 1XZHA 3C97A 3H6HA 1GCIA 1P72A 1UEJA 2HEGA 1W88A 2PX3A 3JD2A 4Q7JB 4C20A 4F56A 2O8FA 2GBFA 5M3BA 2UYGA 3K5WA 1G1MA 3FTPA 4H1HA 4DEXA 4JEIA 2D54A 2YNMD 4E7PA 1ZM2A 1JEQA 2KB0A 1F06A 1M2FA 2QUBA 3K6SA 1VTKA 4PQYA 2BMVA 1CD5A 1WVMA 1KFBB 1Z4LA 1ILWA 1B16A 1C80A 2HHAA 2PWAA 2QE7A 2WDPA 2YYSA 3EHDA 2CVQA 3HJBA 3SIRA 5HTOA 4YV0A 2AEEA 2OORA 2JI6A 3VVBA 3EB9A 4MB0A 1U63A 1DKUA 1EE2A 2RGEA 2C5HA 3I2HA 4XDYA 5AW7A 5LZ4A 1J5EB 5IARA 5LYJF 2ODTX 3HCDA 1UODA 1W8IA 3FMVA 1HYBA 3PRYA 1L7MA 1H8HA 5B64A 1Z39A 2H0AA 4J6EA 4L5CA 4D79A 4DIFA 1HOTA 1EGHA 4LSGA 1NVXQ 4AYXA 2IODA 3H16A 2WIKA 3AU8A 3QFTA 1KVTA 3AETB 2GEUA 5B4UA 2HLDA 2QTVB 1BJKA 5IXSA 5L4NA 2BGJA 3CH6A 2OBYA 2W2KA 3A3OA 2GA8A 3GJYA 3QX3A 4G0WA 4M83A 2OFXA 2QU8A 3ZI7A 5LMNB 5KSZA 1UC5B 4AZ3B 1U80A 3ABRB 2ZTLA 3GGSA 4PLCA 4W5OA 4TLEA 3KU4A 1I7SB 3B1XA 3RS8A 5EZYF 3BD7A 5CRIA 5JJLA 2FYTA 5BNZA 4YDQA 3HS3A 4P22A 3UAXA 4OL9A 1VBMA 2JAWA 2WILA 1P81A 3NYQA 3DL4A 3AM1A 3NIGB 5J4KA 2IT1A 4CTKA 4M1MA 3BSSA 2QRMA 3QWFA 3JWIA 1SEVA 4ER6A 1V95A 3T3HA 3PFIA 4EA6A 4G4GA 1C7IA 2YV1A 3A1FA 2Q1UA 1AS0A 4D2IA 1GGEA 1HYQA 2YJTD 1JLLA 4EI9A 3PR1A 5KAPA 2Y2VA 2CCJA 3FBGA 2DUWA 3H99A 2BFBA 3RWMB 1QK4A 2WJIA 5FI1B 3SMQA 4UTPA 1CSEE 1XK7A 3N2KB 1NXTA 1H2EA 3CKYA 5LMCA 2C78A 3MD9A 4QAJA 4WJLA 1PD0A 4S2EA 1G8JA 5DBEX 4QOJA 5I9IA 2Z56A 3BGOS 1Z4JA 1QAMA 3HNRA 4EP1A 4X93A 4TYYA 1HRKA 4P93A 5CUQA 2LD4A 4CG3A 1Y1QA 3NV7A 3W7BA 3U13A 1E3TA 1Z88A 3E0XA 3NIFB 4FZVA 3T3IA 5IKPA 4RZSA 1JU4A 1M2JA 5F76A 1KU6A 3P0EA 3CR7A 3UYLA 1NSTA 2O57A 2PMKA 4IO1A 4UBKA 4DIKA 4B3RB 4UC0A 3TRJA 1NQUA 4IUYA 2JLUA 2ZCJA 3E9YA 1U7TA 3FNIA 4MJ3A 1I7NA 5K8TA 3MYRA 4R0VA 3FHTA 4MQLA 4TS1A 5AKZA 1JSLA 4KEAA 5NULA 2VTEA 3PZBA 2R7MA 4X85A 3V48A 5JADA 3OX2A 5IASA 4IIEA 1R0LA 1HWYA 1XZEA 1JAIA 1EFVA 3EIFA 3OSZA 1UC9A 1MOQA 3Q3HA 2P2SA 5A2QA 2X0RA 3G2OA 1ZFNA 2B98A 3PKIA 3UBTA 4MGHA 3VO9A 3EIUA 4QM6A 4Q1EA 4DRYA 3KR2A 4BLSA 2HZBA 2VDQB 2X4LA 3FMPB 4Q9NA 1LLUA 4RORA 1JPUA 4IEEA 2VUSA 2WE8A 1ZK0A 4M8SA 3P2JA 3KUKA 2K7FA 1R9GA 1G9TA 1SIBE 2JI9A 3EPRA 3N2LA 1DUIA 4Y9TA 2YVLA 3K2QA 4D26A 1G3MA 2PHZA 3UWKA 2GHRA 4WADA 1BXKA 1F9AA 1ONNA 5EXEA 4E33A 5L3VA 1ZSYA 3QY9A 4Q1FA 5FBQB 1CNMA 2H4WA 2X8JA 3MGCA 5KNDH 5IMBA 2BFNA 2IDJA 3N2GA 5EQTA 3X3HA 4CNQA 1DJPA 4KXWA 2P0YA 5IN5A 2X22A 3WO0A 3OKPA 3ZJVA 2J9FA 3T3EA 4QZVA 1NVTA 1X8JA 2QYTA 1RE1A 1VYUA 6YASA 5KDDA 1A5BB 1ONSA 1KXJA 2YYAA 1FX0A 2IF2A 3EFHA 2P2DA 4IEIA 1WUJS 4LRSB 1GN8A 4TWZA 4AYWA 3PWZA 3K32A 4BN0A 2J3LA 4JP1A 4HH4A 1Y5IA 1QRUA 4KXLA 3IOMA 1FP4A 3CF6R 2FWMX 3V32A 3BRSA 4QBTA 1XK6A 1FSFA 1K6XA 1GGKA 3OEED 4BNYA 3BJIC 4KTTE 4XA8A 5HJ2A 3SJAA 4IDAA 2IH5A 5CJ2A 5BSGA 2QRLA 4W99A 2ST1A 3SKXA 4EH1A 1PDOA 3UYKA 4RX1A 3X1KA 4Y67A 1GGMA 4ZEMA 3ZNPA 2RHWA 3UB3A 3ZNOA 5ICMA 5LYJA 3IAM6 4E5UA 2ZUFA 2I03A 3R3SA 1SQFA 1CX9B 4YP1A 5TPZA 4A16A 3OOSA 2P6MA 5JQGF 4LCJA 1AHNA 3MFQA 1ZR2A 4KR3A 1B1AA 2PLNA 3BUSA 4CIBA 4XWGA 1CEYA 1BXRB 3U7QA 4D0SA 4CHTA 5ELMA 5FCDA 1Z82A 1F4LA 5D3KA 1LRKA 2BJWA 2VJLA 5K0TA 2NZJA 3AFMA 5EEHA 4GL2A 4BGIA 3TEMA 1ISHA 5MN6A 4C7MA 1MOZA 4I8IA 3NEJA 4ROSA 3ZTTA 4DQDA 2E49A 3RCBA 1XDSA 3A8TA 1NXVA 3AU9A 1UK9A 1W34A 2YWHA 5TQ0A 3X2EA 4AKTA 2ZWOA 5LKAA 3EMBA 1JR4A 4XX0B 2XMSA 3UG7A 4LXHA 4TV9A 3LNTA 5LC1A 4OB8A 4RA6A 2GCNA 1E2DA 3H2YA 4J6FA 3QVKA 2PGIA 1SU8A 3BBLA 3LGXA 3ZWBA 3AZOA 3EXEA 3G1WA 4B6FA 4F2WA 1F0NA 4OLFA 4BAGA 1GQQA 1KJWA 2QVBA 3C6ZA 2FZVA 2JFOA 3L6DA 1IQUA 4KZPA 2PUFA 2BTEA 2FMHA 4NZ9A 1ML4A 1P91A 3ZJYA 2O3SA 3ZI0A 4BGDA 1CR1A 4F3CA 2P4SA 3H87A 3V4LA 2DEUA 5IDYA 1PCXA 1ABFA 2AG6A 2UVPA 4QXAA 5F12A 4C0AC 1H9BA 4PYMA 5D8DA 1SHUX 2BDTA 1GHTA 2DHQA 5DM60 2AF3C 3H9JA 3N0WA 4PZEA 5JS7A 3AKCA 2P8JA 2Q3BA 3MWGA 2A9KA 3KZMA 1MENA 4UXHA 5DI3B 4ZXFA 3V9AA 2FZEA 4YCSA 1N7HA 2NU7B 2HC9A 3U5ZB 2HR1A 2Q2NA 2ZYAA 4Y6GB 3ROZA 1T9KA 3N58A 3THOA 3W5VA 1R4NA 3E2PA 4Q4AA 1ZOSA 4OHCA 3PICA 4B3HA 4P2GA 5DGDA 4GT1A 3EVAA 5T64A 1OE0A 2MSNA 2JW5A 3HGTA 3N8GA 2V9CA 2NO7A 4RKYA 1KJNA 1LS1A 5K6AC 1NUSA 1R8XA 1WUHS 3ZV3A 3KSMA 4H60A 2FPRA 1NHGA 1RACA 4U6NA 5T4HA 1QXSA 4OMUA 2NACA 3DWFA 3JYLA 1EXDA 3RGWS 1QG6A 3E9RA 2C31A 2ASEA 2RK3A 1L5LA 2IEBA 3TUIC 4EHFA 4ZARA 1AHHA 1G9SA 2ACWA 3HR4A 3KQSA 1KK1A 4GPZA 3RHSA 1WCXA 3EDRA 5DFAA 4C87A 4TQGA 4V0OA 2QX7A 1LTQA 1Z2PX 1CVRA 2O7VA 2XUFA 4JVNA 1RYHA 2GBCA 4AWXA 2VHUA 4XTCS 3IMKA 3P0RA 1QVWA 2WEKA 4A7PA 1DIGA 2BGMA 5CA1F 3MCAA 3JQ8B 4YRKA 3L0ZA 5CG2A 3PT9A 5GM2A 3IQIX 2AEMA 4N1AA 4L0DA 3KTAB 5H70A 4AJ2A 1VPWA 4OOEA 1X0XA 2X1LA 3I04A 4XARA 3UMVA 5KUTA 2RGAA 3IHWA 1SUAA 1AA6A 3BFJA 2ZSDA 3OECA 2V54A 1NYRA 5CVDA 4KWIA 1O94A 3VPHA 3WHIA 3D2BA 1W30A 1V3QE 4ZAFA 4FEGA 3ZCVA 2P9GA 1WHTB 2HGSA 1J2JA 3KT3A 1FVXA 1GSOA 1DS6A 1PHRA 2DBZA 2PZMA 3NQ41 4HEA1 1OFIA 4HLNA 4UXJA 5ABPA 1EAYA 4ZOCA 1NZJA 2VYVA 5TS3A 1N3YA 3JU3A 3KKEA 1IXSB 3EBOA 1HLPA 2G17A 3VR2A 3I61A 1VIVA 1FP7A 3EJ6A 4L51A 1N8TA 1S5PA 1AMUA 1XDDA 3VFDA 3WSWA 4DWWA 1L8XA 1T2UA 3PYXA 2CK3A 1NVBA 2EFDB 4HWSA 3IH5A 4FHZA 4MQ4A 3DZGA 4L02A 4Q00A 2Y0EA 2CXQA 2BGIA 2JIOA 2R5FA 3GGDA 3THRA 5CVTA 1VJ1A 1PP4A 1PR5A 1SIUA 1TF7A 2HA2A 2HMYB 3AI1A 4ILEA 3SQOA 2BZ0A 3BEDA 2R25B 4UU0A 3MBIA 1YTUA 3P9YA 3JQCA 4B85A 1P74A 1H4TA 2A88A 2XNKA 3WISA 5JQGA 1Y8ZA 5JFGA 2NO6A 3LC2O 4MUKA 1OSNA