4RTOA

Complex of escherichia coli dna adenine methyltransferase (dam) with sinefungin and with dna containing proximal pap regulon sequence
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
268
structure length
249
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSKKVDELLALYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 78
structure length 249
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtoA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtoA01
5DLYA 2A14A 3LSTA 5ICCA 4R8RA 1JR4A 2K4MA 2VP3A 5D1NA 5EC8A 2AOVA 3U81A 3JWGA 3KQOA 2OXTA 4EMSA 3KR0A 2AS0A 2OB1A 2R3SA 3FPEA 3DULA 3TFWA 2PBFA 2AOUB 3E23A 2G71A 4MQ4A 4QQKA 3DMGA 4RX1A 5FA8A 4POOA 2B78A 3LBYA 2AOWA 2AOTB 1XCJA 5T64A 3OU2A 4GF5A 2PT6A 3EEYA 4X63A 5E1OA 4QDJA 3V8VA 1V39A 2JG3A 2EFJA 2G8NA 3ID6C 1R8XA 2GPYA 1RI3A 3G2PA 5E2BA 4X60A 3OE4A 5EQJB 2PKWA 1UWVA 2YXDA 2BZGA 5EIWA 5CCBA 4ISCA 5M5BA 2OBFA 5HIJA 5F2NA 3PT9A 1R18A 1L9KA 3HVIA 3THSA 4A6EA 4OA5A 1NE2A 1XXLA 3EPPA 3X0DA 4V0QA 3KQWA 1VLMA 5DRYA 4AZWA 2PX5A 3HTXA 1WG8A 3T7SA 2H00A 1X1BA 3PB3A 3FPHA 5T6BA 3ANXA 3TKAA 2NP6A 4PIMA 3TM4A 5DM4A 2XYVA 3HVKA 2ZLBA 5LSAA 4RTRA 1AV6A 1RI5A 1F38A 2OZVA 4Z2YA 1VPTA 3IHTA 3EGIA 2ONZA 3NJRA 5K0FA 3L8DA 5HILA 5GIOE 3LKDA 5LR6A 4RVHA 5HIKA 4LECA 5K0LA 2FYTA 3A27A 1NBIA 3UJ9A 3G2QA 5FCDA 4FP9A 2G1PA 1ZKDA 4QVKA 3TKYA 5K01A 2Z6AA 3E05A 3NDJA 4HG2A 3FTCA 1ZG3A 2AN3A 1JG4A 2GB4A 4R6XA 4A6DA 2HV9A 4YUVA 1YB2A 2O57A 2ZIGA 5E8JA 3T0IA 4DZRA 5MHTA 1VIDA 3HA3A 1FPQA 2JHPA 2V74B 2ZULA 3P2IA 2V7EA 3PX2A 4OBWA 4AZSA 4ER3A 5FQNA 1L3IA 4YUWA 1M0EA 2H11A 5HIMA 3R9XB 3DXZA 4LG1A 5C9ZA 4FS8A 1IY9A 4RWZA 4BLWA 4KDRA 1N2XA 2C7PA 2IGTA 3HA5A 3M6WA 3P8ZA 4PYNA 4B17A 4XUCA 5FQOA 2QM3A 3M4XA 3NVKI 5EHIA 4ER6A 2AVDA 3GU3A 3P97A 5DM2A 1RJFA 3HP7A 1JQ3A 4F84A 4WXHA 3UZUA 4OA8A 5EMJA 2AZTA 1BKYA 1JTEA 4FZVA 4KVZA 2XBMA 4ER0A 3LGAA 1U2ZA 4QDKA 5FWAA 2H1RA 2I62A 7MHTA 4CKEA 3A4TA 5CVVA 4EVIA 3MERA 4PNEA 2PGXA 3GJYA 2IP2A 2ONYA 3CJQA 2WK1A 3ME5A 1AF7A 2LD4A 2YTZA 3P9KA 4HC4A 4Y2HA 1P1BA 2P40A 4MTLA 4QTUB 2O0LA 3PTAA 3GXOA 2QY6A 2ORED 4GBED 1YZ3A 4DKJA 2EG5A 3RW9A 2I6GA 3G5TA 1SKMA 3KR2A 4MIKA 5BXYA 2E5WA 3M6UA 2QYOA 3KU1A 5FTWA 4E30A 2ZCJA 5LQKA 4DCMA 3GNLA 4PIPA 1ORHA 2YR0A 3TLJA 3PFHA 4P58A 1NW7A 3M6XA 5EMKA 2BR3A 3REOA 1OR8A 5K0JA 3G2MA 3R24A 2HMYB 1VL5A 5K8VA 2EX4A 5FULA 5BW4A 2GA9A 4PYKA 1KYZA 1M6YA 1RI1A 2PXCA 3BGVA 2QRVA 3G5LA 3DXXA 4HRAA 4WVLA 3SXJA 5K09A 1G6Q1 1FJXA 2NXNA 1O9GA 1KPIA 1NW8A 1JQEA 2QE6A 1VE3A 5FUBA 3UJCA 2AVNA 4ER7A 5GM2A 5K0NA 3OFJA 1FBNA 4HH4A 1X19A 3DTNA 5DM0A 1Z3CA 1XDUA 1QZZA 1NW3A 3A7EA 3SGLA 3SX0A 2Z6QA 3HCDA 3LKZA 5DPMA 2BM8A 2ZVJA 3EVBA 3OU6A 1Q0TA 4E32A 1IM8A 1JSXA 4E2WA 1ORIA 3I58A 3FUWA 4RTSA 4RTPA 1ZGAA 2F8LA 3I53A 1P39A 3EVFA 1TW3A 2IIPA 4GOND 3DP7A 1YZHA 1YUBA 2JJQA 4RVGA 4GC5A 1BHJA 2OYRA 3NTVA 5E9WA 4JXJA 1YFLA 3KPWA 5CVUA 4Y30A 3KQPA 3MQ2A 4C08A 4GOLD 3EVDA 3SSNA 3ELYA 3DMHA 2PVCA 2JH8A 5JR3A 3LCCA 2ZTHA 4E2XA 2GAFA 1RI2A 3BWYA 3UJ8A 4NECA 1QAMA 5EPEA 5E1BA 4P7KA 2BR4A 2P35A 3KQMA 2ZWVA 4RTLA 4HTFA 3FPFA 5DX8A 3P2KA 5E8RA 4PGGA 2FHPA 4QVGA 1P1CA 3DOUA 5EZSA 4BLUA 5CIYA 5GWXA 1I4WA 2Y1XA 2WA1A 2O07A 1D2HA 4PYOA 5CUQA 3EEOA 3KQVA 4F86A 2XYRA 4IWNA 4LWPA 3KR1A 1O54A 1SUSA 3OCJA 4PINA 1KXZA 3TR6A 5K0EA 3R0QA 3TOSA 4E70A 1D2GA 4PYMA 5DXJA 2IH5A 4MHTA 4FR0A 2IDJA 1F3LA 3MCZA 4YUYA 1VQ1A 2OO3A 2ZIFA 3G7UA 1R74A 2IH2A 3A7DA 3NMUF 5F2KA 2GS9A 3DUWA 3MTEA 5B1SA 3NVMB 2PY6A 3CGGA 3P9IA 2VDVE 4DCGA 2XVAA 4EKIA 2B2CA 3IEIA 3MTIA 1QYRA 3B89A 3GO4A 2PSSA 5EMMA 5EOVA 4CTJA 5LQUA 4FT4A 5DX1A 5GM1A 4PYQA 1L3BA 4GQBA 2PXAA 2XVMA 5KVAA 1RI4A 1QAOA 1SQFA 5E2AA 2ADMA 5DTQA 3AY0A 2FK8A 2QRVB 2FCAA 4AUKA 2UYHA 4U7PB 1X1CA 3I64A 3HCCA 3P71T 2CMGA 2Z6UA 1RJEA 3ER9A 2ZBPA 3LHDA 3VC1A 3NWEA 4V0RA 4YUXA 4C03A 4QQNA 3KQTA 4E2ZA 5CD1A 3FZGA 1NKVA 3AXSA 3FPGA 3BKWA 4X41A 4FGZA 3HNRA 4ATNA 5KS2A 5KQRA 4PYJA 1JG2A 2FRXA 2HTEA 3O4FA 3Q87B 1I9GA 4YMHA 3VC2A 5JUWA 3BT7A 5C0OE 2BR5A 4GC9A 1TPYA 1XTPA 5EG5A 5DSTA 1JTFA 2P3LA 3R6TA 2NP7A 5EEGA 3MHTA 5K0BA 2UYCA 3KQSA 4EKGA 4MWZA 4ER5A 1EJ6A 5LQAA 1B42A 4E2YA 2YXLA 2VS1A 1N7IA 5EVJA 3B3GA 3M33A 2B9EA 2BM9A 3PVCA 4FSDA 3EGEA 3S68A 2VDWA 1EJ0A 4RTOA 3FYDA 5LQCA 1ZGJA 2JHAA 3KHKA 4QPPA 2ZBQA 3OZTA 4HTFB 4XUEA 3T7TA 3LBFA 1BC5A 4PYIA 5DRTA 4E31A 3HA7A 1ZHFA 1D2CA 2PLWA 4XCXA 3TRKA 4CXMA 3C3YA 2AOUA 1KR5A 3FYCA 3OPNA 1KYWA 2B25A 1T43A 5IKMA 1WXXA 1QANA 2P3OA 4R6WA 4CKBA 5K0CA 4DMGA 3PFGA 2AOTA 4PONA 3I5UA 2CL5A 3I9FA 2IDKA 2ZW9A 3UJAA 5HIIA 4KW7A 3CJRA 2OPBA 3K6RA 3OU7A 2HWKA 4R8SA 3QV2A 5H02A 1I1NA 1G8SA 2KW5A 4GOOD 5EIFA 3QOXA 1NV9A 4X1OA 2I7CA 1WZNA 3E7PA 3T7RA 5EKXA 1EIZA 1R6AA 1HMYA 3LDGA 1IXKA 2P7HA 10MHA 4HGYA 5P8WA 3IV6A 4M7RA 5HFJA 2FK7A 4C04A 1Q0SA 4U7TB 4RSRA 1SUIA 5FWDA 5GOZA 5ICFA 3MB5A 2HNKA 3SMQA 4RTNA 3A25A 2UZ4A 2WA2A 3CC8A 2YQZA 3MGGA 4KDCA 3B3JA 3KPYA 3FTFA 5CM2Z 4QPNA 1P91A 3TMAA 4KRGA 4FSXA 3HCEA 4K6MA 3K0BA 1NT2A 1G55A 1NW5A 1UIRA 3DMFA 3PS9A 4OQEA 5DM1A 1WY7A 1H1DA 5FHQA 5DTRA 4AZVA 2AN4A 3G88A 2CWWA 2ZIEA 4P7GA 5BW5A 3C3PA 5F2OA 3LECA 3SVZA 1SG9A 2UYOA 3CJTA 3G8AA 2JH9A 3DXYA 3M6VA 4HGZA 3BKXA 3LL7A 3H2BA 2ZZMA 3TM5A 3FTDA 3BGDA 1XVAA 4G56A 3FUVA 4R05A 3HCAA 1X1AA 3CCFA 4DQ0A 3ELWA 2PJDA 3WSTA 1JSZA 2P7IA 4RVDA 1VBFA 3DLIA 2P41A 3SR4A 3B7PA 2N47A 2B3TA 4PYLA 2G70A 3AWIA 4IV0A 4GUAA 4M36A 2I9KA 1JG3A 5U4XA 4M37A 3JWIA 5DWQA 1HNNA 2NXCA 3LDFA 3KPJA 3O31A 4DF3A 2OB2A 1PJZA 2GH1A 3GWZA 2Y1WA 3OZRA 3R3HA 5C1IA 3ELUA 4BLVA 2BH2A 1PRYA 1YF3A 1M6EX 3OFKA 4PCLA 5CVJA 5E9QA 1O9HA 2ESRA 2PWYA 3EVGA 3GRZA 1MJFA 1UFKA 2PX4A 4YV2A 5ERGB 1MHTA 2G72A 4X61A 3FRIA 5DX0A 4L7VA 1L1EA 3DH0A 1NW6A 2ZZNA 4LWOA 4IV8A 5FHRA 2HR1A 2NNWB 4IKPA 5EHGA 3P9NA 1FP1D 2ZBRA 5CVEA 5HEKA 5BP7A 5LQNA 5GINE 1NBHA 5EKUA 1SQGA 3UBTA 2EJTA 1G38A 4CWAA 2GLUA 5ICGA 3LCUA 4RV9A 3VYWA 4BP1A 4BY9E 5K0GA 4KIGA 4C06A 2AN5A 4RTQA 2YVLA 3GDHA 3JWHA 4QTTB 3GRUA 5D1HA 1KIAA 1R00A 1KHHA 3UA3A 3V97A 4CKCA 3B3FA 3BWBA 3HEMA 2P3QA 1EAMA 1DL5A 1KP9A 2OY0A 3UA4A 2ERCA 4UOEA 1RJDA 1L3CA 2PWPA 3OE5A 3BGIA 2IFTA 4AX8A 3ORHA 2YXEA 1AQJA 4KWCA 4OQDA 5EMLA 1FP2A 3UFBA 5GP1A 5KQSA 5K03A 3FTEA 3P2EA 1TW2A 5FA5A 3DLCA 3UJBA 4DA4A 3TPZA 1NV8A 3C6MA 3EVZA 5K05A 1DCTA 2NYUA 2AOXA 5T67A 1KPHA 2VDUE 3HCBA 2PX2A 2O05A 3GGDA 4FT2A 2P1DA 2XYQA 4PCAA 2CKDA 5E1MA 4CTKA 5GIPE 4RTMA 3FPJA 3G8BA 5LQRA 2IBSA 4YV0A 3KQYA 1EQAA 3HVJA 4KIFA 1VP3A 3CVOA 1SVUA 5G02A 3PX3A 1JQDA 3FUTA 3A26A 3FUUA 4XUDA 3TQSA 3BZBA 4H0NA 2C7RA 3BUSA 3SSOA 3O7WA 5ICEA 2DPMA 2NXEA 3NW9A 1WS6A 3GRRA 5DSXA 3LDUA 4BP3A 3ER8A 2PX8A 3NDIA 1X1DA 2C7OA 4OX9Y 1WXWA 3SSMA 4GEKA 4PGHA 5EGSA 4EK9A 4O29A 2Q41A 1EG2A 3F4KA 3IYLW 3LCVB 4PWYA 5HOQA 3MCTA 3EMBA 1AQIA 3C0KA 3Q7EA 2DULA 1XDSA 3HM2A 4C05A 2C7QA 3HCFA 4OBXA 4C07A 2OKCA 3KQQA 3C6KA 2P8JA 1RJGA 2R6ZA 3BXOA 3EVAA 1JG1A 2VZ9A 1Y8CA 4P7FA 3UJ7A 4YUZA 9MHTA 2PXXA 1VP9A 2O06A 3MAGA 3G2OA 3D2LA 4RTKA 2ZWAA 3SM3A 3P9CA 3G89A 4C4AA 3ELDA 3GCZA 1BOOA 3UJ6A 4YMGA 1R8YA 3GIWA 2CMHA 1ZQ9A 3KPVA 1KPGA 5CCXA 4GOMD 4RTJA 3OZSA 2UYQA 3RIEA 2NXJA 3VSEA 2IH4A 8MHTA 3CBGA 4P7JA 3QOWA 3HVHA 1G60A 3B5IA 3FRHA 3GRYA 1YFJA 5EZQA 3UJDA 4YV1A 3BWCA 3RODA 2IPXA 1XJ5A 3AJDA 5CVDA 3ERCA 5DT2A 4DM3A 3FUXA 4ZTBA 5HZMA 1XCLA 2IBTA 4F85A 3CKKA 2JHCA 5KYGA 5LQJA 2ZSUA 4HSGA 2PV0A 3AXTA 1INLA 1QAQA 2YX1A 3JWJA 5IH3A 3UWPA 3PLAE 3EVCA 3M70A 2YUIA 4E33A 3E8SA 3LPMA 2ZFUA 3NWBA 3EMDA 3BWMA 4AZTA 3DR5A 3GRVA 1N7JA 1DUSA 5EEHA 2ZZKA 4RYLA 2PT9A 1G8AA 3KR9A 1XDZA 2AR0A 4M38A 2EJUA 2FPOA 3KPUA 3EGVA 4RVFA 5DTMA 3KKZA 4EQZA 5FADA 3EVEA 3LX6A 5DXAA 5E9JA 3THRA 5E1DA
chains in the Genus database with same CATH superfamily
1IQUA 2WWWA 3SPXA 2QD5A 4R8RA 5EC8A 3WWEA 5A7GA 3I73A 1F06A 2PH7A 1HOTA 3GPDG 3JPYA 2FP4B 3KR0A 2WOOA 4B82A 2YL2A 4FPXA 2R6CA 4KWIA 5H9VA 3FXAA 5M2QA 2YWGA 2G71A 1EX1A 1MJNA 2A1TR 2Z2JA 5BYAA 1SPXA 2RAFA 3DYBA 2CDBA 1TO2E 3D0RA 1Z7BA 2VNJA 3BB1A 4DILA 1QGOA 2L42A 3DDOA 1D0SA 1LSOA 2VHJA 1C9EA 4UDXX 2PLNA 4B46A 3C6BA 4YJ2A 1CQJB 1R18A 3EY4A 1BMDA 1OVMA 4ARZB 4KXFB 4CDRA 1NE2A 1GUAA 1PZGA 5AUOB 4UTNA 3HTXA 2AYZA 1WPXA 2FLWA 2HU2A 1MX9A 2XH8A 1GITA 2GCEA 3BL8A 3QVTA 4KUGA 3ODGA 4DLKA 3STHA 1F2TB 2P9FA 3EDQA 5CFRA 1JDUA 2QAGC 2KMLA 4C4XA 1R6TA 1X70A 2R7KA 1JDBC 3IKMB 2VYQA 4RMGA 4DBLC 2R4TA 4FEYA 3GLQA 4IZHA 3F78A 1Q2XA 2PYIA 2ACWA 4PRKA 3EZYA 2HT1A 3P5BA 4QGSA 5KTNA 1TMGE 3QY9A 2HA7A 3EE6A 4FGWA 4KRYA 2GB4A 2VK4A 3K6JA 4LDQA 1YB2A 1CUGA 3W5HA 4ZOCA 2DKOA 3HA3A 1YCFA 5FI3A 2JHPA 4Z2AA 4KQ6A 4L9SA 5I3ZA 4L0CA 1N77A 1L3IA 1NR5A 3FYHA 4K6CA 3DT9A 1I01A 5HIMA 1EI9A 2VP9A 4FHCA 4IG9A 4OIFA 1QORA 1W75A 3QXGA 4G65A 4P4TA 1N2XA 2XWJI 5IZCA 1G41A 5JMTA 3M6WA 3KVOA 3DOHA 3LF2A 1KY5A 4JK3A 3QELB 2X9VA 1TT7A 5LOVA 3WBBA 1KK1A 3PC8C 4QUJA 5AW9A 4EW3A 1KAEA 4Q4HB 4UBMA 4QPZA 4ZKDA 1M2VB 1ONNA 3HHPA 1H8ED 4EA6A 2D06A 1HTWA 3A70A 3DBVO 4TL6A 4U00A 1WUTA 4TN1A 3MVEA 1MEEA 2PKQP 4F3KA 3CVYA 4Y1RA 3R20A 2XT6A 5FOWA 3LU1A 4Y6LA 1JMKC 1SRRA 4CL2A 1GGJA 3LQQA 1VI5A 3ME5A 1DC7A 3ZWVA 1QC5A 4RH0A 4JYCA 5JWOA 3W34A 4G1FA 3GXOA 2Y6UA 4XFDA 2F1IA 3OIVA 2ATVA 3C6ZA 1PVVA 1YZKA 4GBED 3M5CA 4EAAA 1ABBA 4OHOA 1Y42X 4DKJA 4Q12A 1WXFA 3H9JA 4JUFA 3AR2A 4DJTA 2WNHA 1Z2EA 3QX8A 1VE7A 1CZNA 2RC6A 3T06B 1T4GA 4FFDA 2JI9A 3TRFA 4Q48A 3UCFA 1H2XA 3OM0A 3QWHA 4HNUA 4K6GA 5DIZA 2WQ7A 1TU4A 2W4QA 4PIPA 1F0KA 3F6SA 4JODA 2B0CA 4K40A 1O0CA 1V3TA 4CM7A 2YR0A 3PFHA 4I5GA 1SD1A 2WWRA 4FMCB 2A5YB 3UK1A 2FN9A 4CR8A 3AGPA 4DCVA 4KIJA 4NBNA 4TVBA 3OTQA 2WU0A 4ADSG 2FPGB 5HA5A 3U61B 3BGVA 4NF2A 4YMIA 2GHQA 5FWYA 1M8JA 2XA9A 4ZYXA 1UQRA 2NXNA 4JA2A 4D6XA 3CLUD 4DLRA 1VE3A 2ZSDA 3H9UA 1RWMA 5GM2A 4AFNA 3W7AA 1M67A 5KNCH 3V7WA 3SHFA 1X19A 4NMXB 3DTNA 3LW7A 1P44A 1TIBA 3WGQA 2BM8A 4DEXA 1EE9A 2BGLA 3DTVD 4C2BA 2AJBA 2ST1A 5J4HA 5K4HA 3WV5A 1QPZA 2FSHA 1HFKA 1RLMA 1L5VA 4FZ5A 2RGCA 2WYIA 4U2EA 1YVPA 2XCRB 2VHEA 3ZEIA 1P1FA 1RHKA 1LBTA 3CX6A 4ZOQI 2VAWA 1AN9A 2AJDA 4KUEA 3ZDBA 3KQPA 1YZTA 2Q1SA 2I55A 3PC7A 1DTSA 1JH9A 4NMHA 2QM8A 3KZMA 1WCYA 1ZJ5A 4IUYA 4KZKA 1ATZA 3G9ZA 2ODNA 4GSKA 1UJ2A 1P5ZB 4R4JA 4BEVA 4EG5A 3AIIA 1X3LA 3MYYA 4IF4A 1G4AE 1Z6TA 1J0DA 2Q28A 2JDIA 3NI2A 3QVWA 4QXQA 1WBDA 1LPNA 5AJVB 4WCDA 1E0JA 2DY1A 3DVQX 4S35A 1HNXB 4PGGA 3EHEA 5JQGF 2X0RA 4MVXA 4UNQA 4C7BA 1P1CA 4YJFA 1F0NA 4RZ2A 2BZ1A 2WAMA 5IABA 1W4CA 3K5PA 3QKRB 5JZMA 1ZCZA 4JLUA 5DTJA 4LWPA 4JBWA 4KFTA 4XJVA 4LF6B 6ADHA 2MYUA 3RVNA 1ZVQA 1PNTA 3E27A 1CZHA 4K9PA 4PQRA 4EJ6A 1AH2A 1JXAA 1T9AA 2GK4A 3WAKA 2IDJA 2PHZA 2Q0QA 4ACAA 3T1HB 1A7UA 1F8UA 1R0CA 4LXYA 4GPAA 1MIOB 3NDBB 1YDWA 3VSAA 2C00A 1ZCFA 3R7SA 1R4MB 1U3FA 4PR3A 4OK6A 1UOQA 3VHXB 4RV5A 1GPH1 5EOVA 1ODIA 2VPPA 5EWMB 3IXQA 4BUCA 1FP4B 4PYQA 4WKNA 3U6BA 3JARB 2FW8A 2XVMA 1A9QA 1NOIA 1P60A 3KOZA 4QXRA 2FX5A 4GX2A 3EIXA 5AM2A 5DCWA 1PAUA 4FYHA 1NY6A 2ZYAA 4W7IA 3FJOA 1WBJB 3UGTA 3ER9A 2GBIA 3U4AA 2QQ0A 3GRPA 1QUEA 3AVPA 1VPWA 1G0NA 1U6IA 2EWVA 3MHPA 4YUXA 4CM6A 5BR7A 1I1OA 3AP2A 1G8YA 1S89A 1SBIA 3KQTA 5B1IA 3KHSA 2PZKA 3E1GA 2BEJA 3E2IA 3FYUC 2OZPA 2ZRLA 2AXEA 3F4BA 3L8GA 4PZCA 1LV8A 2FN7A 4BQQA 4WGFA 4F8EA 2Q1WA 4ONEA 3AWDA 2HTEA 2V0CA 4TKVB 2AR9A 3ENNA 4BV2A 5E7QA 4YMHA 1KXJA 5DI3B 3GRAA 4ZAZA 1GILA 5EQFA 4UHHA 1RAGA 4ZAWA 4A8JA 3PGA1 3PRYA 4FNAA 3CVVA 4P93A 1S2GA 2R1VA 4OUKX 2B8TA 1CY4A 1E3DA 2D0IA 3H5IA 3EHDA 2ZUTA 1UJBA 2XXBA 1SMKA 3TCNA 4EEXA 1MO2A 3A28A 3ZC3A 2YY7A 5EVJA 3M33A 3FNIA 3U9TA 4MHSA 2GYUA 1EJ0A 4D9IA 3RUDA 1R0XA 5H8WA 2AEFA 5TPZD 1ZR4A 3OZTA 4L6CA 3FVTA 2WT9A 4QHYA 3VSDA 4FCCA 2W70A 2FDCA 3R44A 5ARDA 2Y66A 4BX3A 4QU0A 2CC2A 1KR5A 5F51A 1J25A 3CR8A 2VJMB 5LIPA 2X1MA 4ZT2A 3BD8A 4FC7A 4J7CA 2GYWA 2ZW9A 1SQ5A 1SHKA 5IAJA 3V80A 4DANA 2ZANA 4GGPA 1QYVA 2V8OA 2Q0HA 5EHZA 1G8SA 2D1FA 4NXNB 2CUNA 2CLEB 1O87A 3EISA 3O4IA 1YBMA 4MVCA 1R0KA 4PZAA 2VLIA 1BGWA 2D5IA 4X44A 5AO9A 3UTDA 3UAYA 1Z16A 3ABRB 4PNZA 3S8MA 1FNDA 4G8JA 4I14A 1NVGA 2G8LA 1X8LA 3K32A 4BNTA 3NAMA 3PFWO 1O6FA 1B6TA 1U9JA 4BIMA 5A5VA 3EASA 3RASA 2G1UA 1I51A 2JIDA 2NUAB 4BCCA 2VJYA 3ADOA 1Z37A 2X40A 4OD0A 1V5FA 1T8RA 1ES9A 4UFNA 4KODA 5LYYA 2VNHA 4F4DA 3AONB 1NIJA 4LC9A 3GC6A 5ER9A 1AUQA 3AKEA 2O3QA 2Q21A 3TZCA 4IVPA 3DL0A 1C9MA 4C0HA 3PFIA 4U5XA 3JR7A 3IR7A 3SS9X 2OHOA 3TSCA 2Q6TA 1MGOA 4YAOA 3D3NA 3NO4A 4DE5A 4ETMA 1FLVA 3ZVNA 3VVBA 5FPQA 4HEQA 4NMLA 3X1DA 3U3JA 5LP1A 5B3KA 3TNYA 2X41A 1NVVQ 1LQ2A 3DE6X 4LMAA 3WKEA 4HT3B 4K86A 3RLIA 1R6VA 1FZQA 2PLAA 3OFSA 4XX0A 3ZTYA 1V5WA 2XMBA 1O97D 1UBCA 2VPQA 3L4BC 3G85A 3K70B 4QC2A 2ZSBA 3TM5A 4DCPA 1X1AA 1U3DA 3D1VA 3OT4A 1LDEA 3PNOA 1WIWA 1BKSB 2AX4A 1WD7A 4WECA 5FPYA 5LP6B 3TAUA 4EHHA 2JLAA 2OG2A 4E1VA 3GARA 3IFSA 3X3HA 3NJ8A 2F8SA 2K6GA 4C43A 4KCGA 4Y2RA 2V7XA 2OB2A 4FYIA 3R0IA 2ETVA 2PD4A 5BWLA 2YWBA 4MV8A 3I2IA 1D1QA 3OSZA 4GPBA 1O9HA 5CVJA 2VUHB 2ZSFA 1WZEA 1F8FA 1OOEA 3EVGA 3LP5A 3JQEA 1SKBA 3SKVA 4O1HA 3VO1A 1U0GA 2UYGA 2AEJA 2D0OB 3HLKA 1W9HA 3IUBA 4HLDA 5ER6A 5FHRA 3CWQA 2C4MA 4IRMA 2LKDA 3KOUA 4AMBA 4ZC8A 3EQ8A 4I55B 5DYIA 3KTOA 8ATCA 5KYXB 1H2HA 3D02A 1E2QA 1NN1A 4N0PA 4B5LA 1KWKA 1JT9A 3IT3A 4LYAA 3QE9Y 5I9MA 2YFQA 3OBIA 3PI6A 4ND8A 5A05A 1J90A 2Y2UA 2GFQA 3QMPA 4S0XA 2E4WA 5TVKA 4AN1A 2E48A 1LWNA 2X58A 4KWCA 3I37X 1K7CA 2BGJA 3V7FA 2A9RA 2AEEA 2FB9A 4XLZA 2BCGY 1XNRB 5JCZA 3GMIA 2OHVA 1MTOA 1AUVA 2IL1A 4B79A 3CLRD 4C7KA 2NYUA 4G2TA 1L7QA 1Q1AA 4F3YA 4GECA 4QYMA 2UUPA 2PX2A 4H6XA 2CCJA 4J1QA 5K3BA 5LQSA 3ZKWA 4DL9A 2M32A 2NUTB 3GDWA 4HAUA 3FHJA 5FAXA 1XA0A 3I9MA 4GE3A 1QYIA 3VUFA 2F6RA 1Y81A 2R47A 2C31A 4LC0A 4XUDA 3WC4A 4G3XA 3A3NA 4L7VA 3VR5D 1C7FA 4CN8A 4MR8A 5BUQA 3U3MA 1CG6A 4NFHA 4NFSA 3HHEA 1TM4E 5K3CA 1ZGHA 2XEDA 1FC0A 3BA1A 3VKWA 4AJNA 4YUAA 2HA6A 5BVGA 5K8LA 1VE1A 4LRWA 5A1TA 2KWIA 2CNWA 3Q3GE 4QUDA 1PT6A 1F14A 5KJ6A 1MIHA 2GGSA 5BNTA 4L4SA 4Y6OA 5KC8A 3E9EA 1XDSA 3FSJX 1EGQA 1S1MA 4NBKA 1G4UR 1EFDN 4PPNA 3OE7D 2Z3ZA 3VSBA 3GA0A 3KSDO 4BAGA 1OVGA 1S4QA 4TRNA 1Q83A 1TYDE 5C8XA 1JFFB 2CLOB 3ZCXA 4AJ1A 3GJSA 4RK4A 3K9NA 2HGSA 2PZGA 3W2TA 4BLTA 2ZWAA 1YZNA 3IPCA 1RCFA 3LX8A 3SC2B 4INJA 4HZIA 1OIWA 1HL3A 1WABA 1CNMA 1OE0A 1VHTA 2D4AA 2J9YB 4GZMA 2WWHA 4RF3A 3BXEA 5T41A 5JJBA 3ICQB 3ZQUA 5FYDA 4B3XA 1YL7A 2V7BA 4YXFA 2MTBA 1X3SA 1YMUA 2RE8A 3AVTA 5I7VA 4OU5A 1X8JA 3BXHA 2GO1A 4IO0A 4E3ZA 4MULA 2VJLA 2XB9A 3IDOA 1TK9A 3OP1A 4YQYA 4HXGA 1XJ5A 5TVGA 1CUXA 3ZDAA 2BFPA 3WA6A 4YAJA 1DUIA 3P4YA 4NU6A 2BL4A 1A27A 2ODEA 2FPIA 4AY3A 4O5AA 2JHCA 4HDMA 2YV5A 1YRYE 3W8DA 1S01A 3EAFA 1USUA 3UXYA 1YCDA 1DRWA 1ZYUA 5BR4A 3IRVA 5IBQA 3SQOA 2WUGA 4FFMA 4PGMA 4OJMX 3A14A 3D4NA 1W5SA 4JNKA 1KY3A 4R0MA 5IM4A 4ZDWA 3IJRA 2PRKA 3TVYA 2BFDB 2HEGA 2CYAA 3KPUA 2HYDA 4LVCA 2QKYA 5JSFA 1KS9A 3M5PA 4B6GA 1UFVA 2HDOA 3EVEA 4TMTA 4CI0B 4WJLA 3KOWA 2BAGA 5I4BA 3OM1A 1I33A 2DR2A 3QU2A 4XB2A 1C7JA 2P9CA 5K4GA 4XX1A 1GPMA 3HKBA 4CQMA 4D4IA 1JFLA 1L4UA 2ASEA 5K3OA 1PBTA 2YW2A 4KLZA 3Q2OA 1QKIA 1RQ2A 1WUKS 4DEVA 3TL3A 5AM3A 1LDBA 4JLKA 1W4AA 1XO1A 2FW7A 2QG9A 1XXHE 2QSJA 4S3MA 5H83A 2ID8A 4Q5IA 2RHOA 3ZI4A 4ZI7F 4ZK2A 5GVRA 1V39A 3N0TA 4DCNA 3EZGA 1SXJE 4EL5A 2X8AA 1ZMTA 3LY8A 4C7VA 4V0KA 1XGKA 2D74A 1F2UA 1BXGA 1XQWA 2P2SA 2X15A 3KJQA 4YRDA 5EIWA 2VUSA 5B2FA 5CCBA 3F73A 3F6PA 5HIJA 4PPQA 1K6MA 1L9KA 1OU4A 1Q0UA 3COPA 3H8WA 2WLTA 1EK6A 2GPWA 4LJ6A 3QU9A 2VSFA 4W6ZA 3PHHA 2BFNA 2HJVA 1VKNA 2ZKLA 3NORA 3GJ3A 4AZ0A 1HPLA 2WYUA 3H1EA 1LSJA 1V47A 4JQZA 2X23A 3SX4A 4ZC1A 3ANXA 4DJAA 2MHCA 4NG5A 1RADA 2JGIA 2V7QD 4JB3A 4V3BA 4AECA 1AHHA 1UK8A 2OZVA 4PLWA 4XOUA 5K0FA 3CNQS 3EGIA 3NJRA 3HS3A 4MROA 3ZD9A 1OGJA 5KJEA 1U94A 5IC6A 3AF1A 3BILA 1DIOB 1X94A 2IC5A 4GXTA 4V1CA 1K9VF 1AK9A 3UQZA 1Z6AA 3FE2A 3HJRA 3FNGA 3MC1A 2VDOB 5AYVA 4D9GA 4QKQA 3WMFA 3WSVA 3LPDA 4DZRA 3T0IA 2DFDA 3I5MA 4TUYA 4L9AA 4QPJC 2ZRFA 2ZULA 1XZCA 3L6CA 3MILA 2FMKA 1T9ZA 4FTWA 1M0EA 1UP7A 1E2NA 1E5VA 5L7WA 4MQBA 3O84A 4LG1A 3FH0A 3HL4A 1FSGA 3WGLA 3K9LA 4BLWA 2HOQA 1HTTA 5A4FS 1J0AA 2BONA 2H59A 3QEOA 2VK2A 3GUYA 5C5CA 4BFUA 3PUZA 3NVKI 3OZGA 2B1IA 1YK1A 4F84A 3HCRA 1PK9A 4L2IB 4UM9B 5LMUB 1BMTA 4WLFA 3H0KA 1L9XA 3OPYB 4TMXA 3HDJA 2ZE7A 4U2BA 2AF4C 2I9PA 1GG8A 2XQJA 2IT1A 3PPIA 3JXEA 4IIFA 4A2QA 1Z5VA 2I62A 2IYZA 4GNRA 3THOA 1FUEA 4A2CA 3OQ6A 3PE6A 4LSWA 2ZAMA 2ZVQX 3E5NA 4Z0NA 3RRJA 2WHYA 3TWOA 3MT9A 4KR0A 3ROTA 4BNYA 3M3PA 4Q4AB 3PTAA 1E7QA 2OV1A 2IEDA 2IHYA 2WKSA 4ICIA 3QF4A 1GT91 2YDYA 4BBJA 1BAPA 4FHGA 3WL8A 3ONVA 4ZYZA 3FFTA 4BLSA 1CR0A 1AKWA 5E6UA 2VR1A 4KO4S 3SD7A 2G88A 2ZCJA 1R2QA 2RGDA 4YT8A 2RJNA 3IGFA 5FOXA 1CHDA 5BUCA 5AXAA 3O95A 1GKYA 1ZGBA 3FROA 4CF7A 3EOZA 3MPUA 1P7CA 4XW2A 1L8OA 1YQ9A 2OD2A 3K2QA 4P58A 4OV6B 3NHSA 2ZXUA 1JJBA 2CLCX 3PT5A 4JOSA 4HDOB 4LVNA 1Y7LA 2OOKA 1Z39A 2XE4A 1HDIA 2D7JA 2OUIA 3QK7A 4LNHA 4MKRA 3IVCA 4DVJA 4BNXA 1H6AA 1GYPA 1NBME 3N70A 4DR6B 1UKAA 1XLUA 4XE5A 1UBGA 1BCRA 4W8GA 2QTNA 1JQEA 4LQLA 5FUBA 1ABFA 2HA4A 3UJCA 2VTKA 2AVNA 4EM6A 4JLWA 3DQZA 2QW0X 2L19A 4EUFA 4TZ0A 4FJ2A 3MUOA 4JMLA 4FOTA 2CXOA 4Q1AA 1K68A 1H8HA 2FMIA 3M6LA 4KWEA 2FQWA 1ISGA 5GZ3A 5COQA 3GLIB 5AP9A 3C5WP 3B1KA 4X94A 4D0NA 4M8IA 4RTPA 1SBQA 1SXJD 3AEXA 4ECAA 2W2OA 1GG5A 1TW3A 2R96A 2ZI3A 3CRNA 3PRKE 3G1TA 2BCJQ 2P6NA 3D64A 3ESRA 3AEQB 4J29A 4QFCA 5HBRA 4X92A 1P5RA 5BSVA 3AM4A 1YFLA 4Z0TA 4GOLD 1FFCA 1VTKA 2OGUA 4W5WA 2ZKIA 2VH5R 4ZMBA 2IBMA 4N0MA 4A16A 4UZSA 4E2XA 2OG1A 2VVTA 2EZUA 2OT3B 2ZJ1A 3BWYA 2QN6A 5F52A 1OJLA 2FPRA 5IC4A 2NT3A 3T3HA 2IZ5A 4NZOA 2P35A 2CXTA 2ZWVA 3OIDA 5DHRA 1X8XA 3A1FA 1Y98A 1MJGM 4JDUA 4Y1RB 2OAQ1 1A50B 4P5PA 4QVGA 4H2DA 5IDXA 4BLUA 1E1QD 5JZBA 2BMAA 3ZDFA 2FFJA 2FW6A 1IPFA 1ZA1A 2O07A 4XDHA 1CJTC 4IWNA 3KR1A 3RU3A 4HQKA 1KMIY 3IP3A 4HATA 3Q3IA 3EGCA 3QF7A 3ZW8A 2H7CA 3AF5A 3OEHD 2OGWA 2CL7X 4W1QA 1VQ1A 3G7UA 4FDMA 1MPXA 3NVMB 3R6WA 1Z2DA 4JH0A 4O2BB 1L5FA 4LF4B 5CVTA 3DJFA 4Q93A 1ZH0A 3C6YA 5L7YA 3L8MA 3LC0A 2FJUA 5DX1A 2JFQA 3T5MA 3I6ZA 2H1HA 4OUDA 3INTA 1RI4A 4FUQA 4LMBA 3OG9A 1TFUA 2ADMA 3A9WA 1XX6A 3VKHA 1DX9A 1K6IA 3FKJA 4GLFA 2FK8A 4C88A 1MTZA 1UBSB 2A9OA 4GFDA 1RYYA 1P0MA 4OQMA 4BO4A 5TX7A 1X74A 3QNWA 1PKEA 1NF9A 4LXHA 4BNGA 1RWWA 2NO5A 4PAOA 2ZK7A 4QWWA 2FW1A 2HL6A 2ZS7A 3MMZA 4URUR 3CZ4A 3VRHA 4YY3B 1L7PA 1SH7A 4CW7A 2QL7A 4E5KA 4W8HA 1KJ8A 4R1UA 1HH4A 4NFYA 1WUHS 4OYYA 1F4VA 1GFSA 4P2BA 1JG2A 2EKBA 4G0OA 2RI0A 3DYIA 3WV4A 2HMVA 1I80A 2O1SA 1SVNA 3VC2A 4Y1EA 3ZQ4A 3OO1A 3BT7A 4E6PA 1ZX1A 3AL2A 3L49A 4GC9A 4M1EA 1BU8A 3R75A 1N0HA 2FZEA 3Q7RA 3R6TA 4UBNA 4A03A 4B8ZA 4R8VA 2QBYA 5LYJB 4RD6A 3ZJVA 1KR2A 1VB3A 3AX6A 3MXOA 2IEGA 2JFOA 3AY7A 3O3OB 2QZZA 4LRSB 5DLDA 1WPQA 4F6LA 1T0JB 4KBGA 1L8QA 2PKQO 2QU7A 4ZPJA 2ZJZA 3JPWA 3ZWPA 4Z3OA 1KVTA 3N2NA 1SXPA 3K9CA 2VH1A 2BFEB 4XUEA 3LBFA 4H1UA 3GD5A 1W5FA 1JRLA 2J9FB 2PS9A 3WKBA 4PZPA 4YJFB 2XWSA 1KERA 1I4OA 2B25A 3K30A 1NBMD 4D92A 1F0YA 2R8XA 1NUTA 2I91A 3THXA 5H4GA 3TH5A 3IHWA 2Q5CA 3W05A 4ZCSA 2QR3A 3FLAA 2WMYA 1W4BA 4RETA 2RHTA 3U26A 1J9EA 1DINA 2DWCA 2OPBA 1E2JA 2Z2IA 4NYJQ 3MM4A 3FETA 1S7CA 1Z0ZA 2D1RA 3BBPA 1D0VA 4NEHB 4UJ3A 2RDMA 3GRFA 1FUIA 4DOMA 2O7VA 3OETA 1Y34E 4LJAA 4R1OA 4IOKA 1LFDB 4LF7B 2P7HA 10MHA 3FGPA 4M8KA 4UTRA 2XLBA 4FFNA 1T0BA 1T3TA 2W5UA 4KQHA 1PQPA 3L8YA 1Z7EA 4TSKA 4BQPA 1JJVA 2BI8A 3PDIB 1N2HA 1SQ0A 2WIDA 3UAZA 3GFQA 2O1EA 4UVGA 2PH1A 2C92A 4K9RA 4Z51A 1EWRA 3CRQA 3LSYA 3IE2A 3GLRA 4UASA 1N2BA 3OOHA 3NIWA 3T4UA 2E4XA 4EKDA 1U3TA 2OYSA 4NVRA 1JLHA 5A4AA 4YAKA 5U9CA 4KRGA 4M1TA 3DZIA 1Q15A 4UCFA 1Q74A 1E0AA 3PS9A 4IWYA 3JQ9A 4LXXA 4Z3DA 4OHYA 5LBTA 5C37A 1MAHA 1TDJA 4BP1A 3MTBA 4F8YA 5ITZB 3BCHA 1Z45A 5CTJA 3OQVA 3WK7A 5K6RA 4RA9B 1N8SA 2QVGA 1E6UA 3CN9A 5TQJA 1FDRA 5KTYA 1W5EA 1KI4A 2XJ9A 3B2EA 4QNMA 1V37A 4TQUS 2CFSA 1T24A 3R76A 2QTHA 2PDAA 2ZBFA 5BMOA 2IPMA 1CS4C 4UUNA 3RRBA 3CKMA 3L3BA 3BGDA 5FOTA 4C76A 4DB2A 1V11A 3DLAA 3ZK9A 2ZPAA 2RG7A 2EOAA 1QRRA 1T8SA 1DJLA 2P7IA 2R1VB 4TKLA 2CBXA 3AWIA 4M36A 3TX6A 4JU8A 3OCYA 3QPDA 3VZPA 4CQNA 3A10A 2ZP1A 2Q9UA 2JBAA 3QITA 5M34A 3O8BA 1YRHA 4FGSA 3BTSA 1KFCB 3OJXA 1YMVA 3OZRA 1PSDA 3RF7A 2QW8A 3FB4A 1PRYA 4HY3A 2HIHA 4NRDA 1EIWA 1VLHA 5I9SA 2PWYA 4H4DA 1E4OA 3X43A 2ODAA 3I2KA 1E1CA 1PS9A 1ZH8A 1OLUB 1HXHA 1JSLA 2FJ0A 2FSFA 2HK9A 2NVBA 1J1IA 3BE6A 3EUWA 2CDCA 5IT0A 1CP2A 4EY4A 1KK2A 1PR5A 1PQYA 3UUWA 4V0ME 1U2DA 3GCWA 5DULA 4E7PA 1JWLA 5CVEA 4EBFA 1NXVA 3PENA 2Q4BA 3WY9A 3HACA 4ETIA 4KDEA 3A6GA 1SB8A 4G84A 3VYWA 4WZAB 2XWBF 3P0EA 4XWTA 1UPBA 1Z68A 4DT1A 1JQKA 1RNLA 5AIBA 1RQGA 2REOA 5A5GA 1OPRA 4XIJA 4CV1A 4D4JA 3FNEA 2FZKA 4R1QA 1WHTA 2P3QA 5AXBA 1CY0A 2O5VA 4XM1A 3B1FA 4GRAA 3O91A 2VJCA 4GXRA 3IJ5A 1YS4A 4ZP1A 1YDMA 3AR6A 5D3QA 3NUQA 3PCRB 4AC9A 1BG6A 4EPXA 5K03A 4IQ8A 2ORVA 2JATA 3NANA 4QGGA 4WT7A 2B6NA 4QUHA 3KKKA 3MYRA 3AUXA 3C6MA 4YP6A 1W88B 1MNQA 3VH4A 4A26A 3LY7A 3IL2A 5MGBA 3F8WA 1V7QA 4YCBA 1NI4B 4ZHQA 5AJWA 3LQ1A 3O1HB 3QVSA 5I4KA 2QN9A 2Y1OA 3IUEA 2IGBA 1P1RA 3NETA 3CWCA 1VXOA 2VJBA 1HQKA 3C1UA 4U2DA 3C7TA 1RPTA 3FD8A 4WHMA 3BZBA 3WGVA 5CEEA 2EJBA 4HAYA 4JN6B 1M54A 2WIFA 3OBBA 1EFAA 2NQTA 4ZZIA 5LLDA 4MDFA 3FZQA 4QAJA 1ZRHA 3LDUA 5HMLA 4BP3A 1G59A 1K06A 2BTEA 4MV7A 3NDIA 2AD1A 1SA0B 2ZE5A 3DHVA 4IJUA 2R2AA 3R6DA 4IWXA 3BH6A 2J9RA 4JP8A 1E3MA 3C4JA 1EG2A 4Q37A 4D4LA 3TMYA 2AD5A 2QAGA 1CF4A 1XR3A 4AAYA 3E3AA 3P2OA 4DG8A 1GN9A 3ENZA 1UP6A 3Q7EA 4EELA 1Y6ZA 3GCXA 3PFBA 1UZMA 3KQQA 4QBIA 3EA0A 2HRRA 3D3KA 4M8SA 3NC0C 2OMEA 4MB0A 1SGWA 2B2XA 1E7RA 4K26A 3EPHA 1FMTA 4CF6A 2VHXA 3L0CA 2MSWA 3AIOA 1XTVA 2V3WA 2WU1A 1UDRA 2BDEA 4B6JA 4Y6RA 3T1YB 3QXSA 3JV7A 4GLJA 3PC6A 1YCGA 3L6EA 3UWOA 5JASA 3B7WA 3DL7A 3LBNA 2G82A 4JI1B 5AVYA 3KOYA 4FLEA 2LIVA 2FNAA 4IIHA 2RH4A 3TXXA 4YCNA 1DZIA 1PR3A 2IOQA 3UHOA 2FKNA 2JAQA 4Z4CA 4IUDS 1I6WA 1K5HA 4ND8B 1KY2A 3PC8A 4IMRA 2PSDA 4OB8A 4PN7A 2F64A 4IF6A 4IINA 2GFHA 1BEUB 3AZOA 3UC9A 2XCOA 4NONA 2E5FA 3G8CA 5PNTA 1UXKA 3MBIA 4YFYA 4IFIA 1GRVA 1R6DA 1L6RA 1C7IA 3NT4A 2V97A 4HWSA 4JJZA 1U3GA 1JE0A 2PR7A 2V1XA 5IH3A 3AESB 1ULHA 1BFDA 3E61A 4PPFA 3F6CA 4O5OA 4UULA 1GRNA 4MO9A 2A6PA 4QXAA 5L3RA 3VVLA 1AGRA 1JNXX 1CUWA 1I2DA 4K9SA 4LQDA 4YAIA 1S3FA 3F96A 2XCSB 1EDBA 2H1CA 4EATA 2AR0A 3TE7A 2B4KA 5C5IA 3LA6A 2PKRA 4R16A 5H80A 1B8VA 1YI0A 5ALYA 3WGNA 4DUYB 1JIUA 3P32A 1EH5A 1B16A 3NONA 4S04A 1ZGGA 1OROA 2F1HA 1WRBA 3RSFA 1HT1E 4JA0A 2AOVA 3VVMA 2KYRA 1XZGA 2P67A 5DK4A 1E98A 4RF2A 5BVGB 1XZNA 3K8OE 4LCJA 3E23A 1W9MA 4RX1A 2VNSA 2C83A 4H7PA 2PUBA 2PKCA 1XCJA 3I01A 3OU2A 4PHHA 5JO0A 3N87A 4DR3B 5LJIA 5EQJB 1RI3A 2YZKA 1IDN1 3IAHA 3TQRA 1J1UA 1E92A 4IIBA 1O57A 1P80A 4RH1A 4HWPA 1UXIA 3C4QA 1ZRNA 4HMQA 3H3JA 3OHPA 2C2YA 1IL0A 2QUZA 3QY0A 3VAYA 2IE8A 3QNUA 3THSA 5TMEA 2ZT5A 4YBZA 4Z5XA 2X2EA 4X3PA 2GPNA 1SXIA 4DLZA 4WOKA 1Z13A 1GGKA 5IJ0A 1WG8A 4Q3BA 5EP1A 2I2FA 2H7XA 1KMNA 1MXHA 2H2AA 1LPBB 4X1YA 5DASA 2F8TA 4Q01A 3HVKA 3HWWA 5AI4A 4J75A 3DONA 2J8ZA 5FPKA 1JMYA 3SMVA 1RI5A 3DVSX 5CFZA 5EKDA 3DMNA 3F3MA 3PDJA 1QIHA 2VCYA 5J63A 3ZW7A 1W1UA 2H0RA 3DOIA 1P0PA 4RIFA 3SHWA 3T5PA 4D8YA 1CRLA 3EBPA 5EN4A 3RQSA 1L8LA 3A27A 3BE8A 4J1TC 1G3QA 3ZHXA 1ORWA 1U2EA 2JGMA 3IIIA 2FRDC 2QG6A 5D00A 4FP9A 2G1PA 2J6CA 3VR2D 4B3HA 2FW0A 4HDMB 5LWQA 4GX5A 3OHMA 2Q5EA 1HURA 4MS4A 3Q0IA 3C5CA 3HADA 1KBZA 1ZZEA 1QB8A 4H4EA 4M9ZA 1ADGA 2O2GA 2HN9A 1M83A 4FN4A 4CM4A 3BIOA 3AF2A 4NBUA 2C42A 4IJQA 4BVGA 4J2TA 3IP6A 1YWGO 1KI7A 2GBLC 1SCKA 4UTZA 5C9ZA 5DGTA 4B7AA 4M1KA 2DT8A 4CGZA 4JJAA 3ZWCA 3O92A 5BSHA 1M8PA 3U3RA 1GGEA 1UT5A 5K3DA 5I8ZA 1V1MA 1KDOA 1QH0A 2DPHA 3HJBA 5C35A 3E9MA 2D54A 5BSFA 2Y9PB 2H4FA 4N0DA 1BX1A 2FWJA 3O7MA 1RPNA 4LE0A 3U44A 1BKYA 1ZRMA 2JI4A 3I76A 3UK6A 2FZCA 4TX1A 2HA0A 4GKBA 4CQMB 5HM6A 1AK1A 1VCOA 1F0PA 1T6BY 3DVAA 2ZEJA 4YJKA 1P5FA 3CRMA 4I1SA 3VYVA 4DYDA 4EVIA 1T25A 2QRGA 4B1FA 4CQJA 3AKDA 1TM1E 4KIWA 5K3FA 4G5HA 4IGAA 2VRBA 1SOAA 3C3CA 2B3DA 4QOGA 2OLJA 2ASVA 4A73A 1QF7A 5HZGA 4RA6A 3SR0A 4M49A 3R7DA 3V48A 2GR9A 3D1JA 4OG2A 2VQFB 4CMEC 2Z2XA 2ZUSA 1Z0SA 2JJ1D 2BKLA 4H7KA 2C2ZA 2LW7A 1AHPA 2RI6A 5FFFA 5EE0A 4JJEA 3ZVMA 3O75A 3BHIA 4F5DA 1I0LA 4AZ0B 4YCCA 4R31A 4JFRA 2C61A 2RIRA 1Z15A 3VR0A 1ORHA 4IDPA 1UT8A 3AI3A 5I8WA 3RYCA 1KY4A 2WMNB 1DFGA 1RBMA 2FVYA 1GN8A 2V0GA 3RK1A 2OBYA 4NAHA 4ZCPA 5KVQA 1OXMA 3DW1X 4JGGA 4QA9A 4BFSA 3HJCA 5FULA 1GUFA 1IATA 1UCFA 1KYZA 2IZOA 3W79A 2JFXA 2ZE8A 4R9UC 4JJIA 2QGFA 4XYMA 4RJTA 4V1CB 6REQA 2ZRPA 2WHPB 3U7IA 1U04A 2HLDD 1WCIB 4PLFA 4FGKA 4IOJA 1L4BA 3TPFA 2PUFA 3I6QA 3K0KA 4HH4A 5A4MS 4R7TA 1MFPA 4B33A 4RHUA 4U2GA 2Z6QA 1AKUA 3B1XA 3LKZA 4MS3A 3KZKA 5FNVA 3VR6D 3ZLTA 4AL4A 1IM8A 2CW5A 5FORA 1GPLA 4CCYA 3SX2A 3HA2A 2F8LA 3UB2A 1DCMA 1GZ7A 2HLHA 2Q5HA 2E18A 4MVJG 5AIAA 2XT9A 5E0OA 2A3NA 3DQPA 1R0LA 5F9FA 1KI1A 4E5MA 4LBWA 4M60A 5KTTA 1FOEB 5DMXA 1GWNA 1NVBA 3CZRA 1GU1A 3PF9A 5TPWA 1W59A 3JSAA 4B3CA 1UPXA 4DLSA 1LDMA 3S44A 3PTLA 4HX5A 2HFKA 1Z8FA 2ZTHA 3JQ7A 1P9LA 2CXSA 3QSYA 3HGQA 4WY2A 4J49A 1O3YA 4Q9NA 5CITA 2PGDA 2SKEA 2YNMC 3QUCA 3CZAA 4NH0A 7GPBA 4KXMA 1OWOA 4BMYA 4HTFA 3LXRA 2DXIA 1NTRA 1P2GA 4LXUA 4IQ0A 4ZJZA 2GJ9A 4IIDA 1KVUA 1LLCA 2AG6A 4KQJA 5EKSA 3SIWA 4EHNA 1E7MA 4F46A 1MJGA 2CJWB 1T5BA 2GCGA 4LHWA 4EWLA 1PKXA 1VHQA 3ON5A 5HZHA 5K8IA 1RYNA 1KXZA 3QF4B 1K6XA 1N1GA 5LXTA 4ITVA 3U80A 2D2XA 1D2GA 3GZ4A 4YUYA 3GD7A 3GZNB 4LJ8A 1KYYA 1EP9A 2O4UX 2VHWA 5DNDA 2GS9A 5SYMA 3PQ4A 4GQIA 1MB0A 3ICWA 3VDNB 5HFNA 3KSMA 2QK4A 1Q1GA 1KBOA 1ENYA 1PF7E 2PSSA 2CBGA 5BY2A 3L4BA 3LO8A 1KARA 2EX0A 2EJWA 5ADWA 5E4YA 3WWZA 5NLLA 1BHO1 1TUBB 5CB8A 5KVAA 5B64A 2H4XA 5KSWB 1UKCA 3NHPA 4LK3A 1HKUA 1X1CA 1Y7TA 1BCRB 1X7YA 2C1XA 2CMGA 1N6OA 3BIJA 4ZQHA 5M04A 2I6SA 3QHQA 1NKSA 3BJIC 2O3RA 4OSOA 4RVSA 1NUSA 3VC1A 3DP9A 1H5QA 2OBNA 3FI0A 1B26A 1DJQA 1J2YA 1RZ3A 5KSOA 4CEHB 1QHFA 5B7QA 4PV7A 4JSTA 1NONA 4E15A 2BHNA 1K89A 2HMWA 3U9SA 3A6FA 4P38A 2BUBA 3IUQA 4RJJA 1QP4A 2ZAGA 1KGDA 4R68A 1JHQA 4EYEA 4BTLA 1VIAA 4C5AA 3VR5A 4FU0A 4KP7A 4ZJPA 2AR7A 4Z9XA 2BIFA 3DOFA 4NI5A 4O4JF 4NYIQ 5DSTA 3ZY6A 3VTKA 3BG5A 2DUMA 1C4OA 3DHWC 2O2SA 3H5LA 1IMOA 4MUKA 5AW3A 3HXOA 2UYCA 1G64A 2XPCA 1ILWA 4BVBA 1OB2A 3DT8A 1OXBB 4BV3A 4CBVA 1DT5A 5IZ4A 4DV6B 3B3GA 4F4CA 3HYLA 3OD1A 3T4PA 1LPMA 1Q50A 1YACA 4MV3A 3OZXA 1AQUA 4JMPA 3ZZ0A 1EGAA 1T0IA 4OAQA 5CW1A 2C7VA 4C6HA 5KPDA 1NU6A 1G38A 3R5KA 5F7OA 4PZEA 1MB4A 1QE3A 1Y8QA 3TLBA 3UV7A 3EPLA 2AOUA 1IXRC 2G36A 3GAAA 4H7JA 4P6VF 4ENSA 3WAGA 2O8EA 3DF9A 4X8OA 3TRJA 4MCJA 3A1CA 3CEPB 4WXPA 4MUJA 1IVYA 1A9RA 3D5QA 5CGZA 2Y93A 5H81A 4DSNA 4XR9A 1Y6QA 8GPBA 1N78A 4G9EA 5JZVA 3IBSA 2EZ4A 1UM8A 2DY0A 5H02A 5ICMA 1UOOA 1YDEA 2FZGA 2KW5A 3GVPA 4N12A 4N0QA 3GHYA 4H59A 2WJIA 1YR7A 4LGCA 2ZRNA 3KLMX 3LQFA 5CFMA 5FBLB 3TLXA 3WL3A 2YHSA 4UHJA 3OURA 1K2VN 2BH9A 4NAVA 4MMYB 1ZR2A 1H6CA 2H1VA 1A2QA 4IIXA 2HYIC 3M2TA 2I4NA 4RVNA 4M1MA 5HFJA 4EEZA 5FBZA 4XOIA 1VMDA 1XIVA 1XROA 1BWQA 1BEZA 1FRVA 2Q1XA 2FEPA 4TQGA 1ODFA 1PNVA 1VBKA 1FVXA 3SZRA 3ZBTA 3SQWA 1GQRA 3A9SA 1E1NA 2YQZA 4EQ6A 5HR5A 1H1LA 4PGAA 4ZYWA 3QE2A 1P2BA 4RPJA 3AOEC 2O0JA 1YBFA 1VJRA 1GTG1 1R12A 4O08A 1KZ4A 1L7XA 3H86A 2CSXA 2EFYA 1FBTA 2HC9A 3U13A 4QO7A 3WGKA 5KKCA 1P4RA 4TRRA 4CF4A 1EVEA 1O96A 5B3AA 3G88A 2QVXX 2JHGA 3LECA 5TJHA 2J32A 1IQPA 3G8AA 2LVBA 2DLNA 4ISBA 5AKYA 2E4VA 1JJIA 1V7PC 3BSSA 5JADA 2ZSAA 3S4YA 1ONPA 1RWXA 3DWFA 4RACA 1G21A 1X6VA 2FUCA 2VXCA 3DOOA 5DVZA 4LJ4A 2H06A 5E4JA 3U7EB 3QKIA 2BM1A 5ALWA 4F93B 1CY1A 3LUPA 2MR6A 4MYUA 2JA1A 4OFZA 3OCZA 4IV0A 1HE8B 1O8BA 2OPHA 3CLKA 3MIIA 2OAGA 2GN0A 1I2BA 2YZNA 4HVTA 4YRLA 3V46A 1U9IC 2ZJ5A 4KB5A 5J2TA 3BXPA 3GWZA 5CJ2A 4B4OA 2IS6A 1Z6ZA 4FZRA 5LA6A 1FLDA 4MIYA 3TAHA 2XNDD 2Z4SA 4LDRA 4E13A 1FW6A 4A0GA 3SYKA 3THXB 4ZWNA 2REBA 4FBMA 1Z08A 3FZEA 1KVRA 1UDCA 2QL9A 4TS1A 3SICE 1J5XA 4LYGA 3LH5A 1P4GA 1XPUA 1Z25A 1M1XB 3IP7A 1PNQA 2JH3A 2XHEA 5BP7A 3EXHB 3F9CA 3BN3A 5IW8A 2A9KA 3EZ6A 5EKUA 3TQCA 3C74A 1S3SA 5C5EA 1PNOA 4XWAA 4N1AA 4RV9A 3M0EA 3VPGA 3WB9A 2G9UA 4UUAA 2AN5A 2ISSD 1WMEA 4FYWA 3ESAA 1E1RD 3DLBA 4K28A 4UNPA 3TUIC 3NHFA 5HBGA 1SCDA 4LIPD 3SXUA 3UA3A 1WLSA 1HYGA 1PZXA 2Q3LA 2Z2YA 3B3FA 2VYVD 1DRKA 1OPXA 4FWIB 2ZSKA 2JIZD 3BRWD 1E3JA 1ZOPA 2W2TA 2XQFA 1EK0A 3JQBC 3KK0A 3W90A 2OL4A 5TLSA 1W36C 1NRJB 4Z9AA 3TMKA 3IP5A 1IZ0A 1XA4A 3U48A 1M73E 1OCEA 4KN6A 4NZYA 2PUWA 3VGJA 5EZYB 3WLLA 1CIPA 1MENA 1WEHA 1P18A 3C7CB 4BKMA 1S8OA 1P5HA 5CAEB 5JRZA 2R5NA 3NIGB 4OQFA 3EVZA 4MH0R 4MWOA 3FSGD 3I4CA 3HCBA 1JKMA 2B5VA 1ZONA 5DT9A 4AXXA 2P9TA 2ZSJA 3RS5A 2CVOA 2J87A 3HPRA 4AB1A 3ADKA 2IBSA 3Q1LA 4YV0A 2ZS8A 1GPYA 3FZNA 1ENOA 1ZH6A 3GYGA 4MV5A 3U37A 5E7MA 4JC5A 3FUTA 4DLWA 2RGWA 3TQSA 1CJCA 3QE3A 1KI9A 3SSOA 4M8LA 3CISA 1U3WA 4P9NA 4RZ3A 4CV0A 2ZJAA 2VYFA 2ZG6A 3VISA 4D3ZA 2JGDB 2VDQB 4MUGA 3U49A 5KU7A 5ES4B 4WIAA 4Z4QA 1BE0A 1UC4B 3ZHOA 4GLBA 4EK9A 2LBPA 3ZU2A 2JBAB 3DGEC 4IFTA 3ZWBA 4EGAA 4D98A 4ESOA 3QQ5A 2HKIA 5CLLA 1YRAA 4OMDA 1ULTA 4PQEA 1Q22A 5DBGA 3AZQA 1AQIA 3KBOA 3NBXX 2VQ6A 4FYYA 4C7MA 1P1JA 3IEVA 1E9EA 2J5KA 3HCFA 4C07A 2OKCA 1I9CA 1JHDA 4BFYA 2PA3A 5KHOC 3D9QX 3JQCA 1E1CB 3U7QA 1ISIA 3B53X 2GXSA 3MQFA 4KBYA 3UKDA 4B83A 3THYA 1JEDA 2QJWA 2D0DA 1YSCA 4F21A 1VRCA 2QLBA 4CMCA 1F5SA 2PXXA 1U8FO 3HXQA 2GN1A 4C3ZA 5IEBA 2OFXA 4BCBA 1GZSA 2J09A 5HJ2A 1AV7A 4WDRA 5CURA 4OPMA 4EO4A 5JDCC 3UJ6A 2GRJA 2H8KA 2R7NA 5GMOA 1VHJA 5IEJA 4PC3A 1KPGA 4DT1B 2R8PA 1I7LA 1W2GA 1C9JA 2NXJA 3IRUA 1RU3A 3D31A 4DDKA 1T6NA 1E2GA 3QOWA 2FH5B 2OZLA 1Y1QA 4PANA 3LQYA 4RK7A 4A0RA 3GEEA 4HMPA 3DFMA 3G17A 2P4SA 2C94A 1RM0A 3GLHA 4OHUA 3LJKA 4X95A 5EJFA 3GPIA 3H9QA 5A3SA 4YASA 4EHDA 3EF0A 3GX1A 1RAHA 3WNVA 4ZTBA 1PJBA 4G1BA 1XVLA 4U7JA 3JAMA 1USVA 4M9RA 5DTIA 4CHGA 2DH6A 4AIIA 1NQUA 1QQ5A 2QQ5A 4N5NA 4HSGA 4I5EA 4JR2A 1H42A 4Q3NA 1JKFA 5LC1A 3TX2A 2Q6KA 3ZW9A 2NU7B 5FNZA 3IUJA 1AO3A 1H5UA 2VYNA 1V8OA 2ZTMA 1RYHA 3M70A 1KZHA 2UU9B 2F90A 3BD6A 2ZFUA 2FR0A 5A7FA 5BWBA 3IPLA 4KTTE 3DR5A 3DMDA 2QE7D 1O89A 2W0SA 4LJYA 4FDAA 1CQPA 2V54A 3E03A 4INOA 4RVFA 5AK4A 4D1YA 2JFHA 3KFXA 4LBZA 4NDZA 4EQZA 3KETA 5BORA 1T3LA 1TD1A 3PGXA 2QZ9A 4DC9A 4DR2B 1O6CA 2DQSA 3IBTA 3MOGA 3NEPX 2K4MA 4J9UE 2VP3A 4RL6A 4IEFB 1YBVA 4K6HA 3C48A 2BEWA 5TE9A 2X8WA 4XA8A 3VKVA 3T0GA 4F96A 4YX9A 4CETA 2H1OA 3RFTA 2E85A 1Z82A 3HXLA 1RLIA 5KNLA 5DGCA 4QXPA 4MRNA 2TRSB 2DHCA 4CKBB 1T5DX 1EZZA 1E9CA 4LKOA 1JAIA 4AP5A 3D7SA 4OAPA 3AUYA 1RXEA 2FRVA 1XDDA 4M0FA 1LBEA 1QVVA 3OEHA 2PCLA 4XD7D 1MR3F 4F8JA 4GICA 2Q9CA 3WSWA 5I45A 1X7DA 1Z3IX 2BZGA 3NHBA 3SEZA 1WKVA 1EDEA 4PLTA 4KYIB 4V2UA 3C2QA 3UQYS 1CEYA 3M4NA 4HB2A 3EPPA 1NBEA 1I6LA 2PIDA 5JVDB 1JHUA 3DA8A 3KTAA 3NNNA 1ZVKA 3HU5A 4TMKA 3WKAA 4JSYA 1O6GA 3H13A 2CUZA 3C8UA 3UJHA 1JEQA 2HMAA 1R0YA 1N75A 3SBEA 2QI9F 2CZCA 1ZMRA 3HU3A 1E94E 2FLKA 2WJHA 3C3MA 3RANA 3VO8A 2UVPB 3WLHA 1XEXA 4XVRA 1FXUA 3M4JA 1OV6A 1WMSA 1OILA 3FFAA 5CNJA 5B37A 4E0BA 3EXFB 2QZPA 4JI3B 3K0EA 3GMSA 3TI7A 3FNFA 4MYSA 2GKSA 2HV9A 3EUAA 2O2IA 5CT9A 1LEHA 1FPQA 2NZ2A 2V6GA 2V7EA 1P81A 1KYXA 3PR3A 2VFAA 3LG2A 3RUIA 4BQNA 1Z7GA 5CTAA 4FS8A 4AY6A 2CLDX 2O8CA 3ETLA 4YRGA 1QGUA 4RMIA 4XI9A 5MN5A 1T3ZA 5L4NA 4JBLA 3FSEA 3QOYA 4LJSA 4ETNA 1T36A 3JQGA 3TTXA 1BHSA 4F1WA 1WXDA 821PA 4OLAA 2N46A 2OLEA 3AR4A 1D2MA 4MQ5A 4C5BA 2R97A 3ETEA 3BL5A 3ECAA 4DCUA 3OM9A 4LJKA 1M2WA 3DDWA 4HMOA 4WINA 1ML3A 1T6YA 4NWIA 4YI5A 2Q9AA 4PLVA 4CL0A 3U3KA 5IKOA 5KPJA 3G9TA 2P9BA 5L9AA 2ZCUA 3UAWA 2F4VB 3L6RA 1L5HB 1TCVA 4RIEA 3U1VA 1X7ZA 5CLJA 5JQGA 4M46A 2EW2A 3N7UA 5JNTA 1JDNA 2WK1A 4P3XA 1AF7A 1DSSG 1IHYA 1PR4A 3MWFA 5KCZA 4C7OA 1H9AA 2RGXA 1WP4A 3CKLA 4QTUB 4DM7A 1E4VA 2YMLA 5AI9A 4E7OA 2NSHA 1SCIA 1Y6RA 3NX4A 3IILA 2WV7A 2YFKA 3A3PA 3K53A 4JBGA 7REQA 2W6ID 4YP1A 1A8PA 2AFVA 3VNAA 4YIHA 3JZIA 2AW5A 3L0IB 1MABA 3PA8A 1DAFA 5EE1A 1TLTA 3PXGA 4MQLA 3OIWA 1IUOA 3BHNA 3AVQA 1EE1A 3IS3A 4L76A 4NKRA 4ZVNA 5IJ0B 5KNCA 2DFLA 3FCCA 1EXVA 3RWOA 3KQKA 1O6ZA 3BXZA 2I3BA 2DETA 1TC1A 4KI0A 4PU0A 4TS3A 3SBOA 3ZWOA 1MD9A 3ISTA 2JEYA 3RSGA 1DJNA 1NW7A 1YQTA 5IS2A 1QTIA 3FR8A 3HI4A 1OR8A 4LHSA 2O2JA 2ZJ6A 1DHRA 4HNAA 4Q7EA 4Q9IA 5BV1A 1I3KA 2P62A 3AKYA 2YZ2A 4NV0A 4U0KA 2HK7A 3S70A 4A0SA 5K8VA 2D2FA 4W7SA 1NXWA 2QVCA 3STXA 2IY9A 5SZJA 2WW8A 3HRIA 2ZIWB 1BYUA 1W76A 1IH8A 1NJ1A 4FE3A 4Z86A 3ZNPA 4CLOA 1E1DA 1YTLA 2QD1A 1PTJC 2WFMA 4PAGA 4IIVA 4RD4A 1KA9H 4DYVA 1TVCA 1C7QA 4PHGA 4XPIA 1GKLA 4X8LA 3GLFA 3QEJA 1XAGA 4FK8A 5IJAA 4P3YA 4RXMA 5EKTA 1Q0TA 4UPDA 5G1PA 2OESA 2QT0A 4KQIA 1U9ZA 5EMNA 3UVEA 2WI8A 3WMRA 5C4IA 1UBHS 2XUDA 2NADA 3EXIB 3MJTA 1ZGAA 2H5JA 5A9RA 2PLFA 1A3CA 2Q7XA 1JKJA 3C6XA 4B2IA 4BVEA 1L4KA 3FKQA 2X6RA 1A4UA 1PWZA 4H60A 4ZD6A 3T1NA 3LUCA 2I6QA 1IZ7A 2IQ5A 4PLYA 4Q1DA 2BOVA 5CHYA 2ZYDA 3ZWQA 1RBQA 4HK4A 1PUXA 3RJZA 3TO5A 3QI2A 1Z7WA 5DP2A 4C5CA 5JR3A 2R11A 4RGBA 2CZQA 5HKKD 3Q88A 1ZMOA 2SBTA 3I8OA 2RBGA 5E1BA 4YS6A 3GA5A 3X1KA 4ZZ3A 1LPSA 2C8JA 3GEBA 5LP6F 1JBQA 1IJFA 3ZDXB 4C29A 4KXUA 3VR3D 1F8YA 3D7RA 5A3VA 1M66A 3LNTA 1CR2A 3O26A 4X85A 5K3FB 2HU8A 3ZU6A 5BN3A 3L77A 4N01A 1JIIA 2YCLA 3DEKA 3WO1A 2GBGA 3ZV6A 4BV8A 1I4WA 4UUQA 2WA1A 5KREA 1A77A 4U7DA 1YNOA 2JGJA 4C9BA 2AFHA 2H4WA 3IAAA 1V35A 4RA6B 5FP0A 5FUQA 5AD1A 3ZQKA 2FZ4A 1P0CA 3C16C 3MCWA 3JQQA 2OXCA 2P3SA 2XBUA 1D03A 3L84A 4JVLA 5FR2A 2ZIFA 1FFAA 3JZMA 4FYKA 3LF1A 4IR7A 1DMSA 2H4JA 1OXUA 4PM4A 4S1NA 3ZTWA 3MMNA 4GU5A 4LY3A 3CGGA 3P9IA 1NQAO 2CUTA 4Q3OA 3MTIA 3ZVKA 3E58A 2XWPA 2QMOA 3QXXA 1N5IA 1AOXA 1RYEA 5JPIA 3RJ9A 4I55F 3TKLA 4X66B 4DUPA 1GHTA 1XF9A 1BHQ1 1U81A 2OQIA 1QIEA 3S3TA 4GD3Q 3T35A 5FWAA 2GZHA 2DWOA 1HM5A 2O3JA 4FIDA 2QVLA 3E9CA 3H6KA 3WGHA 2HNAA 1NTOA 2CK3D 2IKQA 1NKTA 4OTZA 2YZMA 4ZU1X 3FCAA 1DDIA 3KD2A 3VYSB 4D81A 5KC9A 4ZOAA 1T9CA 2RHWA 3ZIAD 2EW1A 5C7LO 4R1SA 4WV3A 2HK8A 5JCJA 3BQMB 1TMYA 4IHJB 2V3VA 4DV3B 4OMCA 2REQB 3RSLA 1N6IA 4M9SA 4MS3B 4MJLA 3RR2A 5KS2A 1L5GB 5KQRA 4P92A 1SKUA 3NDRA 1QFXA 1VPLA 2BHRA 3WGMA 4EHAA 5B30A 3MCUA 1Q6ZA 5F77A 4NOLA 5KOJB 4AQ7A 3W6UA 3RC8A 1X86B 5H4HA 3G59A 1R5JA 3BPSA 4OL0A 5TPWB 2GNAA 3T5CA 3ND7A 1J00A 1M6VB 1VJGA 3FN4A 3TUJC 4ZRDA 4IMIB 1M2EA 4PX3A 1QG6A 5U4QA 2YXLA 5IRCD 1N7IA 1CJUC 3U1BA 2RKWA 2X0EA 1PFWA 4JQSA 3EGEA 3U2QA 4CG0A 1W44A 1ZGJA 5KVSA 2MOKA 4WOCA 1Z4IA 4CFZA 4HTFB 5KBYA 1CUJA 2BMWA 3CMCO 1TIKA 4CXMA 3TRKA 5GV7A 4L22A 3FRJA 4YCDA 2C03A 4G07A 1CRQA 3WB1A 2ECFA 1KYWA 2IXFA 3GUZA 1U28C 4Q03A 3AHDA 4BNLA 3I9FA 1QH9A 3INYA 2OCYC 2PBZA 1PJ2A 2J9XB 3K3PA 2O2XA 4ZU3A 2B2NA 2JJ2D 3ZE9A 4BAUA 4BQIA 1SR8A 3SC4A 1PGNA 1PP4A 2Q2WA 4LRTB 5CEJA 4GOOD 3D7KA 2AMYA 3I0NA 4YT2A 2BFWA 3TNJA 3G02A 4EJSC 1U1IA 1GFIA 2XCIA 3HKDA 3CCCA 3DVRX 1T9GS 4GMFA 5EKXA 3IKTA 1IXKA 2OORC 4R9RA 1RXCA 1ZOOA 2UZAA 3HYNA 1AXGA 1AT1A 3O4VA 4NQRA 4XLLA 2I7DA 1R0SA 2IZ1A 2ZJOA 3WA7A 3SZLA 1HDCA 1CQIA 3UICA 3FMOB 4BO6A 1D8TA 3RB8A 4XGNA 5ALRA 2IEYA 2HHCA 2V5UA 5FWDA 1XZAA 2E9SA 2GZ1A 4ODIA 3FYSA 3F7TA 4QSHA 3CC8A 4NEQA 1G20B 4TTSA 3EBOA 5E4TA 3N8KA 1CS0B 5D7NA 5SZKB 3RTEA 3TZHA 4CLHA 4PS1A 4QPNA 2LCIA 1RS0A 2PZJA 3WADA 1VL6A 3LRTA 3TZQA 2VHVA 5TMDA 2Q5FA 3QVMA 4PF1A 2Q2NA 5AKZA 5HRUA 4G8CA 3FDJA 2I3DA 1NW5A 5TC4A 3GBPA 3IJPA 3OIYA 3ZWKA 3D6NB 2VP4A 4G5QA 1TVKA 2A88A 4W63A 3RDPA 4F1KA 5FHQA 4UTOA 2AL7A 1BJTA 5BW5A 2VIIA 3PZRA 1W46A 3MLEA 3ISJA 4TLBA 3H7IA 3P27A 4LTDA 2EIHA 3MJHA 1PR6A 3HKCA 3TJRA 2YXBA 5IT9A 2ZZMA 3BRCA 2IELA 3U7JA 3WVNA 4WJZA 3CVWA 4G5XA 3WSTA 4CNBA 3DEZA 3A9TA 1XN1A 1XZHA 2Q50A 3NV9A 3S99A 2NNLD 3WQQA 4BQOA 3LUHA 3CEHA 2I3ZA 2JGNA 2P9EA 4BGIA 1SUCA 4D44A 1KRXA 3D2AA 3G0OA 4K6KA 5AM5A 5GVSA 1ZQ1A 1BMQA 2IU6A 4PCUA 3PUYA 4LZZA 4TQ9A 3VM6A 1P72A 4QLOA 3EGDA 3OY2A 3JASA 5DN9A 5C1IA 4CFSA 5A4DA 4BS9A 5JU6A 4DTIA 1B93A 2OZKA 4M0KA 1XCPA 1Y8QB 4ROTA 4RHFA 3IIJA 2O8EB 1P2SA 1RCUA 1UFKA 4LE2A 5DN6D 4U8GA 4JROA 3NDPA 4N3AA 3HQ4O 3M6FA 3B6MA 4QT0A 3V2GA 3E53A 3G5MA 4B9AA 4LWOA 3FFBA 4PPGA 4F2HA 2H48A 2I4IA 2LGJA 5ECYA 3T1TA 1IRIA 2JC3A 2WFZA 1QGAA 4IAOA 2ZBVA 4RZXA 3C4VA 3RGGA 4EVSA 1MAAA 3C5EA 4QM6A 1XTQA 3LCUA 4C2TA 1H66A 3WKDA 1SB9A 3T5AA 3LCMA 1Z62A 3AHIA 2LCQA 3EDRA 4U3JB 5CT5A 4D6YA 1JA1A 5JCOC 3Q85A 1CR6A 1ZPDA 3F5QA 3C1AA 2G76A 3D6TB 4QOSA 2PNJA 3X1WA 1JYSA 4U5QA 3LZDA 2FPMA 4ZVVA 1KO4A 2NV6A 3ORHA 4HWKA 1MBZA 4XQCA 5EUMA 1I7DA 3EN0A 1IBMB 3KWMA 3L46A 4OQDA 2XUFA 1GSOA 4Q7MB 3AT1A 3OPVA 1H1LB 4EQ6B 4XWOA 2V59A 1A9TA 1FRQA 1VA4A 1OZGA 1S8FA 1V48A 1L7NA 1TTHA 2ORIA 2SNIE 2WHEA 4Q02A 2DBVO 2H92A 3OCWA 4JJFA 2Y99A 1D2EA 1NXQA 4WBSA 1UT6A 2QVYX 2OQVA 2Q5JA 3M4YA 4ZGBA 2JLUA 4G01B 3S2GA 1IRXA 4Q3AA 4DNFA 3OTIA 3HMKA 2M6LA 5DYNA 1SKAA 2G5CA 3B6ZA 4JKYA 2P1DA 4CM9D 1WU7A 2OCDA 4PCAA 5E1MA 3JYOA 3PNQA 4PSUA 1LRLA 4FFWA 2FQQA 2CBZA 2NV0A 4HLUC 3S8EA 1I7PA 5EIBD 1A96A 4LXGA 1EFKA 5EJIA 2CYCA 1WU8A 2N9UA 1YR3A 1ZP6A 4ZYVA 5G02A 5A71A 2PMFA 4X6XA 5KVVA 2J6IA 2W4MA 3W1VA 1A8IA 3AVOA 2ZM6B 3CR7A 3DV0B 4CEIA 2CNNA 3O7WA 1QTNA 5JC1A 3DWEX 3F6YA 4IICA 1JLLA 1M9NA 3K1AA 4ALKA 1GKUB 1PDVA 3ZGYA 1RZRA 2XZPA 4B74A 1W73A 3CNOA 3N28A 3K0CC 4GEKA 4NU5A 5AOBA 2DFPA 5J2TB 2PJZA 3CF2A 2CXQA 1TTTA 3FCOA 3CO0S 2BE9A 1U7WA 1DXQA 4ZI7A 4YRPA 2ZB7A 3BMNB 1PJ4A 5LA6B 3IVAA 5DNVA 4J1TA 2C7QA 1YB6A 2FRDA 2JJ1A 3P7MA 1DC8A 3QPWA 1YIAA 2X8JA 1RZUA 2UDPA 2VZ9A 1GTVA 1IXSB 1W8DA 3NNDA 1GRCA 4MWBA 1D4FA 5JISA 1N2EA 4NJOA 4NNJA 4N9WA 3MAGA 3Q6MA 4RTKA 1N7HA 1H2BA 1NPYA 1WJGA 1QK3A 2JRLA 4JS0A 1RC1A 2X4DA 1XRNA 3HYCA 3ROGA 2GBLA 1WZIA 3E18A 1B0PA 3N6XA 2NU8B 3HRHA 4DBZA 1N2JA 2ZJ7A 1I30A 4GWLA 3EZXA 1QO0D 1TT5B 3OQJA 3I83A 3DPUA 4TMVA 8AT1A 2I4OA 2IHJA 4ZVMA 3CZCA 2ORYA 4YCAA 4P35A 3VNUA 2F62A 2XD4A 1W0JA 2ZYUX 3OA2A 4JP2A 2WMDA 3QRWA 2Y0PA 1Z4KA 1LI5A 4L4ZA 5ANRB 3CKKA 1V5GA 5K6TA 1K7EB 4Q3LA 4R71A 3RI3A 3X1YA 4GI5A 1DXYA 2XYPA 1C3OA 4HFRA 2QUAA 4HR7A 2SICE 1FU7A 2UZ3A 1QXSA 2VA8A 2ZR7A 3CN7A 6PFKA 4NJMA 1TD9A 1GAXA 1FDIA 4DKXA 3PJFA 2WM9B 3PUIA 3QWBA 2ZZKA 4OGGA 2PMBA 4D4MA 5CXQA 5JATA 5KYTA 1S3IA 2X7JA 3ILYA 3KLBA 1U6KA 2HIMA 4CMEA 5HUHA 2FPOA 4RJLA 1YJXA 1IZ9A 3ZJUA 4Z3KA 3DE5X 4C0AC 3MLAA 4KFSA 5HUQA 5J5AA 1N7GA 1YCHA 5ALUA 1L1QA 2IXBA 3NTUA 5D1NA 5HRAA 5JS1A 1AQ6A 2QNBA 4O8ZA 5T8KA 3CO5A 4ZYTA 2D62A 4G63A 5DEOA 4G5FA 4AULA 5CFLA 3SJUA 1GAJA 3TFWA 3EUEA 3ZWMA 1P3DA 4ASUA 3DMGA 4HN2A 1OWMA 4J76A 5FA8A 4D2IA 1E32A 5LDDC 5HIAA 1N6HA 3ABOB 4K3UA 2AT1A 5K51A 1NXSA 3ITDA 5JAQA 2XUIA 4BVKA 2EFJA 3M1AA 3G2PA 5E2BA 1MVOA 1X14A 4KIUA 5AMXA 4I9NA 2G25A 5EWJA 2B35A 4BO3A 2G67A 2R1ZA 3FR7A 3C3JA 1Z18A 4KGDA 1NLFA 4HRVA 2PMWB 4R84A 2J08A 5M5BA 3THYB 5F9HA 3ZHZA 3MF4A 2BT4A 1THGA 1YI1A 1S0UA 2H2IA 1IN6A 4KQEA 4PZLA 2CMFA 3I9OA 3QXHA 5AOVA 4DUGD 3GP8A 3RFUA 1IU9A 1ZLYA 2WSYB 1CRZA 1W85A 4NCKA 1F6WA 1Z5GA 4JT9A 4L8WB 5JCXA 1KFEB 1QYCA 1USKA 4OFXA 4WEOA 2ZLBA 2RAVA 1GA6A 3K2IA 3QGMA 2DJIA 4Z2YA 2F1OA 1ZUNA 2OZLB 4XYEA 2P1ZA 2ONZA 2GI4A 1RQRA 2VAMA 4B31A 4BTVA 3GLHB 4LECA 3NKFA 2OXIA 4J4HA 5CPBA 2FOXA 2C97A 2OFWA 2G1KA 4Q9HA 1LKZA 2PQ0A 2W90A 4YMLA 2ZOSA 3ROXA 2XZLA 2OYCA 3H1TA 2YNMA 4Q4DA 4ZEVA 5KYYA 2GK7A 2TS1A 1CY7A 3EQ7A 4I6JA 2W6CX 4UVIA 3TTWA 1ECCA 1Z2CA 2XMSA 3KVYA 2XXJA 1YS2X 2O57A 2OD7A 3HCWA 3Q8WA 2VT6A 4CM8A 4J0HA 3PQ8A 3PX2A 1JMVA 1ZVJA 1N92A 4G36A 2BMFA 4L0MA 2DEUA 1SELA 1TX4B 5FF9A 1VG0B 2CXRA 2CGEA 3OKFA 4C4SA 3VYRB 1IN7A 1HE4A 4FIZA 4RWZA 1O95D 4PBSA 1HGXA 4BO5A 1WTAA 4JI8B 3W6OA 4UE2A 3R77A 3W77A 1IY0A 1JDZA 1CQWA 1MX3A 3M4XA 1U8XX 5EHIA 1N9GB 1JI3A 5CCDA 3T3IA 3M1YA 5JNWA 3UZUA 4FZ3A 4OB7A 1Y9JA 3A1NA 2LCFA 1E9AA 3SVTA 3WI7A 2BEWB 2CMKA 2O6LA 2XZDA 2HF9A 5LYJF 5CDFE 3RKRA 5BO5A 1UMCA 4FNOA 3DZ8A 4G24A 1L5NA 4A15A 1P61B 1T9BA 4WASA 2Z83A 1GU0A 1JBEA 2PPLA 2Y71A 1E79D 4INPA 4R3WA 4X3OA 4QTYA 2DWQA 2I4LA 1U8UA 1U9YA 4Q7KA 1ZXXA 1VLJA 4GSLA 1JILA 3U4DA 1VGRA 1VZ2A 1U0JA 2WWIA 4JFAA 1ZJZA 1A82A 1RWBA 1EFRD 1LJUA 4DSZA 2ZRJA 3G5TA 1V9SA 4I4CA 1E4EA 2NX2A 2BHSA 2IHKA 2XMCA 4P3OA 5KZMB 4AY2A 3CU5A 4AYXA 1PJLA 5D3MA 1LLUA 1N3IA 5CP8A 5A9TA 4ZVTA 4A2PA 2AWOA 3H4VA 1PLKA 3KTAB 4MS1A 3ZGXA 4BUJA 1YVUA 5H68A 4B9EA 2AKEA 3G5AA 4NMMA 4ZDKA 2DHDA 1OKKD 2EBFX 3F7MA 1KIMA 1YRQA 3RC1A 4I50B 5HJEA 4BVAA 1XEXB 2OLKA 3SBDA 2GMWA 3COWA 1CUAA 3I9NA 3DAYA 1C2TA 2GF9A 3C7AA 4YO8A 4ZVQA 1A9SA 4TT3A 2QP4A 2YN2A 4WNIA 3CRW1 3BEOA 1QG2A 3F5SA 4W9MC 4TLAA 1THZA 4YCJA 4G81A 1U7TA 3OX1A 5LZ5A 2NG1A 2NTVA 4EMUA 1G3MA 1TUIA 1Z8DA 3OU6A 3W5IA 3Q8MA 2X5KO 2O54A 1FJ2A 3OZCA 1WOYA 3UMSA 2TMDA 3LPAA 1D2NA 1T10A 2B69A 4DCCA 1GR1A 4RTSA 2QN3A 3O2QB 5EJ5A 2HIGA 4YJ3F 5SYAA 1JB1A 5IT4A 2RHLA 2VT2A 3K4QA 4ARCA 5D5QA 4GC5A 4UXHA 4AUNA 1C8KA 2CHFA 3AEYA 4JWKA 1IBCA 3JSXA 1NYQA 1I14A 1FYFA 1SVWA 4L5AA 4OXRA 1UPAA 3JQGB 3KC2A 5CVUA 4M6WB 3O4GA 4LK2A 1KMHA 1FY2A 3I2GA 3FJ1A 1P73A 3JD0A 4QHTA 4UXIA 1T5SA 3TBHA 4V24A 1GTZA 3JQ8A 4IGFA 1NNI1 3IIMA 2B4YA 3HU1A 9GPBA 3KQMA 4H7FA 5JD6A 1DXOA 1MT0A 1Z07A 2ZBEA 1QRAA 3KE9A 4I19A 1X7ZB 4RPKA 4HRXA 3TTUA 5JQGB 2HA3A 1C1DA 1TYCA 1XRQA 3DOUA 2QY9A 1E9VA 2WT4A 4WMLA 2HR1A 3OQNA 3HO8A 4DIEA 1QGYA 1HV8A 4CMJA 2R62A 2ATXA 4EGJA 1MCZA 3GQBA 1C30B 4DHWA 1Z35A 2QV7A 3AOEA 3OCJA 4N8DA 3IEKA 4PZYA 1RQXA 2BD0A 3BEDA