4RTOA

Complex of escherichia coli dna adenine methyltransferase (dam) with sinefungin and with dna containing proximal pap regulon sequence
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
268
structure length
249
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSKKVDELLALYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
molecule keywords DNA adenine methylase
source organism Escherichia coli
molecule tags Transferase/dna
total genus 78
structure length 249
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtoA01
1RI4A 3RW9A 2FCAA 3P9KA 4HGZA 5E1OA 2IH2A 5GM2A 3EVDA 2DPMA 3KR2A 5EOVA 4AX8A 4EQZA 5ERGB 1EQAA 3TMAA 5LQKA 2HR1A 2VDUE 3MTIA 4LWPA 5FA5A 3TRKA 1AF7A 2YXEA 3O31A 4QVGA 5LSAA 1UIRA 3HCCA 3GIWA 1JG1A 3G8BA 5E1DA 5CVEA 5KS2A 3GRYA 2PX5A 3EEYA 4ER0A 1WG8A 1EIZA 2QRVB 4U7TB 3KPYA 5KYGA 5CVDA 4GOND 5E9WA 2AOTA 5GWXA 4E32A 5GIPE 2G70A 5FULA 2FHPA 3I9FA 3BGVA 5DSTA 5ICGA 5FTWA 1XDZA 5K0GA 4GOOD 4X60A 1YFLA 2P3LA 3DLCA 5C0OE 3L8DA 2XVMA 2XYRA 1KYWA 4ER5A 3K0BA 1SUSA 1JG2A 2BR5A 2O06A 2YXLA 3A7DA 1EG2A 4O29A 4EK9A 1D2HA 3KQOA 3R9XB 3HCBA 5DTRA 2B3TA 2FPOA 1X19A 1ZHFA 3LPMA 4C4AA 3P2KA 2AVDA 2PV0A 3Q87B 3P9CA 5EEGA 3UZUA 3EVGA 1KR5A 3AXSA 3LL7A 1VP3A 3DOUA 4V0QA 5CVUA 2P7IA 3CC8A 2G72A 2ZZKA 3FPGA 3BZBA 5K01A 2AOVA 3ID6C 4ER6A 2G71A 3PT9A 2UYCA 3M33A 4GUAA 1JQ3A 2VS1A 4RX1A 4RYLA 2GLUA 4Y2HA 3NW9A 3HM2A 3SGLA 5LQNA 4RTKA 1SQFA 2XVAA 3EMDA 2ZWVA 3EVCA 1YFJA 3DXYA 3HCDA 2UZ4A 5FWAA 5DM1A 1QANA 2Q41A 3BWMA 1VPTA 3EVEA 4GOLD 3MCTA 1L3IA 1X1DA 2R3SA 4OBXA 3HA3A 3SSOA 2EX4A 2P3OA 2P35A 3EPPA 2P41A 1VP9A 2GAFA 5HEKA 1AQIA 4RTJA 5HIJA 2N47A 5GM1A 3DXXA 1NW5A 1YZ3A 2P1DA 3OZRA 4FZVA 3DLIA 4CKBA 2BM8A 4HTFA 3SX0A 4DF3A 2JH8A 4RV9A 5CUQA 1G60A 2A14A 1UFKA 4DCGA 3KPUA 3THSA 3PLAE 1NKVA 1NW3A 1EJ6A 2IGTA 4BP3A 4CTKA 1PRYA 1JR4A 3UFBA 1U2ZA 5MHTA 1JQDA 3EVFA 3UJAA 3M6WA 4GBED 2FK7A 4PYKA 3SVZA 4E2YA 2ZBQA 3GDHA 2PWYA 5T67A 3UJ8A 5LQJA 1I9GA 4QPPA 5CIYA 4BY9E 2XBMA 5H02A 3DTNA 2PWPA 2AOXA 3ELWA 4UOEA 3R0QA 3GRZA 4FS8A 4E70A 4FGZA 3TLJA 1R00A 3DH0A 5DX0A 3HEMA 4QQKA 2GH1A 2C7QA 3Q7EA 1H1DA 1RJFA 3KQWA 4PYQA 5EEHA 4QPNA 1L3CA 1VIDA 3IHTA 5LR6A 4F84A 2JHPA 3E7PA 2GA9A 2HV9A 3KQYA 2VZ9A 5CVJA 1HMYA 2FK8A 3HP7A 4Y30A 3TQSA 5GINE 3QOXA 3DP7A 3CKKA 3D2LA 3LBFA 4LECA 3FPEA 3S68A 3MAGA 3VC2A 4POOA 1XCLA 4X61A 3ELUA 3BWYA 4DKJA 5EGSA 5E1MA 3G2PA 3BGIA 3HA7A 1ZQ9A 3IYLW 4ER3A 2ORED 3I53A 3PX2A 5FCDA 2PXAA 3P2IA 2IDJA 1R74A 1JSXA 1L1EA 4P7JA 3KR1A 1N2XA 3P9NA 5K0CA 2LD4A 3LBYA 4C05A 4RTOA 1WXWA 4PYJA 2PGXA 3LECA 1O54A 2HTEA 1MHTA 5CVVA 1VBFA 1FP1D 3CCFA 3UJ6A 5EIWA 3A4TA 4ZTBA 1JG3A 9MHTA 2YVLA 1G38A 3RODA 4B17A 3AJDA 3FUTA 3G2QA 4OQEA 4AZWA 3ANXA 4HSGA 4YUXA 1EJ0A 3KPJA 4IV0A 5EKXA 1NV8A 3EVBA 1X1BA 3PFHA 3M4XA 4E2WA 4ISCA 3KHKA 4GC9A 3G2MA 4R05A 3O4FA 3HVIA 2DULA 4GC5A 5HOQA 2H11A 4R8SA 3M6UA 4QTTB 4X1OA 1P91A 2ZZMA 2AN5A 3BKWA 3G89A 1F38A 2PSSA 3GNLA 4ER7A 2H00A 2PBFA 4KVZA 3PFGA 2JHAA 1D2GA 4GOMD 1X1AA 3TKYA 5EG5A 2CL5A 5BW5A 2NNWB 1RI3A 4A6EA 5JUWA 4RVFA 2EG5A 1RI1A 3HVKA 1ZGJA 4RTLA 3MB5A 3GRUA 4GF5A 3LSTA 3KR0A 4H0NA 3SM3A 5U4XA 3THRA 2JH9A 2AN4A 3UA3A 2PX8A 3A27A 5DX8A 1NBHA 1NW8A 5DLYA 2NP7A 1KHHA 1QYRA 3GJYA 3NTVA 4FP9A 4V0RA 4MTLA 3ME5A 2NP6A 5DWQA 5F2OA 4A6DA 3VSEA 2NXEA 3EGVA 4KIFA 4EKGA 1L3BA 2GPYA 1TW2A 1XVAA 4PIMA 1R8XA 2I6GA 3IV6A 1QAOA 4GEKA 2Z6UA 3NVKI 3MGGA 4QVKA 4MWZA 3FUXA 2IIPA 3GXOA 5EVJA 3OU2A 4DM3A 4C03A 1N7IA 2AS0A 3HCAA 2I62A 5ICEA 1M6EX 3FUUA 5LQRA 2PT9A 4E2XA 5C9ZA 3FYCA 1XDUA 3IEIA 3V8VA 3GU3A 2QRVA 4IV8A 4IKPA 4KRGA 1G8SA 4AZTA 5KQSA 3FYDA 3GO4A 3LHDA 3LGAA 3A7EA 4FR0A 2PX2A 3CGGA 3NWBA 3FPHA 5DRYA 3HNRA 4XUCA 2ERCA 1O9HA 4PYMA 4DZRA 7MHTA 10MHA 4PINA 4FSDA 5K0BA 2NXNA 4PYIA 5T6BA 4NECA 3CVOA 3MTEA 2AVNA 5DT2A 5DM2A 3FRHA 4K6MA 1BOOA 5FQNA 4BLWA 2ESRA 3C3YA 4YUWA 2IFTA 3R3HA 1YB2A 4X41A 3UJ7A 4YV1A 2O07A 3MERA 3HVJA 3CJRA 5HILA 3MQ2A 4BLUA 2AOUB 4XCXA 4WXHA 1KP9A 3OFKA 3KPVA 4L7VA 3KQVA 3FTDA 5B1SA 1NBIA 1RJGA 3DMGA 2KW5A 4HC4A 4BLVA 3PS9A 2ONYA 2GB4A 1Q0SA 3HTXA 3BXOA 1L9KA 2B25A 3I5UA 3KU1A 3MCZA 4C04A 2Z6QA 2R6ZA 2PLWA 2OO3A 3LKZA 3TR6A 1YZHA 2PKWA 5P8WA 3NWEA 2CWWA 2H1RA 4XUDA 3SXJA 3VYWA 2YX1A 4RSRA 3ERCA 5LQAA 1X1CA 2Z6AA 4KW7A 3EGIA 3DR5A 3M70A 2IH4A 3LCCA 1KPGA 4YV0A 3E8SA 2BH2A 3KQPA 4M38A 4RWZA 2VP3A 2YXDA 2CKDA 3JWJA 4BP1A 3DXZA 3JWGA 5EHIA 1RJEA 3V97A 3PX3A 3P97A 2OXTA 5DM0A 2ZSUA 3HCFA 3OE5A 1FBNA 5K0JA 3B5IA 3NDJA 5K0EA 2P7HA 3DUWA 1ORHA 5ICCA 4YUVA 2VDWA 1VLMA 4EKIA 4QDKA 1BHJA 3FUWA 3PTAA 3B3FA 1XDSA 1BC5A 4MHTA 1XTPA 4CWAA 4RTMA 4OQDA 5FADA 2ZW9A 1RI5A 3JWHA 3C3PA 3UWPA 2P40A 4QTUB 3AXTA 3KKZA 3E05A 3E23A 3NJRA 2PXCA 2G1PA 2CMHA 2YUIA 3U81A 2I9KA 3TKAA 2ZWAA 5E9QA 1VL5A 2QY6A 3P2EA 5M5BA 1TW3A 5K0FA 2ZFUA 2IBTA 3A25A 3ELYA 5DTQA 3ER9A 3K6RA 3F4KA 2GS9A 1P1BA 2B78A 4PGHA 2IBSA 3OU7A 3HA5A 2HNKA 3AWIA 5BW4A 4PYNA 4QDJA 5DX1A 5EC8A 5LQUA 1XJ5A 4R6WA 2OBFA 3GWZA 4AZSA 4HRAA 1NW7A 5K0NA 3QV2A 4JXJA 1SVUA 3O7WA 5EQJB 5EZQA 5GOZA 5HIIA 1TPYA 4YMGA 5KQRA 1P39A 3LCVB 4U7PB 5D1NA 2ZBRA 2ONZA 2K4MA 1JSZA 5DPMA 4EVIA 5EHGA 1M0EA 3ORHA 1JTEA 5FWDA 1WXXA 3BKXA 5HIMA 4F85A 3EEOA 4CKCA 2VDVE 3KQTA 3LDUA 4PYLA 3FTFA 3G5TA 2O0LA 3SSNA 3UJDA 1YF3A 4PNEA 5C1IA 5E1BA 2OYRA 5DM4A 4YMHA 5KVAA 5FHQA 2HMYB 3A26A 3ELDA 1QZZA 5EZSA 5FA8A 1D2CA 1KXZA 4RTQA 3VC1A 5D1HA 3P8ZA 2AOTB 2BR4A 3B7PA 2EJUA 3T7RA 5F2KA 2IH5A 2QE6A 3NMUF 2OB2A 4P7FA 4ATNA 4E2ZA 1WZNA 1G8AA 1QAMA 2XYVA 2BR3A 1QAQA 4C08A 5K03A 4DMGA 5GIOE 1KIAA 1I1NA 1SG9A 1WY7A 2P8JA 2WA2A 3LDFA 3UBTA 2YTZA 2WK1A 2EJTA 4DA4A 1ZKDA 1MJFA 1ZGAA 3CBGA 4AZVA 2E5WA 1XCJA 5GP1A 1UWVA 2ZIFA 3FUVA 3I58A 1V39A 3OFJA 4PYOA 1NV9A 3KQMA 4KDRA 1FPQA 5CCXA 3DMFA 2V7EA 3KR9A 5DXJA 1IXKA 1SQGA 2ZVJA 2ZCJA 3LCUA 3FPFA 2C7PA 1AV6A 2ZIEA 3TPZA 3T0IA 1SUIA 2ZTHA 1Y8CA 4LG1A 4P7GA 2OY0A 2AN3A 4M37A 5DSXA 4WVLA 3SR4A 1FJXA 2PXXA 3OPNA 5BXYA 2PJDA 1P1CA 1G6Q1 4YV2A 4E30A 1N7JA 2FYTA 4OX9Y 4GQBA 2JG3A 4PONA 3BGDA 3EGEA 3G2OA 5EMKA 3T7SA 2Y1WA 1DL5A 1O9GA 5EMMA 1AQJA 2OZVA 1SKMA 4HTFB 4IWNA 3REOA 3G5LA 2V74B 1YUBA 2YR0A 5K05A 4MQ4A 5IH3A 2FRXA 3B3JA 4PGGA 3TFWA 1NW6A 4AUKA 4YUZA 5CD1A 3P9IA 4DQ0A 4FT2A 3FTCA 3JWIA 2WA1A 3X0DA 1T43A 4XUEA 4RVDA 2C7RA 2B2CA 3DMHA 2UYQA 3FRIA 4FSXA 3C0KA 3TOSA 3EVZA 2AOUA 4RVHA 3WSTA 3MHTA 5E9JA 3UJ9A 1F3LA 3HCEA 4P58A 1JTFA 3I64A 3LDGA 2ZZNA 3T7TA 4KWCA 3C6MA 5E2BA 5G02A 2QM3A 3FZGA 1WS6A 5K8VA 1RJDA 4F86A 1VE3A 2I7CA 4M36A 3SSMA 4CXMA 2BM9A 5CM2Z 5ICFA 5F2NA 3SMQA 1I4WA 2JHCA 5DTMA 3UJBA 2B9EA 1OR8A 1DUSA 2PX4A 1IM8A 2PVCA 4RTPA 2G8NA 2Y1XA 3CJQA 1JQEA 3BUSA 2AZTA 1KPIA 5EPEA 2JJQA 3PVCA 5E8JA 3C6KA 5DRTA 1R6AA 2ZBPA 4M7RA 3LKDA 1VQ1A 2ZIGA 3OU6A 4R6XA 2O57A 2CMGA 1FP2A 2NXJA 1XXLA 2IPXA 2UYOA 2ZULA 2OKCA 3NVMB 3UJCA 2IDKA 1R8YA 5HFJA 2ZLBA 4PCAA 1NE2A 2HWKA 2NYUA 5FUBA 1G55A 5E2AA 1RI2A 1Q0TA 5JR3A 3B3GA 1DCTA 3R24A 3LX6A 4PWYA 3FPJA 5FHRA 4Z2YA 2F8LA 1ORIA 3BWBA 4YUYA 3G8AA 2P3QA 2BZGA 3G88A 3P71T 4RTNA 5LQCA 3B89A 5K0LA 4OA5A 4EMSA 2O05A 4CKEA 1KPHA 1BKYA 4HH4A 4RTSA 4X63A 4OBWA 3KQQA 4C06A 2YQZA 1R18A 4PIPA 3M6XA 3R6TA 3AY0A 5EIFA 5IKMA 8MHTA 3OZSA 5FQOA 3PB3A 5HZMA 3HVHA 4HG2A 5E8RA 2UYHA 2OB1A 1IY9A 3GRVA 3TM4A 3FTEA 2XYQA 1INLA 2ADMA 2AOWA 2EFJA 2PY6A 3NDIA 4LWOA 4R8RA 3EVAA 3GRRA 3GCZA 3KPWA 3RIEA 1Z3CA 2AR0A 2QYOA 5EMLA 4E33A 4P7KA 1HNNA 2IP2A 3DULA 3EMBA 5K09A 4RTRA 2PT6A 1M6YA 3KQSA 4DCMA 4E31A 4QQNA 3ER8A 2NXCA 1PJZA 4PCLA 3TM5A 2C7OA 5EMJA 4OA8A 3BT7A 4KDCA 4HGYA 2OPBA 3H2BA 4G56A 3CJTA 4RVGA 3G7UA 5HIKA 5CCBA 3GGDA 4C07A 3UA4A 1KYZA 5BP7A 3OZTA 4CTJA 1ZG3A 3OCJA 4KIGA 4MIKA 1EAMA 4FT4A 1JG4A 3OE4A 3BWCA 3QOWA 1B42A 1NT2A 3M6VA 5EKUA 5T64A 5DXAA
chains in the Genus database with same CATH superfamily
2ZROA 2HSDA 4FFPA 4K9QA 5CX1A 5E1OA 5BYJA 2DPMA 3V1TC 1QOZA 3WRYA 4MYCA 3KALA 2ODAA 2OM2A 3GJ7A 2RFLA 1WPRA 4QVGA 2CSUA 4P3KA 5A5EA 3JR3A 3U3KA 4DLAA 1G41A 3FDXA 2HIAA 3HMKA 4NYMQ 4UUQA 1EM6A 4K28A 4CMGA 1O0SA 4URHA 1DTWA 2JJ1A 3TNYA 3NANA 2G7ZA 3AB7A 3F67A 3LNTA 4ZCPA 4P4SB 4X3PA 4LRXA 5DSTA 2IUEA 3DHVA 4E5VA 1S8NA 1YE8A 5ALUA 2VNAA 4MR8A 4IZ6A 4YCJA 5I4BA 4F3RA 2Z9CA 1G3QA 1KKUA 1EG2A 3GNTA 1P1FA 1D2HA 4MHOA 3IE0A 4EEXA 2B3TA 1EWYA 2HPHA 4OP2A 4YMUA 4AS3A 4GI1A 4JI7B 4DADA 4ND5A 3VMMA 3DZIA 4BQRA 1VP3A 1KI6B 1U2GC 4XEHA 3T15A 2C61A 4FE4A 4OHWA 3TZKA 4D6PA 4LDJA 1OZFA 2CFSA 3C7CB 2J0UA 2DJ5A 4MR9B 3W3AD 3WNDA 2FPGA 3VBCA 4YRLA 3T5CA 4Y9TA 1K08A 3PT9A 1EUDA 4CTOA 2IKSA 3KX2A 3LWNA 1QO0A 4KQWA 1KDOA 3MBOA 4YDRA 4YT5A 3RRJA 3OZ7A 4G1MB 4O6VA 3JD0A 1ZK3A 1CERA 4DRYA 5LQNA 1YH3A 1GGEA 5FTMA 4OQ4A 3T5AA 3HCOA 4KKXB 1T13A 3ESZA 4IWXA 2P2GA 2I3GA 2O5RA 3CKYA 3NHPA 3PXDA 4QDZA 521PA 1PYDA 3MWGA 1M74A 4AN4A 1UMBA 2YWFA 3ANTA 4EYKA 3W79A 2ZYIA 4LV6A 1YIDA 3LQ2A 3W0LB 4QPJC 5E6RB 4RJIA 3H3JA 3FETA 5KX5B 1NW5A 2XNCA 1E1CB 2FR1A 2GCNA 4QUGA 1GEGA 1Q7GA 4YJGB 2JKVA 3VR6D 5LZ9A 2VYVD 2JAUA 3EOZA 5FPSA 5F98A 1C4KA 3FSJX 2AUNA 3ICPA 4D92A 3F5DA 3KUKA 4C29A 5LP6F 4R0NA 5BSUA 3THSA 5E4JA 3RYIB 3RQIA 2ZP1A 4ND8B 2YL2A 3ZY4A 1N8SA 1P19A 3TZBA 3W5UA 1VB5A 4DWVA 3R4VA 5EJ4A 2YNMC 5L3SA 4J7CA 3EXHB 1EFKA 1PUIA 1CJCA 2N42A 2I71A 3OBBA 4FX2A 4M9SA 2FMTA 3Q0IA 3RAJA 2QP9X 1NJ2A 2EBUA 5AMXA 5LQJA 4TVBA 1RC0A 4QPPA 2YHSA 1CQIA 2RGAA 1XSEA 4FJ2A 3BPSA 4XRGA 2I8CA 1V7ZA 4I55A 1AMUA 1P9RA 2GBPA 1IVNA 1X13A 3ADKA 3IDAA 3KAJA 4QSMA 1V3VA 3PJDA 3CF4A 1JHUA 1OT3A 5IHXA 1TLTA 2VA8A 2BJVA 2EIXA 5SICE 4MNTA 5DVZA 4DNOA 1I3LA 3U9TA 1VKZA 3CEMA 2FEWB 1UCFA 2I4MA 2RGNC 3E7PA 3FIJA 3PUVA 2AG0A 4DRXB 5FEUA 3C14C 5JSUA 3HWWA 3R76A 2Z4TA 4UREA 4Q7QA 4XM0A 3TIGA 1OLXB 1M1NB 3GFPA 4LECA 4AKEA 4MQEB 4YRDA 4B32A 3WYCA 4M9ZA 2VK8A 2Q4EA 1TPZA 5JXGA 2BF7A 3Q11A 1SCBA 2D06A 5LQMA 3SDZA 1S89A 4TGLA 3PXGA 3SF8A 1ZR2A 2VK2A 3NALA 5ES4B 4G0WA 1GTL1 1ACLA 2VDKB 1J06A 2VH1A 3ABSB 4S3MA 2JFWA 5HF8A 3PDIA 1EP1B 2HLHA 1OFTA 4NXNB 2VNIA 5KCZA 1N6LA 1CU1A 2OCPA 4QAQA 1MO3A 1ETUA 3EGXB 2QYTA 3K2QA 4OK3A 5F76A 4G5RA 3S2YA 4Z49A 1F51E 2ATXA 2CHEA 4PYJA 3T7EA 5IVPA 2Y8EA 1FUUA 1V5GA 1PV4A 1GA6A 2XMGA 2VDOB 4PFSA 1SBTA 1J0CA 2WJ4A 2X1HA 3H99A 4ILKA 2GN9A 5DBFA 3A6KA 4QM7A 3RS8A 1YS7A 4EGSA 4IV0A 2J0SA 1S2GA 1YI1A 2GLTA 2V0NA 3L1UA 4KFTA 2N0SA 4RPCA 5EKXA 4ISCA 5EXEA 3UH0A 4ER0A 3VZSA 3GJ5A 5EP4A 5TDHA 3CXUA 2J3IA 5L40A 2PBFA 2IP4A 3CSDA 3DV9A 3WGUA 3A4NA 4YASA 1DWPA 5TQJA 4UBJA 2H29A 4P2BA 4ZHQA 2QTCA 2V9ZA 4IF6A 3CMCO 5ALHA 2H48A 4UTZA 3DEKA 1RKUA 3S40A 3KKLA 1KZ4A 5DHAA 4UM9B 2RD2A 4Q93A 2R6HA 4HWTA 4MLDA 3VV3A 3VH4A 1RXUA 1FDSA 3UA3A 2P1ZA 3D8TA 5EA2A 2E55A 5LJIA 3I12A 1VIVA 4FU0A 3PR2B 5EY5B 3COJA 1SUEA 1LXCA 4KIFA 1PZGA 3CLVA 1Q16A 1GPMA 4TRMA 3FPAA 3C8HA 1O58A 1P7WA 3WIBA 4M1KA 1OC4A 3ZGNA 2NO4A 4MWZA 4QNMA 4R2MA 2PV7A 3I0ZA 4NPHA 4QXRA 4CHTA 5EN4A 1A9QA 3QI2A 4QHSA 3JQEA 3A2LA 2YHIB 3COYA 3N58A 3FJOA 4MWEA 4X97A 1H4QA 3ETCA 1ZMOA 2GYWA 1K3TA 3E1SA 4GPIB 1L5KA 4AP9A 4DMFA 4J0IA 4UASA 5LZ2A 1PJ8A 5C1DA 3A7EA 1WVGA 5EHZA 4UVEA 5JS7A 1QRRA 5KTOA 3IAXA 1JE0A 4KOAA 3AUFA 2H3HA 1XZJA 3U4IA 2IGBA 4WFQA 4A26A 5MGNA 3GYBA 4YYEA 2PHZA 2PANA 3AFMA 4GM0A 4QOHA 2PU5A 2EJCA 1EFTA 3DONA 1XTIA 5T6BA 1I3OA 1PG2A 1XA4A 3E5RA 3EXFA 4M2LA 1X9GA 1FS5A 3UB3A 1V3UA 2Z2YA 5KCMA 3T5DA 5CTJA 4HDOB 2QUKA 5L7YA 2J87A 3IMCA 5K2MA 1E2JA 1D9XA 5DHQA 1UPTA 5C8YA 4CF6A 3TBKA 4RULA 2ZUWA 4HPJB 5DH9A 4D97A 5ENVA 4QJ4A 1DKOA 5AHXA 2COUA 4M7WA 4BO2A 1T9ZA 1W4CA 3GFFA 2W43A 3NGMA 5EYPB 2MIIA 3ZLUA 3RM3A 1GTZA 1FTQA 1VM6A 2R8YA 4G07A 2P6PA 3R7DA 4F96A 3K05A 4A2PA 1YQUA 1X80B 1OHHD 1WIWA 3VKHA 1Q1GA 1BSVA 3DLHA 4FYMA 4L73A 1AO0A 2WD8A 4DC9A 1WP9A 1PJQA 2QF7A 5IJXA 2GFHA 2P0YA 1ZX1A 4REQA 1KH3A 821PA 4RH3A 3FMGA 4NICA 5AP9A 4ALJA 3UB4A 1H2XA 1LLQA 2WAYA 4EEKA 2JLYA 3VOAA 1JSRA 3A3KA 2OM6A 4XUDA 3ERCA 3RFVA 2DR2A 2BKXA 1AHHA 4COKA 1RZ3A 2GARA 4O0LA 5CHEA 3V4VB 4QUBA 5AVVA 1KC1A 5AJXA 4E5YA 4R8LA 3G79A 1J1UA 3G2JA 4CHGA 2H1IA 4H60A 1XAIA 4BC1A 5K4HA 4GIBA 4W1RA 1WO8A 3QWFA 4PN3A 3MWKA 1DFGA 3VZDA 5KO2A 3WL3A 2Y66A 3IUPA 1E79A 5DLQC 3H5WA 4TSKA 5JD3A 4AY2A 3EZLA 1ZNWA 2C8VA 1XK6A 1ORHA 2YJTD 1O8BA 2X40A 3BHNA 1AE1A 3DBRA 5DASA 5T4BA 1QNFA 1O77A 1GG9A 3N2LA 3N8GA 3EFOB 5BYBA 3WC4A 4PBSA 4ZCMA 3VA7A 1J25A 1PSZA 1GQSA 3BMQA 1BDHA 3BGSA 4IXDA 3OQIA 4RTMA 1CY0A 1E64A 2VN8A 2VSNA 2ZIXB 3I6YA 3IPLA 3PJFA 3MGBA 4E12A 4Q21A 2AK2A 4RFSA 4YRZA 5I9IA 2BY4A 4M0DA 1XVUA 4M8LA 4MPPA 3LY7A 4NI5A 4F2PA 1E7WA 1M8JA 3FXAA 4INAA 2Z2IA 5J2TA 1JVSA 2YUIA 4IS2A 4KREA 5CW2A 1JAHA 1TK3A 3E18A 1VL5A 2QY6A 3EF0A 4L28A 1S5PA 4OHBA 5EQFA 1XTKA 1LDBA 4E08A 4B6PA 5A3QA 1I6MA 1FU8A 2UUCB 4AL4A 4N5MA 2QX9A 4F3YA 2HGZA 1EE1A 5AW8A 3W4IA 4E6EA 1I2MA 4BV3A 1UFVA 2JIZD 1XJ5A 4EG1A 1QVRA 3PBKA 1P0MA 3CLUC 3DSRA 5F9MA 5HIIA 5LZ7A 1KL7A 2G6BA 2UU9B 4UTRA 1XLTC 4QOFA 4AXBA 1Z5ZA 2Q3EA 1MC8A 3L6CA 2AXEA 5LMCA 4BNWA 2K4MA 1I2CA 3A1TA 3IALA 3LXUX 4F6RB 5AI8A 3PEVA 5HIMA 2ZR9A 3FN4A 4L15A 1W73A 3VYTB 1QF6A 4CKCA 2VF8A 4RY2A 3A4YA 1E2FA 1E5TA 3CX6A 1KO4A 2OCBA 3N8HA 4I50B 3SSNA 4JBNA 4KZKA 4CM1A 5KYXA 8GPBA 4DUYB 5TLSA 2NAPA 3AF4A 3B8HA 4S1VA 4YIKA 2BTEA 1QM5A 3QKTA 1CTQA 1QH1B 2C8KA 4YACA 1R6UA 3KWMA 4D0GA 1JW9B 1W76A 2JZCA 2ZRLA 2WHPA 4PF1A 3WG9A 3C3WA 2JVJA 5BNWA 5D1HA 1DO2A 2PH3A 5REQB 1X8KA 4DREA 2NV2B 2XUZA 2CXXA 1Q1AA 4AMVA 2GF9A 2XRZA 4AJOA 2I4RA 4HDQB 1J7JA 2BOVA 4I0WB 2OHOA 4G5YA 5KINB 3B9QA 2O2EA 4EIWA 2YKGA 1C81A 4GVXA 1KIAA 3QHAA 2P9GA 3LIIA 3NO4A 4MUNA 3FNFA 4JI3B 1CRWG 4DA4A 2IIBA 4RFVA 3DTTA 1BH2A 4LUCA 3K9WA 3F73A 5B37A 1D1PA 4HK4A 4JA2A 1VMEA 4U9HS 1NBOA 4WSOA 3NT4A 1ECBA 3B3QA 3IAM6 5CDFE 4B5KA 3F8SA 4DCJA 3ITKA 5I45A 1JDZA 3LCUA 1FDUA 1NX9A 2OC4A 2X5JO 1GA4A 3NDPA 1C2YA 4J1NA 4JXKA 4LJSA 3SNKA 1IWPB 2ZTHA 2CHGA 2UKDA 5K99A 1CUGA 4MS3B 3CIOA 4JJ4A 4Q9LA 3I28A 3IDZA 3E22B 4TZ0A 1N7JA 4GI2A 3E5HA 4PONA 5J58A 3DCIA 5H3HA 1JH9A 1HL7A 5EMKA 1O9GA 5FV7A 3T4UA 1C3OB 2QPTA 4IBOA 4LOIA 4CKBB 4MKRA 4D82A 4QU5A 1QFXA 2FQYA 2ZXFA 1OZHA 2Q0SA 1I4EB 3NYRA 2PNJA 1BEEA 4WNAB 1KK0A 3OZGA 1RXEA 4LBVA 4AUKA 1NJ8A 4ND3A 2VUSA 2C7VA 1FUYB 3EUAA 1DIRA 2YFYA 3RYHB 1DTEA 2ES4A 1EX1A 2BFPA 4UVHA 3OSZA 1UK7A 5JPCA 3A0UA 3DGEC 3CS3A 3LPAA 1UBNA 3BMNB 4YGXB 1SK8A 3DL7A 3E2IA 1CJSA 2DT8A 2YIJA 5CB6A 2GA8A 4HATA 2C2GA 2FWBA 2OBNA 3I64A 3PTZA 4HAVA 5COQA 1H4VB 2AEMA 1V1MA 2QLFA 5E2BA 3RRXA 4B4KA 4D2IA 4CEHB 4F92B 5CM2Z 1EEXB 5ICFA 5AKJA 3I72A 4EF6A 3BIFA 5JPIA 3A1VA 2C98A 3BICA 3TLKA 2XGSA 3L4BA 5FEMA 1CQZA 2X3YA 1PFWA 4IDDA 1LLUA 5FFFA 4PNZA 3FOBA 4S04A 1DJMA 3IKVA 1PE0A 4NESA 3QEKA 3W2IA 5TJHA 5CH3A 5AI0A 3ZIDA 1W0JA 1NKSA 4DEYA 3D7SA 3QTBA 4J94A 1IULA 3A9TA 2OVBA 1M5RA 1B73A 3HYSA 4J0KA 1R5BA 2BE7A 3GAAA 3RU7A 1XRJA 3I09A 1O0CA 2FOLA 2YOGA 4PC7A 1RWWA 4I5DA 2KWIA 4NVRA 3WX0A 2YZKA 2JGKA 1ESMA 4TKZA 1I3KA 3S6JA 4ASUA 4EZBA 2VJNA 4RK1A 1LTHR 2C0CA 3OQJA 3D02A 3QNUA 4BVEA 2DHRA 3ZDBA 3P4XA 2NO5A 3TX2A 5C35A 3RSOA 1UFQA 1GTJ1 3IVRA 1C8KA 3PUHA 3DW3X 1Z88A 3N6RA 3BGOS 1RM4A 2AXNA 1XDGA 1EIWA 3AEQA 4IFTA 4JENA 4E5SA 3W5CA 3MXOA 1P2UA 2R96A 5HZMA 2M6KA 2D0DA 1XZGA 2FFRA 4QQFA 2R44A 3VU0A 1ZCAA 1V45E 4RQUA 1XTTA 4AQ7A 1NIPA 5IT4A 4IDFA 2AOWA 1JYEA 4P4GA 3IUNA 5C18A 1PEKE 3IV9A 1Z3CA 4PLFA 2DQ4A 3UPUA 1VGQA 2A67A 1JPNA 1THTA 4YJ3B 4EG8A 1ECLA 4UMDA 1DE0A 4PVCA 5AJHA 4DIBA 4E31A 3NT5A 2X2FA 4URYR 3UC5A 4C2AA 4EGCB 1T15A 3A4LA 3C7AA 3ZI0A 1N9GA 1V6AA 5JNRA 5I7AA 1P4RA 2OGUA 3T95A 3VR3D 2FEXA 3F3YA 4NPCA 4ZI7B 1LBIA 1K7CA 1YQTA 3EEBA 3N2NA 3GLHB 5KX5F 1H69A 3WYAA 3LQYA 1ZINA 3OZTA 1NUHA 3OCJA 4JB3A 2B2XA 2P5TB 4K9SA 3OT1B 4XPIA 5B3JA 1C9KA 1WMDA 4HDMA 2P78A 4GZLA 1KK1A 1I2BA 4TTJA 1DX6A 3W8RA 3ZDFA 3OJOA 1T29A 3T3NA 4QX6A 3QA9A 2BHSA 1EE9A 1I7DA 1UKVY 3EXIB 3ECSA 4Q4HB 3QJYA 3RFXA 5AO9A 2JVKA 1Z39A 5D3KA 2ZANA 4O08A 3MTQA 2ZRNA 1D9ZA 4L16A 5JATA 4OU4A 2X9GA 4PC3A 5H80A 4WUTA 2EV9A 1Q44A 3LI2A 3NBQA 3D7KA 3FMFA 1Z6ZA 2CV0A 3C1TA 5FTWA 3CVVA 2FG6C 4I4NA 3PQ3A 2G76A 4FHEA 3ZXXA 5ERXA 4I1SA 5HE8A 4UD2A 1XWWA 3KKQA 3PKZA 1E9CA 1KDTA 1CZNA 3RS2A 3HCBA 4G0ZA 1FVOA 1TU4A 4HDCA 4IKOA 1H2ZA 4BNNA 3DVQX 2PV0A 3ECCA 5EEGA 4C4RA 3ZE8A 4D74A 4HH1A 3KTAA 1L4UA 3DOUA 5F7XA 2J5BA 2GZDA 2X5OA 3R44A 4ON9A 4POAA 3RLFA 3DNFA 1B7GO 4FJ0A 3QGMA 4G0PA 1HE2A 3WHIA 4D99A 4W9MC 1T4MA 1JDNA 3FWKA 5KU7A 1RZRA 2GLUA 3BN3A 3ZHXA 2VJPA 2VEDA 4OUDB 1MJHA 1SQFA 3F2IA 3IR5A 3QY0A 2AJTA 4OBBA 3R7FA 4KYIB 3ZZTA 1XMOB 4A0FA 1AZLA 3SZRA 3BBLA 4QDUA 3SSOA 1ZSVA 1XF9A 4CYMA 5CB4A 3FW1A 3L8CA 3WAGA 1H3EA 5A9SB 4FGJA 3LX8A 4FWBA 3NCHA 5JJLA 4HY3A 3HABA 1YZ3A 1A98A 1YB1A 3MTAA 1ZRMA 4XSGA 4Y2VA 2DBRA 2J9YB 2J41A 1N6HA 3DCYA 2ZYDA 4FDVA 3LG2A 2ZBVA 2I2DA 3OF2A 1E4EB 1T36A 3VHQA 1SQ5A 1ZJ5A 1UFKA 2IZ1A 3BQNB 4W8HA 4YROA 1NW3A 1GPKA 3TXXA 1C9MA 5K6TA 2QN3A 2ZSDA 1I3CA 2ZBFA 4LOLA 3ZQ6A 1HSOA 3TEMA 3ZD6A 2GESA 1U2ZA 2WQ6A 4NQZA 5HMMA 3MNFA 4C14A 4IRXA 3T0GA 4P38A 2JBAB 1SC1A 2ZKLA 3DDWA 1PK7A 5HSGA 3L07A 1JB1A 2R1UA 3CZRA 2HF9A 2FU5C 2FZCA 4XOUA 1RYYA 2DPGA 2HMAA 3I5AA 2XBMA 1N78A 5H02A 2XZLA 2AOXA 4KHPB 3ZIUA 4HQLA 1B00A 4EA8A 4MYUA 5CXXA 2WE7A 1IOZA 1OU4A 5DF1A 5TQ0A 1SUWA 2C7QA 1A9PA 1P9LA 3Q7EA 3FNGA 1GZUA 4FHDA 4Q7JB 5AJTA 5HOEA 4G23A 2PS9A 2ZIUB 1V1RA 1C5KA 1YE5A 4YYZA 5AVQA 3EWSA 5G3ZA 4YVFA 1OBOA 1QG0A 4ZHSA 4KO2S 5KTMA 4XQCA 1XJQA 1JMKC 4M6WA 1JHQA 3TFQA 3UXEA 2BKUA 2I65A 2P9ZA 4ARZA 2Z2XA 1P0FA 1PZMA 2CXSA 1E3WB 3RUEA 1TJNA 1NNI1 3NBMA 1XD2A 3UAGA 4B6OA 1X7GA 1CUSA 4DILA 1SCJA 4MWDA 1XO1A 2NO1A 2PGLA 4L5JA 4W7SA 4ZALA 1P3Y1 2WQZA 3K31A 1HFKA 2ZRAA 1L5MA 3A4MA 1R74A 3PFFA 3RRMA 4F0JA 1BMTA 1EINA 4U02A 3OOJA 4NKRA 3ULKA 1DIBA 5I9LA 2W2OA 2RHCA 1A3CA 3EXEA 3L4JA 3TSYA 3AK4A 5JAQA 1X15A 1G9SA 1HZJA 2DQSA 3REGA 3CCFA 2QRUA 3FVQA 3LVRE 1KVQA 3WYNA 3KXKA 3C6ZA 3WRXA 1NSYA 3AILA 1L1RA 4DWWA 4YUXA 1RC8A 1T8PA 2P9JA 3KPJA 3FB4A 3H18A 1W87A 3OBIA 3OCZA 4WK2B 1Z6TA 3KHKA 3MJHA 3PDCA 4R05A 1QTNA 4OHZA 5C7LO 5I8ZA 3BJMA 3W6UA 2HJHA 4PCVA 1A1SA 1F2TA 3DBHA 1O5IA 4X66B 2C0PA 3MJVA 3DFFA 4LTMA 3K6JA 3AYZB 4PO8A 4UATA 4XYEA 2PVPA 4Q37A 2AV6A 3SS9X 5KTPA 1PWEA 5AW3A 2IPOA 1ZZGA 3FVRA 4HJXA 4P5DA 2Q3DA 1T2NA 1L4KA 4MV0A 4IO1A 4RF2A 4V0RA 1LI5A 2NP6A 2I33A 4LZOA 2P4EA 4N9WA 2NXEA 2Y05A 4A92A 1AGNA 1SG6A 1YA4A 3U7EB 1P0PA 2DCMA 2FCRA 4BX9A 3L7CA 3MT8A 3PICA 4RJLA 1ZI8A 2VI5A 5DEOA 3R7LA 2Y1KA 5JAZA 1WJGA 3FKQA 4Q47A 5MDHA 2P62A 2FW6A 1OGJA 1YE3A 2P4HX 3CMMA 4O2AF 4QRIA 2IV7A 4I3HA 5LQRA 5A03A 1PFKA 1RHMA 2G0NA 1DMSA 3FYCA 5EJ9A 2A0UA 3KJHA 1VRCA 2I7VA 2B1JA 4JNCA 2FUG1 4MS1B 1ZCBA 2YY6A 4KQHA 1ZESA 5I3CA 4RS4A 4L1KA 3SBOA 3OLZA 5FR2A 1PGQA 3W78A 5KC9A 5KTSA 3Q3GE 1R1DA 1CB0A 1RLMA 1B1CA 2D4HA 2V58A 3O92A 4JJEA 2B4AA 4RSMA 5L3VA 3RG8A 4MJLA 1FRNA 5AK4A 1I0ZA 5G4LA 3BFVA 3NU1A 1YMQA 1YZLA 4MB2A 5GAJA 1G5FA 2WINI 8AT1A 1Q7RA 3WXMA 4X1YA 3KPVA 3W6NA 3QPDA 4M55A 2YMLA 3AW9A 5BSTA 3GLGE 2XE4A 3TD9A 4E22A 1Z28A 3R74A 4NMMA 2QW0X 1PTKA 3NAZA 1C7QA 2OSVA 5EWMA 5ULLA 3PS9A 3G23A 3WTBA 4LNUB 2P2NA 3SR0A 2OT3B 1ENYA 2CJXA 3E8XA 1IQUA 4QFMA 2CHQA 1U04A 2PTGA 5G0SA 1XQWA 1SXHA 2H2IA 4JC0A 1SXJA 2PR7A 4TS4A 5DCWA 4J16A 1BMQA 1WL8A 4L5IA 3IR7A 4ARVA 1PWZA 1JVNA 1T10A 4DSAA 2R4QA 4LNHA 3AQIA 3R0JA 1T3HA 1NQTA 1FLDA 1Z8HA 2QGZA 4I50F 1PFGA 2VNHA 3W5VA 4BRUA 5BO5A 3GV0A 1TKAA 2VXOA 1E5DA 1B3BA 1NP6A 1T9BA 2ZSFA 3A04A 1VE1A 3KOZA 1VJDA 3NM4A 3GUHA 3OC6A 4FINA 2G9UA 3QTTA 3JWJA 3D8HA 3N59A 3JWGA 1PJRA 4RF4A 3WL5A 4DMUB 2PUCA 1SBYA 2OXTA 3GJ6A 5FNVA 2XWBF 1FBNA 2FR8C 1PX2A 3FOCA 3NDJA 4HSEA 1XJCA 1ADYA 1U6KA 5FTNA 1JIKA 1WCWA 3I8SA 3KL4A 3B3FA 2B83A 3DMDA 2GPWA 2IP1A 2X4IA 3AETB 1T9GS 3BMCB 1BMDA 1Y1KE 1K63A 3D6AA 3OTIA 4HDKB 1CRLA 1VA5A 1PCXA 4HEA6 4BLOA 5EJ8A 3K9FC 1RWNA 4C7MA 1IN6A 1KNXA 2Q46A 3NAQA 3QU4A 4QTUB 1B6GA 4MINA 3O9ZA 2PRYA 4NONA 1N5KA 1O3YA 2UVPA 4DNPA 3LNCA 3JQ8B 3ZJVA 4OIMA 2JGNA 2VL7A 1IOLA 1PBNA 3DDUA 1M2KA 3RG2A 4Y1RA 1YNSA 2YWDA 1C3VA 1C9NA 3O75A 1E0SA 1BHO1 4M4SA 5DM60 4TL8A 3WLKX 1UL1X 5JNSA 2WMNB 3EH1A 1NLYA 1UC5B 4TS1A 1C0LA 2XJ9A 3NXSA 3OEHA 3W3AH 1ZRSA 3TQQA 4E5PA 3RBVA 1R50A 3GQBA 3HDJA 4A8JC 5FTLA 3NTQA 1PYGA 4FVTA 4LHYA 1XZCA 3B82A 3S2IA 2PZKA 5FV4A 2QAIA 1YRLA 5HYVA 1M6WA 4B3SB 2RHGB 5JQGF 3I4LA 1CQJB 2MYUA 3C41J 5E7IA 3DV0A 3U39A 4MB6A 4ZV4A 4JZKA 4EFLA 3B48A 3AM1A 1EVEA 1OCEA 2DSTA 2AK3A 1OPRA 2VRCD 3FYUC 5AQEA 1OTHA 3VM6A 2AN1A 4BRZA 4J75A 4M9RA 3LQ4A 1P5ZB 2HBYA 4XW2A 3WQBA 4DAOA 5J4YA 1M34B 2QUIA 4IR7A 1A4UA 1HE8B 4OB7A 4AO7A 2ZT7A 5CA1B 1DRKA 1D2CA 1E1QD 2G67A 2QUBA 2FWMX 2VQSA 5DGXA 4MI3A 4C9BA 2RK4A 4E5DA 1FW6A 2QE6A 3BCUA 3NUGA 2OB2A 4AF6A 3DPUA 1Z6XA 1J2JA 3JYLA 3LTNC 2BR3A 3OO0A 4FONA 2I6TA 3AHCA 2KS6A 5GJVC 3NDRA 2C1EA 3AERA 1NUTA 1DC6A 2H9IA 1BCSA 3R9IA 4B82A 2WTAA 3UBTA 3W9YA 1QX3A 4OEHA 3PCRB 3OO1A 5AOVA 1A69A 3IFSA 3SX4A 2UZ4A 4DSTA 5LMZA 1UPFA 2YMMA 2VJQA 4D46A 1JZSA 1IHYA 2YNMD 1CHNA 3A3PA 2DUNA 1QIEA 4D8VA 3IAS1 1E92A 3CWQA 4KE6A 5C1PA 4PX2A 4WBNB 4EG5A 1CUDA 3PIIA 4HQRA 3T94A 4LG1A 2HHLA 5B1HA 7ADHA 4NEGA 1FJXA 2NVUA 2E4XA 3L1HA 4RETA 2NVWA 4A4DA 3LFUA 4B3GA 5JSHA 2ID7A 2PJDA 4YV2A 2B5VA 4IOMA 4TVSA 1UBRS 5K9ZA 5LPNA 4MKIA 4OP3A 4JB0A 2W2LA 4MV5A 4WOPA 2XTAA 1WY5A 4X6XA 5EMMA 1AT1A 2FQXA 4IWNA 1W4LA 3N87A 4YK7A 2ZE7A 2OAEA 1X8JA 2NSYA 3LHIA 1L1QA 2AD1A 1ULUA 1SCAA 4GYYA 4N12A 5LDDC 3R8XA 2JAXA 1FVHA 3LGXA 5EVCA 4WZBB 3JPWA 1EFRA 4FT2A 1CV2A 2DB3A 5TGZA 1V43A 3UMRA 3JWIA 3PPIA 2BP7B 1BE1A 2Z1NA 4M8NE 4OOFA 3NWJA 4I14A 3CZ5A 4K8RB 1W0KD 3B85A 5DB4A 1O94A 3RIHA 2G4LA 3CYFA 3N0TA 1VLQA 2KSQA 3H9JA 2AFIB 2H5EA 2FG5A 3C1OA 2VPXA 1FDTA 3LK7A 4FOLA 1AKQA 4INOA 4IILA 3TQHA 5LKRA 3T7TA 1MO2A 1R4NA 3C43A 1MA3A 4B6EA 2FLVA 2I7CA 3OECA 2RK3A 3QNWA 1K2VN 4PHFA 4C88A 2FZVA 3IIJA 4MQFB 2FZGA 2ZUCA 3PLNA 1OR8A 4B3CA 2ASVA 2J8ZA 1DUSA 1GZ5A 4KAFA 1QE3A 4WRRA 1U0OC 3DOEA 4JP3A 2GUGA 2ZBEA 4WX2B 1N5OX 2V9PA 4WACA 5DRTA 3VO1A 2WAOA 2WSLA 4WJLA 4OH7A 4CL2A 3OU6A 4WAUA 2O8FB 2FVXA 3DOFA 1FLAA 1PEAA 1RYNA 1AS2A 4BNLA 4ZTUB 3N76A 1BGXT 1G9TA 1U94A 1UJ6A 3EPHA 2EEZA 2HWKA 4UHDA 3P52A 3TL2A 3AY6A 3I1JA 3WMRA 2DUUA 4JP2A 4GM4A 4MWTA 5TR9A 4D4JA 1DCTA 1FRVA 2WHEA 3HN2A 2KX7A 2UUBB 1JU9A 4LF5B 2I34A 1FQKA 4FFBB 5LB2A 4DZTA 2RGEA 3PD7A 3BD9A 1R6BX 2PT5A 2SCUB 3BWBA 3QEOA 1GDTA 2SNIE 1KFJB 1XVTA 4XYMA 2I7XA 3BJZA 4DDMA 4DN6A 2O14A 2HA2A 4WFJA 4H3SA 5ECDA 1KTIA 4H2DA 4Z4CA 4M98A 3EFHA 5L4NA 1Y80A 1IMJA 4EMSA 1IB0A 1Y1TA 1C1XA 1SUAA 1EHCA 2OK8A 3G1UA 4L4UA 1IUKA 1Z5WA 1EA7A 4NFSA 3FSGA 3M6FA 5IEJA 3M6XA 3CUUA 1B0PA 4F9TA 3E1GA 5CBPA 4W5TA 3DZGA 2AT1A 1EJBA 4DG8A 2WKSA 5ITZB 1HQDA 4KCGA 5IM5A 3V9PA 1SU8A 3EG9B 2HZBA 5JRJA 2BV3A 4Z4IA 2OMKA 3QXCA 4RL6A 1LTKA 2O59A 2D4AA 3UO8B 2MSNA 4MQUA 4PG8A 3W34A 4GLBA 2AR0A 4AF7A 5AICA 4OX9B 5IU6A 3MWEA 4Y0AA 4LMBA 1KGSA 2RAUA 3OM9A 1QS0B 4MKXA 4MUEA 4QOSA 3B6EA 4A8JB 4A7PA 1XAJA 4Q3BA 3WMFA 1ZAYA 3DE3X 1V47A 5TPZA 3KO8A 2MMGA 2C7OA 3IQHX 2UVDA 1MX1A 4M9QA 4PO1A 2J08A 3V4ZA 1MDBA 3CJTA 3DYVA 1LEHA 3DBVO 4RVGA 3SC4A 4C07A 1XLWA 3STUA 1QJ4A 3L5KA 4DLYA 2QM0A 2D62A 2H16A 3HJHA 3ABQB 4Q3NA 4G5HA 2XNJA 5T5QA 1C3EA 3B7WA 2XE8A 3GRKA 4MKHA 3FYUB 4XB2A 1DFHA 1JG4A 1NF2A 4JLDA 4O2BB 5FJJA 4XD2A 1D03A 4PAGA 4Y6OA 3SZMA 2PCLA 4F4IA 3W9UA 3IKMB 2WQ7A 4AX8A 3KR2A 1V5EA 4BV8A 4N3CA 2HR1A 5EIOA 4KO4S 1EWQA 1OAAA 4AN0A 2XRFA 1Q3HA 2NUPA 3JS5A 3G8BA 4NFHA 1UWLA 1IONA 4BGIA 1M67A 1WCIB 1NJ6A 1WG8A 2PL5A 2YICA 1E94E 3H5VA 3MINA 2QN9A 2QRVB 4KODA 4BFLA 4GKKB 3CTMA 5CVDA 3SC2A 4LC1A 4JN6B 1RQNA 1RNLA 4G4GA 3GCGA 4GS5A 2FOXA 4NBNA 3W7BA 5EHXA 4G0YA 4ER5A 1YDMA 1QZUA 2YXLA 1XR3A 2AI2A 4QL3A 1M8GA 4RMJA 2GERA 1JBQA 2BONA 3M8KA 1M75A 2NU7B 1R0CA 3BHMA 3LRTA 3VTFA 3ZV7A 1U2QA 3FMPB 3T61A 3EVGA 1GSAA 2C2YA 1Z2DA 3I62A 1YR6A 5DHUA 1RAIA 5DHTA 2CMKA 2V7QD 3CC8A 1FTSA 4TSFA 3H1PA 4LE0A 4YQYA 3ZCPA 1XEXA 5IPFA 3V34A 3FMVA 1F5NA 2UYCA 1P75A 2YV5A 3SI7A 4E88A 1U1IA 4E7OA 3RUIA 1JQLB 1PW5A 3L6EA 4EW3A 3FHTA 4QRHA 3I34X 1Z5NA 3B1YA 1FDOA 3NHKA 4KX3A 1IHXA 3DXYA 3O1IC 1EU1A 2Q6IA 4LDNA 1BCRB 2AF4C 2WIDA 3LF2A 3HA3A 4KO1S 2EX4A 3GN1A 2BMWA 3NX4A 4XIFA 1IRXA 3LFTA 4UZEA 3K1AA 1KFCB 3ZY2A 5L6MB 1QQBA 4F72A 1OB5A 1S01A 1UM9B 4B6SA 5JH7A 5KVCA 1Y4DE 3SX0A 1XL0A 3B70A 2FPMA 1SRQA 1NSFA 4G3XA 3RK0A 4RV5A 1FFSA 3U7RA 4NCNA 3G9QA 1CWUA 2R7NA 1EJ6A 2RCYA 5HJ2A 5DLPA 3L8MA 1JR4A 5JXJA 3UW3A 2P3SA 3M2TA 1OAOA 4DLSA 2V1UA 2X7HA 1T2VA 4WNCA 2BEVB 4YWJA 1YCDA 3LUGA 3IHLA 4DLUA 3SVZA 2QZ9A 2P0AA 3NTRA 3AHFA 2Q50A 1S3SA 3D3WA 1TVCA 1EBUA 2XUHA 1I3NA 3LTEA 1J9GA 3G5UA 2HJSA 5BN4B 3DFMA 4UTXA 4BO7A 5HRAA 5IABA 5IYZB 1GGVA 1OFGA 2NAFA 4MV7A 2FOIA 3FROA 4ETMA 1QLWA 2XXBA 4JS0A 3RU9A 3DH0A 4BEVA 4O5AA 3MXTA 3JRNA 5D85A 1G9XA 2JEYA 4C01A 3QUAA 3N74A 1H5NA 3CNBA 1HNWB 5EUMA 3IHTA 3T41A 1JYSA 3ZK7A 1MP0A 3TAHA 1EB8A 3Q6MA 1PIWA 2KLBA 1IEXA 2DJIA 2FK8A 4KXNA 4DMMA 3QOXA 4P3PA 3VKUA 3CKKA 4PGFA 4MWGA 1D1QA 1QLJA 1HLFA 1C0IA 2C8LA 3K0FA 4K9KA 1GPNA 1ZAKA 1RFLA 1T6NA 3CKLA 4RJKA 2JLQA 4RGBA 1R0WA 1L5LA 2PX6A 3SNHA 1Q1EA 3QVJA 2WP0A 1GHTA 2FFJA 4IIDA 1NVMB 1I14A 5CJPA 3P2IA 1D2MA 3OOYA 2QPLA 1M2HA 4K26A 1U11A 1CC1S 4JLAA 1YBVA 1O97C 3IT2A 4OK5A 1TZCA 1IN8A 5G0UA 2Y1CA 4RADA 2PIDA 2XTMA 3EGDB 2OORA 2X5XA 5IAOA 3I30X 1MAVA 2BGLA 4BQFA 1YB6A 2JIMA 3OIWA 4ZQHA 4DZZA 5SYMA 3K5WA 3VZPA 9MHTA 1ONOA 1GZHB 3VUFA 4NV1A 2WLTA 1CUYA 3OE1A 5DI3B 4JLKA 1MIHA 1NV8A 2EP5A 3SXUA 5K0SA 2AMFA 3HO8A 3I9V6 4P4LA 3HZOA 3DAPA 3HU2A 1Y5RA 1YRHA 4PAOA 4R8SA 5CK4A 3N2GA 1LF0A 3W8FA 1NKTA 2GJAA 2O3RA 3UYKA 2F7SA 1K92A 1CUCA 1Z12A 2BC9A 2CYAA 4LJ7A 1QQ5A 3GGOA 1SU6A 4MA4A 3II6X 1DP4A 4M21A 3TKYA 4REMA 2ZGVA 1OAKA 3RNOA 4GRDA 2DHDA 2C78A 1Z2PX 3F8WA 4BNDB 3VOBA 3O3CA 5CITA 1E5XA 5CT8A 2VK1A 1ZGJA 1LSSA 2YBDA 4BVAA 5AVRA 1OI2A 1CW2B 1EWTA 4PLGA 3HDGA 1DEXA 5BPHA 1PGNA 2WTNA 3IB3A 2P1RA 3IKJA 3ISJA 3ROFA 1WW2A 1NW8A 3CZCA 4FNGA 3JALB 4YAUA 4YJKA 5G1OA 1F4PA 1CUIA 4FYIA 2DFLA 4MLZA 3WHLA 1SOVA 4B3TB 5JVDB 2GI4A 3Q3EA 2APJA 3K5PA 4E1BA 5A4KA 2X6QA 1EPUA 4LYYA 1G63A 5FBZA 1TEVA 1HNZB 1PG5A 4HNAA 2D0IA 4I55F 1WD7A 1MAHA 5JLJA 4DDTA 1VMKA 3A2NA 5KQPA 4Y9DA 3GXOA 5CLFA 3N3AC 3VNRA 1MB0A 1V8OA 1TTHA 1FS4A 2PIAA 1YFKA 2R62A 2ZI5A 3WGVA 3MOSA 2VHWA 5DK6A 1QOQB 1N1DA 4DSNA 2YC2C 2XUQA 2EFYA 4JUIA 3WDKA 5SZIA 4C78A 2RAVA 5KQSA 1JR3A 1OYWA 1CJTC 1PWYE 4R0VA 2IODA 2VATA 2WKWA 2ZIVB 1PR9A 4BASA 3I3SR 4IO0A 5D3MB 1O9HA 3WFJA 2IYOA 1SVOA 2BEUB 3KOWA 4S0ZA 4YQEA 4ZOLA 2WWVD 2C9DA 1CUHA 2R7LA 3CT6A 1Y8ZA 3BDAA 3U4GA 1QV7A 4FMCF 4K6MA 1YHZA 3C3YA 2YV1A 4B2PA 3QEBZ 2C5HA 2H54A 2A94A 1CPYA 1V8PA 2GHRA 4JEIA 3ZBUA 1J5XA 2YY5A 3O90A 3OWHA 4G2TA 2QGFA 2WF9A 2V6IA 4DEVA 2GT1A 3NJ4A 5I9TA 4EP1A 4B9EA 3C6XA 3P20A 4L7VA 4LIPD 4NCHA 4G01B 4AG6A 3DNPA 2H7XA 4F93B 1YBHA 5GGXA 2HADA 2YRFA 3OZFA 3AG6A 5EJGA 4C6SA 1KQFA 4HQ6A 1VXOA 3CQ9A 1G20E 1T4CB 1UDAA 2Z8ZA 4CCAA 1KFKB 2PGNA 1G98A 5JC8A 1YD7A 1E9BA 3BOSA 5ADVA 1ZH8A 3H5OA 4LYFA 1CY7A 4EB3A 2OFPA 3MTGA 3U31A 4BO6A 2AG1A 1FNNA 1HDRA 2DHCA 3KHUA 1L8XA 2BELA 2ZJ4A 1CQPA 3ND6A 4R01A 3RTBA 3KZXA 3DMTC 1OX6A 5I9BA 3SXJA 5E0OA 2VDMB 1FL9A 1KH2A 2HXSA 2VJKA 2Q1WA 3D4IA 3LT2A 1R9JA 2HA6A 3E8SA 2J5XA 1FMJA 2CL0X 3HZZA 4JJ7A 2NZWA 4ZJUA 3WYBA 1JMYA 4P08A 4YCSA 1FLVA 5CA1F 1ABEA 3E9QA 1QZXA 4WY5A 3PX3A 1HE1C 2QM7A 4FFNA 4V0KA 2ZJ6A 3WYGA 4ZQGA 5JCOC 2B1IA 3NHUA 5IS2A 3OY2A 3VNQA 3BK7A 5JXIA 3A58B 1D3AA 3NWPA 1F60A 1SHJA 2CZCA 3D0RA 3P26A 3QEAZ 1RWQA 1K0FA 2HPAA 4TV8F 4FLMA 3OPYI 2L19A 2X7JA 3O8LA 3GLKA 2W22A 1IY0A 1E2KA 1KZ9A 2O7RA 2H1HA 2VZEA 1MQAA 1JFFA 1OBVA 3IEKA 3LUJA 4UJ5A 5AIAA 5HS4A 2OCDA 3ACCA 3OCUA 2C57A 1YCFA 5H16A 3Q7TA 1LW6E 5CJJA 4I2VA 4D3FA 2YWEA 3RJ5A 3HFJA 4JX8A 4ALKA 1ONSA 3AXTA 3GPCA 4M1ZA 3J81k 3VH3A 2PA0A 4PQFA 3RS5A 2JFZA 3ONDA 1ZGGA 4FKMA 4HNRA 3OVMA 5BYKA 2JJ1D 4GKBA 2I9KA 1SUFA 4ZAGA 1W46A 3QKSA 1R6XA 1QKIA 2FEOA 1RLOA 5K0FA 4BMDA 1CJMA 3QYPA 1IZYA 3S70A 1VIAA 4KMSA 4C4YA 3CFYA 3K3PA 2F3TA 1FA9A 2LP4Y 2REQB 4OGGA 4ARIA 1DAHA 4O1HA 4A0GA 5C2JB 1R27A 1N5RA 2W0SA 4KQEA 4PLHA 1KDRA 4X95A 4Z9AA 4ZDIA 1EZZA 3HXTA 1T1RA 1P5HA 3A1UA 3OFND 1KP3A 1U1DA 2JS7A 3F6CA 4GLOA 4WN3A 3VV2A 1LI7A 2PUJA 5ALMA 1TJPB 3BGWA 4U7PB 1XL1A 1ODKA 4TWRA 2PWZA 2DY0A 3IBTA 4XFDA 4KQMA 5L3QA 2R97A 2SKCA 3V4FA 4EO4A 4D9BA 4XVCA 3CINA 4HO1X 5BVHB 4ZCSA 5LIRA 1QO0D 3JX9A 3OPYB 3GFBA 4B6RA 3V4OA 2O2IA 4JKYA 4BXOB 3LPNA 4PNEA 2J3JA 5B1YA 3AG5A 3MS4A 2RJOA 3K32A 4AY3A 1KJ9A 5FA8A 3GLIE 2QHXA 1NGSA 2YINC 3H8WA 3S5UA 4RTQA 4TL7A 1BW9A 2HN9A 3NYQA 5ANRB 1MABA 2XRMA 3F5QA 1DAGA 5A4MS 4I9HA 1DCMA 4QKQA 5ESRA 3RBAA 3T3OA 1G5HA 5FL7A 4DUGA 2W5UA 4MQ5A 5FO0A 1E6EA 4K5QA 3A9SA 1JIXA 1A8SA 2HO5A 1SG9A 2IEDA 1A8QA 4C6HA 4LMAA 4RU1A 4JMPA 3D4PA 4ZQBA 5UKDA 1LX7A 1QB7A 4R2XA 5IDXA 4COOA 4BECA 4F8YA 3JQAA 1EK2A 1YB5A 1YZYA 5I48A 1LZLA 3V1LA 2O5EA 3UFXB 1BN7A 1V39A 1E8NA 4J7AA 1QYWA 5F51A 4BQSA 4HDRA 4OQFA 5CYOA 4BMVA 1ZIXA 2BFDB 2PH1A 1I4OA 2QAGC 2P9YA 4JJ8A 5IF9A 3MUFA 1H2WA 4CM9A 2ORVA 3ESDA 1CP2A 4WIAA 5DYYA 2O6LA 3D6FA 3IQWA 3V8EA 4A0QA 5I7FA 3K6KA 3H05A 3TDNA 3QIVA 4RACA 5DSXA 2R1VA 1REQA 3KZOA 4M1MA 3BK1A 1ZOOA 3DL2A 3DM5A 4X54A 4MRMA 2I55A 3MWDB 4GQBA 1YACA 1FP7A 3RVDA 3N75A 2V6BA 2J0EA 1PD0A 2Y1WA 3CRRA 1UPAA 3LOPA 1ARZA 2FDXA 5A2GA 5B4UA 1Y5NA 3UGQA 1ZJJA 4F60A 2Q4RA 4WGGA 2CXOA 2GXQA 3HB0A 2IEGA 2XVZA 5SYAA 1AUPA 1X38A 1QH8B 3KSUA 3MJRA 6LDHA 4U5QA 3ES9A 3RUCA 1N5MA 3OEEA 3RTAA 1ZK1A 1U3DA 4NMWA 5CD1A 1MTOA 4ZODA 4PTZA 3GVXA 2ILTA 3VOSA 1IXZA 3KCNA 4H1TA 4DVJA 2OENG 1GRCA 2VWQA 1Y3AA 3FCOA 5CLJA 2UYQA 2ZS8A 3TQFA 1NRXA 3WGHA 4U6QA 5DKFA 5L7TA 2OYCA 2W6IA 3GOHA 4CQMA 1NXOA 1V6SA 1XU7A 3TINA 3EJ6A 4AMYA 1TB4A 2HF8A 2XUPA 4Q1FA 2BGGA 2Z3ZA 5TC4A 5G02A 2IWRA 4F86A 4JA0A 1XCPA 2NU8A 5ER9A 2HU7A 2BM9A 5KKCA 2ACVA 4REOA 1N3LA 3QBTA 1NW4A 5JDIC 2ZRBA 3WQHA 1UOOA 1AHPA 4MP8A 2KBEA 3RUHA 4B7CA 4YRTA 4NOJA 1GSOA 1FK8A 1PJTA 1XYYA 4RTPA 1YV9A 2WT4A 3C8ZA 3LK6A 4OFXA 3PI7A 4O2BF 4WK6A 2JJQA 1IG0A 3MN1A 3PVCA 5FL3A 4HT3B 5I4IA 2PSHA 4NLLA 1JJFA 2I6UA 2ZULA 4C1NA 2IPXA 3DTVB 5TS3A 1ZI6A 4O8ZA 1JKJB 2QVLA 1ISRA 1GV0A 1U8FO 3TDMA 1JA0A 2JEOA 2H92A 3BBPA 2DU8A 5E2AA 4YR9A 3VX3A 2BEKA 1PT7A 3BHJA 4YQFA 4DV4B 3BFJA 3U0VA 2W8BA 1SKBA 2H06A 1DAFA 4QUJA 4MUHA 2OFXA 2VSQA 3K9CA 4P83A 4GVPA 4HB4A 2BDTA 2CDCA 1UOQA 3H9CA 3KT8A 2XCLA 1L4FA 4WKPA 2F4VB 3DYIA 1GXSB 4PR0A 2CLHB 3HU1A 3K73O 1B6RA 1DKMA 1ZM3A 3NEYA 1BWPA 1L5SA 2R00A 2XOXA 1GGKA 1ZM7A 4Z3KA 3DZJA 2IUTA 3R6TA 4D44A 4YR7A 1RLIA 1CJKC 1GRQA 1UZUA 3OH8A 5EIFA 1GNTA 4EH1A 3OZSA 1W1IA 3CEJA 2A58A 3HVHA 4M22A 1CR4A 2YZNA 3N2KB 3ENWA 3L01A 3FFWA 4PSDA 2PY6A 1DO0A 3INYA 1AURA 1T6YA 3KJNA 3LQRA 1Z68A 1ZOLA 4XWAA 4MKZA 2OZLA 4ZWNA 1W2HA 1ZC4A 5C81A 3UMSA 3IXLA 721PA 3FD8A 2F59A 3ZWXA 1EGMB 4Z1MD 2QXUA 3T06B 1IN5A 1CZOA 2AZ4A 3NC0C 1UBJS 4PCLA 3FGPA 2Q7DA 1ORWA 5DFAA 3BH7A 4L22A 1JHMA 1T5HX 4UNQA 3ZVRA 3OP4A 3UT5A 1CY2A 3JASB 5DT9A 4YAIA 4RIHA 3L0IB 3MT0A 2ZYAA 4EGJA 4MA0A 3QVGB 2ET6A 4BZXA 4MIKA 3NG1A 2BDEA 4BVJA 1HE5A 1GZ3A 4MO2A 3AC0A 5A02A 4UDNA 4PQRA 1GA1A 2Q5CA 2PSFA 4JQZA 4N0EA 4BE4A 3T99A 5TMPA 3GEGA 3RFFA 2IH2A 3I1FA 1TT7A 5H70A 3H11A 3LQFA 1EQAA 3KVRA 4K9LA 1Q0QA 5SY6A 2UXCB 1D6NA 3L8HA 3AZOA 3LUDA 4G81A 4LBWA 4LK3A 1N2JA 1TAHA 2SKEA 5EXDA 3ZNOA 2DBQA 3JAMA 2JLBA 4K0RA 3ZU3A 1ISIA 4XFJA 3LY5A 3V1KA 3CN7A 5IYZF 4WXPA 2JD2A 3S99A 1JEYB 1QONA 4MHSA 1XAGA 2Z56A 2G70A 5FULA 3ZHTA 4D45A 1J20A 2RIRA 5AJZA 4URXR 1UPXA 4IDGA 3PE6A 4JJ6A 2H8KA 2Q1YA 3S2UA 1TO1E 4ARUA 1UBCA 2FPIB 2O06A 1MNAA 1V35A 3FHOA 4NPAA 2XUGA 4MMYB 4TT3A 5JV5A 4G4SO 4DCSA 5LC1A 4E51A 3MM4A 3K4PA 3Q87B 5JWOA 3IPAA 3DOJA 1LB1B 2QAGB 1J2TA 2CFOA 4TZTA 5EZYA 4ZC8A 4CFSA 4CM4A 2W42A 4DB2A 3IUJA 5AJVB 2O0HA 3CH4B 5BORA 8OHMA 2P7IA 2XBLA 4H1UA 3RRZA 3VISA 3OHMA 1KQNA 5IKEA 5JY1A 5M7EA 2WNHA 1JQJC 2G72A 1T2DA 1UUFA 1WULS 3HBLA 2HPZA 1BOFA 1D04A 1JHPA 2HSGA 2OE2A 2PK3A 4I9UA 2ZB2A 4KI0A 4QYTA 1GG8A 5CU7A 4YCDA 3BF8A 1I2DA 5B36A 5CDSA 3VBEA 2JHFA 1Y5IA 2E9SA 2BFOA 5AM0A 1VPTA 1S4MA 4GOLD 1R16A 3ILXA 2QTWB 3IP9A 3N8IA 1Q12A 4P32A 4BGUA 4UKDA 4EHDA 4U2GA 4KQJA 3QWBA 4GXQA 1II9A 1JKIA 2XB8A 4JI1B 4TYWA 4BNTA 3DLIA 1OY1A 2A30A 2H63A 5CYPA 5FAKA 4BVGA 1EK1A 3OZIA 2BJWA 3EIUA 5H4GA 1N2CE 1Q21A 2ODWA 3K92A 5CFNA 9ATCA 1MB4A 1PRYA 2VYNA 4M0EA 1E62A 3SBXA 4Q3AA 4Q3LA 3PC8A 4BVBA 2H2AA 3T4EA 1OKKD 1J42A 1L7AA 1NI3A 2I6SA 2FK7A 2IEZA 1BRMA 3ANSA 5IN5A 5BN1A 3RLIA 1IATA 3WIUA 2PWYA 3ZX5A 3ZQJA 3A6DA 4AUEA 1QO9A 3WWYA 4P3OA 5DYIA 2I4OA 4A5OA 1IQ0A 4OXNA 5A06A 3OZCA 5ILQA 1VJ1A 2FSPA 2L17A 1P29A 2FMUA 3VU3A 3BH0A 3S8EA 3KBBA 5HPYB 3VNVA 1EFPA 1E3QA 3AQ4A 3OPVA 4JQOA 3TLJA 1ZOIA 3VKGA 2QLLA 4A6PA 3W3ZB 1QO7A 1R8JA 5BWNA 2A35A 2F1HA 5EEHA 4N9QA 4QUHA 5JVDF 1A96A 3CWCA 2V6JA 2VF4X 3QLTA 3PWTA 4ML3A 5CFLA 1GOTA 1U0TA 2AYXA 2HJRA 2XGOA 1R8SA 3PE3A 2I2AA 4U8HA 5GVRA 5TEWA 4CV2A 1OE0A 1OXKB 4G5SA 4CM3A 2PXHA 2R1TB 4OGFA 1OI3A 1SBQA 4P35A 4RMGA 4UDOA 2FN8A 4NBLA 3SU8A 5A9RA 5BUSA 1AUXA 1X7ZB 2R47A 1DXOA 2NVOA 4WA7A 4Y6RA 4ZI2A 3D8NA 1G42A 3O4VA 3S2ZA 1N7HA 3WLSA 8ADHA 3COWA 1K88A 1GPUA 5I9MA 3PNYA 5C7OO 3L46A 1T8YA 2YWXA 3ODGA 3W90A 3ZWKA 3OTGA 2BCJQ 2XNDD 3UG6A 1E63A 3NPMA 3O8OA 1RRVA 2ID9A 3O8QB 4X6LA 2WD7A 1W35A 3D6TB 5BOVA 3TQCA 5K0CA 1Y0BA 2GILA 4U2DA 1KI4A 1UDWA 2AFHB 1LX6A 1MHTA 4ND2A 4IVQA 4DIEA 4I08A 3PL5A 2YJ5A 3DL4A 3WMEA 3F9IA 3UJ6A 5A0VA 2C97A 4JBXA 4RMHA 2A9PA 4QYSA 1ZMXA 5FKJA 2B3DA 1SVKA 5HQTA 4H6PA 2QDKA 3LOQA 4XXHA 3AR6A 3G5MA 4NL4H 1N5DA 1BVUA 5FPYA 3PFHA 3ZOZA 1S9HA 4FIZA 3GX1A 2AEEA 4TXMA 5CB4F 2FPUA 2JFNA 2X4LA 5A6SA 4MDEA 5HOQA 1FFAA 1ZPDA 2H11A 3M6UA 4FZJA 3PQ2A 4TWZA 1M33A 4L5AA 4CW7A 4R1MA 4D26A 4F71A 1E3IA 4ZVSA 3RAPR 4YP9A 4QDTA 1D2RA 2JHAA 3MQ4A 4D4KA 1QHFA 1PVVA 1USUA 2E2WA 2CL5A 4UNSA 1L1FA 4CI0B 5KWEA 1G64A 4JKOA 4ZT4A 2ZJZA 4ALIA 2K6GA 2P5YA 4W6ZA 3V8BA 4RTLA 1MORA 1HFEL 3CUTA 1B1AA 3LJKA 1IHOA 4TM7A 1PUXA 4XDGA 5GVSA 1I8TA 2SHKA 1BGVA 2WF5A 4HS9A 2GXAA 1WMSA 1C4OA 3Q0EA 2ZRFA 3GP8A 1OQAA 3EGVA 2BM1A 3WTCA 2O5CA 1YVRA 1EDBA 2HQRA 1K3FA 1L3BA 1UINA 1JRLA 2F3UA 1QHHB 2JFOA 1PEYA 2WR8A 2Z5VA 2X1LA 3HXPA 5F33A 1HLGA 2Q6TA 3Q88A 2BHRA 2INGX 3F6SA 3GLFA 2XUKA 5CCDA 2QMOA 3JAKB 5EE5B 5JSZB 1H9BA 4QT4A 2JBWA 2ATVA 4IJMA 2JGFA 4RQAA 2EVWX 2DFKB 1JYFA 3FUCA 5HP4A 1KO7A 4MV3A 2A6PA 3GU3A 3KAKA 3V3TA 3L0SA 3GO4A 4NYIR 5AVWA 2QVZX 4AMZA 1L4BA 2F62A 5CA0A 5K4AA 4QBTA 4D4IA 4B2LA 2CFRA 4D3ZA 2X15A 3ZTYA 5CJ2A 2G17A 4HZUB 1KARA 1E9DA 3IKTA 4KLNA 1D7AA 4F4DA 3P4UA 3O8BA 4YJFA 4AZ0B 1DQYA 1WDMA 2LKDA 1FYFA 3Q2IA 4JR2A 5JJKA 3G5AA 1GU0A 1BWQA 1IUPA 4IEFB 4LXTA 4XX0B 5FQNA 3D7LA 1PAUA 1YCHA 2IFTA 4NYIQ 3OLVA 2W2QA 3CJRA 3HVJA 4KE8A 1F7VA 3UHAA 3A6FA 1QCCA 3IUYA 4DJ5X 3D1LA 3IOEA 1TQ4A 4WADA 4ASUD 2ZJ5A 1KP9A 1MUUA 2XPCA 3DVSX 2G5TA 4ENRA 4ZZ3A 3K30A 1JPJA 3FR7A 4LRUA 4HUQA 1UMDB 4MTCA 5LBTA 4GKVA 5BURA 1NX6A 2TS1A 5ELLA 5EIAA 1BX3A 1DXHA 1KK3A 2WIGA 2XA2A 4NU0A 1NAHA 5ALJA 2ONYA 2GPAA 5AVYA 1S1MA 1Q0SA 1QFYA 1D0SA 4RFLA 1L9KA 2B25A 3KJQA 1G6OA 1VI2A 2RGXA 3JQ7A 5BV1A 1EFLA 1M5UA 4A3SA 1X9HA 4LDZA 1MAAA 1NMZA 2CWWA 3T34A 4Z4EA 3UCFA 4Z0NA 1NTRA 1XB2A 2JJ8A 2WUFA 4GP7A 1DV1A 3QFRA 2C59A 2VQ6A 4PQEA 2WJVA 2HO4A 5B3AA 4RHXA 2MSCB 1NONA 4TT8A 4WT7A 4OHMA 3U7QA 5GZ6A 3HFSA 2XB9A 1I2ZA 2DQKA 3VSCA 3FBGA 1R12A 5EKDA 4BNXA 4CEJB 4FX5A 4ZT5A 1W4AA 2C04A 3WB1A 2C54A 4RY9A 1E7YA 1PT8A 1FFBA 3BTOA 3RC3A 4V03A 2IU4A 3H8VA 4QOEA 3LUBA 3DQPA 3BHIA 4GO1A 4KX5A 3KSDO 3PFWO 5A7HA 1YVEI 1EX9A 3GP5A 3O4JA 3UPDA 4AAYA 4FTWA 5J43A 2WWWA 2ZW9A 5L8VA 3ZKWB 1GITA 4XH9B 2GZ1A 4M9UA 1YS9A 2ZTMA 3NJRA 3GZ4A 4XWYA 4D98A 2XHEA 1EYZA 5AI9A 3I9KA 1XXHB 3STWA 1ZH6A 5ELXA 5D86A 5KMGB 4OMDA 1YK1A 5DBOA 2W2TA 2DM6A 1A9TA 2HSWA 1KZ7B 2CHVA 2ZRCA 4Y6LA 3TR5A 2C1ZA 2GVDC 3D7NA 2B78A 4A0SA 2FGKA 3TOXA 3DBLB 1KERA 3UVEA 1HORA 4BBAA 2FWAA 2RC5A 4WUVA 3L0BA 1SD1A 2B99A 2ZSHA 4QNNA 3C3KA 1SUCA 1P39A 5ED0A 3WGLA 5DGHA 1GQ2A 3EYAA 1RADA 4HEJA 4G0MA 5DPMA 4DR4B 4R1TA 3DMPA 5DCLA 3TW8B 4CG3A 2W6PA 1FFGA 3AJ8A 3AF1A 4P80A 4H7FA 2PTHA 2EJWA 3R3ZA 3VAZA 4D0NA 5IG2A 2PKEA 5JC1A 1ZBQA 2D1QA 1DARA 4DXAA 4BNIA 2C1XA 4FR5A 3H7AA 5E1BA 2Z5GA 3LT1A 4YMHA 2WIBA 3ORQA 5FHQA 4BZWA 4C0WA 3GEHA 3F4BA 5G2OA 1TFUA 3ZLVA 1O95A 4EL0A 3CX7A 4X85A 2CLKB 2PMBA 4J8PA 3K9QO 1YQQA 4WZAB 3AX6A 1BKSB 1C1DB 5I7RA 1CETA 5BVGB 1KYIA 4UOQA 1SXIA 5D00A 4R98A 3AGQA 3R5TA 1ZU5A 3GR6A 2QL7A 3RFTA 2DOKA 1PN3A 4JL5A 5T4FA 1F6WA 2Y76A 3EQ8A 4AJKA 4EECA 3KYBA 1Q84A 3LHFA 1GYPA 5DU2A 4KRFA 1ULZA 5JS2A 5FNVF 4NK4A 3UK2A 2VK4A 2WK1A 2CL7X 4HPWA 4UZFA 3L0PA 5ALSA 1I30A 5FR1A 1ZGAA 1DIGA 2E5WA 4AZVA 4CKWA 3QW4B 3OM0A 4C7JA 4P6VF 3F4LA 2DWUA 3W8NA 1DX9A 3PJEA 4IUDS 4RCZA 2FSHA 1DDIA 3KR9A 4FK8A 4HUTA 3ND8A 1Y8AA 1A9RA 3PQ8A 2BFCB 5M34A 2C2KA 3OZEA 3IURA 4IJVA 4X8HA 1JECA 1SUIA 4J2HA 1AM4D 4QBHA 1XA3A 4U7JA 5BR7A 4MQ6A 4Y6GB 2L0XA 5HBGA 1TUBB 4JU9A 3OPNA 2VH2A 4XA8A 3H9UA 1QVAA 2QG4A 4J0GA 3OG9A 1T2EA 1U98A 2V6MA 2EQBA 3ITEA 4N7RA 2B61A 3ICCA 3FCEA 2IELA 3LP8A 2J3EA 1QX4A 2AHOA 4B7ZA 4YJ2A 2QI9C 1THMA 5ALXA 5DHPA 3SZUA 1KR2A 2GYYA 2PEYA 5I7WA 2QRGA 3G5LA 1YS1X 2F1OA 4DIOA 4PZYA 3CCBA 4N82A 4F6LA 4KYUA 2VOJA 4YGYA 4DG9A 3O74A 2W2VA 3O91A 2Z3VA 2C2OA 3ZDCA 4YUZA 3P9IA 1SMKA 5COBA 1SA0B 3ZH9B 2WA1A 1KEEB 3GMTA 2JRCA 4QELA 3W05A 4B34A 2Q6KA 5HZKA 5CP8A 3TLZA 1JA1A 4CQLB 3UMVA 3TOSA 4AP6A 3IQGX 4CDRA 2AOUA 3F71A 5D7NA 4OL9A 1H8EA 3JZAA 4ND6A 4TL6A 4LMRA 4MS4A 1F3LA 2JI8A 5TPWA 4E5UA 2BGMA 4NMXB 3TW4A 1PLJA 1SXGA 3AH8A 1O97D 2OD7A 1EVLA 1COWD 2VPYA 4LX0A 5K8VA 5K20A 1BNCA 1UPCA 1EE2A 3SMQA 5ALRA 4HQFA 4FOPA 3BORA 4TMTA 2J09A 4NIMA 3UJBA 2ZTUA 5M29A 3EEIA 4F8EA 1HSZA 2CJWB 3TEFA 1IM8A 2BFEA 3W4KA 2PSEA 3BUSA 3JQBA 2AZTA 1RAEA 1KPIA 3U16A 3NTLA 1H23A 3K0AB 2RH9B 3ZCQA 3MCAA 1KSHA 2A9KA 1UT5A 3GMSA 5AK0A 3UK0A 2A1UA 4EQ6B 1Q0TA 2CBZA 4Q6WA 5DW0A 2YN4A 2BIFA 3FDJA 4FE3A 3PXEA 4ND7A 3VR5A 2R68A 3PC6A 4LJ6A 1XNHA 3JQCA 3ZJYA 1ORIA 5ALPA 3IDFA 4QG3A 2P3QA 1NLZA 1OXVA 3DHYA 1DZIA 2FRDC 2XCIA 4XM2A 3ASZA 3GFVA 3AEYA 4JODA 1NN3A 3UT0A 2OO7A 4TQGA 4S2EA 3ZK8A 5EIHA 5JDCC 1B6TA 2AHRA 3W1WA 1JP7A 3UKJA 2ZYRA 2C4MA 5BRAA 1R18A 1C0EA 3EGWA 4M0LA 2YVAA 2JK0A 2C77A 3ZH2A 1DPGA 1K6IA 4YRQA 2NQ2C 3FLAA 4IIYA 3RIGA 4DCCA 2EJBA 3T3DA 2A0KA 4K81B 2KBFA 4QQRA 1D07A 1UPBA 3PHGA 2EFJA 4R9NA 2BFBA 5KKAA 4F06A 5JUWA 9ABPA 3KPWA 1YFZA 2CCKA 1CLEA 1L5HB 1VE7A 3IERA 1A71A 5EMLA 3U0BA 3RC8A 2XV1A 3JTEA 1XCGB 2VJYA 1NVVR 4RPJA 4N48A 1PJ3A 2ZSAA 3BTUA 1K8RA 2QRNA 3DAOA 3KJFA 5CX1B 6GPBA 3EQ2A 3A6HA 3ZJ5A 3GLGA 1E4YA 3QLJA 3HL0A 3IVAA 4N8SA 2RGUA 4NMLA 5DNDA 4ZD6A 1N36B 1QKJA 1VMDA 2XMPA 3ANNA 3ZWYA 2E82A 1D8AA 3L6RA 4FPXA 4B40A 2Y0DA 1Q3KA 4TLLB 4BJ1A 1E9FA 4FT4A 5B6JA 1NVVQ 1Y42X 1XOIA 2BUAA 1E1RD 3OJCA 4UE3S 1VMAA 3RW9A 2QQ5A 1RHQA 2R751 4FBMA 4MR8B 2UYYA 1RYZA 1QOPB 3LWBA 5CXUA 1EK6A 5FA5A 2ADOA 5H9VA 3DD5A 3MTDA 2IYXA 2HCBA 3PGKA 2RI6A 1XZLA 2ZUUA 1NNLA 3NUQA 5KOHA 1OD6A 1XMJA 2R86A 3IEPA 1OZAA 4HF7A 3WIVA 1EUCA 3AF6A 2F8MA 3FMOB 3D2CA 3PITA 1TVEA 2LXNA 4BGVA 2X3UA 3HBFA 3FWZA 4X60A 2P3LA 5AVJA 4IH9A 2GWHA 1QTIA 4IOLA 1RCTE 3BH6A 2BMFA 5J4LA 4X62B 2Y0CA 1F1JA 2ZM5A 1H4SA 2DFNA 4OK6A 5AW4A 5E9AA 3WWEA 2AVDA 1G3IA 2VDPB 1P6XA 4IHJA 3HKEA 4JLPA 4TXJA 1TJ4A 2Q4BA 4OY3A 4ZARA 2RHWA 2A9VA 3FA2A 4HHEA 1KETA 1U8CB 1W96A 1ZIPA 2Q2VA 2QVBA 4JHXA 3T9FA 5IUNC 1WZIA 2FW1A 5FI3A 3QPCA 4II3A 5LNK6 3FHLA 4PZ9A 4XJVA 5ARDA 3DTVD 4EFKA 2C2MA 4R9VA 4RX1A 1KOFA 3ZW7A 1EESA 1FXWA 2AJDA 3GELA 4LMPA 1K8XB 4Z9YA 2DSNA 1PL0A 2ZJ0A 4KQ2A 4X8MA 3VR2D 3I04A 2HCTA 4Q9HA 4UULA 4BYMA 2XWQA 1L3IA 1X1DA 3EBOA 4Y1EA 4MLCA 3WAKA 4EJ6A 2DETA 3PQCA 1B76A 4P5PA 4R4JA 1BZYA 1HY3A 1AHIA 4IKEA 5J4HA 3DKRA 1QFSA 4DFDA 1OBFO 3OZRA 1NBME 3JQDA 4M0FA 4EY6A 2VQEB 2XCSB 3L8GA 3PHHA 3UAXA 2WYIA 3LSYA 1QF7A 2JCBA 3W77A 1CQIB 5C32A 1WHTB 3I8OA 1I5EA 4FYHA 5JZSA 3TJRA 4IVRA 5DNUA 4G0NA 1FB5A 2BMDA 5EP2A 2PSDA 1ODFA 3TRFA 5HUHA 1P7ZA 4I7EA 4G4SP 2O8EB 3AVUA 1XYGA 1JHXA 4NMHA 1VHJA 4OJTA 3IAS6 2CNLA 2E5FA 3AEXA 3PPWA 3UCXA 5BT8A 5HXAA 4KGZA 5JSYA 2F1KA 2EATA 3D4OA 1E2IA 4NG5A 4R84A 3VU1A 4DXDA 1EWRA 1S8FA 2W83A 2Q3BA 1XZFA 3QF4B 1FFDA 4CIYA 4FM9A 2W4QA 1NAIA 2FFHA 4PG6A 3CUYA 3EF1A 3ET4A 1KSJA 1G16A 2PWPA 3FF4A 4QGGA 3U3DA 3H4IA 2Z2ZA 1M1ZA 4JASB 1OGYA 2H4YA 1P72A 1NFFA 1G1MA 1F2UB 1HE3A 2WI8A 3FNIA 4JVNA 3MMNA 5DNEA 3OM8A 3C5VA 1KMNA 1ZN2A 3LY8A 1PL7A 3G0IA 4Y67A 3ZNPA 2F55A 1RMQA 3AYXB 3QWIA 2PR2A 4GZ3A 3S55A 4UD6A 5I4KA 3VPGA 4G5GA 3AUUA 3C15C 4X61A 2IL1A 3MLAA 5EGSA 1XQXA 2ZRDA 3KLPX 3M1LA 3SZ3A 3QE3A 2OGTA 3BGIA 4KPUA 1KE2A 3UGJA 2OCKA 1ZQ9A 1BQEA 1EUQA 1UFOA 4M0KA 4X1KB 3ZDYB 2O20A 3BJRA 4WN9B 4BAUA 3N8KA 5AK5A 4XGQA 4I4TA 1H65A 1HDZA 3AIIA 2JLWA 2IS2A 1OFUA 3VR6A 2VYVA 2XE7A 1W49A 3SQWA 1E3EA 3RGWS 4MP6A 4L76A 4ZHQB 2IYTA 4GI3A 5EIWA 4DDUA 7AT1A 3JQ9A 3GMIA 1LSOA 3G2QA 3ZU4A 1I4LD 1NXXA 2EG9A 3PQ7A 4KGVA 2FE1A 4Y2YA 2JVIA 2IX3A 1E60A 1YU6A 5AW6A 1PFQA 4G25A 5EXSA 2J4DA 3X1WA 5ES3A 4MARA 4KSBA 3DC2A 5IASA 3O0TA 1TZKA 2DX7A 3HA2A 3FI9A 2AN5A 3GNLA 3Q6NA 3PGVA 5D2CA 2DUJA 1XC7A 4QIHA 4PC6A 1W6RA 1NUSA 1YUNA 2VVTA 3USCS 1NOIA 2W2LD 4XRRA 4A6EA 5C51B 1ELOA 3QKRA 2C7GA 4RLHA 4WK4B 1RI1