4RTPA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and with dna containing proximal pap regulon sequence
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
246
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVKKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
total genus 84
structure length 246
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtpA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtpA01
3ME5A 2GB4A 3FTDA 1EAMA 2ONYA 2IH5A 4PGHA 3DR5A 3GCZA 4Z2YA 5EEGA 3NW9A 2AOWA 3REOA 1IM8A 1KYWA 3A7EA 5EOVA 4YUYA 3PS9A 3OZRA 4AZVA 4PNEA 5DTQA 2WK1A 4ZTBA 2QY6A 2OB2A 4HSGA 5E8RA 2XYQA 4EMSA 4F84A 3G5TA 3G2MA 5LQRA 2NP7A 5FADA 1KPIA 1RJFA 1X1DA 4C08A 5ICEA 1VP9A 1ZKDA 3HA7A 3I58A 1I9GA 1ZGAA 2AOUB 2P1DA 3M6UA 4LG1A 3HVJA 5DX0A 1KXZA 2YXLA 5E1MA 5DT2A 5GM2A 4BLUA 1AQJA 4MHTA 3G8AA 5DXAA 2NXJA 2DULA 2JH8A 1XJ5A 4KRGA 5BW5A 4RTJA 3M6VA 5E2BA 2Z6AA 4ISCA 1SKMA 2BH2A 2GPYA 2HWKA 4ER0A 3HTXA 2BR5A 1NW7A 3MGGA 4FR0A 2EJUA 3MCZA 5DSTA 3OU2A 5EIFA 3V97A 2C7PA 4AZWA 4DA4A 1TPYA 4FZVA 3KHKA 9MHTA 3SM3A 3FPJA 4E30A 1WS6A 2NXEA 3OZTA 3Q7EA 1BC5A 5K0FA 2ZZNA 4FS8A 5K0EA 3GNLA 4YMHA 2V74B 3DXZA 4QTUB 1DCTA 1O9GA 2P8JA 4FT4A 4KIGA 3LL7A 5EHIA 3G5LA 1KYZA 3GDHA 1QZZA 2AN4A 4MIKA 4MTLA 1H1DA 4IV0A 4ATNA 4E70A 5LQUA 5LR6A 2EG5A 2FK8A 5K0CA 2EFJA 2A14A 3CGGA 3HA3A 5ERGB 1MHTA 4RV9A 4V0RA 4Y30A 5F2KA 3UBTA 3SSOA 4C07A 4R6WA 3UJ8A 2YTZA 3UA4A 1XTPA 3ELDA 5EKXA 1HMYA 1EJ6A 4PYMA 3DP7A 4RTLA 1KP9A 2G1PA 4KW7A 2R3SA 2OY0A 4ER6A 1NV8A 3BXOA 4UOEA 2YR0A 3PVCA 1JQDA 3E23A 3EVBA 4M38A 3GRYA 4AUKA 2UYQA 3DLIA 1NBIA 1ORIA 3TKAA 5EC8A 1ORHA 2AOXA 2JJQA 1IY9A 2AN3A 5K05A 3G2PA 8MHTA 3KPYA 2PWPA 1YZHA 1WG8A 3NDJA 3BWMA 2P3OA 4KIFA 3KQOA 1G6Q1 3AJDA 1XVAA 3FYDA 4E31A 4HGYA 4DQ0A 1JG1A 2ZBQA 2ZIFA 2ZTHA 1VBFA 1NV9A 1EQAA 3E7PA 3GXOA 4KDCA 4U7PB 4E2ZA 1YFLA 1ZG3A 4QPNA 3GGDA 2ORED 1WY7A 3FPFA 1AQIA 3PX3A 3DH0A 5T64A 2C7RA 3TPZA 5BP7A 1FP1D 2Y1WA 3G8BA 2UYCA 4OX9Y 3THRA 2GS9A 5E9WA 1O54A 2BM8A 2K4MA 4PINA 2ZCJA 2AS0A 3UZUA 3KR1A 4RTRA 3V8VA 2BZGA 1FPQA 5EKUA 4RWZA 3TOSA 4CXMA 3LX6A 2HNKA 3D2LA 3JWJA 5K09A 3GRVA 5K0NA 4P58A 4PCLA 2FPOA 3UWPA 2ESRA 2FYTA 5HIIA 2JH9A 1SG9A 4X63A 5KQRA 3ER9A 4PIMA 5GWXA 3KR0A 5EQJB 4RTMA 4O29A 2HMYB 2ONZA 3MB5A 4GF5A 4P7GA 2XYRA 5E1OA 3G2QA 1JSXA 3DULA 4P7KA 1VP3A 2AOTA 5FA8A 2N47A 4WVLA 2O57A 4AX8A 3EVFA 1OR8A 3KPWA 4QVGA 3IHTA 4OQDA 4RX1A 3A27A 2PX4A 5DX8A 3CJTA 3AWIA 5EZSA 2IBTA 5D1NA 1M6YA 2AR0A 3JWGA 4LWOA 5FCDA 5FQOA 4E2XA 5M5BA 1RI1A 1QAQA 3C3YA 2AVDA 3LDFA 3I5UA 1SQGA 3I64A 5EMMA 3AXTA 4IWNA 3TFWA 1P39A 1XDSA 3LBYA 3TRKA 3SX0A 3CCFA 1VL5A 3DMGA 1FJXA 1F3LA 5EMJA 3P2EA 1NE2A 4CTJA 1DUSA 4PYQA 4AZTA 3ORHA 1R74A 3CC8A 5CVJA 3JWHA 5LQNA 3KKZA 1KIAA 5DM1A 5DXJA 3K6RA 4PYOA 3PB3A 3MTIA 1WXXA 2OZVA 3IEIA 3P9IA 4HH4A 4KWCA 3KR2A 3EGIA 2XYVA 2YQZA 3NWBA 1JG3A 1SVUA 3P9CA 3LCCA 5DM4A 5FULA 5K8VA 5G02A 1INLA 3FUXA 1XDUA 1X19A 2WA2A 3HVKA 3Q87B 5CCBA 1JTEA 1XCJA 2PWYA 1QAOA 4QDKA 3HCCA 3JWIA 2IBSA 2G70A 1L3CA 3BGIA 3P97A 3KPJA 4HG2A 4DCGA 3AXSA 2OXTA 5DM0A 4CTKA 5LQJA 3LSTA 1R8YA 1L3BA 1YF3A 3CVOA 3OU7A 4EQZA 5DWQA 5HIMA 5JUWA 3SVZA 5KQSA 4QDJA 4FSXA 1AF7A 5EHGA 3NMUF 4PYIA 3S68A 2UYOA 4RVDA 3H2BA 3GO4A 2CWWA 4XCXA 5DTRA 4A6EA 2PXAA 3DTNA 2VP3A 5E2AA 4R05A 4ER3A 3BZBA 5DLYA 2Z6UA 4RVHA 3R9XB 2I7CA 4QQNA 2QRVB 4EKGA 3LPMA 2I6GA 2OO3A 3G89A 4CKEA 2GAFA 3HCEA 4HRAA 1P1BA 3BUSA 4RTOA 2PX2A 2O07A 5CIYA 4EVIA 2C7OA 3NVMB 4HGZA 4E32A 3FUWA 3M6WA 1YB2A 5CCXA 1QYRA 3LCUA 3FTCA 1VPTA 4BLVA 4K6MA 1VLMA 3NJRA 3C6KA 3O7WA 5K01A 4PGGA 3KQYA 1KHHA 5EVJA 3BGDA 5K0BA 5K0GA 3EEYA 2P7IA 1L3IA 2O05A 3LDUA 5E8JA 4E2WA 5FWDA 4PYKA 3P2KA 2C7QA 5ICGA 5H02A 1XXLA 3UJ9A 2H1RA 10MHA 5EPEA 3TM4A 5F2NA 1JG2A 1FP2A 3A26A 1Q0SA 2PT6A 3IV6A 3PTAA 2GH1A 3BKXA 4GOOD 2NXCA 3SSNA 4RTPA 3C3PA 1P1CA 2PKWA 2ZWAA 5T67A 3PT9A 4RTKA 4FT2A 5DPMA 1NW5A 1X1AA 2YXDA 3TKYA 2AOUA 5K03A 4PIPA 2R6ZA 5EZQA 3EVEA 1I1NA 3HCAA 2ZLBA 2YX1A 5D1HA 2Y1XA 2ZBRA 3RODA 2IGTA 3NWEA 1SQFA 3HP7A 5FWAA 3SR4A 4DZRA 4RSRA 1EJ0A 2B3TA 1KPHA 2IIPA 1M6EX 4FGZA 4X60A 1U2ZA 5CVUA 3U81A 3HNRA 3LKDA 3SXJA 4QQKA 3KQSA 3TMAA 3VSEA 4PWYA 3WSTA 4U7TB 4G56A 3HCDA 4HC4A 3R0QA 5FHQA 2ZBPA 1RI2A 5DTMA 3QOXA 4QTTB 2ZVJA 4OBXA 1JTFA 5U4XA 3A4TA 5HEKA 5C0OE 2PY6A 5FQNA 1R00A 4IKPA 3HM2A 5GP1A 2Q41A 2PXXA 3EVAA 5CUQA 4DCMA 2YXEA 3HA5A 5EGSA 3OE4A 4B17A 3FZGA 3SSMA 4R8RA 3NDIA 3LECA 1SUIA 3K0BA 2PBFA 1PJZA 2JHPA 5DM2A 1AV6A 2AVNA 3ELWA 3FPGA 2PGXA 3A7DA 2ZSUA 3GRRA 3EMDA 2VZ9A 1QANA 2YVLA 4PCAA 4QVKA 1X1CA 2VDWA 3KQTA 3X0DA 4BLWA 5LQAA 2OYRA 3B3FA 3HVIA 3ELUA 5FTWA 3R3HA 4XUEA 4M37A 4RVGA 3BT7A 3C0KA 4C04A 2NXNA 1ZHFA 3FPHA 3EPPA 4RTSA 2AZTA 3LDGA 4GOMD 3MERA 3KQVA 3P71T 3P8ZA 4P7FA 1ZQ9A 3KPUA 4BP3A 4OA8A 2ZIGA 2DPMA 3AY0A 3EGVA 3KPVA 3I53A 3KQWA 3DXYA 4GEKA 3PFGA 3B3GA 5DSXA 3GRZA 2OBFA 1N2XA 3B7PA 4PYNA 5BXYA 1WXWA 2IPXA 4AZSA 1NW6A 3OZSA 2CMGA 3RW9A 2IH2A 4GC5A 1M0EA 4OBWA 3B5IA 2VDVE 5HILA 1G55A 4BP1A 1YZ3A 3EMBA 1D2HA 3MHTA 2BR3A 4LWPA 2XBMA 2BR4A 2AOVA 1UWVA 3LHDA 3VYWA 1BHJA 5FUBA 3CKKA 4IV8A 4PYLA 3UJBA 4YMGA 4YV2A 1G38A 1IXKA 1UIRA 2PX5A 3BKWA 3M4XA 1KR5A 4CWAA 7MHTA 2PVCA 3C6MA 3OFKA 4M7RA 2P40A 1TW2A 3TLJA 5C9ZA 2QE6A 2B25A 1P91A 4C05A 3EVDA 5E9QA 3MCTA 4YUZA 2JHCA 2EX4A 2KW5A 2H00A 1O9HA 1FBNA 1NW3A 2PX8A 3GIWA 3P9NA 5HZMA 2CKDA 3VC1A 3BWYA 4OA5A 2JHAA 5MHTA 3FRIA 4GOND 3OCJA 3OPNA 2I62A 2ZULA 3L8DA 1D2CA 4Y2HA 1X1BA 1TW3A 1JQ3A 5CD1A 4NECA 3F4KA 1RI5A 4L7VA 3CJRA 4X1OA 5EIWA 1JG4A 5HFJA 2NNWB 3OE5A 3UJAA 4X61A 4RTNA 4GUAA 4LECA 5ICFA 1XCLA 5EMKA 4DKJA 1R6AA 2IDJA 4GQBA 3M70A 1G8SA 4HTFA 2HV9A 3NTVA 2QM3A 3GJYA 2P3LA 2XVMA 3DLCA 3QV2A 5FA5A 1R8XA 2OPBA 2V7EA 3UFBA 4YUWA 4R6XA 3DMHA 3QOWA 1T43A 3OU6A 2UZ4A 5ICCA 2PJDA 4C06A 4DF3A 1EIZA 2CMHA 2O06A 3ELYA 4EK9A 5JR3A 5LSAA 3FUVA 3G2OA 2G8NA 3HEMA 3DXXA 1Q0TA 5HIJA 3MAGA 1N7JA 2ZFUA 1SUSA 3EGEA 3SGLA 4A6DA 3HVHA 2JG3A 2IFTA 3ERCA 4YV0A 2B9EA 2FHPA 1V39A 3BWCA 1RI3A 3EVCA 3HCBA 4JXJA 5CVVA 3UJ6A 2B2CA 2ZZKA 4C4AA 4FSDA 2XVAA 3T0IA 3UJ7A 5EG5A 3KQPA 3NVKI 2PSSA 5GIPE 3BWBA 3FUTA 3CBGA 4WXHA 4PYJA 2BM9A 1VIDA 3DOUA 2ZZMA 5IKMA 1XDZA 2AOTB 3FRHA 2EJTA 4RVFA 5GM1A 2ZW9A 3T7SA 1BOOA 1RJEA 2OKCA 2PLWA 2VS1A 5E9JA 1NKVA 4ER5A 2NYUA 1PRYA 3IYLW 2IDKA 2HR1A 4MQ4A 3GWZA 5K0LA 5CVEA 2I9KA 4XUDA 2PT9A 3R24A 1D2GA 4RTQA 1R18A 5E1DA 3FUUA 1L1EA 3P9KA 3SMQA 3TM5A 3UA3A 2NP6A 4OQEA 4EKIA 4POOA 3T7RA 2P3QA 3MQ2A 5BW4A 5EMLA 4DMGA 3G7UA 1B42A 2FK7A 1VQ1A 4F86A 3LKZA 1YFJA 2P7HA 3EVGA 3M6XA 1KPGA 5C1IA 3GRUA 1HNNA 5CM2Z 1JR4A 5FHRA 2IH4A 2G71A 3E8SA 5GIOE 1MJFA 1RJGA 3A25A 4KVZA 1NBHA 3DUWA 3UJCA 1NW8A 2ADMA 3B3JA 3B89A 1RI4A 1Z3CA 5HIKA 1I4WA 2OB1A 4CKBA 4YV1A 4YUXA 4E2YA 3DMFA 2IP2A 3LBFA 3PFHA 1QAMA 4FP9A 5E1BA 3KU1A 5DRTA 2G72A 5GINE 1N7IA 3O4FA 3EEOA 2UYHA 3LCVB 5KS2A 2FRXA 5KYGA 4X41A 2GA9A 3KQMA 2WA1A 5DX1A 3FTEA 1RJDA 2VDUE 1JSZA 4E33A 1YUBA 1EG2A 2FCAA 1G60A 3GU3A 3M33A 5EEHA 4GC9A 2PXCA 5KVAA 1F38A 2QYOA 3UJDA 3I9FA 4M36A 5GOZA 3HCFA 4CKCA 1Y8CA 3G88A 1NT2A 3ID6C 4QPPA 3FYCA 5F2OA 3T7TA 1G8AA 1DL5A 4KDRA 4PONA 4BY9E 2CL5A 2LD4A 2GLUA 3KR9A 3P2IA 3TR6A 4HTFB 2H11A 2ERCA 3EVZA 4V0QA 5DRYA 5T6BA 5CVDA 2P35A 3CJQA 4DM3A 2P41A 4P7JA 3R6TA 4ER7A 5HOQA 3PLAE 2QRVA 3PX2A 4MWZA 1UFKA 4R8SA 4XUCA 3RIEA 3ER8A 5B1SA 2PV0A 2AN5A 2ZWVA 3MTEA 4GOLD 2O0LA 3OFJA 2F8LA 4YUVA 1JQEA 4H0NA 3THSA 3FTFA 1L9KA 1ZGJA 3FPEA 4RYLA 2Z6QA 1WZNA 3E05A 5K0JA 4GBED 5IH3A 3KQQA 3VC2A 1BKYA 2HTEA 5LQKA 2E5WA 3O31A 3ANXA 5P8WA 3TQSA 3LGAA 2ZIEA 3BGVA 4C03A 2YUIA 2B78A 5LQCA 1VE3A 4F85A
chains in the Genus database with same CATH superfamily
2G0TA 3IR5A 4YP0A 1CEXA 1TYDE 3JVDA 1K86A 2GTHA 3X1ZA 3DT9A 1PJTA 5EEGA 3T7AA 3BE6A 5BN3A 5MN4A 5EOVA 3R0JA 4LJ9A 2EP7A 3PS9A 4EOGA 4X0EA 2O2ZA 4JP1A 1LF5A 2FUG1 2OB2A 3NBAA 4HSGA 3C7DB 2XYQA 4UCXA 5KYTA 1U0JA 4I1UA 4EHJA 1JQKA 4IDQA 1A1VA 5JYEA 3EFOB 5A02A 3U80A 3KYDB 1U9IA 2WJ6A 4ZQFA 4F96A 5K09A 4BLUA 4G0ZA 4NABA 5DT2A 3TX6A 2WMDA 1AQJA 2BTOA 3D3KA 2WY2D 2VH5R 4M1ZA 1DVRA 1G2OA 4ND6A 1Q0QA 1ULUA 5K51A 2OP0A 3IBGA 4KYTA 1UEXC 1IHOA 4YC7A 1MGPA 2YXPX 4AMBA 5BVGB 3O8BA 2B98A 4LSZA 5KTNA 5F51A 1B3BA 4GH5A 3RPEA 4FS3A 4AQDA 3L79A 4GMFA 3TLCA 3KHTA 3RIXA 1KC3A 3CG4A 3EZ2A 4WNAB 2PUCA 4DA4A 3J7TA 4ICIA 4M9RA 1YZNA 1M54A 3T06B 2PQ6A 3LDHA 2ZSKA 4H6WA 1E79A 1H5QA 1T3LA 4ZV9A 5BUQA 1GTSA 4YMHA 5NULA 1KJYA 2OCBA 1ZNYA 1Q1NA 4KGZA 2DWUA 4IQ8A 5GV7A 1TJYA 4DCTA 3SVLA 3JQDA 3KLBA 1KNQA 5COQA 4DIUA 3AHEA 3CXUA 2EFHB 3FN4A 3HWX1 5JRDS 3SS9X 1JAIA 2QZSA 2W6OA 3FSGD 5DOVA 3GFOA 1EGAA 1NLUA 2V6BA 2DKFA 3KE9A 3OQHA 2A14A 5AI5A 4XGRA 4FILA 1P7PA 1N8NA 4ZI7A 1E6WA 4BFVA 5LB2A 1AK2A 1Y8RA 3BILA 2WUVA 1A2KC 3UA4A 1B8NA 3EH2A 2BY4A 4PYMA 5GONB 4W7HA 3ENWA 4PPQA 1CLUA 1PP4A 2D5IA 4F2DA 1KZ7B 4Y6OA 3F71A 1CJKC 3QLTA 3H5AA 3R5JA 4BYMA 4QAJA 1FTSA 1CJSA 2RARA 1EBFA 3A3YA 3H9BA 4XIIA 2Q5FA 3DLPX 4QEDA 3P20A 3WGYA 3AEKA 3QZUA 5L7WA 1ACLA 1GY8A 3DDWA 5AXDA 5TGDA 1KI8A 2NU9A 2RGAA 4KPUB 1G16A 1K7EB 1PJCA 4XIJA 1FPMA 4ZXPA 4L8YA 3U4HA 2BFDA 2ZTHA 5FWXA 4PSUA 4BX8A 4EIWA 2A94A 4TXLA 1YFLA 1K92A 3WGIA 4YACA 4G24A 1OXBB 3WK9A 3N87A 3F7OA 3VKUA 2WYUA 1OFHA 3KZKA 1ZZGA 3QFCA 5J9FA 5JVDF 3QEAZ 4V3BA 2GX6A 2V9PA 1LKZA 2HIGA 4MA0A 1FS4A 2GD1O 3PITA 3I0NA 4DKXA 1OOEA 1B76A 1GZHB 1RLJA 1VZ3A 4NBTA 4AIIA 2HCRA 4H9GA 3RVJA 3UWOA 1AB6A 2V0GA 2OP1A 3ONFA 1P4AA 4M7PA 2VUTA 4AWBA 5A9SB 2FPOA 2ESRA 1T8PA 3A04A 3TBFA 5K8VA 1MVNA 1WDWB 3W9SA 5KQRA 3P9SA 5M2QA 3TS1A 3ER9A 2N1MA 2RFLA 2WJ3A 2HMYB 4YAOA 3BFKA 3RUIA 1F2VA 1X1SA 3EC7A 5G4LA 3PNMA 5KCMA 3RJ9A 1II8A 1KVRA 3B38A 2KBFA 5BNFA 4AAYA 4A8JC 1R7RA 1ZMOA 3LHFA 4XLZA 2W2MA 4Y18A 3LNTA 1QGUB 3NBQA 2O1SA 1ELOA 4L7QA 3KELA 4LXYA 3GYGA 3IIMA 1GU1A 2A84A 2VP4A 5ES4B 3DYBA 4ARCA 3DBLB 1W2WB 2D5CA 5A3SA 1PNQA 4J0QA 1MHPA 2HPHA 4RF2A 4AZTA 3V6LA 2AG8A 3CWCA 2DTEA 5K3FB 1MT3A 3PL1A 4YMSA 2WJPA 1UMDB 2DYKA 1DEHA 2IX9A 2WR8A 2PZFA 1KQGA 2VNAA 1XN4A 2ORVA 4MQ5A 1N5KA 2P5YA 4E1BA 4M7WA 1WXXA 4KWCA 2FXIA 4OLAA 3KR2A 2HF8A 2WVJA 1CRQA 1B6TA 1SCIA 2Q0XA 2NO9A 2H4WA 1TL7C 1GNLA 1W75A 3QPUA 4GS5A 3P27A 3DMYA 5FBWB 4BWFB 2WI8A 1IPFA 1JA9A 2YNMA 4C0SA 1RJWA 2CMDA 2FQ1A 3GYBA 2G5TA 4QDZA 2YN2A 4G6ZA 4DCGA 1ODCA 1SVKA 4J07A 2OD9A 3KAPA 1Y3HA 1DC6A 5DP2A 4Q9LA 2VHQA 1ZGZA 2PWZA 3PNVA 1U8AA 3LGSA 3ZXSA 5B6IA 5ECGC 3QITA 5E7JA 3KEOA 2XWSA 1IBCA 5DV9A 5HIMA 3SVZA 3AG5A 3AEXA 3QYAA 4BNMA 4CDRA 1WBDA 5EWLA 3R6WA 1MPTA 1OHHA 4PYIA 3LK7A 1L4KA 2XV1A 1H0KA 4XFJA 3SXUB 2H0RA 4RVDA 3UTCA 1GTZA 3HYRA 3VPBA 2GBIA 1YDEA 3L8YA 1ZM2A 2LDBA 5DHPA 1HX7A 1FDOA 1PCXA 1RXIA 2SNIE 3NOOA 4HB3A 4RM3A 4AKIA 1P8AA 3GEMA 2VCYA 3M9LA 2Z6UA 5DNWA 4GRIA 1Q12A 4RVHA 5L7TA 2HUNA 4QGHA 1LTKA 3V2HA 1PZEA 2A6PA 3FFWA 1DT3A 1GOTA 2OORC 1BXGA 4J1TA 4HV4A 1Q6ZA 2BKLA 1PTJA 4G8JA 3FSJX 2I2AA 4KN6A 4L51A 5IWAB 4CE6A 1GGKA 2VTDA 5CIYA 3NVMB 2J1LA 4MVJF 1CC1S 1NXOA 2Y1FA 3HDJA 2GRUA 2GD0A 1UJ5A 2PRSA 2RH4A 2WQ6A 4AJOA 2XMBA 4FC6A 2XXBA 4RFSB 2VYNA 2CZCA 3CRQA 3A1DA 4MIYA 1B8PA 1Y3FE 3R3JA 5BMVF 1S96A 3EEYA 4C6HA 2B7LA 4GPD1 3L7KA 1ESNA 1T5SA 4XX0A 2CCGA 4W9NA 4IH1A 3MJSA 5AJXA 3ZUPA 1SC1A 1CQWA 1ZHOA 3NUZA 2BKUA 2NWQA 1B26A 2DQ4A 2AQKA 3HCPA 4GDMA 1OXUA 1NASA 4E5YA 4EHAA 5BYAA 2JFOA 3ZKAA 3RTGA 3O26A 3N2LA 4KNYA 4GOOD 4ETNA 1KQOA 2C5GA 3B2QA 4FE3A 1HYEA 2BFFA 2UUOA 4D8UA 1IZYA 2H1CA 2PKWA 4MSUA 1TUGA 4JVLA 3TMYA 1PX2A 4BE7B 4AMVA 1EFRD 1JI0A 1O0SA 1QZXA 5ER6A 4HZIA 2JDIA 3Q40A 4WXRA 2FWIA 2Q6VA 2PGLA 4AMUA 4HWKA 2V6GA 2BJVA 1KJIA 3A9WA 3BGOS 1DEOA 4HI0E 1UCFA 4PIPA 3TW8B 5IC4A 3THXA 4IXMA 4B3BA 2EKLA 4XJTA 3RODA 1Z13A 2IGTA 4PZPA 4UTPA 3HU3A 5FLEX 4OHBA 3HP7A 5KTTA 3QLEA 2W00A 1S2OA 1ZINA 4GOKA 3NG1A 4DARA 3O74A 1CG6A 2IJGX 3C4JA 3LKDA 3ADOA 1BKDR 3TD2A 1YU9A 2QL7A 3V1TC 2W98A 4KSBA 2WM8A 3QY0A 4NZ9A 1T3SA 4Q4AA 2QSZA 1OLUB 2ZVJA 5C5EA 1A5ZA 1LXCA 3BCSA 2ECQA 2YWCA 3H16A 3E7WA 1QE0A 5C0OE 2OFFA 2GN4A 3R9KA 3TTYA 4AK9A 2WTAA 4YRMA 3EVAA 4FQ5A 1WX1A 1A7KA 1P1RA 4NPHA 3UQYS 1CP3A 3P9RA 1FF9A 3GLFB 4X20B 3DUFA 2FKAA 3KQLA 4JOQA 4F3NA 4TLCA 3KXKA 4FHZA 4MV5A 1ES9A 4QGGA 4ZRMA 3C5WP 3ELWA 5KX5F 3HUFA 4PCAA 4P0PB 2HCJB 5AKEA 3EQ6A 3BPSA 2FLKA 4B4VA 3OCVA 1L5MA 2FW8A 1XEXA 3R3HA 4G1EB 4XPIB 4K8OA 3T12A 1U3CA 4DCJA 5FFMA 1BW9A 5A4FS 4EEZA 4FFDA 4U7WA 3JD4A 1O57A 1CEEA 3DZCA 1DCMA 3GDWA 3MERA 2YV1A 2MR6A 4Y6QA 5I7HA 2ZRQA 4R2KA 3RAFC 4WFJA 3W1EA 5J5AA 2JLCA 4YX9A 3LQRA 3PFGA 4I6JA 3Q1LA 1AZTA 3B3GA 1TIPA 2NU9B 5EP1A 3UAWA 5DBFA 2ANCA 4Y2GA 2CHVA 3WX0A 5KTKA 4IXWA 4PYNA 2FDRA 2HGZA 3GJZA 1EZZA 3ND7A 4NULA 2CLLB 4I55A 4ZDKA 2P2LA 4X1YB 4B2PA 1KE2A 2FSGA 2VL7A 3HJCA 1DBWA 2Q3JA 1BEEA 3KAKA 4EB0A 1U81A 5SZIA 2I2FA 4II7A 3V2GA 2G08A 2R4TA 5IN5A 2W5UA 5FUBA 4C2TA 3T94A 2Z2JA 4JLNA 1O4WA 2OGWA 2BEWA 1IFXA 4C3OB 4AXBA 4RNDB 4R2MA 4CQMB 1RYNA 3QIAA 4XOUA 5TPZD 3ENZA 4FFPA 1AIPA 1FSSA 2P40A 2GEVA 1NLFA 4PS1A 3TNFA 1G8FA 4AMYA 4ER3A 1QGUA 4XE5A 1KEZA 5E9QA 3W90A 2JK0A 4BV9A 1KH1A 3PDJA 2BZ0A 1CRZA 4PHFA 2O48X 1GD1O 4NS1A 2VXOA 3INTA 1NW3A 2AZ4A 2PX8A 4H3VA 3W06A 4ZN6A 3BK1A 4XA8A 1TE2A 3TOVA 4O3MA 2VJCA 3GLHB 1X1BA 2B2XA 3ETHA 1JR2A 3OIVA 1X14A 1ONBA 2JFPA 1ORVA 1SZDA 4U9IS 2PFGA 5FOXA 5IVDA 4EJ0A 3UHJA 5CT9A 4G97A 5IC6A 1PO7A 4NNOA 4BV3A 1DC7A 1EK1A 1MABB 1Q2XA 1USIA 3UCXA 2IDJA 4E2FA 2HLDD 4JGGA 1UXIA 3PDIB 4MRSA 3E70C 1ML4A 1N0WA 2ONKA 2OVFA 2VF5X 1E2EA 3KHSA 2C3MA 2XEDA 3DLCA 5J59A 2MINB 4ROSA 4P98A 1J8VA 1QH1B 2OPBA 3JQGB 3R8XA 4ZOAA 4YUWA 3RK1A 4YDSA 4C43A 1EJ2A 2PZEA 2GR9A 3BTVA 4GNKA 4JI5B 2OAEA 4S1PA 1G2IA 1OU4A 2VNHA 3FPCA 2GPWA 3DE3X 3LX4A 4QM6A 3JQ7B 4F06A 3VDRA 3G2OA 3DXXA 3T9EA 5LZ9A 4ZCLA 1D0VA 4ND8B 4RGYA 3AEUB 4A6DA 1Z68A 2ZPUA 3HVHA 1TAQA 3GPLA 1GZDA 4YP5A 4MKFA 2CDNA 1S2DA 4UDYX 3UJ6A 3GFFA 2XTJA 1NUPA 2HHJA 3IKJA 2JIZA 4TVBA 5JQGA 4B3GA 5A7FA 1NF3A 2WF9A 3PP8A 3BWBA 1GT6A 1AC5A 1OX4B 3IULA 3B13B 2IYWA 1VJTA 2WBLC 3JQAD 2V3VA 1I5RA 3ZGNA 4B6SA 1XA4A 2BOVA 4XWOA 1FRNA 3DYVA 3MHTA 4AVYA 5D3MB 2Z09A 3OPYB 1KYTA 2FZCA 2VJDA 2VS1A 2H2GA 4A23A 1ST3A 2AG1A 2GZ3A 5TMBA 5CDUA 5EJEA 3OM8A 3OQIB 1KZGB 2BTEA 1RQ2A 2PN1A 1Z26A 4X24A 3IT2A 4NCBA 1Z4OA 3SIWA 5SZJA 2VF7A 2ZITA 5CB4A 1CF2O 3FDJA 4ZYVA 4MVXA 4OU4A 1P3JA 4QRIA 2Q7DA 3F2VA 3IODA 4IAOA 4UU0A 5EMLA 4U6QA 5THKA 1P1IA 2I7DA 1JA0A 5G0WA 3N53A 3RSQA 4QXAA 3H0EA 3ZNQA 1XK6A 2AMYA 1LZLA 4LVNA 1RSZA 3DDOA 3EDRA 4JZKA 1QMPA 4O2BB 4Q01A 4IDOA 3PUHA 4RLHA 4GM0A 4TKVA 5GIOE 1ZESA 3A4VA 1QX3A 2ZWPA 3EGXB 3I6YA 3KWJA 4G09A 5EL0A 4J0GA 4FYKA 4BP8A 2OCKA 2WD8A 1TTHA 4ZGBA 5BQFA 2XWPA 5D3KA 5KNBD 1I94B 1G8PA 4F1WA 3DDCA 5HQTA 3DBLA 4FN4A 3IPRA 1JEAA 5KQPA 4RWEA 4Z6KA 3V4FA 4XWTA 2PT5A 1CXZA 3KVVA 3F0TA 2W93A 1BA3A 4DLKA 5AVQA 1E9SA 1H2AS 1VA5A 1LQTA 3C2QA 5KBYA 3BFXA 5LLTA 4LRYA 3U4QB 5FI3A 1R66A 3RVNA 4DMLA 1RWQA 3EEFA 3GCDA 1XPUA 5F33A 3MXOA 5ARDA 4PTYA 1YUBA 2IHVA 4HNAB 3UT0A 2CW5A 4K1LA 1CZNA 4KQGA 1JQJC 2FW7A 1G0OA 2GXSA 2OGZA 2IY7A 2OFPA 4RS4A 4B7ZA 2ECPA 3IRUA 4JX8A 3ZE0B 3HCFA 5EXSA 3F6SA 1OILA 3FNGA 3ID6C 4NCIA 2H1WA 5HF8A 1QF6A 5E7QA 2CXSA 3SLRA 4PONA 1ZLYA 1GUYA 1PHPA 3PQCA 5J23A 1GDTA 4AUEA 2LW7A 2AR9A 4DLZA 1YBFA 2COUA 5TE9A 3K09C 4ER7A 4RH0A 5DBOA 2CNLA 4LISA 2WF6A 3O83A 3L2OB 2YHIA 3GPCA 1SCJA 4CKWA 4CU2A 3P4YA 3DFIA 5DTJA 4YRJA 1AKYA 1K2WA 2EGHA 1BMQA 3I73A 3Q2IA 1IB0A 1KF0A 4HPJB 1JQEA 3F2IA 3R7BA 3MELA 4EA8A 3MWEA 3MJRA 3O38A 3T3HA 2Z6QA 1L7AA 2PD3A 5CLHA 5F1PA 5J3JA 3VDXA 2BE7A 4MQFB 3RYHB 5KQLA 3ROEA 1Q1GA 2A4KA 5D86A 2ID8A 3CX8A 3EQ7A 3G1WA 1ZLXA 5DXFA 1EDEA 1ONSA 4F85A 5LDGA 3I4FA 3DVLA 5E95A 5D51S 5TJ9A 4NH4A 2QAJA 5MFZA 3WYCA 2C2OA 3T3MB 1M83A 2VDWB 4ASUD 4RGVA 4EW2A 2B4QA 3VR6H 1CFJA 3EZ6A 4I4LA 2E2WA 4IX1A 1PN3A 1T9GS 5P21A 4G5SA 4K9DA 4PGFA 2Q1TA 4J9UE 4V2IA 4LJSA 4EMUA 1TQ2A 1KPIA 1RJFA 3OFVA 4G67A 1Q7RA 1E3DA 3UV6A 2O20A 3SIXA 5IKEA 1N8TA 4KPEC 2QRGA 4PIVA 5K3OA 1PT6A 1UPTA 2MSCB 1KXZA 2UUPA 3W6PA 2QVXX 3IV9A 4K28A 3WOHA 3S81A 3I9V1 3BD7A 5K8IA 5SYNA 3CNOA 2CK3A 3CMCO 2PUGA 2CKMA 4KRGA 4HWSA 2FG7C 3NDBB 1XCOA 4LN1A 2F8SA 4KFCA 1AX9A 2WABA 1EIWA 2AH5A 4EGAA 1GGHA 1W88A 2GM5A 1W9MA 3LLMA 4TL7A 4TKZA 3R5HA 3NVAA 2H5EA 4M8LA 1EHIA 3WMGA 5DM60 1T26A 3FPJA 3HDQA 4DEYA 2IRWA 4W5HA 4B74A 4J0JA 2NXEA 3SQDA 3DPSA 4FGWA 1TZJA 1ULAA 4ZVKA 3PJDA 1P33A 3GT3A 4U7DA 1YE8A 3OZWA 3ZBQA 3CWZA 3CZRA 4YAGA 1UDBA 4ZKDA 2R0QC 1JHVA 4FHGA 4DCSA 4H7EA 3RUHA 4ONEA 1SU4A 3ZU3A 1HFWA 2JCXA 3ZY3A 3AESB 3EZ7A 3KYIB 2ZIAA 2FWJA 2YHSA 1QGDA 2ZT5A 4KTTE 4KQMA 5BWMA 1QHSA 2A0KA 3QEOA 4MPTA 1IM5A 4M0KA 3T61A 1ZZEA 5DFAA 4ECEA 5CH8A 1NHGA 3PFWO 1K98A 4MINA 4LDPA 4RD3A 4RTLA 5TVGA 1QGAA 1QS0B 2R3SA 4C2BA 2ZM5A 3FTQA 1ZI8A 3MJDA 4EA7A 4O0LA 4A5SA 5EUBA 3GMTA 2EZUA 3N8GA 4BMCA 4QOGA 2AN3A 1FTWA 2EARA 4AYTA 2VDMB 3AFHA 5B7PA 3RRMA 1WPRA 1GNRA 3SC2B 2M1ZA 1XROA 4LOAA 3VPXA 1U63A 3R7AA 3VOBA 2CHFA 2IXEA 2PQMA 1LFDB 3FBTA 3OSZA 1RYFA 2GF9A 2LV8A 2Y71A 2ZIFA 4MWSA 3H6GA 3L07A 4WKPA 2GPTA 5SYMA 4EB3A 4HRVA 4DDUA 2VNKA 3QXSA 4AM8A 4GWGA 3VPGA 5T64A 3ZY6A 1G3MA 2FLWA 3ZU5A 4QTYA 4ESVA 2W2LA 2Y1WA 3KOZA 4EI7A 1V8PA 2ORYA 1SCUA 1DSSG 2K4MA 4LJAA 3U6BA 2HCBA 3F3KA 1R4NB 5DGXA 4F7WA 4YRGA 2W8BB 3PJEA 3U4DA 4HJXA 2GXUA 1C81A 3DWGA 5ELLA 4P58A 2C82A 3PNYA 4EUNA 4EZEA 2F59A 3JQBA 1MEEA 4KWHA 4G1MB 2QTHA 2OHVA 1RRVA 2NAFA 4YCNA 2I4TA 2WD7A 4LQDA 1NMQA 4ID3A 4TGLA 3VR2A 1ZD9A 5E1OA 5KYYA 4G4SP 1VP3A 2PD6A 3ZZMA 4NDZA 4QXRA 1U3UA 3LXRA 4QVGA 3WZ2A 2EWMA 3QW2A 5CFZA 2X4IA 4GZMA 4HQ6A 4O2BA 5FJJA 3RC1A 4G23A 5EZ6B 4GXRA 2IKQA 1IOZA 5JZVA 4QG7A 1RI1A 2CNWA 4NATA 5IBCA 1GNTA 3KB8A 4U2FA 4CMAA 4LGVA 3URKA 5A5DA 1O5TA 3WK4A 3GEHA 5FOTA 1H85A 1NYRA 2RK4A 2A5DA 1DKLA 4G89A 4ZVUA 1CUHA 5JCJD 3SWWA 1H3NA 2FSVC 2D2FA 4I8DA 1QDLB 4N54A 4P4TA 2QAGA 4LK3A 3ZE7A 4Q6BA 2W2LD 1JECA 2HX1A 1MC1A 4F5EA 4AMGA 1OLXB 3N0VA 2VJOA 1AK9A 5BY2A 3AUYA 3OIGA 3O1LA 1G3QA 2E4ZA 5HP4A 8LDHA 1A7AA 1YO6A 2WM3A 2HSEA 2X5XA 3LCCA 2CVHA 1CUUA 2DFNA 1IZ7A 1X1RA 1YC5A 4MZXA 5EVCA 5FULA 5G02A 1BWQA 1TLTA 3O94A 4EY4A 1FUYB 2AMLA 5J1TB 3ZJ5A 2PWYA 5T41A 5IG2A 2OXRA 1FYDA 1USKA 2HRRA 1CB7A 2PEZA 5AO9A 2QTZA 1VYUA 1WNTA 1LA2A 2WNHA 3FM9A 3OWOA 1R8YA 1KP2A 3RC9A 1TA0A 1P9NA 4EQZA 1YF3A 4H7DA 4UUPA 2IELA 5ETJA 2GT1A 2Q3BA 3C6YA 3C70A 7MDHA 1OV4A 4WTOA 3W3ZB 1OKKD 1XD2A 2HIMA 4ECAA 1R4AA 2GZAA 3FPBA 2G0NA 5LJLA 3EIUA 3GP3A 1EVIA 1G8KA 2BHRA 3CR7A 2PM8A 5AKXA 5F3RA 2AN9A 1EUDB 3NTQA 1JHYA 4EPTA 5KTSA 1RBYA 1RWMA 3A6LA 5FT9A 2DERA 4A82A 1YQDA 2YY7A 3LPMA 3G89A 3GQBA 2W6CX 2CD7A 5KNCH 5EJMA 4G8DA 1X74A 2BW0A 2QTBA 3D0OA 5GGYA 3OO0A 4PRYA 1WXEA 2WB4A 2XRMA 4MVJM 1P8JA 4OJMX 1H9BA 5JAQA 1L1FA 4WFQA 3T5CA 5KPJA 4MKIA 3IP1A 3QPCA 3U7QB 3NT2A 5FIUA 4ITUA 5T4EA 5CB4B 1J0CA 4JJ8A 4HD8A 1OLSB 1U8TA 3N74A 2P9EA 1TM2A 2WU8A 1JVBA 1QVZA 2P11A 2X19A 2H2AA 4TXHA 5G2OA 4DMMA 2BDEA 1QFJA 4MR9A 1U0OC 1JGTA 1UJ6A 2NUTB 4WUTA 1AKRA 4D26A 1B15A 1NONA 5J4YA 2ZE8A 4NTZA 4WUVA 4C76A 4Z0HO 1MFZA 2XKKA 4CTMA 2FRVA 3IQIX 4R2JA 1DX6A 1T3HA 2RKBA 3E2PA 4I5EA 4BXOA 1XB2A 4YJ2A 3HH8A 2O54A 3E2MA 4LF5B 1P1CA 2VPYA 2BWJA 4IHJA 3C3EA 3FMVA 3PT9A 1KO4A 4PHTA 3DVAA 3FVWA 4J1SA 4TMXA 3PQ8A 1WMAA 2IEGA 1DOHA 1G42A 2J9FB 4NFLA 4WJKB 1UZMA 3VR4D 2VAPA 3BF7A 4FKMA 3PCTA 1ZIDA 3LTNC 1X42A 4AFNA 3AESA 1ENYA 3Q72A 4F3KA 1IB6A 1F1BA 1RKXA 2X23A 3H83A 2WAAA 2ZT7A 4HATA 1XQ9A 3QVLA 1XZMA 2BI8A 1SCDA 2I33A 3CX4A 2HREA 3NWEA 4INPA 4QOSA 3L8EA 1ZUNA 1PR6A 4MMXB 1AS3A 4RSRA 4UUNA 3ER6A 5J58A 3OZBA 4PO8A 5CX4A 1PV4A 1PL6A 3PDHA 1YRYE 2EW2A 2QLTA 2CYAA 2XUPA 3G49A 5LMZA 3U44A 2H4JA 5L6LB 4MYUA 3WMWA 4YXFA 3VZCA 1RKQA 8OHMA 3IVXA 2Q8QA 2PY6A 5GPBA 4TVKA 2ZXFA 3TLXA 1JU9A 3SJZA 3QWHA 4R1UA 3ZGZA 2C4TA 1W85A 3LECA 3RC3A 221PA 3QBVA 5BPHA 1QHHA 3GRRA 2FAXA 3MMPA 1CUIA 1FDIA 5C3UA 1M1YE 1GTMA 3MD9A 3B3FA 1VCNA 3HU1A 1JIQA 2GHRA 5ADUS 3HWSA 4QC2A 4TQAA 3BT7A 4L4RA 3C0KA 1SU6A 1UK7A 2RSLA 4JUAA 4M1TA 4L4UA 3SZOA 4HX9A 3A2LA 4KXVA 2Q07A 3W5JA 3QPBA 1CIVA 1TO1E 5IT5A 4TM7A 3USCS 2WWVD 2Y76A 2L82A 3B8HA 3RS7A 5L4SA 4IGIA 3KQWA 4MJLA 1TVCA 4TT8A 3LRTA 2L17A 1H8EA 4JEUA 5DGHA 1JQLB 4ZV7A 1KZ6A 4I7EA 1EXMA 3DFKA 3HN6A 3TPCA 1WPQA 4Z3OA 3NLLA 3TVDA 4AZSA 1HDZA 2CMGA 2YWGA 2B5VA 3ZQJA 3OCCA 3O3CA 3INRA 1G55A 4XB6B 4IEFB 2DTXA 3I12A 1LNSA 5LZ5A 3F3MA 2Q29A 5LNK6 1UWVA 1J8FA 3U0VA 4EUFA 3EAQA 5K2MA 4DA8A 4YXWD 1E3SA 2HYDA 3FCXA 1UBOS 1VYTA 3P2MA 3BKWA 1ECBA 2QJFA 3JS5A 1IL0A 2BFNA 3PD1A 4IJWA 3K53A 4L8LA 4IHKA 1IJEA 1E2GA 1MB3A 5JJLA 4HLNA 5IWCA 3ZOKA 1QHXA 1BDHA 1HEUA 1KYQA 1P91A 4YIKA 3M1AA 4NMMA 4QQ8A 2GKOA 4RK4A 4EGFA 4CCWA 2B2NA 1P2FA 2VHCA 3DMTA 1QHNA 1XZJA 4TSRA 4N6NA 4M0UA 3S8MA 2NPFA 5B64A 1W44A 1F4VA 4F2HA 2JHAA 4QLBA 4GOND 3AI3A 3KNZA 3EX7C 2X9QA 3IOBA 1HGXA 3MJHA 1NVBA 2HEGA 4FHEA 1VL6A 2P2NA 4BN0A 3CJRA 4LJ4A 4B3RB 4V24A 3ADBA 4K2HA 4DILA 2NNWB 5E6RB 1RYDA 4X61A 4D43A 1G41A 3H2KA 4OBBA 5A7GA 1FLAA 1R6AA 1PT9A 4FR2A 4URFA 2YJZA 3IO3A 4EVRA 1TQHA 3ZU4A 4P86A 4IXTA 3QHPA 4EUKA 4JP5A 4QZVA 1QFZA 2XVMA 4UBJA 1L5OA 4LJKA 3NBYC 4QU8A 4Y2TA 1LBSA 3KJQA 4E09A 4F5DA 4F2WA 2ZRDA 5C8ZA 2O1WA 2HJSA 1LJ8A 1SBYA 1RWWA 1T9DA 4F8JA 4IDDA 2QUIA 3TOCA 1G8YA 2RIPA 3DVQX 1WPXA 3VR6D 3QG1A 4ZVMA 3VHXA 1EIZA 2J6CA 2JAQA 3HBMA 3OQ1A 3QKRA 5IAEA 3RRYA 1EUCA 4HS4A 1TKCA 1IZ0A 4NENA 1QIFA 3SGLA 4WZAE 1RLMA 1SVLA 2R44A 2BFPA 3V7WA 5KWEA 1N77A 3NEAA 2C0CA 4MUFA 4H6PA 3BRWA 1KI6A 1E5XA 1QP0A 3NEJA 2JANA 4KIJA 4MHSA 1CQPA 5FWXB 1CE8B 4ZHQB 4TTRA 4R71A 1MQSA 3KQPA 5BYJA 3GFBA 4CBVA 5TLSA 3W5CA 3U7GA 5KC9A 2Z9DA 4UM9D 1Q84A 1JR3E 4IMJB 4TLMB 3BWXA 4LGCA 3AEQB 4OLHA 4EHFA 4FGSA 5IKMA 2HRZA 4BFCA 2ZU0C 3BA1A 3O93A 1MH1A 3RYIA 4ARVA 4Y1FA 4RCVA 4DT1A 3U3JA 1PJ2A 5AUQA 2G67A 3ISJA 5AK5A 2AV6A 3NNNA 1XLTA 3K0CA 3UA3A 2OC4A 2P1ZA 3SMQA 3TRHA 4RFSA 1QTQA 4MS4A 1HKHA 4DSUA 5JHGB 1ISMA 1SC3A 2J0EA 4NF2A 2UKDA 2ZRBA 4AJPA 1JG6A 1NP7A 1VLHA 3AHIA 4ID9A 4W5RA 3CH4B 3IR6A 3D5EA 3K92A 3IQEA 5CM2Z 5KUTA 4N12A 1HDOA 4Y6SA 2ZB2A 1UBTS 2B8NA 2V55B 1TUEA 3UJCA 4XWKA 1VG8A 3ZWAA 621PA 2Q4DA 4PFJA 4RK5A 4EGJA 5ED4A 2QK4A 4FJ0A 3Q7SA 1EE1A 13PKA 1K3TA 2IP2A 4P22A 3E9CA 4X1KB 3H6HA 3PFHA 1Q19A 1YAHA 2ALJA 3B1WA 3MYYA 4OI4A 1FRVA 2HN9A 5E1BA 5CA0F 1TX4B 2PIAA 1OFVA 3CUSA 2O5EA 1BCRB 3O4FA 2VH1A 4M60A 5FLXA 3NAZA 3CZ4A 1U0NA 4K6CA 4PZYA 1KVUA 3COZA 4AF7A 2VRCD 1PFWA 3TVYA 3VR4H 1MDBA 1E4OA 1FNNA 3M49A 1KOLA 4HN9A 1ZAYA 3ICEA 3R0XA 3AVWA 5EEHA 3R7LA 2ZE5A 1ZUNB 2OBNA 3UJDA 2PAFA 4MI6A 2CVZA 2JIOA 4ND1A 3RAEC 3ZZNA 3NRCA 2P9YA 3N86A 5EXPA 1L2TA 1PX0A 2V7BA 1XWIA 5KSYA 4R83A 3CEMA 1WULS 5CIWA 5D7NA 3VYVA 1RC8A 2GLUA 2YWHA 3NGXA 4GFDA 4KOAA 1N9KA 2LRHA 3UMMA 3ECCA 1SIUA 3NZEA 1SIWA 1GLNA 2XA9A 1XLUA 1RCFA 2XKBA 1BZYA 3ABZA 3V00A 3TZ6A 1QVWA 4F4IA 2PV0A 4RXUA 1X7DA 1KYVA 3FZEA 3Q2KA 1BCSA 3V8NA 4XQEA 2LTAA 1XE3A 3O2NA 5KYWB 3MT9A 1UKCA 2IYQA 2QN1A 5AOCA 3OA2A 3USES 1QRDA 5C18A 4I55F 3KT3A 1QC5A 4MEJA 4Q9JA 2IWRA 2IP4A 5G0VA 4KR3A 3ZWOA 2RC6A 1KI1A 2P90A 4XX0B 5IH7A 1J7JA 1XRJA 3CNLA 4BHTA 2GB4A 1WXDA 2IYAA 1ADBA 2YFHA 3LKVA 3T7JA 1E63A 1ESDA 3DR5A 5LP6A 3MINA 1WW3A 1THZA 3IJEB 3HR7A 2R68A 3A7EA 2JVKA 2JIDA 4O25A 4YP6A 4V0OA 4DNXA 2F1IA 4UATA 4WJZA 5FBLB 2IZ0A 4YH1A 4O4JA 3ZHCA 4DUZB 5INTA 1YA4A 1S1MA 1I4LD 2H5LA 1RQLA 2NZVG 3G2MA 3GQBB 1J00A 3QOFA 3TZHA 5DN6D 3CA8A 1I8TA 5LD2B 3PUJA 4H77A 4JBWA 4R2LA 5ARCA 3WGMA 4UFNA 1GHTA 1H5NA 3T38A 5DM70 5K6AC 3ZJUA 1U7XA 2GI4A 3O8DA 4NAHA 2ZWIA 3EA5A 4UNRA 2NO4A 1ZI9A 2OUKA 4FDLA 2ZJ2A 4IRXA 3RUDA 3IURA 1UQTA 5E7MA 1F17A 1L8XA 1QQTA 3DWIA 2ZQYA 3GUVA 1VLQA 4KEAA 4XKJA 1XQ1A 4DBLC 3IRVA 4NMLA 2DPYA 2IPMA 1RXWA 2G36A 3O8OB 3I6MA 5FYQA 2EJUA 3MCZA 1HFEL 1U7DA 4ZZIA 4DMUB 5JCZA 1ZVKA 4BFTA 1Q1AA 5IBPA 2B4RO 3ZY5A 4CI9A 1IC6A 1NI5A 4K9PA 5K0FA 1HT1E 5LP6C 3O03A 2P8JA 1E9BA 2VQEB 2CNKA 1TF7A 4PAOA 3TD9A 2O7NA 4HDNB 5E4JA 5JCOA 1DIAA 3LT1A 4TKUB 5J4KA 3H1AA 5FEMA 3Q3GE 1FSZA 2GBLA 3H17A 2FCRA 3EDOA 4WCDA 4A0QA 4E5KA 1EFAA 5ALPA 1JHXA 1IDN1 4S04A 4Q1EA 2V8OA 3SHTA 5FPKA 3DG9A 4WNYA 5IU6A 1E64A 3KWMA 3B5EA 5FH9A 3GLHA 2DSTA 3MSCA 4UZFA 5ALFA 3HEAA 4B2LA 1ZM9A 4JFRA 3W5HA 4P3NA 3B6MA 4HO1X 3AIIA 3AETB 3CPHA 3UMRA 1QIHA 1UDWA 2MWMA 4E3ZA 3QI2A 4S1WA 2VUSA 4DTCA 1JHZA 3LX8A 3OFND 1NBIA 4CIXA 1FRQA 3COWA 3HO8A 4P4LA 4PAQA 9GPBA 2MR5A 1E0JA 1GZVA 1RT9A 1TK3A 3DHVA 3HO1A 5I8WA 3AF0A 3AW8A 4EM6A 2G1KA 4E31A 1CUXA 1P0FA 5LQSA 4JJGA 1YS9A 3RRNA 3TGLA 3ZD9A 1ODLA 4N82A 2P9BA 3KTAB 4X71A 3FKSD 1JWBB 1CR2A 4DVJA 5JPCA 4ZOBA 4JASB 4M3NA 2XQVA 3IKMB 4LYGA 4DANA 3B9RA 2GETA 1BS9A 1K06A 2QRNA 4J1TC 3ZE2B 1PSDA 5B1HA 2Y8EA 1A8QA 5CLIA 1VB5A 4HKTA 4P84A 3ZK7A 1ZL0A 4BFXA 5JXHA 3D2LA 2Q4BA 1KWGA 4UTZA 3KJNA 1FDSA 1PNOA 3KZXA 4ZTZB 2O2XA 2OAGA 3TTXA 3KSUA 4DR5B 3BYZA 5AHWA 3P7MA 2LBPA 3OLYA 4ZVPA 2O2DA 4AJEA 1LB1B 3CRVA 4LC9A 4AKSA 2V7WA 4ZGWA 2C2GA 4YXWA 1UJNA 4GF5A 5K7SA 1RFLA 3NTUA 4FD3A 3HY3A 3G0GA 3BIXA 4AX8A 1Z36A 2Z3WA 1HYHA 3KPWA 2ZSHA 3QYFA 4URVR 1XWFA 2F48A 2OV4A 2FQYA 3AF2A 4UPDA 5LOVA 3DYIA 4GR4A 5ALZA 1VE1A 4Y6PA 3ONEA 1FMJA 3PXDA 2EBWA 1XNQB 2AG6A 4RBNA 2J08A 4BMVA 2JL1A 4ZEXA 3I5UA 3QFSA 5AQ1A 4GIBA 3TFWA 2IV7A 1DBIA 4UBNA 1M8FA 2OM2A 3C3MA 3O95A 4I1OA 2HA7A 3IEKA 3H0KA 2QAIA 2VK2A 3SBOA 1BJRE 3S40A 1DUSA 4X1IB 5CLGA 1FVHA 3TLBA 2QMHA 3H9UA 1TUBB 1J6UA 1G7TA 4MW5A 4YBRA 1BA2A 4TZKA 2PAAA 1JLSA 1ZSVA 3BMCA 3IPLA 1QH0A 1TYCA 1E3IA 1ZNZA 1U0BB 1GXSB 1XTSA 1M2HA 4WJLA 4PU0A 2REQB 4Q39A 3JQEA 3R6LA 4P82A 3GROA 3N3BC 5KCZA 2R8OA 3FUXA 1K63A 3KJZA 2XIJA 2ZOSA 3HCCA 1NZFA 1Z0IA 3C3KA 2VHZA 2IBSA 2APJA 1YQQA 2CNOA 3BGIA 4KX3A 2ZJ3A 2YJ4A 4MVJD 3JALA 1PLJA 3GF4A 3HJNA 3ANLA 4DLRA 4UBOA 1HT2E 5JUWA 4IIFA 3ENQA 2NPIA 4BJ3A 4E13A 3EPKA 4YCLA 5L6MB 2FW1A 1MB0A 2F3QA 3QMVA 1PR2A 5TQ0A 2JGDB 4KLAA 1NM5C 4B9EA 3FR8A 1G1MA 2GLTA 3UY4A 3I3SR 1NFFA 1F0NA 2RGEA 3P94A 2B36A 3FAZA 1IY1A 4TL6A 3RVDA 5G40A 4DJTA 1YONA 1VRWA 1XQVA 2DPGA 3E5NA 2GBFA 3GLSA 2QUZA 4UVDA 3RIGA 4MYRA 4HUJA 2I6GA 3WWCA 2GVZC 1TCCA 3IJ5A 1LDGA 3IXQA 5K2OA 2MIIA 5EMNA 1I3KA 1KEVA 1T91A 4C0XA 3PUZA 1PLLA 3ZQ6A 1EMDA 3LPNA 4QGAA 5I7SA 2FETA 1QO0A 4E32A 3C74A 1NUHA 1VMEA 3ITEA 1U9IC 2FZKA 1G8GA 1MG0A 5BN4B 1QH8A 5M04A 2MSDB 3IUNA 1B73A 1VJ1A 1KJQA 4P80A 1VG1A 3I62A 2V59A 4HDOB 1WMEA 2R25B 2UXBB 3T3IA 1YR9A 3WWPA 3K0FB 3QUBA 1DKQA 2WV9A 3IXMA 1S2MA 3GFGA 3V8BA 5AVOA 4L02A 1D8TA 3A26A 1NG1A 4KGVA 2ECOA 1D0IA 1TKBA 3QM1A 1T2EA 3N8NA 1JB1A 4JQSA 1AXRA 1MBZA 2NO1A 4WBNA 5HSGA 2D1RA 1GAXA 3VSBA 3CRZA 3ND8A 2DHDA 2IF2A 3WBKA 3JQFA 3HGQA 4L28A 2IS6A 2YIVX 1ZH8A 1OXTA 4OH1A 1X1AA 2E4AA 2H59A 2C54A 5FAKA 3SICE 1VDZA 2R8RA 4PCUA 3LS2A 5DIZA 3TRFA 2PL9A 3JVUA 1A9TA 4LRTB 2UZ3A 4OK5A 3D02A 2AEEA 3WGNA 4OHRA 4Q12A 3GJ8A 1SQFA 4IS2A 3ZDRA 3AR6A 3QA3E 5JSUA 5L3SB 1PR0A 2K2QB 1EJ0A 5KNBH 3AFOA 3NV9A 3QLVA 1P2UA 4KU4A 4TYPA 4TKUA 1E9RA 1JEQA 1G7SA 4QQKA 5AUNB 1N9GB 2BF4A 3QELB 3OIDA 3PHHA 2EQ5A 5FHQA 5C7IO 2R6JA 1UDXA 3N5CA 2EQBA 5IUNC 2AZDA 4OMCA 1XPRA 5EQFA 3EGOA 5EWJA 6REQA 2ZKIA 4U2KA 2AC7A 3EW7A 3WQSB 3FLAA 2XOXA 2E5FA 2XE4A 3A36A 2HK8A 3ZXYA 3ZCQA 3OE4A 4CM8B 2J3MA 3SSMA 3PD7A 4Q4CA 1ZVMA 1M2VB 4NZPA 1XKLA 4A1FA 1NHWA 1PJZA 2FWPA 4AUNA 2JD1A 1YRBA 5G4KB 4CV3A 2AVNA 2ZDHA 1UPFA 4XDGA 2C98A 3BD6A 4PPGA 1QYDA 2Q3DA 2H4HA 2FKNA 1YB4A 1PZXA 3TOZA 1QV9A 3NONA 3WLSA 4DA9A 2BGWA 4R0VA 2H9IA 4I2VA 4UTNA 4MI9A 3GEGA 4OSOA 1SUDA 1W52X 2JBAA 1R1DA 2PZBA 1BDBA 4ZAZA 3I0ZA 3AETA 3EHEA 2PO5A 1V16A 3IH5A 3SAJA 5I7WA 4MUBA 4FB4A 1W2GA 3BMXA 2Z3VA 2ETVA 4ETWA 5A62A 1AHPA 4ILEA 3WB1A 3I53A 2YUTA 1K8XB 4PQYA 2IZ1A 2TMKA 2ATIA 3WGQA 3I8XA 5HYVA 1WAMA 3HFJA 1XQXA 4BVBA 5JBIA 1DC4A 4FQ8A 4WADA 5BXYA 5EXXA 4B75A 2D7DA 4LNUB 2BZSA 1I3MA 1Y9JA 1US8B 2Q9CA 1P4JA 4KO2S 3B5IA 4LKRA 3WE7A 4GYJA 1YZ3A 3LDAA 1IHYA 4G86A 4RVUA 2P6RA 2G4VA 2FJ0A 4NV3A 2ZI4A 4YV2A 2AUTA 1OH5A 5T6MA 1MCZA 1Z37A 2GRAA 3COPA 1QO9A 2BD0A 3OFKA 1C2TA 4H0CA 3R0ZA 1JSCA 1ZK3A 3GUZA 4MR8A 5HRCA 4K03A 1GPWB 1RWBA 3LFHA 1PQYA 1P2GA 1SG0A 1QMGA 2C7VA 2ZUCA 1M75A 3U4QA 1NQVA 2SHKA 1XMSA 2JD0A 4WBNB 1FBNA 4CF3A 4NYJR 4X62B 4MW6A 5FEUA 3BWYA 4ENUA 4L85A 3T5TA 1R9NA 3FVVA 2DT8A 3CKLA 1TW3A 4QOIA 4WFKA 3L01A 4RJKA 2JFZA 4N03A 2QL6A 1F60A 3NJ8A 1JX6A 1L5RA 1WB5A 3HV0A 2DFKB 1DXOA 5T5QA 1H8ED 2Y67A 3L8ZA 4H1TA 1WDTA 5LA6F 1OBOA 1W5FA 1E5VA 1VCMA 2H63A 1P1FA 4EHBA 5I01A 2VC2B 3CZMA 2RONA 2AT1A 1J97A 3JVEA 3QU7A 1LEHA 4Y9SA 3UT6A 5CYPA 2PUEA 1OKKA 4Q3NA 3RHTA 4LFBB 4ND5A 4JBHA 2ZI9A 2ISSD 1QQ7A 2V45A 1NVWQ 4YJ3A 5B6JA 5HUQA 1ZU5A 2ZE7A 1Z0KA 3CURA 4Z4CA 4ZVOA 3TXXA 3O92A 3PNBA 4Z7OB 4ND4A 4R31A 4Z49A 4EMBA 2H0QA 2QTWB 3PRKE 4L08A 3K31A 3MAGA 4UE6A 1V3UA 5A3RA 5ADHA 3V3KA 1XVIA 4RETA 1P6XA 5FXMA 5DYNA 4BCBA 4JT9A 3RS9A 4WZ6A 5AESA 3DLTA 5CVVA 2YC4C 1KBOA 5AI6A 2BPOA 2ZZKA 3H42B 5F77A 4CG3A 2QORA 2SKCA 2YWEA 4DV6B 2AX3A 3QE4A 1F0YA 3IVMA 3OPXA 3K9GA 4PHHA 2P6MA 1U5AA 4DR2B 1ZUD1 3AR4A 2GCOA 2XGMA 1KGDA 3BH7A 1PJBA 1PT5A 2H54A 4UHCA 1TU4A 3KXPA 2F90A 5F7XA 1FP4B 4F3TA 2OAP1 2ZGVA 4YRZA 4M9ZA 1GPJA 5GZ6A 4EZIA 1NKVA 3KQUA 2NYUA 1JSLA 1E7SA 5MDHA 2VPIA 4OHOA 1CJBA 1ZJJA 5L4LA 3GEIA 3O8QA 1GVHA 4IQFA 4MQ4A 5F78A 2LR0A 3AO0B 3C3DA 1R18A 1UOPA 5AOBA 2NP6A 1LZKA 4MZDA 2PX6A 1VA4A 4S1TA 3WLTA 2O9JA 4CRWB 4H4DA 4RA6B 1RPTA 2Z1DA 2ZKLA 3WLRA 3UPUA 1DG9A 1JFFB 4YLEA 3VR4A 2Z5VA 4PVDA 1N92A 4M87A 1A4IA 4NBLA 1YFJA 1JKJB 4X6LA 2WLTA 5ALHA 4ARZA 3WNQA 4F86A 4HWOA 3B48A 4UEJA 3JRNA 1UZUA 3L7MA 1E20A 3W78A 1MJFA 3ENNA 4PG5A 3B89A 1VM6A 3PCXA 2HWYA 1GL7A 1GUAA 2IPNA 1FXUA 3PUYA 4H08A 3IIKA 3T54A 3LUBA 2QD1A 2YDXA 3DW3X 2FZGA 5IC5A 1NMZA 5LOVB 2BJHA 1VPLA 2I3BA 4FE7A 4OI2A 4Q19A 1PUXA 4OK3A 3GUCA 2WT4A 1JSZA 2Q3FA 4JQOA 2FWMX 3ESXA 1QCCA 3JY6A 2WF8A 3IR7A 2W11A 2RBEA 4OJKA 2ILTA 2X0IA 3WFZA 3SFTA 1CQIB 3RLIA 1SKQA 2BEUB 3CW9A 2VQ3A 5JO9A 4CKCA 3KVRA 4U7JA 3UUEA 4PSCA 1HTTA 2JRCA 1Z62A 5TY0A 3NHKA 4UBLA 4OXRA 4KDFA 4MUIA 5BW8A 1WZCA 2FMKA 1Z3IX 1JLRA 1ZOSA 3GC6A 2XSZA 4MYSA 4PG4A 1DPFA 2JGJA 4WESA 4V0QA 5ENDA 1IATA 2CFIA 5CB8A 3CJQA 2AFIA 3JQFC 5HOQA 3ZWCA 3C7AA 4RF5A 3K0AA 4BMNA 2I4RA 3D5TA 5LYYA 3GLKA 3LP8A 3L43A 4QBGB 2FPPA 2QS9A 3I4CA 1K9SA 4KZKA 4YJKA 2GCIA 3G1TA 4TTTS 1EFDN 4F7DA 4RMGA 2ICAA 1Z4IA 4XIGS 2Y66A 5BWNA 1BRMA 2B83A 2FY8A 4TT3A 4TLBA 3WL4A 4ZYYA 2IW1A 2OFWA 3DFUA 1N57A 2Y0BA 3D0QA 2C4MA 4RZ2A 4EJSB 3KT6A 1KO7A 2LKCA 1C30A 3ANXA 4EY7A 2HJRA 3SEAA 1YRLA 2VNIA 3LGAA 3L8CA 4HMOA 2ZATA 2B78A 2HH9A 3PJFA 3PHJA 4PF1A 3CLRD 1GSHA 2WTMA 2XMZA 3Q9SA 5TEWA 1CV2A 5JXJA 1QHHB 3Q0TA 2BHLA 1M2KA 2EVWX 2JIMA 4ESHA 3MWGA 1FTQA 1QIJA 4B2IA 5DSZA 5ALVA 1FU7A 1LD3A 1WKVA 2IKSA 4TROA 2Q2OA 3RSLA 5K8TA 4KR7A 1K4MA 2QY6A 1DI0A 3QWIA 3KX2A 1VJRA 1UKEA 1P0IA 5CCDA 4F92B 5JXGA 1RYYA 1QHEA 4GMKA 3T99A 1PGNA 3W8FA 1U3DA 1II8B 1HO3A 3Q8WA 4ITVA 4G1UC 2Q1YA 2JKVA 4HWPA 1F8YA 2B35A 3ESRA 2B4YA 3GAAA 4IINA 4IIJF 1S4MA 4IJ5A 4YASA 5BV0A 4TYWA 1FUEA 3D43A 3HBFA 2EV9A 4JU8A 4KN8A 5ECWA 5K8JB 1AGNA 1U02A 4ZRDA 1ZH0A 2HRQA 3NDRA 3O3MB 1D8AA 1W34A 4KQFA 2JH8A 4UNNA 2JVJA 2FXVA 4XR4A 2P8SA 4NU0A 2HLDA 3JQ6A 5KJ1A 2R7NA 2BM0A 1MAAA 5HMMA 4AYXA 3WMEA 4K8RB 3E7DA 3OJEA 3HJUA 2CXPA 1EGQA 2ZSAA 3EFBA 3FNBA 4G0OA 3VC7A 3KKQA 3KHKA 1E0SA 2JH3A 3H9QA 1TNDA 1UOEA 3QLVC 1CIJA 4Q1BA 1HLPA 3HJFA 1WS6A 2WWGA 1OPRA 4I9FA 1ZJYA 3RUAA 4IIGA 2MSEB 5K0EA 3FHJA 3LZDA 5EMHA 3TKLA 2NQTA 1DARA 3OEYA 4FJ2A 4R41A 1DCTA 1E1MA 4QO7A 1W4RA 4JCOA 4L2IB 1SKBA 4LRXA 5EHIA 3VAYA 4BLTA 2HPVA 4ALKA 1RHMA 1KYZA 1MMFB 2XUFA 3GDHA 4BDSA 1QZZA 1NXTA 5T57A 2AN4A 2WIAA 3F5FA 5AW7A 3Q0EA 3RFVA 3ZW7A 1U28A 1ISIA 1TMYA 1XCPA 2ZVDA 5JAZA 1XZFA 3COJA 2C9OA 4KK3A 3UXEA 1PFVA 2BFOA 1NBMA 2G0AA 2RAUA 1UJ4A 5DVZA 1EFVB 5DW3A 4LCJA 1E1KA 1YJQA 4R6WA 1SB8A 4D9NA 2W0MA 3UJ8A 4ZI3A 2DHCA 2J8ZA 2Q9UA 5JYBA 1QRTA 2C8JA 3BHJA 1CY2A 3HFRA 2ATXA 3E23A 1SXQA 2O8FA 3DLIA 2C84A 2F3SA 4G5FA 1U7UA 4NBWA 4N3AA 2QZ4A 1SPXA 4O0MA 4NAUA 4EB6B 1E5LA 2XLBA 5KNDD 3DC7A 4DIOA 3K6SB 2DKOA 1GN8A 3B53X 5JQGF 4GSYA 2ODQA 4ND3A 4LZAA 1MG5A 4JXXA 3QUSA 4JWTA 2G1UA 2N42A 4DLYA 4KDCA 3KUKA 1CE8A 1WUYA 3E7PA 4FC7A 4BNHA 1PNRA 3GJ3A 3ET4A 5DNEA 4TRNA 4OQLA 5FPPA 1BYIA 1WY7A 5EYPB 3FPFA 2DUNA 1DBVO 3EXAA 5ALRA 3RSZA 1OAOA 5K0SA 1PW5A 4OYHA 3A10A 3RADC 3CISA 5FUMA 2XPCA 2CFSA 4NENB 3QVVA 3KB6A 2CVPA 2OK7A 4AIRA 5KQMA 1J2EA 2ZUEA 2H4ZA 1FPQA 4BB9A 1G0NA 1N78A 2W6JD 4LA4A 2X7XA 2N46A 3NIGB 4I1SA 1QHYA 4ARZB 5IMSA 5JECA 2NIPA 3GHHA 4PCLA 5K3EA 1WXHA 3RWMB 1J42A 4UBMA 4J76A 5HIIA 3T3NA 5ERXA 2W2TA 1G5PA 1DAFA 3BXEA 2IEZA 4P7KA 2H0AA 3AW9A 4WZZA 1H1LB 5EUMA 3UJHA 2GN2A 2YYAA 2POQX 5J40A 4YQZA 4L1KA 1JKJA 3LE8A 2OZEA 4YFYA 2EEZA 3CJTA 4DR1B 4XFKA 3RBVA 1GG2A 2DH5A 3JWGA 4Y2UA 1U7WA 5B4TA 4MYDA 5LZ7A 4V0LA 2HLNA 3C3YA 3ROGA 4ZYZA 2Z1NA 3KSAC 2ORWA 3ICQB 1UF9A 4LKOA 3LBYA 3R3WA 3I4LA 3TRKA 1L5HB 4R4JA 1F3LA 3VI4B 4CTJA 4Q5IA 4ENTA 4MRNA 5I5EA 1NWHA 1N3BA 3P9PA 1OAKA 1L7XA 1IRXA 5C1OA 3KVOA 1QH9A 4UHFA 3T1TA 1K27A 3B6ZA 5JFOA 1VZ2A 1T35A 1KYXA 2R7KA 4JOSA 1EUCB 3EGIA 1KDTA 3IMEA 3BH0A 1KNXA 1SVUA 1USGA 1O8CA 1PJ4A 2OENG 1NU8A 2QPTA 2PYDA 2D0PB 1LLCA 3BIOA 2MYTA 4L4XA 3AM5A 2WA2A 2ZUDA 4EABA 4CM8A 3NV7A 1GRNA 3DBHB 3CLVA 1NIJA 3O90A 4MGZR 5FOWA 2F9MA 4LOKA 1XCGB 4RIFA 4KDEA 3MTDA 4ZCQA 4ADSG 2NYVA 2Z4SA 3ZDFA 1L0BA 1C5KA 1NJ5A 1FFHA 2OV6A 4OHFA 1QORA 1YB5A 2CLMB 4CT4B 2BGLA 2ZTLA 4FOSA 2PUFA 3TI9A 2X22A 4TV9B 4RK6A 4XUGB 3RU2A 3V3TA 1A9OA 3BDAA 1KI6B 5JWRA 4CGZA 2MYNA 3K1YA 3C5VA 3E1SA 2AXEA 3N2IA 4XCXA 5AXCA 2DC1A 5KMGB 2EEPA 2OK8A 4BWYA 1TF5A 3GD7A 5A06A 2YYZA 3TLAA 4CF6A 5FOVA 2JLAA 3OQJA 3ETLA 2C03A 2O0KA 2UVPB 3BDVA 3HY6A 3PE6A 1M34E 4WEOA 4BATA 5C35A 2AF3C 1Y1RA 3P2JA 3GA7A 1E4YA 2AXNA 4POAA 5AT1A 5EWMA 3RROA 3WY9A 5LPNA 4Z7QB 2J9ZB 2GVNA 3UGQA 1RRMA 2H2DA 3NPAA 1HZZA 4C4YA 5K6AA 3RM3A 3PC8C 3F4BA 1DAPA 3GRPA 3E3NA 2X9GA 1XTTA 4OHCA 5ICMA 2VWPA 1KJNA 2CCJA 3L1JA 3F5QA 1UFVA 2NUPB 2XD9A 4UD2A 3CRNA 5TSDA 3UOAB 4D99A 4DCVA 4ZI5A 3GGCA 3SHOA 3D1VA 4ZQIA 2RE8A 4Z4GA 3WGKA 1U3FA 4PYKA 3EZGA 3ZCUA 1E2MA 1HC7A 4ENVA 2O5RA 5IPFA 4OOEA 3UMYA 4GRAA 2QR5A 3HA2A 4K6KA 5BN3B 5BUZA 5F2NA 1SWVA 1EB9A 4YPVA 1V1MA 5TQJA 4MS4B 4Z1MD 3PEUA 4QO8A 2HB6A 1AXGA 5BXQC 2CHGA 4B3DA 4ETIA 2XZDA 2HD4A 2LIVA 2XUAA 1TM4E 2NVOA 3I9V6 5CLLA 2EFEB 2W4MA 3DCYA 5I3CA 1Y42X 5L7YA 3WGZA 4LF7B 4WZBB 5DLQC 4J3NA 4GVLA 1S8FA 1I9CA 4G2TA 4YV7A 5H81A 2R6ZA 1YVUA 5JLAA 3KOMA 3WSVA 2XR1A 4CT5A 3EVEA 1I1NA 3G59A 1Y82A 3VVBA 4ZO6A 2YJ3A 1J06A 2WWRA 2FDXA 2IHYA 1T6XA 3G8DA 3QENA 4Z8YA 3RD5A 1Y8RB 3WDMA 5K4GA 1HZZC 1R6UA 1Z7GA 3KL2A 1WZUA 4XWWA 2MMCA 2NUBA 1JB9A 4FZ5A 5CG1A 2AFRA 1JU3A 1U0SY 1U0GA 1L7EA 3NAGA 3SXJA 3T5AA 3ZLJA 5TJHA 3AOEC 1W73A 1ZX1A 3OLZA 2QEQA 3D4IA 4R8LA 2ATVA 3OCXA 3MJTA 4OBXA 4IXNA 2PMWB 1ZM3A 1IJKA 4JB3A 3HLKA 2G8LA 2O2HA 1XT6A 3TZQA 2WNSA 1YVRA 1UMKA 1OD6A 3BG5A 3IESA 2QNBA 4TLEA 1JBKA 3K20A 4BUZA 5FBRB 3PBKA 5DASA 1VTKA 2TRSB 2D59A 2OGUA 1YTLA 3P5SA 1GLVA 1T5HX 2Z2ZA 3NORA 4J90A 4QQRA 4WNCA 5HJ2A 4LRSB 2ZSUA 2GJ8A 2FG6C 4RDHA 1Z7EA 3G0HA 1M6WA 2JGLA 3MRXA 2II6A 3MUOA 5C34B 1A96A 4A8JB 4E4TA 1LV8A 3GGSA 1RM0A 4RL6A 5HF9A 3W34A 5EHZA 3TTUA 3V8QA 5LMNB 4LFAB 2ZB4A 3FFTA 2BMEA 5BN5B 2DT5A 1QGZA 1GQYA 2PRYA 2J46A 3TPFA 4MHOA 3K9LA 3GLIE 1BJTA 2H65A 4JKOA 4ZAYA 1V48A 1PEDA 2CUZA 3ORQA 4LXGA 3LDGA 4YMVA 1CF9A 4IG9A 5JNTA 1LX6A 1ZEMA 3M6MD 1LVUA 4HQFA 5KKAA 4D4HA 1SXPA 2HSWA 3BHIA 3U31A 4H3KB 4WX2B 2YIMA 3UHFA 1ZUHA 1NBAA 4L07A 2BAGA 2IEAA 4KWEA 4LMPA 4GR5A 1EP9A 1FS6A 1ULHA 3GZJA 4XW2A 3GEBA 4PVCA 2I99A 1C1DB 3CNQS 3ND5A 1XLTC 3UNXA 5BRAA 1PV1A 1E1RD 2C2WA 4IGKA 4FCCA 1P17A 1JYFA 1J24A 3AB8A 3WA6A 1EWTA 2ZYAA 5BN4A 1TCBA 6YASA 2SKDA 1UKBA 3BE8A 3CZ9A 3GQVA 2H1VA 4NYMR 1JLHA 4JVSB 1V37A 3D8BA 2OUIA 2IX3A 2PDAA 5EFOA 3AM1A 1NT4A 4TWZA 4BGIA 4R1MA 4NU6A 3F74A 3QXJA 4DZZA 2HMVA 3RWOA 2BMFA 4KLZA 2GN0A 3AUXA 4BVEA 2F4VB 3RNOA 4R9SA 1N33B 4KB5A 3EVDA 2OG2A 3C1OA 5LU8A 1LRKA 3ZGLA 9LDTA 2O8CB 3OZFA 4QSMA 1N4DA 1O9HA 1QF7A 3H5WA 4Q9AA 3BREA 5KHAA 1RRKA 4NCHA 4YDQA 5HZMA 5IX8A 3VYSB 2ZETA 3EMKA 3K35A 4W99A 4V03A 1TPZA 3OKCA 1WR8A 4MI3A 5AHKA 4II3A 3NGMA 5LYJA 1IQ0A 4NHEA 4H7FA 4MVCA 2RGCA 2FFQA 1PFYA 2MCFA 2VWGA 4MEAA 4NJEB 4YHBA 1L4MA 1R37A 4TMTA 4U39A 2EKQA 1TM5E 1NC1A 4TSFA 2GYVA 3TLGB 4DC0A 1F5SA 3IDSA 5DO9A 1ZN7A 2R86A 3R5TA 3DZKA 3JYLA 3L7LA 4GQBA 1ABBA 5KAPA 2Z2KA 1L4EA 4HTFA 1G8SA 4OGFA 3E27A 2HV9A 3QUTA 3UV3A 4QNNA 4AX4A 3GJYA 1Q3KA 2VZEA 1W36D 1SVMA 1EFVA 3SFVA 2ONCA 4WK6A 5JO0A 2E7ZA 4DV2B 2QOEA 1GPDG 3OLQA 5D85A 3QQ5A 1WWKA 3CH5A 1CTQA 2C1EA 3F9CA 4HLCA 3AI7A 2BUAA 1PQUA 3NX4A 4HDMB 2UZ4A 4Z9YA 4C06A 4OF4A 3HZOA 1M5TA 3DB2A 5LSAA 5JE8A 3FGOA 3NGLA 3TR0A 3ESYA 1WZEA 3RG8A 4OL9A 4Z8XA 1X9GA 5I8ZA 1C3OB 3HPRA 4ZZ1A 1Z0FA 4MW0A 4DY4A 1JQ5A 2I1QA 1A27A 2AMJA 2COKA 3OHPA 4L0MA 1D2MA 1KY4A 3NIBA 3IIEA 3R3SA 4G81A 2B2CA 4H59A 3ZBTA 3NBFA 3R1IA 2R11A 3A31A 5I9IA 4CR6A 2PSSA 1HEIA 4D9GA 4YRKA 2ZVPX 1Z7YA 3DLAA 3WTBA 4PEVA 3TW4A 1W29A 4RGBA 1G6KA 1HYBA 1X2EA 2ZJ7A 1YTUA 4KH0A 4C1NA 3BIWA 3K15A 5I5GA 3OF2A 1TJ3A 4MYHA 4BQIA 2PV7A 5E9JA 4P9NA 1HE8B 2WM9B 2GD6A 1EINA 1VBKA 2IDKA 1E1CA 1NN0A 3K9HA 3LWDA 3J81A 1V9CA 3UTDA 3I9KA 1O5OA 4RTQA 5KNLA 3DOEA 1E9EA 1OE0A 3V4VB 1XFDA 2QJRA 5KSOA 3T7RA 3JZAA 1UXKA 5KYYB 3RC8A 4PLTA 2OV1A 3CB2A 2G07A 2J9GA 3O73A 2ZSIA 4GO1A 3K05A 4YT5A 4PV7A 1KPGA 3QVKA 4LXIA 1J5EB 1H65A 1CY6A 1AZWA 1DJPA 1B93A 4RD4A 2G71A 3J80A 2GFHA 2HWUA 1MB9A 2X1HA 2XMSA 3AX6A 3K8YA 1NW8A 4KVGA 3AH8A 3D6NB 1Z39A 4F45A 1RI4A 2VSQA 3P2OA 4B8YA 2HHLA 3HABA 1XPOA 2CJXA 3GW8A 3OF3A 4PZEA 1QXSA 4E2YA 1VI2A 4HQLA 4EYEA 4ZDWA 3GLGA 1BRTA 4WMLA 1TEVA 2V9ZA 2ZBUA 2NO7A 1RAGA 1FCJA 5B1IA 3CZPA 2FFAA 4RADA 3I9JA 3W4KA 5L8VA 2XHZA 2DWPA 2NZXA 4FOOA 1WDKA 1XTQA 3SYNA 1L5ZA 3JAKA 5F5NA 5BSUA 1HSZA 4MUEA 1PGPA 2Y05A 4RDCA 5BNTA 5D5HA 3TAXA 4ZJUA 2IZ5A 4CG1A 1PDWA 1I2DA 1CR6A 2Q2QA 3FWYA 2L19A 5A0VA 1GFZA 3R09A 3N5KA 3I9FA 2P79A 3B3AA 1ZA1A 3P2YA 5ALNA 4BIIA 4D3ZA 4I4TA 2IA5A 3T7TA 4N7MA 4CL3A 5I4BA 2AEFA 1H5UA 1YJXA 3CCCA 1EFPB 1HLDA 1NVGA 4JYBA 5H59A 1KSGA 3TQQA 1IEQA 5EQDA 5KDDA 1D6SA 4H1UA 1T2AA 2QMUA 3HSKA 1PZNA 2PGOA 3FJ1A 1C0KA 3ONDA 3SSAA 3N2KA 1N32B 1XVUA 4WZAB 2WG2A 4OLFA 3R6TA 3RFFA 3UJ3X 1F8XA 5EP4A 4CM9A 2QYSA 4MQEA 1E1YA 1Y7PA 4BN5A 2V6IA 3D4OA 5DYTA 1R6XA 2IYXA 3LW7A 4HNTA 2Q9AA 2UU9B 2PU7A 2HA0A 5ALWA 3S8YA 1FVXA 3WAJA 2XXAB 2IOFK 3EOBI 5DEOA 5JNWA 3LUJA 1ZGGA 2C3OA 2OSVA 3VAAA 2HF9A 4TWJA 4DCPA 2AEJA 3BTUA 5CTAA 2NUPA 5IDYA 2GARA 3Q12A 5J2TF 4MQUA 1Z12A 3UXMA 3WYDA 1B6RA 2WKQA 2XY4A 3FNHA 5JQGB 4KRYA 3RI3A 4I1YA 3SX2A 2IH5A 2XUGA 4LS3A 3B6IA 4NP6A 4NU5A 1KIMA 4WLVA 4ES6A 2AOWA 4B46A 5CBPA 1JLKA 1YFKA 2G04A 1KOFA 2VHYA 3OZRA 4MGEA 1Z17A 4HLDA 4OAQA 3RVLA 1FFXB 4O5AA 5IVPA 4UZSA 3UAYA 1RNLA 2JFVA 3G5TA 4LDNA 1VXOA 1JXMA 2VPZA 3I9NA 3ML1A 4X97A 4DSAA 5LQRA 2D74A 2X9NA 2I8LA 1X1DA 2HQOA 3FF4A 3OZAA 4FI3F 4R7ZA 1NM5A 1G19A 5T3YA 3FMPB 3IQZA 3L0IB 4JEHA 4RMIA 3BCUA 4MITA 1LPMA 3L7AA 5LQJA 4X91A 2OQ2A 3ZVLA 4O2AA 3LBNA 2K7ZA 3RHFA 1ODKA 2G25A 1YZYA 3NETA 3WAGA 3GLIA 2DULA 5DI3A 1LBEA 5AUOB 3OESA 4CV2A 3E5MA 3U3ZA 3MGBA 4RTJA 4Y2RA 1I3LA 4KO1S 2JLZA 4J4BA 3ZJVA 3QK7A 2G76A 4ARIA 1C1HA 2YZGA 4R1LA 3ZWXA 1R12A 3LV8A 1ESCA 1DUIA 5FI1B 5LZ2A 4C78A 2RGNA 3C7KA 4N3GA 4G84A 3TB6A 1IZZA 2C2ZA 2E89A 3R3ZA 4FS8A 2C2YA 2RAPA 2WP0A 1W8IA 2PZAA 2W2KB 1PJLA 4FDTA 4IIVA 2BGMA 4QTUB 3OP1A 4GPEA 1H4QA 1FFCA 4ZOLA 3HVRA 1QV7A 2O2EA 3DVAB 1GDDA 2HM7A 2YOGA 3G5LA 3E3OA 3BA6A 3I2FA 4WZBA 5LQUA 2OHJA 3OWXA 4MTLA 1QM5A 3E0QA 1TGVA 1Y9EA 3A0RB 3IELA 5GQSA 5SY9A 2BMJA 4XYMA 2OBMA 4TN1A 2BFBA 4LOIA 3HA3A 3F78A 3THWA 1K5HA 1RPNA 2GJ9A 2W2PA 3A6KA 3PQ6A 4RV9A 3IQXA 3KJGA 4Y30A 1BX0A 1GV1A 4C07A 2WSIA 4C6SA 4MAAA 2GVDC 3FDZA 4UMEA 5HBRA 2DE0X 1J1IA 3KE8A 1N5OX 4Q47A 3QEKA 1XZQA 3G8YA 3L6RA 4P7BA 1DHRA 1W46A 2FUKA 1KSJA 1H6CA 1Z18A 2VDNB 4Y2XA 5GV8A 1Z2OX 4AY2A 3PEYA 5EJGA 1JZTA 1BFKA 1F0KA 1JR3D 1SB9A 4GGOA 2FX2A 1MD9A 1HYQA 1R6BX 4FCWA 5T3UA 3GFSA 3OZDA 1P7CA 5FPHA 3VTZA 3W8EA 1SUPA 2C3UA 3NM4A 3E4DA 2HDWA 2QJOA 2AJBA 4R01A 1Z74A 4WRRA 1H93A 4F3RA 2I2BA 2ZBGA 3D3JA 1KI4A 3TN7A 3D8UA 4PC7A 3GXOA 3TE7A 4FM9A 3RU3A 1SG6A 3QKRB 2PBZA 4MQLA 1GT91 4XGQA 3U56A 2ABWA 2CNBA 1AGPA 2BM8A 5AVUA 4OQXA 1QKIA 2DZDA 4P93A 3RS2A 3U5ZB 1T8TA 1A88A 3L1IA 3ZGVA 4Y6RA 4AD8A 1NZDA 3AR2A 4I4CA 3S1LA 2I2DA 3LHIA 4G0PA 3TXAA 3HXQA 1KO1A 1XP8A 3UEOA 1TIKA 2RDMA 3VU9B 2R6R1 4N8SA 1M73E 3PI6A 2ONZA 2OOKA 3P9ZA 4X7BA 4FYMA 3DEIA 4IUBS 3R7SA 4RYDA 3MRVA 3VH1A 3A1FA 1H2BA 1ADJA 4WW0A 2PIDA 4PLZA 4BUCA 3A8TA 3FNEA 1HE3A 2BEVB 2GNAA 3A3NA 3IMFA 2HC9A 2Z2IA 4W6QA 4HN4B 4BPRA 1JWAB 1RE1A 1T0UA 2NW6A 4RQAA 4E5MA 2V9CA 1T4GA 1E2QA 1QVVA 4GXTA 3V4LA 4NOMA 1KZ9A 5FAXA 4I1PA 1EWRA 2EZ9A 4RACA 1BGWA 3GWGA 3AR8A 1XDSA 3F6EX 2B8JA 4K5QA 3UN1A 3CCFA 1YDHA 2OCDA 2QDXA 1UBRS 3IE0A 1QO0D 3JPWA 4UMVA 2WHYA 6NULA 4MLDA 4UAJA 2PKYX 1OZGA 3TXYA 3EEBA 2DQSA 2AW5A 4B0PA 3N75A 1M76A 3UPDA 5IM5A 1FOEB 1M1UA 2YL2A 4IG4A 4JX9A 3SKXA 5CEFA 2X2OA 4G0YA 4B3TB 1CZRA 3EBPA