4RTSA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gtcta)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
243
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 81
structure length 243
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtsA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtsA01
2ONYA 5EHIA 5FWAA 3UJ8A 1QYRA 4QDKA 3PX3A 3H2BA 2C7QA 1O54A 3KQWA 4CXMA 3EVFA 3C6MA 2I6GA 3HNRA 1DL5A 3CJTA 2GPYA 2PJDA 2ZIFA 2AOUA 3LDGA 1QAOA 4E2WA 3DP7A 2OZVA 1G55A 5CVUA 2OYRA 1SKMA 1ZKDA 5G02A 4E2YA 2ZBPA 3EMBA 4EQZA 5K8VA 4OX9Y 5E8JA 4MTLA 5DM4A 3B3FA 5ERGB 2OB2A 2IH5A 2K4MA 4PYMA 4R05A 3NVMB 3P2KA 4PYNA 3THRA 1KHHA 2R6ZA 3B5IA 3G2QA 4PNEA 4BLUA 4WVLA 5T67A 1XTPA 2V7EA 4AUKA 2FHPA 3ANXA 3G2PA 3I58A 1VL5A 2C7RA 5KS2A 1JSXA 2YQZA 5F2OA 2IPXA 5P8WA 2VDWA 5FTWA 2PXAA 3GGDA 4PYKA 3ER9A 5LSAA 3HVKA 4PCLA 2GA9A 4YUVA 4RTNA 1ZGAA 4RV9A 4YV0A 3AXTA 1YF3A 3HEMA 4CTJA 5B1SA 2UYOA 1G8SA 4O29A 3EVDA 3E05A 5BW5A 2Y1XA 4QPPA 4EMSA 1JG4A 1R00A 5K01A 4E2ZA 1ORHA 1R8YA 3I53A 3KR1A 2BR3A 4P7GA 4F85A 2QYOA 4R8SA 3P2IA 4QVGA 2XYVA 4C08A 3NW9A 3KQTA 1XCJA 3SMQA 1SQGA 1WS6A 4GOND 4OQEA 1TPYA 3IYLW 4BP3A 4ER3A 4EVIA 1ZGJA 4U7TB 2AOTA 3LECA 1INLA 3M6UA 5K0LA 4PYJA 5E2AA 4RTJA 3FPJA 2HWKA 2VS1A 3DXZA 4E70A 2F8LA 4GQBA 5FWDA 1BKYA 4M36A 3U81A 3M70A 4PYLA 5D1NA 1X1BA 3P9CA 1RJEA 4RVDA 3CJQA 4AX8A 2VZ9A 4YUXA 2JH8A 1X1AA 5EEGA 1RJFA 3PB3A 5EC8A 3DULA 4RYLA 3SX0A 5DPMA 4GC9A 5EKUA 3LCVB 1ZQ9A 3TMAA 2G1PA 3NDIA 5DM0A 2VDUE 4MQ4A 1PJZA 3NTVA 1IXKA 2PXXA 3TM5A 4BY9E 5CVVA 2O07A 3DMGA 3I5UA 3M4XA 1M0EA 3G7UA 1NE2A 2JG3A 3C3PA 1L1EA 3AY0A 4GEKA 1NT2A 1RI3A 4MWZA 2OPBA 3MQ2A 3RIEA 5K0CA 3THSA 4RTOA 1XJ5A 5C9ZA 1KYWA 1FPQA 1HMYA 5FHRA 1O9GA 3K0BA 3R3HA 2NXCA 2ZWAA 3OZTA 5EVJA 2CL5A 2EG5A 3G5LA 3TKYA 3REOA 4B17A 5F2KA 5EHGA 1WXWA 3MCTA 4ER6A 3FTEA 2O0LA 3CJRA 2AOWA 3MB5A 3OE4A 4KVZA 4PGHA 3LBYA 3R0QA 1Q0SA 1EG2A 1FBNA 1TW2A 1F3LA 1L3IA 2PT9A 3EVBA 3ORHA 4XCXA 3IHTA 3K6RA 4PINA 4RWZA 4DCMA 3R9XB 3UA4A 3KQQA 5HEKA 5K0BA 5D1HA 1NW7A 3FRIA 2ZTHA 3O7WA 1KPGA 4Z2YA 2PV0A 4X63A 3UZUA 2HMYB 3AXSA 3DLIA 1YFJA 1NW8A 3F4KA 4OBXA 3TPZA 2O05A 1KPIA 2BZGA 2WK1A 3IV6A 4X1OA 4A6DA 2AN3A 3DMHA 4RVHA 5FADA 5CIYA 2ZZKA 4EK9A 5KQRA 2ZIGA 5GWXA 2GB4A 2HTEA 3C3YA 3FRHA 3JWGA 2P3LA 3EGIA 2GLUA 1JTFA 4PCAA 3NWEA 5EMJA 5MHTA 3T0IA 5GIPE 4FS8A 3KPWA 4HGYA 2EFJA 1P1CA 3HCDA 4P58A 3CBGA 4RTPA 4GOMD 1G8AA 5GM1A 3UJ7A 4XUDA 3VC2A 2I9KA 3B7PA 5K05A 2ZZNA 2Y1WA 3BWCA 8MHTA 2ONZA 5FQOA 2H11A 2ZSUA 2O57A 3HCAA 5LQRA 5EKXA 4GOOD 3HVJA 3QOXA 3OZRA 4F86A 2FPOA 3DTNA 3PX2A 5K0EA 3EVZA 2PT6A 1YFLA 4CKCA 2P3QA 5HIMA 5LR6A 5DTRA 3P8ZA 2O06A 2PVCA 4ER5A 5IH3A 5LQJA 4E33A 3KR9A 4X61A 3UWPA 5HILA 5DM1A 5EMKA 5CD1A 1BC5A 3FTCA 2OXTA 3VC1A 1X19A 5CVDA 4BLWA 3GRRA 4Y30A 3I64A 3NVKI 2JHPA 1D2GA 1WY7A 3RW9A 2QY6A 3VYWA 3UA3A 4HH4A 2BR4A 4FSDA 3KR2A 4QDJA 5CCBA 5M5BA 5GIOE 5HOQA 4ZTBA 2B2CA 4PYQA 5EZQA 1D2HA 3GDHA 4E32A 4DKJA 4DA4A 2I7CA 3ER8A 5GP1A 3KQPA 5DSXA 4ISCA 5DX0A 1N2XA 4QQKA 3A7EA 1BOOA 3SSOA 5JR3A 1WXXA 4PONA 2CMHA 3I9FA 4AZWA 5CCXA 1L3BA 4POOA 2QE6A 3FPFA 3Q7EA 3GXOA 1M6YA 3PVCA 1L9KA 2B25A 4HGZA 5FA8A 5HFJA 3FUVA 2P40A 3HCBA 1JQ3A 3UJCA 2C7PA 1NW5A 1XCLA 2PX2A 3M33A 2IIPA 3MERA 3P9IA 3SR4A 2G72A 1JQDA 3GCZA 3LSTA 2FK8A 3G2MA 5K0NA 3TFWA 4E2XA 3KR0A 2PKWA 1YB2A 4OBWA 2ZFUA 2PY6A 5EMLA 4AZSA 4AZTA 4KIGA 2OBFA 2ORED 2A14A 2AS0A 5IKMA 3MGGA 3UJ6A 2UZ4A 3LHDA 4E31A 3MTIA 3G5TA 2CKDA 3MHTA 3HTXA 5HZMA 1SQFA 2UYHA 2P7IA 5EOVA 4RTLA 2DULA 4H0NA 4JXJA 4CTKA 2H00A 4R6XA 3EEOA 1IM8A 2ERCA 3DXXA 3MTEA 1KR5A 5EIWA 2NXJA 2WA2A 3B3GA 1T43A 2EJUA 3A4TA 4KW7A 2ZZMA 2Z6UA 1QZZA 3EGEA 5KVAA 5LQAA 3CVOA 3V97A 2ZLBA 2YXEA 2ZWVA 3UJAA 1JQEA 2B78A 3ELYA 1MHTA 4DZRA 5JUWA 4LECA 5E9WA 1P1BA 3SVZA 5E9JA 4BP1A 3BKXA 5HIJA 3UFBA 2QM3A 3LDFA 3NWBA 5FQNA 1NW3A 1RI1A 3PFGA 2XBMA 3C6KA 5F2NA 1JG2A 2HNKA 4BLVA 5LQCA 4GC5A 3MCZA 4RVFA 3M6VA 3GIWA 3JWIA 1VIDA 2VP3A 4RTQA 3UJ9A 5EIFA 3BUSA 3ELUA 3FPGA 3RODA 2ZCJA 5FCDA 4YMHA 1RI5A 1VBFA 3UJDA 3P2EA 3A25A 3OU2A 5DLYA 2AOVA 3FUXA 5FUBA 3T7RA 3OCJA 2V74B 2NXNA 5EZSA 3SXJA 1JR4A 3LL7A 2Z6QA 4PGGA 3LKZA 2GAFA 5K0FA 3EVAA 2NP7A 1XDUA 5EPEA 4PYOA 5ICCA 5BP7A 1MJFA 4WXHA 3A27A 5H02A 2ADMA 3TR6A 3T7SA 3ERCA 2G70A 1F38A 3CKKA 3TRKA 2PX5A 1WZNA 1VPTA 2EJTA 1EJ6A 3DUWA 3OZSA 1VQ1A 4FZVA 5E8RA 1ZHFA 3P71T 2IGTA 5E1OA 5E2BA 3SGLA 5U4XA 2IFTA 5DTMA 3GRUA 2P41A 3P97A 5FHQA 1WG8A 4L7VA 3JWHA 3O4FA 4FSXA 2VDVE 5DRTA 4C07A 3GJYA 4P7JA 1Y8CA 2JH9A 3ELWA 2R3SA 2IH2A 1N7IA 1H1DA 1KP9A 2IBSA 3P9NA 3FTDA 3BXOA 3NDJA 3BGDA 9MHTA 3HA3A 4PIPA 2YVLA 3ME5A 1NBHA 3HCEA 4XUEA 5ICEA 3X0DA 4OQDA 10MHA 5KYGA 2QRVB 4QPNA 4R8RA 4MIKA 1QAMA 5DSTA 3PS9A 3SM3A 3G2OA 3KPUA 2P35A 1PRYA 3KQSA 2GH1A 3DOUA 2NXEA 4X60A 1RI4A 2OKCA 1KYZA 3KPJA 4DM3A 4OA8A 4HRAA 3FUWA 1HNNA 4K6MA 2BH2A 5T6BA 2NP6A 4RTMA 2YUIA 2YXDA 2N47A 1D2CA 2EX4A 3D2LA 3LGAA 3E23A 1IY9A 5E1MA 3DR5A 2JHAA 1Z3CA 2Q41A 3GRVA 2XVAA 2PX8A 2XYQA 3PFHA 3PTAA 3DLCA 5DXAA 3B89A 1V39A 7MHTA 5CVJA 4GUAA 1XDZA 1FJXA 3BWMA 3EVGA 1KPHA 3O31A 2UYQA 3TLJA 1M6EX 3G88A 1N7JA 2LD4A 3TKAA 1RI2A 2ZULA 3LKDA 4OA5A 3R24A 4RX1A 5K09A 3G8BA 1VP3A 4IKPA 5E1DA 3LX6A 4YUZA 1XVAA 4MHTA 4YMGA 3HP7A 2FRXA 2YX1A 4XUCA 1I1NA 1SUIA 3HVIA 1EJ0A 2DPMA 3GO4A 4GBED 4LG1A 2P7HA 1U2ZA 2JHCA 3KHKA 4IV0A 5DRYA 5DWQA 3S68A 3SSMA 3AJDA 3VSEA 1YZ3A 2XYRA 4HTFB 4CKEA 1QANA 1KIAA 1QAQA 2B9EA 2YTZA 1JTEA 1YZHA 3BGVA 3JWJA 3OPNA 4X41A 2B3TA 4DF3A 5LQUA 1AQIA 5T64A 1R8XA 3LDUA 2AN5A 2IDJA 3EPPA 3IEIA 4F84A 5K0JA 5LQNA 1Q0TA 2NNWB 3HA7A 1TW3A 3P9KA 4P7FA 4PWYA 4A6EA 4RVGA 3AWIA 5HIKA 3BWYA 1AV6A 2IP2A 1G6Q1 3C0KA 3BZBA 3OFJA 2ESRA 4ATNA 2BR5A 1FP1D 1YUBA 3R6TA 4IWNA 4ER0A 5EEHA 1ZG3A 3A7DA 4V0QA 3BKWA 2UYCA 4YUYA 2YXLA 2PX4A 3WSTA 1I4WA 3EVEA 1P39A 3LPMA 3A26A 4RTRA 3DMFA 2ZVJA 4KDCA 4GOLD 4LWOA 2FCAA 3PT9A 4DCGA 3GNLA 4P7KA 3GWZA 3L8DA 3DXYA 3TM4A 4AZVA 2CMGA 5ICFA 1OR8A 5C1IA 3QOWA 5BW4A 3CCFA 2E5WA 3G89A 3GU3A 2P8JA 3V8VA 4HC4A 3FUTA 3FPEA 2QRVA 3OU6A 3OU7A 3EGVA 1UWVA 1BHJA 2Z6AA 2PLWA 2PSSA 3FYDA 5DXJA 4V0RA 3E8SA 2XVMA 4LWPA 2AR0A 1G38A 4M7RA 2HR1A 2OY0A 4FR0A 3KQVA 5GOZA 5DX8A 2P3OA 5EGSA 5DTQA 3EMDA 4KDRA 5GM2A 3G8AA 3T7TA 5CM2Z 5HIIA 2AVDA 3ID6C 4EKIA 5BXYA 4PIMA 2PBFA 2I62A 4C4AA 3BGIA 2PXCA 2OO3A 1SG9A 2ZBRA 2HV9A 1R18A 2IBTA 3ELDA 5E9QA 2BM8A 2YR0A 2C7OA 5FA5A 3NJRA 4G56A 4C05A 3HM2A 3MAGA 3LCCA 1UFKA 2AOUB 1I9GA 4HTFA 3TQSA 4M37A 3M6XA 3FZGA 2ZW9A 4EKGA 5K03A 1RJGA 3DH0A 3FUUA 4QTUB 4Y2HA 3PLAE 4RTSA 1NW6A 4QTTB 3HA5A 1O9HA 1VE3A 4DQ0A 1R74A 2G71A 4CKBA 3BT7A 2PGXA 3FTFA 4U7PB 4UOEA 2ZIEA 4ER7A 4YV2A 2PWYA 1P91A 4GF5A 3OE5A 3HCFA 2AN4A 1X1DA 1NKVA 1VP9A 2ZBQA 1VLMA 4M38A 2FK7A 1G60A 4C06A 1XDSA 4IV8A 1EQAA 4QQNA 1JG3A 3UBTA 4RTKA 1EAMA 3B3JA 3M6WA 2JJQA 4PYIA 5EG5A 1NV8A 1R6AA 3EVCA 4KWCA 2P1DA 1NBIA 1KXZA 1B42A 1SVUA 2AVNA 3NMUF 1JSZA 3Q87B 3GRYA 1XXLA 5FULA 3FPHA 2AZTA 3KPYA 2AOXA 1NV9A 3OFKA 4CWAA 2GS9A 3FYCA 1RJDA 1UIRA 5E1BA 4YUWA 5C0OE 5KQSA 5K0GA 3KKZA 2OB1A 2H1RA 2BM9A 3BWBA 3KPVA 3KQOA 3KQMA 3KU1A 4C03A 2CWWA 4FT4A 3GRZA 1ORIA 4R6WA 1FP2A 2KW5A 5CUQA 5GINE 4KRGA 2IDKA 4C04A 5EQJB 5LQKA 1EIZA 4QVKA 5DM2A 1AF7A 4KIFA 5DX1A 4YV1A 1AQJA 3KQYA 3CGGA 3CC8A 4RSRA 2AOTB 5CVEA 4FT2A 5DT2A 5ICGA 2IH4A 4DMGA 2G8NA 2PWPA 4E30A 3EEYA 4NECA 1L3CA 3E7PA 4HSGA 3LCUA 4FGZA 3TOSA 1DUSA 2NYUA 3LBFA 4FP9A 1JG1A 1X1CA 3HCCA 3QV2A 3SSNA 4HG2A 3UJBA 2FYTA 1DCTA 5EMMA 1SUSA 3HVHA 2WA1A
chains in the Genus database with same CATH superfamily
2QN7A 2HCJB 3OCCA 1ONOA 2RC5A 3LV8A 5TMBA 5KU7A 3LQRA 3V2HA 5EP2A 5HKOA 5K0TA 3U19A 4CXMA 4B3FX 1F5SA 1SOVA 2XNHA 3NUQA 5EPOA 5ILGA 1QQ6A 5TXGA 4JUBA 2Z1MA 5KWIA 2AOUA 3EOZA 1DWPA 1FLAA 3MINA 3ES9A 1AK2A 3GR6A 4IRXA 4DNOA 1YE3A 3AOEC 1XD2A 3IJEB 1QZXA 3NDPA 1W48A 1ZKDA 2FMKA 3P9QA 4OJKA 4EAAA 2DBVO 3DTTA 4ZDKA 3AC0A 4KL8S 4BGUA 3X2SA 2JFQA 2V4ZA 3KAPA 3VPCA 1QQ7A 2FEOA 4DQXA 5BUCA 1P1FA 2X5NA 3OZWA 1M2GA 3HBMA 2RIRA 5F3DA 3O90A 4OQFA 3UENA 1QO9A 5AVQA 3HZOA 1XZNA 3QU4A 4IL5A 5JTUA 2LE0A 2H1HA 1Q50A 1JEYB 3HXLA 3GBSA 3QXGA 4M87A 4RANA 4JSRA 1GTRA 1QKIA 5MFZA 1FB5A 3QNMA 2FPPA 2FKNA 2WINI 5F2OA 1E3MA 4C6TB 1TC1A 4BN4A 5AW1A 1ZK1A 2DH5A 5LNK1 4D4IA 3PC7A 2V7QD 4WUTA 5LSAA 2J45A 4PCLA 1VHJA 3ONWA 4N0QA 1DDIA 2RK6A 3LG2A 3PPXA 1ZGAA 1U8TA 3SX2A 5F5NA 3U7QB 5B64A 3PWTA 3ZS8A 5D5PA 5DF1A 3OVMA 3A1TA 1E6UA 4NK5A 5DDIP 1LW6E 1V8FA 4O4IB 4TSFD 4Z0TA 3KR1A 2ZJ1A 1UPCA 1QTRA 4E14A 3R3SA 2ZETA 2V58A 4FHCA 4BNDB 3AU8A 3ND7A 4GOND 1DQRA 4Q82A 3ROGA 4MMYB 1DHRA 4AJPA 4ER3A 2Q4OA 2AOTA 2ERXA 4IEEA 4W9NA 5ARCA 2OTCA 1DQNA 3H4TA 1C8VB 1M1YE 2O48X 4GR9A 4WXYB 5G53C 5MF6A 2A6PA 4MO2A 4E70A 4R40A 1N2IA 4Z1OA 5JV5A 4HZUB 1BKYA 2QVCA 2SKCA 4M36A 4Z8YA 4PYLA 5THKA 4D8VA 1IBMB 3ZXXA 4TS4A 2JKVA 1PN3A 2XRFA 3N8DA 2JI6A 3DA8A 2X58A 3IQZA 4G65A 4RVDA 5EIHA 3W6NA 3GQBB 2O2SA 2XX3A 2AUMA 1VL6A 4REOA 3EZ9A 4IH1A 5AW0A 3GLGB 4ZVMA 1DRWA 1CJCA 3VU9B 4U39A 1H4VB 4TRMA 5LXTA 4URYR 3BXPA 1PJZA 2C2HA 4AF6A 1NOKA 4E3WA 4NULA 4A8JB 1YBMA 4L5JA 3JRXA 2IITA 4OHVA 4RPCA 4U1RA 2V45A 4D9BA 4CQNA 4O0MA 1KGSA 3T5CA 4HF7A 4TSRA 1HMYA 4HDKB 5HBGA 2BGWA 2X8JA 4GKVA 5BO5A 3OJ0A 1OB2A 2CL6X 2GZ2A 4G5HA 4JLPA 4PLFA 1LJLA 1RZVA 1Y98A 4XQ9A 5ERYA 5EHGA 1WXWA 3AB8A 3G9ZA 3TLBA 5HJ5A 2MIIA 3TSZA 3UC9A 4DLNA 1RE0A 3PFCA 1SD1A 1BHSA 2SCUA 2J0SA 3OZGA 3MBOA 1N9ZA 4EG8A 1I2BA 4EW1A 1OI2A 4JITA 3R9XB 3FRJA 4QQFA 5E4YA 1GTL1 4M1OA 1KPGA 3H86A 4WCVA 2WQ7A 2O8DA 1GRQA 1HDGO 2ZBVA 3U3JA 5ALQA 2VQEB 3IUYA 2HF2A 3NDBB 1LI5A 1UQTA 4S1OA 2AA3A 2C2MA 1ENYA 2R6FA 1KPIA 3BE5A 4ACAA 4BQRA 3IT0A 2AZDA 7ADHA 5DNDA 4GL2A 1Y0BA 4RK0A 4E7PA 3F9IA 3RUCA 4JBYA 3WBBA 4RVHA 1EXNA 3KVOA 3KO8A 2PNJA 1L6RA 5CT8A 3GEGA 4XD7A 3FMPB 3HKBB 3PD0A 3AEUB 2JCXA 5H5JA 5B1DA 5LOVF 3I72A 4XJVA 1O0BA 2EHDA 3WLIA 1IWOA 1P1CA 1UBEA 5ALZA 3WA7A 4O33A 1P2UA 3UVEA 4HNRA 4JQOA 5K05A 3OPXA 2HH9A 2HFJA 4L3WA 3UUEA 5ENDA 2Y0BA 1G5IA 4X24A 4Y9TA 4X7BA 1AGXA 1EH5A 5B1HA 2IPLA 4FE4A 3EDYA 1U0GA 4KJZA 1XT6A 2FWPA 3HY4A 4UNSA 3NHWA 3OF3A 4L0QA 2JZCA 4CPDA 6REQA 2HJWA 1AZWA 1HQKA 3FMFA 2C03A 4QELA 3GVCA 2BYTA 5DM1A 1KMMA 2FW9A 2OMEA 1YDHA 3FTCA 1NA5A 2BWJA 1IEWA 2X1LA 2YICA 2JGAA 3R7BA 4EBFA 1XAIA 1ZKMA 3GC6A 1K9VF 1AZTA 2OCXA 4G07A 1H9AA 3BE4A 5DWDA 1UBKS 2Y68A 4MZXA 3COJA 1E63A 1JILA 1KJNA 4TLMB 4AMBA 4QBTA 4KGVA 3I61A 2RGNA 1V8OA 4G63A 4BNVA 2XOKA 2IXAA 4RADA 5DSXA 1PK8A 4DRXB 3Q2KA 3HKCA 1MGPA 5LMZA 2VJPA 1Z88A 3KWJA 3BSFA 4J16C 3PWKA 5LOVA 4JUIA 4LUCA 4F6LA 4EHFA 3UYKA 4TVOA 5AVYA 1IQPA 5H3LA 3RS8A 3UK7A 5J9FA 3MN1A 1NW5A 4QUAA 3RS9A 3M33A 3TZ6A 4I4NA 1KDTA 3LXXA 3EARA 1VG8A 3PSHA 4IBOA 4R9VA 3U1TA 3TMKA 4A8JC 3C6BA 2XI4A 4Q3EA 3LOQA 4ID3A 4EELA 4EHBA 5KI6A 1KOFA 5JRZA 2WFMA 3B8HA 1KOGA 4S0XA 3BPSA 5CYOA 5DBHX 2R5WA 3CUWA 1U8ZA 2A14A 2ACVA 4QHTA 2EQBA 4N8SA 3PYLA 5U1PA 4ZK6A 3SEZA 1AUQA 2PL5A 1JEAA 4KZPA 3O0DA 3V7FA 3WGNA 1FNSA 1UCFA 4UAGA 4XM2A 2UZ4A 4FM9A 2FOIA 3BJZA 5KTYA 2PRYA 4H31A 4EI8A 2OHJA 1NVWQ 2Z2YA 2ZJ2A 1EE9A 4TL8A 3II6X 2BEWA 1UF9A 2CLOB 3HN6A 1UMCB 3DXXA 5I9TA 3UB4A 4ETNA 6LDHA 5EIWA 1ZUWA 4M9UA 2GEFA 5LLDA 3GGSA 1VJCA 3Q6NA 3T9EA 3D6AA 2GHIA 1U9CA 1I3LA 3CVOA 1EGHA 4UDNA 1R6XA 1RTTA 1HZJA 2VSOA 4GKKB 4ALNA 1UKZA 1RC1A 2OESA 4GXTA 4ENSA 4PW0A 3AFGA 5BSUA 4AUMA 3OZUA 4BVGA 1CF4A 2R25B 3BKXA 2JBAA 3N8HA 2BBTA 1BH6A 4YAOA 1Z29A 1ZCFA 5TGZA 2PE5A 4G23A 5KB3A 3AQIA 4F5YA 4CL2A 4OF4A 4MIEA 1UK8A 2EKPA 3ESAA 1NF9A 1XZIA 3CKMA 4KBFA 3K8QA 3WISA 4QE3A 1V8BA 3OQPA 4IRUB 3OH8A 2J41A 2V03A 3FR8A 1FU7A 3JQCA 2ADOA 3QF4B 4I2NA 4E7OA 4WH0A 2QJFA 2JKYA 3FUXA 1R4MB 4BBJA 5F5LA 3SDZA 4ENVA 1W88B 4MR9A 3DZHA 4Y7DA 5DASA 4HNSA 3TUZC 5EZSA 1VHQA 4NU0A 5J4VA 1SEVA 2XQKA 4J6FA 2YOGA 1K92A 1DTWB 4JB8A 1B8VA 3DWIA 3CNBA 4IZOA 2HJ9A 5TQVA 2ANBA 3ESCA 2WIDA 1C7RA 2OC4A 1TA0A 1Z7BA 2AG0A 3RV3A 3QE4A 4C0BA 5JSQA 3NBAA 5KYXA 2G88A 1MABB 3F1KA 4K9LA 1GNTA 2INGX 3VR6H 3PSAA 1CUEA 1C7JA 2FZ5A 4G9GA 3T1QA 5DTMA 3O4IA 1GYQA 1J8QA 4DV3B 4RD1A 3UHFA 1JHPA 2O1EA 4XKJA 3RJZA 3S55A 4XOIA 1C29B 2AZMA 4G2TA 3JQRA 4RMJA 2ZJ3A 1RAAA 3B6EA 3CT6A 9MHTA 1BE0A 3UANA 3H2YA 1KK2A 1RXEA 1I4EB 1P2GA 1TLLA 4Z99A 1EKXA 3FKJA 2VQSA 1B0UA 3GFRA 4RBNA 1ZVQA 4R7GA 4PS1A 5F77A 1OBCA 3X0DA 3HY3A 3GZNB 2Y8EA 2QW0X 4QU9A 4LI0A 4K87A 5COQA 3UEOA 4BTVA 5KUTA 3KKQA 5KOJA 3TBKA 2JIZD 2W7TA 3K1YA 4Z2AA 4LRUA 3Q11A 2Q1XA 3DEYX 4HRAA 1U8UA 5D3MA 5DH9A 1BFKA 4WKPA 1Y37A 3NM4A 4N1AA 2X3YA 3JARA 2O2HA 4D99A 4ENQA 2Q41A 1AMUA 4EYSA 1UP4A 3TF5A 2CJXA 3KZNA 3ON5A 3PFHA 1ESEA 1R0SA 1Y3BE 1T2CA 1NQAO 1OZFA 4FMPA 5AVJA 4Q9LA 2Y27A 3I32A 4HXEB 3T3GA 4J2HA 2FW7A 1LD3A 1OC4A 1JAZA 1RQPA 3GLKA 1WU7A 2HZBA 1BVHA 2ACWA 1AGRA 1COWA 3I3OA 4F8JA 5B4UA 1ZN7A 3WGGA 2YX1A 5A2GA 1P4HA 4XJXA 1DC8A 1XQ9A 3GO4A 2AMYA 3U40A 1XJ0A 1V16B 5BR4A 1MN6A 3WGOA 4XVCA 2DHCA 3IURA 3JD1A 1IY8A 3PGKA 1E6LA 1GT6A 4BQSA 1YK0A 1E4EB 4WINA 5AJWA 3MT8A 4TV9F 3LC0A 4A6EA 3WDMA 2GHRA 4ANFA 4IH9A 3AWIA 3BJMA 4I5DA 4F4HA 2BN4A 3B2NA 3JAKB 4FFPA 1XQWA 1YUBA 2PTHA 5HDQA 3AUYA 3NJ8A 3OJEA 4WKNA 4Y6RA 5AKLA 4ZZ0A 1A72A 2CUZA 1TJPB 3EDQA 3PD7A 3IP1A 3I0MA 4QWMA 3VPSA 3ZUPA 4A8TA 2IUSA 3ORFA 4Q3KA 4ZMRA 1CTQA 4UTNA 2A5DA 2FE1A 1EP3B 3DXYA 1E6CA 2EBWA 2GVZC 4RYDA 3S8MA 3ZTTA 5KWSA 5IABA 1XRMA 5J47A 3C15C 3ROMA 4AURA 5F2EA 4N01A 5DGTA 3R7FA 3R8CA 2P8JA 4LDRA 3AEXA 3OU7A 4JJ7A 2W71A 4JOCA 1O9BA 4U7FA 4TKVA 3TSOA 5BN3A 4E51A 3V7YA 2PAFA 1QQBA 4MW2A 2Z6AA 3ZE7A 5T7BA 4MIYA 4BB0A 1TUEA 5MGNA 1RABA 2ZUCA 1L7QA 7ABPA 1ZHOA 1BU8A 3DE1X 3PGLA 3KVRA 5K3CA 4ZKDA 3CPJB 3V4RA 2ZJFA 1KIFA 3MMPA 4P22A 3WIUA 1TYBE 5DGDA 1RRFA 1TT5A 5HQ3A 3MRTA 2K87A 5CLFA 1T9DA 3G8DA 4P31A 1KDVA 1JDVA 3KXPA 1N5OX 3KUDA 4X3PA 2DLCX 4U2EA 3IBSA 4BECA 2AQKA 2B7CA 3QPCA 1M76A 2ZB8A 4PNPA 4TTVA 3RARA 3IUQA 3THWA 2HT1A 1XDGA 1U7XA 1Z9BA 3ROEA 3NV7A 4WZAB 4F1JA 1EZZA 3C3EA 1E3QA 1JIQA 2PXHA 1Z6PA 2WYIA 3NBKA 3W34A 1W1IA 4QG7A 3RTAA 1KEEA 1BE8A 2PZBA 3B51X 3ESQA 3GYGA 3JQEA 1W52X 3KTOA 4QTUB 2C61A 4KVGA 1MTOA 3GVIA 1AHHA 1R5JA 1QO0D 3R5JA 1NUPA 4P4SA 3O5AA 1NXOA 1M1YA 4QLOA 4C6RA 3FTFA 2CVHA 3KEQA 1HDXA 3NI2A 4GSYA 2P11A 4IIYA 4PSDA 4V0SA 4GP7A 4A0RA 1DCMA 2JHGA 1GR0A 5SV2A 4IQGA 3KWFA 2QTBA 5AI4A 5CRIA 1XHFA 4H3VA 5G0UA 2O8BA 4L9SA 3ZDXB 1F8XA 3OAAD 3JQ7A 3EAFA 3LUJA 4HB0A 1JNYA 3C1TA 2VZ8A 4L5CA 4OB6A 2VRCD 1CRZA 5E7MA 1A8QA 3B1YA 3WLNA 3OQNA 3M4JA 5JISA 3NMUF 3SOZA 3RVNA 4BX8A 4HX2A 4P1ZA 4OX9B 3SK0A 4RMIA 3ODPA 5C3UA 2GRUA 1E94E 1UIRA 1FW8A 4Q03A 2HW8A 2DT8A 3N2GB 2OK8A 3F6EX 4KN6A 2VZLA 4GXQA 2OB1A 1ONSA 1CY4A 1MUUA 4UXHA 5C8VA 2J3KA 1PFYA 5CJPA 3LA6A 3KKMA 3NC0C 1FP2A 3CUTA 2YHIB 3OE1A 5ALMA 1UUFA 3BWXA 4BQPA 4JDUA 2OCAA 5K8IA 4OK5A 1UXHA 1D4AA 4CF6A 4BJ5A 3FROA 4JK3A 4JODA 4LYHA 2ZRLA 3OUZA 4FFRA 4NECA 3DL2A 2DTDA 1ZR4A 1E3WB 1PX2A 2XGGA 2JARA 3I45A 4ESOA 3CVWA 1HX7A 1U2GA 3KDAA 1VJDA 1RWNA 5FPPA 1FYDA 3CUKA 3UJBA 2FSUA 4EATA 2BHNA 1P0MA 4GKBA 1NI5A 1YBAA 1RFLA 3C8DA 3S3TA 3THYA 2O6HA 2ZTUA 1PS8A 1XELA 4FHGA 4CN9A 1J8MF 1JF8A 3E2PA 3TMYA 2G3YA 3PEWA 4YPFA 2PMWB 3F47A 1ONPA 5FXMA 5F9MA 1JR6A 3ABIA 1CHNA 3HB0A 1Z4KA 5BXQC 4RCVA 4E2WA 1R5NA 5J1SB 2OCPA 4YRFA 3D7LA 4RO0A 2ABWA 1SVSA 3HG7A 1SN7A 4JYCA 4A03A 2FKAA 2HM7A 1HOTA 4MKIA 4OX9Y 1EA7A 2B7BA 2WWGA 3PE6A 4MYUA 3FAZA 3V2UA 1DZ3A 3VR4H 3K94A 3Q8MA 1G98A 3KFXA 3CWZA 5FEMA 2P78A 1C7ZA 2B20A 4I9FA 1M2NA 4ZTZB 5H83A 5I9SA 3EEQA 3STHA 5CPBA 1WU8A 4WVLA 2B8JA 1D0SA 2H8GA 5REQB 1ZSVA 3ET5A 2G1JA 3OF2A 3V34A 4WXRA 3I58A 1VL5A 2Q0XA 2J9XB 2V1XA 1YRHA 1AQ6A 2E55A 4WBNF 3ER9A 3PFWO 1N6LA 3GJXC 4ETIA 4FKBA 4GMKA 3RQSA 1QMGA 5AFSA 1R9JA 1W8IA 3OEHA 2WTAA 1G3IA 3AJRA 3F4BA 4RLHA 2CJWB 3S1AA 3QI7A 1TF5A 4ZJZA 3KEOA 1JG4A 4NMLA 3S7TA 4QO8A 2NGRA 1D1PA 1P44A 1R8JA 2OQ2A 4G24A 4RQUA 1ORHA 3RGGA 1OFHA 1NHGA 2FR8C 2Z2KA 1HQDA 2G6TA 3MBKA 4EL5A 5EGNA 3P2IA 1FFCA 1N1DA 1B7GO 1WA5A 2XYVA 5BWLA 1YR6A 3RUPA 3AEKA 2H2GA 2C2OA 1CUGA 2APJA 4LPKA 1KHTA 3OCXA 4QGAA 1N5LA 2PLNA 2Q3JA 1ZZEA 1B16A 1M54A 2ZT8A 2OAQ1 4YWJA 1L5FA 4BC0A 2O2YA 2PUAA 4JS0A 1QB8A 4LJSA 2ZBGA 3C6ZA 2P5YA 3AR7A 2GZDA 1TEVA 1W9MA 3CWQA 1DWOA 4BMSA 1BE1A 2PTGA 2W93A 4JKYA 5D1NA 1OBOA 5IJZA 1A97A 4QG3A 4B31A 4RC9A 3AEYA 1MBZA 2H48A 4W5JA 3SXPA 4QTYA 1HR0B 1BROA 2J4CA 3SX0A 1OKKD 4RYLA 2V7PA 1Z0UA 3P9XA 2XT6A 4HEA1 5HPYB 2RD2A 5JXHA 5BN5A 5H9WA 1LPPA 3GJTA 2EU8A 1AS3A 3TMAA 3QEBZ 1OT5A 1SA0B 1Y1QA 3MYRA 2WWFA 4Z9XA 4DMLA 1DIGA 2CYBA 3DMGA 2IZZA 3E5HA 3IHKA 1NE2A 2F90A 2CV0A 2UZ1A 3KVYA 3TW8A 1Y6RA 4GPIB 3V3TA 5EJ2A 1WETA 1G1AA 1FW6A 1T8YA 3CKYA 3PEFA 3QVTA 4DARA 1N57A 4IUBS 1KQOA 2QNIA 5EE9A 1EXWA 1HEYA 5FPQA 3OEWA 2COUA 2QN8A 2J08A 1KU0A 4HN2A 3REOA 4LHVA 5A3QA 4HDCA 4RJIA 1XQ6A 5LZ4A 4PGHA 4ZHQB 3CZPA 3A1NA 2QRPA 2XE6A 1EG2A 4GWGA 5BVGA 3ORHA 1EWQA 3IHTA 4CVNA 3FHOA 2VUTA 2C83A 2QRQA 4G0XA 1I3OA 4LXUA 2REQB 4UFPA 2QF7A 5LZ5A 2OBYA 3AP3A 5AHRA 2XV1A 5IARA 4MUKA 4FN4A 4MA4A 1II8A 3KQLA 1EIWA 3T95A 3EGOA 2YNMD 1NUHA 4HH0A 2VSXA 3L4EA 5HSGA 3OLVA 5G1PA 4P38A 1Z35A 1WXEA 1U2EA 2P9CA 1RU3A 1ZIXA 2XDQB 3O26A 1OAKA 4UVDA 3SS7X 4WZBE 1U7OA 4FS8A 4FFOA 1SC4A 2FGJA 1JAYA 1FFHA 4A0FA 1MZVA 5C5CA 3VC2A 5GM1A 2PZLA 2VDPB 3I52A 1UC5B 5IWAB 2X0IA 1CR6A 1O77A 1IATA 3LSYA 1UJ6A 1T2VA 4EG0A 1FEZA 2VWQA 3U60B 5C1OA 2FPOA 2GQ0A 4LZJA 4EGSA 3KQNA 1T6YA 1N92A 1WXQA 4O2AB 2AD1A 3H2HA 3N1UA 1V0JA 4KYVA 2XUJA 5FBZA 2Z9DA 1TADA 3KR9A 4AWXA 5CD1A 3BD9A 2DKOA 4DS3A 1T35A 1F2UA 1H2XA 3T9AA 3E48A 2GCNA 4LXGA 1IHYA 1NNLA 4KR0A 4M9RA 3KRTA 5G3ZA 3G13A 4KPGA 3RW9A 3GGOA 3UA3A 1HK7A 1NP3A 1XTKA 3HCPA 3NHSA 4W5NA 2DSTA 4FSDA 4UEJA 4EEZA 3LO8A 1UQUA 4NNOA 1M6WA 3CUUA 3CPEA 4PR3A 1E3JA 4H7HA 1XKTA 1C30B 2R6GA 3FPKA 3N28A 4RCYA 4UHCA 5ADUS 1GKIA 1JZTA 5LU8A 1P2FA 3AUFA 3EVNA 2AN9A 4H4CA 4RH0A 5F1YA 3VYSB 2P4EA 4FXPA 4PHHA 4BWFB 4OIMA 4F56A 5DX0A 3ZGXA 1YCDA 2W2LD 3DEAA 1SPXA 4D44A 4FU0A 1L9KA 2ZSAA 1SCJA 3KD2A 3TK1A 1U3CA 4MGIR 3CMMA 3LRTA 5JIBA 3ZGNA 1NKTA 4J75A 5AMXA 2FWJA 2P9TA 4HVLA 3P9IA 2BIFA 2BHSA 3KFLA 5DZSA 1VE5A 1C9EA 1QHHB 3QIVA 3WYGA 2NMVA 3WICA 1SU7A 1JHUA 5K4GA 1MPTA 1GV1A 4V24A 1D2AA 3D9QX 2VCEA 5C3MA 4LF4B 3W5SA 5AJYA 4HDSB 4JC0A 5IW8A 4EHIA 1C9KA 1G8GA 5B6PA 2WSBA 1M6VB 4CV0A 5LMNB 1OBFO 2IKQA 3CR8A 3SEFA 2I8LA 4A4DA 3OQJA 4C0LA 2B8TA 2H00A 3CXUA 3VOBA 3W2HA 2Q0QA 5K3BA 4R69A 3N6RA 3F7MA 1V48A 2V4MA 4JEIA 3UAYA 3ZE8A 2FMHA 4C0JA 3FYUB 4XGNA 3UC5A 4BEVA 4NBKA 5NLLA 2NSJA 4GMXA 1MO5A 2X2OA 2ZWVA 1Y9AA 4LQ4A 3SHVA 4M54A 1I6WA 2EC5A 2P5TB 3NIFB 2BP7B 3LWDA 2GO1A 2J30A 1WKVA 1PEAA 4F9EA 5E9JA 4EWLA 1GGKA 1UOQA 1S3FA 5HIJA 3LDFA 4N8EA 4R1LA 3A05A 4U6SA 4WDRA 2FPGA 1ISJA 2VRNA 1E77A 4KQWA 5B55A 5IHPA 1SVKA 4I3HA 2NU8A 1D1SA 2I1WA 2I1QA 1BS1A 2OCYC 1RKUA 3DL7A 3B13B 2V7XA 3QPAA 2R8PA 1VLQA 1M33A 3O8QB 4B7ZA 5FJJA 1NVVQ 3DEJA 2HQSA 1FVOA 4N5IX 3IBCA 3T7RA 4C3UA 4Y2YA 2ZQZA 2FQQA 1RVDA 5SYNA 1EWRA 2JVKA 1MEEA 4NVRA 1YDGA 1ADJA 4RA6B 4CKEB 3FJ1A 2Z6QA 3LKZA 3WVNA 2HJSA 3PFIA 4V0KA 1T34A 3BFVA 3BZUA 3B7WA 2QN6A 2SECE 1NYQA 4PRKA 1GNVA 1L4NA 4AP9A 1WZNA 4AMYA 2DAPA 1T2NA 2NG1A 1OLXB 1FU4A 3WTCA 1ZHFA 3P71T 2WU1A 2CLMB 4L6IA 4MROA 3SC6A 1G6HA 4KQJA 4LTDA 4B0OA 4DV4B 4AY6A 4A2PA 4J7AA 1MMFB 3WB9A 4L7VA 2GYVA 3O4FA 1O1YA 2R3SA 2X7XA 4LOAA 2IH2A 1H1DA 2AX3A 2C9OA 1W19A 4RLFA 3SHQA 2I87A 4BRUA 5T57A 3L4KA 3DVAA 4CEHA 1ZJWA 1A5SB 2QB5A 3BTVA 2ATIA 3FSRA 3HCEA 1W8DA 3OIYA 3WO0A 3FDXA 1K97A 4MQLA 5CLQA 1PS9A 1JFTA 4YRCA 2Q07A 2BAGA 4R8RA 3PUJA 4V1CI 2XD4A 3KQSA 5JQGF 3FZQA 2GH1A 2H07A 3K8OE 4N5DA 2YL2A 2OKCA 4GIBA 4D74A 3FUWA 1P6QA 3TTSA 3L49A 2OGZA 4F4JA 4HPXB 4ID9A 2ZATA 4QOSA 3ZZ0A 1P1JA 3IDOA 4D3ZA 1HL7A 5GONB 3RS5A 4ZDJA 3E9NA 4P5EA 1Z3CA 5DNEA 4UTPA 4YP0A 3FIUA 4N5HX 5DHFA 4D0GA 3LT0A 1OYVA 3VJKA 3U6KA 2N42A 3KSAC 3RG8A 1CV2A 1F9AA 1WUHS 5AM5A 1AA9A 3O38A 1ST2A 3GJ5A 3NTQA 4UPDA 3RI3A 4A92A 5F21A 4BO1A 4ALJA 1X1TA 2DECA 5E1DA 2GETA 1LTQA 1BRTA 1PDWA 3TGLA 2R8ZA 1N2ZA 2WC1A 2F2TA 3E7WA 1DLJA 4QGGA 1F51E 1SUIA 2QRZA 1JIXA 4LX0A 2VHVA 1ZITA 1YQ9A 1T4CB 3FYUC 3OWOA 2IHVA 2JHCA 3L46A 4GVLA 5TPWB 1ZK2A 3SSMA 4EO7A 3DT9A 2MINB 4J1TA 3PD1A 1QANA 4TXMA 2CJPA 2YTZA 2GCIA 5ALNA 5ECYA 2B61A 2YN4A 5B57C 3OKFA 3R74A 2JIDA 4F84A 1NVVR 4YUXA 3HA7A 5FYQA 1RPTA 4X20A 4AT1A 4LN1A 4RVGA 4UBLA 5FPKA 2ESRA 5AIBA 4Q4HB 5EKSA 4MR8B 3I0ZA 2A9QA 3OZEA 3ZHBA 1NN0A 4V0QA 5JQGA 1E6EA 2UYCA 4JBLA 1H8HA 1O94A 1PO7A 3DFFA 1C81A 4V0LA 2G4CA 3QPVA 3R0VA 4RHTA 4XQCA 3EVEA 1JJIA 3RSFA 2D1QA 5D3ZA 4AYWA 5CEFA 2F59A 2JD1A 3MTGA 4Y1FA 4HQLA 4AW9A 1N3YA 3IBYA 1LLFA 2N9UA 4EFKA 3AKZA 1IBKB 3H2JA 5TDHA 2I66A 4Q3DA 1K3TA 3KLBA 4L0DA 2YKGA 3R5XA 5C1IA 4TS1A 3IR5A 1CT9A 1E79A 2N46A 4RJKA 4GFDA 4WI1A 1PW5A 2QZ9A 1DAOA 4J0QA 2V6JA 2NZUG 1J2EA 1JB9A 2YFKA 3BFJA 4CCYA 1G64A 1ZIOA 2D2IA 2Q2QA 2W00A 3HDJA 4C9BA 2PSSA 5A9RA 4MUIA 4ND8B 1QLHA 3T99A 1I5OA 1IM5A 2QD3A 1UODA 1RJ9B 1O6ZA 3RYHA 5HCUA 1RQLA 2Q2OA 2D62A 4KV7A 3OCZA 5FV4A 1I6MA 6GPBA 1ESMA 2HA7A 3LP8A 4YHBA 4X8HA 4EKIA 1S9HA 3MQ4A 4C3VA 2ZROA 3U7HB 1GU7A 4RD2A 3VDQA 3E9RA 2Z98A 1GL7A 1IOWA 2R6HA 2VXYA 3F7NA 1NYLA 3FTQA 1FPMA 3IRUA 4BFCA 4CM3A 4E13A 1ADFA 1SKAA 2EFDB 2I9PA 4FHEA 3ZW8A 1QONA 4HZGA 5CDFE 3PC8A 1RQ7A 2QQFA 5AO9A 1OI4A 1W9HA 5K6TA 3C16C 1U04A 2HCBA 4PANA 1UZAA 4AJKA 2CXRA 2IE0A 4IVQA 2GSWA 2A9OA 1E3EA 1YUMA 1UPFA 1I13A 1PGOA 1HA3A 2G71A 3D0KA 4CKBA 3RC3A 4JBWA 4M3NA 3BT7A 2HSJA 3ZVNA 2ZIEA 2I0FA 1B4DA 1ECLA 1P1KA 3JR7A 3HWRA 4PO9A 3DAHA 3LIIA 1NKVA 1U2QA 2VPTA 4PS0A 1P0QA 2H7VA 7YASA 1IB0A 2OFPA 3UKOA 1TM3E 1NTOA 2YHBA 2X0EA 1UFQA 4PYIA 4BBPA 2I2BA 1IONA 2XRZA 4FE7A 2FRVA 5AR1A 4EMTA 1K7FB 2GYWA 1KXZA 3DB2A 3EQZA 1TVMA 3WFZA 3GRYA 2CUKA 4P2GA 2XUHA 1Q16A 4C0WA 3LP5A 1V3QE 4YA6A 4CMAA 1XCMA 3FVQA 1KFKB 2XF8A 3CO0S 3KL2A 5DHUA 3FOFC 5K0GA 1WO8A 2Q2NA 3ETJA 4IILA 4DTIA 1MAAA 2F1JA 5HS4A 3BH0A 1T9AA 1A9SA 1YULA 3U9SA 5KJ1A 1SOWA 4RCZA 3K9BA 1RYEA 2HA5A 1ORIA 2ZIXB 5KQLA 3O75A 4L4SA 1BG6A 1NMEA 1QVAA 2FPUA 1JFVA 4OPMA 3CVUA 1WPRA 3MWFA 4NONA 1CDDA 3PI6A 3PRHA 2QRNA 2GN4A 4BKOA 1A50B 4FEAA 4UDOA 1CZHA 1YJBA 2IIQA 3QX9A 2R87A 5GJWC 1S01A 2GASA 2B4RO 3F5QA 3U4GA 4A91A 1NHWA 3U3ZA 5BW8A 1TYDE 1FP6A 3I1JA 2CLDX 1GILA 1L3CA 4R2LA 2Y92A 3PI7A 4KLCA 3RASA 2CL0X 3IX7A 3O2SB 3THXB 1ZXBA 4MI1A 5A05A 4OYYA 3ZU2A 3TB6A 1UINA 4IF6A 4DRZA 4MR7B 4CQMB 2CWDA 1DV1A 2E18A 2PKCA 5HFNA 2II6A 4CR7A 4WFQA 3G02A 2PIDA 3A6KA 4BO4A 3M8KA 1CPYA 3E0QA 2XXBA 2QXTA 3DE5X 2GTPA 1TUIA 3L02A 4OKNA 4GP9A 2WM2A 3PJFA 4CDRA 1AUXA 1SQSA 1P75A 4HGRA 3COPA 2VYVA 4ZT6A 3HNRA 4YRKA 3RTDA 1BXRB 1DWQA 5F33A 4BQEA 1O7JA 1U2TA 4DPMA 2MU1A 2LCFA 2OYRA 3LVRE 4WZBA 2BM0A 2IELA 3MJCA 5AVOA 4DLPA 4O1HA 6ABPA 1XMIA 1RDFA 4MTLA 5E95A 1GGVA 5DM4A 4ERNA 1L4HA 1OJLA 4RXUA 1MNQA 3DHNA 1PD0A 1IVYA 2CLEB 3DYVA 1AV7A 4PYNA 3CQ9A 1QKJA 2DWOA 4TMZA 4KOEC 3TE6A 1L8AA 2P2LA 3ZDCA 2L2QA 4RH1A 1KI8A 1Z5VA 3FDZB 4AUKA 2WNHA 1SO8A 2FW0A 2J59A 4EPRA 4PZEA 3H8WA 4L4XA 5FIUA 3PQ3A 4FMBB 2JFBA 5K51A 2GNOA 3HVKA 4WLOA 3OOEA 1TAHA 5H9VA 1F0PA 1MAWA 4QLAA 4UHJA 5B4VA 4KK3A 4QYMA 5EHQA 4TWRA 4RGBA 3RTEA 3N2KB 2FLWA 3H1AA 4FNAA 1QLWA 4P2BA 3EVDA 3E05A 3HKEA 5B1SA 1PCXA 1SCNE 1X7XA 2GCOB 3Q7IA 1R00A 2BFOA 5IDVA 3SKYA 3C97A 1OWMA 4YJ2B 2QJTA 1KEKA 1YS4A 2MSDB 4HB3A 1I36A 1V4NA 2Y9PB 2BFEA 3ZHZA 4IDDA 1NXXA 3MPOA 2M9MA 5AJTA 4BL5A 2I65A 3M9WA 2EFHB 4O4JF 3AL0C 4L78A 2R7NA 1NLMA 2LPMA 3SC4A 4BATA 1BDIA 1E9RA 1TCAA 3PHJA 4HYQA 4KOAA 3VFDA 4ECAA 1CRLA 1QWSA 3HI4A 4I4TF 3VGJA 3AH8A 4PYJA 5IAOA 1I01A 2RHLA 3HNOA 3FPJA 1UMDA 1FX0A 1QHFA 4GS5A 5G0VA 1D0VA 1M2OA 2BUCA 2EG9A 4DMUB 3BXZA 2GWHA 2R2GA 4LY3A 2VHQA 5CH3A 3U81A 3A3YA 3N70A 3NP9A 5K4AA 5LA6F 1I0ZA 4M55A 4BTLA 4A15A 1ZIYA 4B3HA 5BMVB 1VMEA 2AJ8A 1O95A 4J43A 5SY4A 1X1AA 1IPHA 1VLZA 4JENA 5IAKA 3KM0A 3VZQA 4E88A 2VTBA 2CT8A 3U09A 2JEOA 4YO7A 2TECE 3LCVB 2X2PA 4QDOA 4DM4A 2IPNA 3ICEA 3W90A 5EXDA 4ZQIA 5CX1B 5HGXA 5DW3A 5KHAA 4LVNA 1DQZA 1RHUA 1H2HA 3IUJA 4C4ZA 1L4KA 1RYFA 1TM4E 3A32A 3PHBE 4IR7A 4WSOA 4JFRA 5L7YA 1IHDA 4O1IA 5FL7A 3RVQA 1F8GA 1PKXA 1VPLA 2C0QA 2Y66A 4WD3A 2QD1A 2ZPUA 4IS2A 1G3RA 3UOAB 2RAPA 3I5YA 2FWIA 3GLRA 4PZLA 1RLUA 2E5FA 2EG5A 1HNXB 3I9V6 3UG6A 1Y3HA 2REOA 3BDVA 3PXUA 4O4JA 3VSCA 1NNEA 2Y76A 1IBSA 2R2AA 1PV4A 1LC0A 1R5OA 3WIOA 4BU0A 4HCJA 1K8XB 2RDMA 4EO4A 4ROSA 1FBNA 2AEEA 1X7ZB 4PM4A 4FINA 3FAKA 3H6GA 2GD6A 1KOJA 1QH0A 1ULSA 1Y5NA 1RT9A 3GH1A 4F4IA 3UTDA 4N6OA 4XB2A 4KFCA 3TJMA 4OP3A 4Z2YA 2WWYA 3AXSA 5LA6A 1UK6A 3D4IA 4AB1A 1OTHA 4HUQA 5C2JB 4QOGA 4LDQA 2O05A 3DT6A 5M04A 4JLJA 4EGJA 4J0GA 3G0BA 3O92A 1R8QA 5AICA 1U0TA 1EFAA 2O14A 3SN6A 3Q3VA 4MARA 3IOEA 3LNCA 2CUTA 4G8DA 3U7FB 1C1YA 5E2IA 3LK7A 2KX7A 3RRMA 4FNGA 1BS2A 1M2FA 1FUUA 1DV2A 1H6CA 2FDCA 2QSZA 2NU7A 3BHJA 1PIWA 2OM6A 2A35A 3P32A 4JFAA 3SQNA 2PFKA 2HDWA 1CR2A 5JALA 3UJ7A 2ZZNA 4O6VA 3T7CA 3NNDA 1WQ1R 1XTQA 1RFGE 1TC2A 4ARBA 1UR5A 5C4IA 4DLAA 1DFIA 2RAVA 3T9DA 1J8DA 1IH8A 3F7OA 1LZKA 3HVJA 5AM1A 3V8NA 1RPZA 4EOGA 4EQ6A 3LVQE 4HWPA 4YXFA 2DPHA 3LOPA 4DAEA 3PDUA 3RE1A 5ECGC 3B38A 4FZ5A 4N5NA 2V98A 5AI6A 5FI0B 3RS3A 3PQDA 5CVDA 2FW8A 2XB4A 1ZMBA 2IU3A 4MQUA 2UXCB 4KE8A 2EEZA 1XKQA 5FOXA 3U6BA 4MB6A 1ITZA 3I9MA 5CEJA 1XL1A 4PC6A 5DBFA 3FNEA 2NIPA 5I7OA 5EXPA 3TNFA 1AKQA 1OYYA 2NZYA 2QRUA 2QTVA 3MLBA 5DIFA 1WUYA 5G0SA 3RAFC 2B2CA 2EX0A 3ZWBA 2ZWPA 1OW3B 1JDNA 1ZPDA 4NABA 1KNXA 2W48A 2W98A 4R3NA 1OFUX 1DQPA 1QPBA 1XZ8A 4ISCA 4EW6A 2OG1A 3UK2A 3LMKA 1WZIA 4NH0A 3GAFA 3OPYI 5DHPA 1DEHA 1GFIA 2B3DA 1K98A 5EXEA 5EYPA 1MV5A 5CEEA 2Q5JA 1X1SA 3OESA 4ABTA 2ZWIA 2IJGX 1QOZA 1QF6A 1LDNA 1VB3A 2X1MA 3DONA 3IL2A 1E2BA 3K53A 2IIPA 3B1KA 5M2QA 1IBLB 4ZI7B 4L27A 3GRPA 3TIXB 1NIJA 1II9A 1JXAA 2FK8A 3AKEA 2J9FA 2JLAA 3E58A 2FVYA 5CHEA 1WXHA 3A37A 1AKVA 2BD0A 2NSLA 3HHPA 3NG1A 4MW9A 1JDUA 4J4TA 4YWHA 4PNHA 3RRYA 2D4AA 3E0XA 2YJZA 1UOPA 3ZLUA 5GV8A 2O9JA 3I92A 2I3BA 3GEPA 2XYHA 3IIKA 4Y6GB 4O4LB 3ZH9B 5KC8A 3G5TA 1UKAA 1KBQA 1FLDA 3V1NA 4R0MA 3EBOA 2ZDHA 3EXEB 2VDRB 1HURA 4WXPA 2QGNA 4DSNA 5K3OA 1CJKC 1E61A 4PGAA 1IM8A 2D1FA 2IHNA 1L7DA 3EPJA 2ZSFA 2H4JA 4Z7JA 5JNWA 4JA2A 3RIYA 2DHEA 5B3AA 3LA8A 5D85A 4KH1A 3DAFA 4JLKA 4GAEA 2XMSA 3ORQA 4WOPA 1TYEB 3RS2A 4D5EA 1DBPA 3IB6A 1JR2A 1F14A 1NONA 2FAXA 3R7LA 4UPEA 3IVGA 4E0BA 1YRAA 3DE7X 2EWWA 5CFQA 5KSOA 4D82A 2VP2A 3LQ1A 4UUNA 4YDSA 5D6OA 1P1BA 5BW6B 3OECA 4KNYA 4S2EA 3D8RA 1HGXA 1T91A 2ST1A 3G68A 4XUGB 4LJ5A 3HGTA 3NWBA 2QTNA 3A4NA 4CLOB 1IPEA 1F0NA 2RC6A 4PFSA 3WJ7A 2W8BB 3QWBA 4I50A 1MC1A 4RTQA 3RS7A 3WK7A 1KDYA 3UHJA 1DJQA 2K2WA 5F9FA 1R0XA 4JGIA 4LJ4A 1C1DA 2B1JA 4GM0A 2FV8A 2PHZA 4YMHA 5KOHB 3FX2A 3H9QA 2ZVPX 4KWEA 5KNDA 4TMFA 1QO7A 5FBKA 2XPCA 5FUBA 4NCHA 2UUOA 3OCJA 1USIA 4PAMA 4QOIA 4L8WB 3NWPA 2VP4A 1CQIB 4KNVA 2NVWA 4JQZA 5CNKA 1JR4A 3CW2A 5DU2A 5ANRB 5EZYB 3RYTC 1PW7A 2YC4C 3K0AB 4ABYA 1D6MA 1E9AA 1WABA 3GMIA 4HGQA 4WK4B 1X42A 4I1UA 4Z1MA 4B3GA 4RUKA 1SOAA 3WV5A 4F91B 1JHVA 1RRPA 3D5EA 1BXGA 3KZXA 3RVKA 3CKKA 3GLGE 3W2TA 4DT1B 4G25A 4IM7A 4M0CA 4HNAA 5JMTA 4G0ZA 1J2YA 3EXG2 1D4ZA 1RS0A 3SGLA 3UHOA 4O02B 2BFAA 3P97A 4TS9A 1F6BA 1FDWA 1W93A 2BKAA 3NIGB 3DDSA 3OA2A 1GCUA 3ELWA 5CDFA 4JJ6A 3DZ8A 5T4BA 3RWMB 2VLBA 2JHFA 5ITZB 5LIPA 5BPHA 4ZAVA 4YAJA 1EFTA 2DUWA 2QS9A 3VRHA 1QIKA 3QVKA 2OVBA 3DPIA 3VI3B 3EEFA 4NENA 4TRNA 4WA7A 4B4OA 1NUTA 4IJWA 5KNCA 1XE3A 1DS6A 3CN9A 5IK2A 4IDHA 3V6LA 1SCIA 4M83A 4MRVA 4BVLA 2BMFA 4LGCA 3G2OA 2P35A 4GI7A 2BMVA 3UFXB 4WN9B 4PG7A 1QCZA 1RKQA 2NP6A 1HNNA 3L6EA 5DI9A 4TMWA 1RXYA 4Y2QA 2H4ZA 5DYGA 3D2LA 4E3ZA 1PJSA 1AQUA 3BD7A 3WMRA 4UARA 5AUOB 5IMSA 4JY7A 4RKWA 2XGSA 4DDUA 1AUPA 2CE7A 4C4RA 2VDJA 7MHTA 3VU3A 1J22A 1YHYA 3VYRB 1FFGA 2ZANA 3AJEA 2X5KO 2VAVA 5KEIA 1RTKA 2DFNA 1V7CA 3G88A 1CUJA 1SVMA 3DF9A 3IEPA 4FFBA 4IYRA 4Y2VA 4R16A 5T5QA 5CPFA 4GX2A 5K09A 5EL0A 5JZSA 3H17A 1Z0FA 3BQNB 3TBHA 1QGAA 2I1VB 2ZI6A 5KTNA 4AJOA 4Z9YA 2VA9A 4IH4A 1DHTA 1YTLA 4QFCA 5EKDA 2ZYTX 2A1UA 1R1DA 2AJCA 2HXYA 4QXPA 4RMNA 5G1OA 3N2LA 4ZYLA 1T2EA 1U5CA 5AXAA 3IP5A 4TXHA 4UVIA 2RBEA 4JJEA 1KJ9A 3EW9A 3LYUA 5EIBD 5JU6A 3GOHA 1WCWA 3W2IA 5ESWA 4JL6A 4IIXA 4A82A 5A0TA 3HDHA 1ID1A 4ZRMA 1KEVA 3RSLA 1N9GB 1M1ZA 3P9KA 4DWJA 4XRGA 3EYWA 1G6Q1 4M22A 3D0OA 1K8YB 2GJ8A 4FYYA 5BVHB 1FP1D 3RU7A 3COYA 1FYEA 2K6GA 4V1CB 2YCLA 3A7DA 4RSGA 1P74A 1KDZA 1BYUA 4ZQFA 4NESA 2WWRA 5H16A 3DAGA 3ZJTA 1MENA 2G9UA 3F6BX 4PQRA 4YP5A 4WPGA 4YMSA 3SQXA 1PFVA 3LTEA 3R0ZA 1ZMRA 5DYNA 2F9LA 2IKSA 1JQKA 3GK3A 5EP4A 2VCYA 3P2JA 4QREA 1Z37A 3I30X 1W5SA 2ZB2A 4DBLC 3OD5A 5MN4A 2NU9A 2G5TA 3P27A 1ZM2A 2ZTVA 2OHIA 1SU4A 1LI4A 3OBIA 5K0SA 1CY0A 1FS4A 1KF0A 2H52A 3FUTA 3OIUA 4HC4A 2B1QA 4HH3C 2A9KA 2YV4A 2ZS8A 1YOBA 4IJ6A 1IRIA 1P7CA 2QLFA 4L76A 4LCBA 1HC7A 1MQSA 2AG1A 3EGVA 3OE7A 4DDMA 1PGJA 3W8RA 1JIVA 3DZGA 2DCUA 2VSFA 2WV7A 1K7CA 3MIIA 1BA2A 1XTTA 3E8SA 3OWHA 4HUJA 3DVSX 4DKXA 5JAMA 1RWMA 4CYMA 2AYYA 3HEBA 2R62A 1N9KA 2GBPA 3EMDA 1ZGGA 2XTAA 3GAAA 4H17A 1LVGA 1SEPA 5A9SB 3SQLA 1R9NA 1TLFA 1G8KA 4G86A 5JMWA 2JAQA 3E7FA 1KYYA 5F52A 1EDBA 4NAVA 1I4TD 1DCKA 2G4VA 4TTAA 5DFAA 1OSNA 1Q74A 4UHDA 3ONDA 3HXQA 2PX3A 2YFYA 5JVDB 3DDHA 1JPVA 4YMWA 3VH4A 3VXKA 1MRZA 1FJHA 3PUXA 4R81A 5IYZB 2VF4X 3J81A 2BM8A 2Z2XA 1H0HA 1S96A 4C7OA 3B3QA 2I33A 5IVDA 1WUIS 1JXQA 5TARA 4BKQA 1Q0QA 1SZJG 2HIHA 3NT5A 5F64A 4M37A 5JZVA 3CNOA 1TKBA 5K03A 1JLMA 5JC1A 1NR7A 2FUEA 4QTTB 3GT7A 3AV3A 3H9CA 3OOJA 4B8ZA 5ISMA 1ZNZA 4QICA 4XD2A 5HXAA 1U3DA 5JASA 1NU8A 1DIBA 1UFOA 4ER7A 1P91A 2FVXA 2XODA 1UXOA 3ZY4A 4YRRA 1KAHA 5ENZA 2XGMA 3EMKA 3BSYA 2A0FA 2LXNA 3I73A 1YFKA 4XLLA 4Z9BA 3T7AA 4QQNA 4US2R 2PUEA 1Q19A 2BY4A 1Y7HA 3UMFA 3BMQA 2WVHA 4KWCA 2QAJA 2ID9A 4YJFB 1GCOA 3PE3A 4HAZA 4PWZA 3F46A 3QU2A 5F1OA 4UW9A 1GPBA 1UMBA 1SBTA 3ETLA 4CWAA 3V6MA 2XQVA 5CT4A 2J09A 1FL9A 3PPIA 2R8EA 3D5QA 3R3VA 1U5BB 4LK2A 3SG0A 2WTBA 4RHYA 4UDYX 1QVVA 3PEUA 1T8UA 3ENQA 3MILA 3H1BA 1XZFA 1EA5A 1WX1A 4EGQA 5CB4F 3AOEA 1Q1NA 2H54A 2B0CA 4IXTA 4MVJD 3T4XA 4MUAA 2VNJA 2VDMB 1UJMA 2M1ZA 3IOMA 3LPLA 5CM8B 4CCAA 4RSRA 2IGBA 3L41A 4RL4A 3TW0A 3ZWCA 2B1RA 1P1RA 2PZEA 2WJPA 3WYNA 2ORWA 3F5SA 2PBZA 2Y0PA 1G7CA 3L7CA 5I7RA 3QV2A 1HNZB 3WLOA 1J2JA 1EUCB 3I8OA 4RJLA 3D3JA 1D03A 2G5PA 3SYKA 4WCFB 5ITVA 1XVUA 1ZRMA 1T3GA 4U6QA 2JFVA 4X45A 3F6SA 4IZIA 3DZIA 4QDKA 1WNTA 1Y9DA 4K81B 1VA4A 3NYRA 1E2MA 3PC4A 5A3VA 4HR7A 1XDDA 2GPYA 3VDXA 4A6PA 1PVDA 3F71A 3GEIA 1IBCA 5FRDA 1XU9A 1CUAA 4K9RA 3VR5A 4MUYA 4O4HB 1I1OA 2NUBA 4J7UA 3ZGVA 1FTGA 3VVCA 2RCYA 2IOFK 3HLKA 1ENPA 1P6XA 3VPBA 1X15A 3WDKA 3EF3A 5ERGB 2X9GA 2OORA 3NXKA 4QOFA 3ZNNA 4MQEB 2QR3A 4GZMA 1M1UA 2NX2A 1A1SA 1JIUA 1E5XA 1V1MB 3NVMB 4N9QA 2CNNA 3R7NA 4B74A 2VF2A 1OVMA 3BE6A 3D3NA 3HV2A 4PAGA 4IGEA 1YE8A 3PR2B 1EFUA 3AHCA 2VJNA 2Q5FA 3RVPA 4RS4A 5P8WA 4BKRA 1HBJA 1N2GA 2PXAA 3QE2A 3SF8A 4ESHA 1U7ZA 3RH0A 3H19A 3TTYA 1EUZA 3HB9A 2V54A 4OQZA 1KDRA 3BK1A 1VLVA 1L4BA 4XYEA 2XWBF 3WE7A 2OV8A 1R37A 2CXOA 2C9ZA 3WL6A 4QAJA 4A8HA 1WSBA 2XAAA 3LVBA 4M6WB 2CV2A 1D8AA 2ZU0C 4MVJP 4MGHA 4PHTA 2OYCA 3TIVA 1TE2A 1X9GA 3BCSA 3F5FA 2GXAA 3RJ5A 2DT5A 5EFZA 2JAWA 3L7JA 1M9NA 4IW3B 1CY7A 2XZLA 2BFDA 5G0TA 4B81A 1F0KA 1PQYA 1SUCA 2VHEA 3FLEA 2OQVA 5CIQA 4U7TB 3L7OA 1LLUA 2NO4A 2R96A 1MB3A 3LE8A 3NEPX 2BGTA 4RJJA 4BDTA 3X43A 3QUAA 1G59A 2BEVB 2HWKA 3SE0A 7REQB 2F8LA 3PP8A 4LDZA 1NURA 3KXIA 3WG9A 1AKYA 4Q3BA 4DMRA 3PNPA 1DX4A 2PJZA 1I3CA 2YYZA 3KEGA 4FEYA 2BUAA 4BO8A 3AESA 4OMDA 1LH0A 1TU3A 1Z8DA 5DP1A 3FM9A 3H97A 4K9NA 4O4IF 5AOBA 2Y9MB 4ESEA 2YXPX 5C8YB 4X1YB 4CKCB 5K8LA 5L51A 3AIOA 3B2EA 1G18A 1ODSA 1KY2A 2D0IA 3WKBA 2JLRA 1LV8A 3KZOA 5B7PA 4FCTA 3OM0A 3IEKA 1G3UA 1G4AE 2R7MA 2GBCA 3RC8A 3DOOA 1D7OA 3BDAA 3HZRA 5K0CA 3HXPA 4OJTA 2J7PA 3DOJA 1T3LA 1A8UA 3K32A 1TRKA 1XDWA 4JWTA 4R2JA 5KNCH 1EFLA 1QYWA 1RCFA 4TQAA 4NNJA 3T3NA 5AIAA 4PF1A 1EBUA 4JAVC 3WS7A 1JEYA 2MWMA 3FTEA 4K0KB 2A7XA 1PU2A 4UTXA 5B2ZA 4GPEA 1YU6A 2JIQA 2QUAA 4C6TA 3FSEA 4WCFC 3VU1A 2PJRA 3M6AA 3ML1A 5IG2A 3TNDA 1PNQA 4KXVA 5L8VA 2AB0A 3QKWA 4RWZA 2FUNB 4WKOA 1V47A 2JASA 5HEKA 3UWSA 5JECA 3P2MA 4R2HA 4Z4IA 2TS1A 4U0KA 3U7QA 2HMYB 3F6CA 3LLMA 3OY7A 4JLAA 5DGHA 4TZTA 2ECKA 5EE3A 1VMIA 4WIAA 3SQWA 2WK1A 3FWPA 3SZLA 4O4IA 4X1KB 1QFSA 2EF1A 4WZAE 3QBTA 5IT5A 3K0SA 3MT7A 4IGAA 3SKVA 3VH2A 4BNDA 4IWXA 1E5QA 5ESXA 1FDIA 4INPA 4BE9A 1Z39A 5IFLA 4TYMA 3EGIA 3HPRA 3HRKA 5CB8A 3EEIA 5I47A 1JHZA 1T13A 5LC1A 1CQJB 4TT3D 2A84A 3AEQB 1T5IA 1E5DA 2KE5A 2HSWA 1MB4A 3LZ6A 3QFRA 3GFTA 4QA9A 3Q8LA 3TD2A 4EH1A 1PZFA 2PS0A 1T3ZA 4HZUA 2ZRHA 1XK6A 1VGVA 3WMEA 4UBMA 1GPYA 4F72A 1Q1EA 3HI6A 3IESA 1E5TA 1WUKS 2GUGA 3OC0A 2A0XA 4TN5A 1AURA 2LUOA 1UKYA 3EGDB 5CX4A 1HLPA 4C4SA 3GQBA 4J16A 5BQPA 4F3YA 4FDAA 3GLGA 2MMCA 3Q8WA 4Q39A 4ZA2A 2KHZA 3EQ2A 5TV2A 3VH3A 4YX9A 4PY2A 3JAWB 3IBFA 3O91A 3CEJA 3V80A 5J1TB 3VU9A 1PLJA 2OXFA 4E33A 1WEHA 3QYAA 4N7MA 1NW4A 4EMUA 1BC5A 5JJKA 4A8JA 5JUWA 1VHDA 3G6KA 1JWLA 3JQ6A 5B58T 4TX1A 5D3KA 1SELA 1TU0A 3RFFA 4QZVA 3MTBA 3VYWA 3PQ5A 1IQ0A 2RE8A 1FVHA 3EY4A 2JI8A 5IC5A 4C78A 2VO1A 3LBAA 4HDKA 3UW3A 2LBPA 4PSAA 4IJMA 4MWEA 4DKJA 2E1RA 3JY6A 4KE7A 2N75A 4NBTA 2CHVA 3WQBA 4MKRA 3OT1B 3KQPA 3LM8A 2Q4TA 2WU4A 4FLFA 4RZUA 3KV3O 2PS9A 4QU5A 3RVSA 1VBNA 2R79A 5FNVB 1IZ9A 3J81k 1DIRA 1B0PA 2HDOA 1EFPB 3NKFA 3RKUA 1IHOA 4HGZA 4P83A 4KYIB 4C7MA 4Q18A 3FGNA 3R9XA 1E1QA 2QYTA 4GR4A 4JBHA 1ZNYA 2FR1A 4F8EA 1YH3A 3NYWA 1RE1A 3CRMA 1AB5A 2C5HA 1ARZA 3B8EA 3WP0A 3TJZA 1D07A 5C32A 3GCZA 2AKAB 2QUIA 4Y0NA 3JQFA 1Q12A 1SU6A 1K3FA 2YJGA 2D8AA 1VMDA 2XSZA 2PKWA 4NG4A 4NZ9A 2FPRA 4NBUA 3A6ZA 5HK8A 3W5HA 3R2JA 4CL8A 1EE2A 2M6SA 1DTEA 1T36B 4KIGA 4OTZA 3NVDA 1ISRA 3ODGA 4Z51A 1NT4A 4WMLA 3HKBA 3E70C 3ZWQA 3AEUA 2VP9A 1TRHA 2EIXA 4CGYA 3G8YA 4B48A 2GSDA 3EXFB 1H4TA 5HZMA 4OFWA 2YC2C 1NBAA 2H0RA 3V9PA 1KJQA 2ERCA 3RRZA 4AG3A 3L0IB 1CEYA 2I1LA 2QYSA 4XDGA 2EJUA 3MEQA 1U2DC 1NFFA 1VXOA 4WNYA 4TYWA 1NWHA 5EIBC 2LW7A 2FZKA 2GEVA 2PH1A 3OPYB 2QUBA 5DBEX 3VGPA 2GX6A 3OSUA 2NTJA 3LWZA 2WFZA 2TYSB 1XCGB 5JJLA 4HQ0A 3MTQA 4LYFA 2Q5EA 3T54A 3MOIA 2HIMA 1Z6TA 2J5XA 4G0YA 4RZ3A 3LYAA 4IO0A 2BDEA 1ODIA 5DLEA 4B6FA 3VR2D 1Q3TA 4B84A 1LPBB 2O3RA 3D7SA 3H2KA 1M5UA 4NY1A 1UBFA 3ELUA 1BN6A 3PA8A 5C7YA 4GHWA 1KO1A 3UJDA 1GUYA 1NN3A 3NUZA 4M8NE 1O0CA 5DLYA 5E6SB 1EHIA 3A8TA 4DRXA 5D5HA 3SWWA 2EKDA 3E1GA 4N41A 5BSTA 2F1HA 3SXJA 4XRRA 4EKEA 1BZYA 2H92A 4RQAA 2FGKA 3LL4A 1J9GA 2XIJA 3PDWA 2DWQA 3I01A 1EHYA 3MUNA 4LBVA 4PYOA 4V0OA 2PEYA 3TZQA 4UAJA 5FR2A 5ES4B 1USKA 3KKKA 1KFCB 4AROA 2G9ZA 5HDBB 1E4OA 3U7RA 2VAMA 3L0YA 1T1SA 4CIAA 4Q3CA 4KJXA 1MEOA 4S2UA 2QPLA 3KIPA 3JQBC 3PNBA 4UE2A 2X40A 2WFAA 4MAFA 2IP1A 4XI9A 4A3SA 4Z0PA 4DJAA 3CIOA 2Q50A 4OMUA 3V42A 4RLQA 3UGKA 4ARVA 3GJYA 4DR1B 3MCWA 2JH9A 3E9CA 2QL7A 2W9XA 3A6JA 3W6OA 3ILHA 4Z54A 1H3EA 1A2OA 4PHFA 5IAGA 3HU3A 4XCVA 4CUJA 1RACA 2YWEA 3VR5H 1GTSA 2O8CB 1UMCA 1QR6A 1GVNB 2QTHA 4C2TA 4XUEA 3RR2A 1P3JA 3HO8A 3L3BA 1FFAA 2HU2A 4OJMX 4JLUA 5GGXA 2EP7A 2O7RA 1NZJA 2YW2A 3OICA 10MHA 1C9JA 3V4PB 4I8DA 4D1YA 1LS1A 4F2DA 3NO4A 3U9TA 4XWOA 3PHHA 1HE5A 2O5VA 1J0CA 2Q62A 2J3QA 2YRXA 1PQWA 3W77A 5IBPA 4G1CA 1D2CA 4QGBA 4MVXA 1CJTC 1ZUNB 2ILTA 1W25A 4MWOA 1YQDA 2Q6VA 3NNSA 4P08A 4XW2A 2XVAA 5ALWA 5CFPA 2XYQA 5BORA 2VYCA 5K2OA 3SZGA 4ENPA 2WPNA 4PIVA 2Z4RA 3R3UA 4YQFA 1H6DA 1UH5A 1A5ZA 2VJMB 3JQGB 3KJNA 1OLUB 2AI3A 4GQIA 3N39C 4HQNA 5FV7A 2Q6LA 5YASA 4MLCA 2DCMA 2R65A 1A88A 5D6NA 3CLTD 3I1IA 3G8BA 4X65B 3QF4A 2WJYA 4GU5A 2HREA 4AM8A 1YR9A 3QUSA 4WQMA 4GX1A 1U90A 4YCMA 1R4MA 1G7SA 3LT5A 6Q21A 1KO5A 3BWEA 2DPMA 1W88A 3IUMA 3OLQA 3HCWA 4X91A 4D57A 5KVVA 1R7RA 4HLUC 4HWGA 4J1QA 2PUJA 4NXMB 2BMAA 2VHUA 2XYRA 5CCDA 2B9EA 2PUWA 3T3PB 4JC4A 1RIFA 4TGLA 4ZGWA 3KXDA 2H2AA 2YY6A 4N65A 5IFKA 1R2QA 1N78A 1DTWA 1LLQA 3Q2OA 4IVNA 1AKUA 2XUIA 2HQOA 1D09A 3KNZA 2NNWB 3DG9A 4MYDA 1E2UA 1TW3A 2GAIA 3TSCA 3G1TA 4Q4CA 4YRIA 1HT3A 1AKTA 5FI5A 4K6KA 2H08A 3PUKA 3LHIA 4HATA 5THQA 3ZHVA 1NUAA 1MABA 2JJ2D 1RR6A 3GMSA 3S28A 4DUGD 3VJLA 1T1EA 5CA0B 1XRQA 2GILA 2JLWA 4R31A 5E0OA 4ZI3A 2LTAA 3VNSA 1J9EA 1YQWA 3BGSA 4ZXPA 3QMWA 4KDCA 5B1EA 4I8IA 4S1VA 5J59A 2KBFA 2M32A 3JR3A 1Y7TA 3GWZA 3QX8A 2ZAMA 2EV9A 4MYCA 5HUJA 3W4IA 1OR8A 4KX3A 4ZYYA 4Y9RA 3I6MA 3QOWA 4ENRA 3OZXA 3CMCO 4F4DA 2FFJA 4MDEA 4NE2A 1B6GA 2X0KA 3TL6A 1I8TA 3GZNA 1CZLA 2Z43A 3ZXIA 2OHOA 3FPEA 1SFRA 3OU6A 3BX1A 4X85A 2XQJA 1JLKA 3OLCX 2X0JA 1MLDA 3PL5A 2HCRA 1BHJA 2OXCA 2PL9A 4TSFA 5A4IS 4EDFA 4NPAA 3FCAA 3K3PA 4LJ8A 4JIGA 1KMHB 2GPBA 3D59A 4C14A 5CXQA 4DCTA 4R2KA 3JS5A 2IYUA 1IUNA 3AR3A 2DFVA 3CY6A 3IR7A 2NO1A 4MVCA 5JS1A 3BXEA 5CM2Z 2ZKLA 4TZ6A 3VA7A 1ESCA 2CXXA 1Z8FA 1JHXA 4EG4A 1XA3A 5DCYA 5BV7A 5JT1A 3D2AA 2VJBA 2C5BA 3L1HA 4N18A 3C45A 2PQMA 2XUPA 4RZIA 4N7JA 5EHNA 2X4IA 1Z73A 3I2YX 3JWPA 2AKEA 3JZAA 2ONKA 2PFSA 3ZX4A 1V8ZA 3AX6A 4G56A 4J9UE 2WT4A 1JHMA 4LRYA 4PSUA 1T8TA 5E7QA 3WWDA 1V16A 5C7IO 4YGXB 5FX2A 4CV1A 1GHTA 4KLZA 4IUYA 2JLZA 1H2AS 4FI3C 2EARA 2KYRA 3DH0A 3GLTA 3MJEA 4PLHA 5KTMA 3KZVA 1MO6A 1E4EA 3DQZA 4G4GA 3STTA 2QTZA 3KX2A 5JJ5A 5LMUB 4IEIA 2WM3A 4ZOQI 3S6JA 2VH1A 4UOEA 3JAKA 1K5HA 1C3OB 1ADCA 4DR7B 2IUEA 4YRAA 1EQ2A 4B3CA 2FSIA 2ZI9A 1IHPA 1E59A 2XUGA 3CF4G 4JL5A 2XZOA 3UBTA 1T3HA 2DU8A 3NT2A 4FDVA 4K26A 2JJQA 5H59A 1TMGE 3DKRA 4ZEMA 1R6AA 3CRQA 2BONA 2WZQA 4I6EA 1PJBA 4P36A 5DM60 4OB8A 1JMVA 4QD3A 2BT4A 4AMZA 3Q87B 5I7UA 2FR0A 5JE8A 2FG6C 1Y6FA 2PQ0A 1EK2A 4MGZR 3DC7A 1CUIA 4CI0B 5KQSA 2XR1A 5CBKA 1U4SA 4YHHB 2FPMA 1OFGA 4KN5A 4Q21A 2C7BA 4RPLA 3BGWA 4J2TA 3KQMA 1YJ8A 1YRWA 4YJHA 2ZUVA 4XGQA 1L5YA 1REQB 2EZTA 1ULAA 4UTRA 5K99A 4DMFA 2H4XA 4HAUA 4XASA 4P93A 1HWYA 1CUWA 1A7AA 1WVIA 2V6MA 3WGHA 4YV1A 2RHTA 2HMVA 2HRCA 1P8AA 2JGDB 3R20A 1PEYA 3BF7A 4FT2A 5EN4A 3GFGA 4GGMX 3AG5A 2QBYB 1E9CA 3V8RA 5AOCA 4EJ6A 2O2GA 1RM4A 4G1MB 4TQGA 3PQCA 4IJUA 1SURA 4EZBA 2WKWA 5B37A 1SUSA 1PZHA 2C98A 3C6QA 4KHZA 2V7GA 1NXWA 5JNRA 2OLJA 2QE7A 2P9YA 3ZXYA 1O54A 4DLLA 1I9CA 2HT6A 1JP7A 3F1LA 4WZAA 2WTUA 3OJOA 4C4YA 3CJTA 3BQ9A 2DGDA 5HRAA 4NHOA 2OO7A 1QAOA 1LSSA 4BRWA 4MH0R 4OH7A 3L01A 4D25A 4LIPD 5FBLB 3W78A 2XMZA 5BV2P 1H66A 4R9NA 5L9AA 3DFIA 3LW8A 3LO5A 3BICA 3NKVA 4IHAA 4LZPA 3G8CA 1Y3IA 2BW0A 2V7VA 1UPXA 2PUFA 1W4BA 5CIWA 4ZT7A 2B4YA 4RY8A 1J1ZA 1W4RA 1ZONA 4MHSA 1AQLA 2YWJA 4HWKA 4H3SA 3CVJA 4QIHA 4U2CA 4U7HA 5T67A 4YRGA 5I4CA 5IKEA 5LJIA 4B3SB 2PWBA 1FNNA 3UUWA 4G6ZA 2RGXA 1M34B 2O7VA 4PYKA 3BOSA 2HLHA 1E1CB 2V3VA 2I6TA 3IAM1 3N8NA 1DKUA 2GA9A 3OETA 3QQPA 4HLCA 4U5QA 5ALLA 3TGWA 3ZWYA 4MVWA 3F3YA 1ML3A 4HNVA 5M34A 1LGYA 3E4DA 4OI1A 1R6TA 5GJVC 2IUUA 5DE3A 4X1IB 4CF5A 3Q2IA 4R1PA 3COWA 5JJIA 3N2GA 3WZLA 1QHYA 2Q9UA 4R1OA 3I8SA 4WXEA 2D7CA 2CZCA 3L8MA 5KTOA 2J87A 3VNAA 3WGUA 2YHIA 4P4UA 3NW9A 4OP1A 4URZR 1XTRA 4IXMA 3N59A 1TPYA 1ODFA 2GR9A 2Z56A 3IYLW 4R9RA 3CRRA 4YCBA 4C0XA 5AVWA 2VSYA 3BXGA 3GLFB 2WWHA 1S9DA 1INLA 4YAEA 1IB6A 3JYQA 4IJKA 3DD5A 3KP1A 3LK6A 1E3WA 1H5UA 1MAHA 4HPWA 3TEFA 3BIOA 5A02A 1G7TA 1XRNA 4FGKA 2JCSA 4QBKA 1Z15A 4ALLA 4BLPA 3G23A 5FEUA 2WT9A 4CEJB 2ZSJA 1C0LA 2ENUA 1PQ4A 5LB2A 4ILKA 3N6XA 3B6MA 4S1PA 4DCNA 4TXJA 3V2GA 3W5BA 1HRDA 3D8HA 5AHOA 3PT5A 1HE1C 3UO8B 1S8OA 5FUWA 4K6FA 4WY5A 1V3UA 3GLVA 4BGDA 3TRIA 4BY9E 1U1FA 3R3XA 4ZVTA 4EVQA 3G7UA 3OJXA 2W6OA 1M0EA 3BD8A 3QNWA 1I2AA 4J76A 1K1EA 4D42A 1P2BA 1ZM4A 5KINB 1K0FA 1ISHA 1YZYA 4ODIA 2ZQ5A 3L4JA 5F1PA 4QUDA 1ZVKA 3DGFC 3FFBA 4HJXA 1KYIA 5LPNA 1P4SA 4EENA 1WOMA 3GZJA 4M1EA 1JQBA 1GGFA 4MQFB 5KTKA 2QI9F 5HKBA 1Z5PA 2IYQA 2RARA 2XUZA 1XZLA 4FS3A 2QDXA 5REQA 3TQRA 3SQOA 4ZV4A 3RBAA 3I4FA 3JD2A 3H9EO 5TIIA 1R12A 2IS4A 1TT7A 4F3TA 4JDPA 2ZYDA 1FXWF 2C94A 2G80A 1FFXB 1LC3A 2OAP1 2YWCA 2P8SA 3FVRA 3K6RA 4IX1A 3QBJA 4QASA 1I10A 3ACCA 4P0TA 3HU5A 4JI5B 1U02A 1FA9A 2CJWA 4KFTA 3G3EA 4CR6A 2D1YA 3BSSA 5CDUA 1TIPA 3QTBA 2Y6VA 1XC7A 1YB7A 4IVPA 1DXOA 3ZQ4A 3ROZA 2OBXA 2O2DA 5BV8A 5BWNA 5KDOA 4Y2GA 3AW9A 4JQSA 1PSWA 3ZGYA 3C3YA 1G6KA 5FWXB 1IBRA 2VPIA 4ZHQF 4X71A 2BGGA 5IDYA 3KPWA 3TO5A 3I28A 3ITNA 4GZLA 4KPUB 3WGTA 1GNPA 4PLVA 4C01A 2I9KA 2DB3A 4UULA 4G5GA 3INGA 3SZMA 2O57A 3SQDA 1JEOA 4LY9A 3C8UA 1DOZA 3KDPA 3N2ZB 5DK4A 2OBBA 2BJVA 2X9QA 4UNIA 1GCIA 1P3Y1 1W0JD 2Q6OA 3F8TA 3I6BA 4LHXA 1B6TA 3P8ZA 5LR6A 2Q9BA 2W5UA 1YBVA 1RIIA 1YR1A 4OHCA 4X61A 2AH5A 5FR1A 1SA0A 4Y6SA 4EKDA 1THZA 1PT7A 4RPGA 4QRHA 4H7PA 2NM0A 1W75A 2PAAA 4IXWA 3T7JA 1GL3A 3TAUA 3P9SA 3GRCA 4UM9D 1MC4A 3ETCA 3CISA 4Y6PA 5LP1A 2B83A 2QY6A 4IDAA 2J0UB 4TV9B 3M1LA 4JBXA 3ZV5A 5EJ5A 5I8PA 1AHIA 4J94A 3ZHYA 3LXRA 4QDJA 2W4MA 4P80A 5ALUA 4HP8A 1A4XA 2TMDA 1N7HA 2IZ0A 2XF2A 1N2OA 2XJ4A 4OM7A 4YRNA 4MX8A 4ZAYA 5EZQA 1LQ2A 4YDHB 5J5VA 2JLXA 1NVKA 5ABPA 2ZREA 4I6JA 4BVAA 1SCUB 1XCBA 4L5BA 1GDHA 2XHEA 2CN1A 4DW8A 3ZV6A 3RM3A 2EW2A 2PUHA 4ZHQA 1JNXX 2PR2A 4G0QA 3IP3A 2PSEA 4PLCA 3QG1A 2I78A 4FONA 4Q1VA 4C0KA 4NOKA 1IOLA 1MJHA 2Y1FA 3F5DA 4YY3B