4RTSA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gtcta)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 81
structure length 243
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtsA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtsA01
1JG2A 1M0EA 3FZGA 3AJDA 3C6MA 1NE2A 3LGAA 3V97A 1QZZA 2NYUA 3MCZA 3OPNA 2JHPA 2QM3A 3P97A 2NXCA 2O06A 3Q7EA 3SGLA 2G1PA 5E1BA 4FGZA 5FWDA 3MGGA 5E9JA 4H0NA 2HMYB 2ZTHA 3BWBA 1QAOA 5DM1A 1ZGAA 2FPOA 1SQFA 3RW9A 5ICCA 3BGVA 5DSTA 3TM5A 7MHTA 5HOQA 5EC8A 1XCLA 1X1BA 1RI4A 2I7CA 4BP1A 4QPPA 4E70A 2G71A 4KIFA 2G70A 3PX3A 3UA3A 1VL5A 4C05A 5E1MA 3TPZA 5EZSA 1XDUA 4C4AA 4XUDA 3MQ2A 2E5WA 4FZVA 2C7PA 2B9EA 4GOLD 3HCEA 5C1IA 3B89A 2UYHA 1BKYA 1QYRA 3OCJA 5FA5A 5BXYA 2Y1WA 2GAFA 1XDZA 5LQJA 3KQOA 4G56A 5K0FA 4KRGA 5DRTA 5EKXA 4C04A 3DMFA 4QQNA 5EZQA 1XJ5A 2IFTA 1VPTA 2AN4A 3GRZA 1VBFA 2IPXA 2PX4A 4HTFB 3KQYA 2OXTA 4C03A 3EEOA 3E8SA 4R6XA 1Q0TA 2PXXA 4GEKA 4X61A 3MHTA 1JG1A 4RTSA 1MHTA 2GS9A 4HH4A 2PX8A 2P3QA 5T6BA 3WSTA 4RYLA 3SSMA 3EVCA 1RJGA 3GJYA 3EVDA 3DUWA 3G8BA 5EEHA 3UJ6A 1NW7A 3ER8A 2AOTA 4PYJA 2AN3A 1I1NA 1VLMA 3KQPA 1F38A 1NW6A 1WZNA 2IH5A 3LSTA 1RI2A 3MERA 1DUSA 4HRAA 3THSA 3LHDA 1FP1D 1IY9A 1RI3A 3TLJA 4EMSA 3IYLW 3NVMB 1JSZA 5HIJA 2ZFUA 3FTDA 3VYWA 3LCUA 4RVHA 2PLWA 2BR3A 5EHIA 3R24A 3ME5A 3QOWA 3G88A 4L7VA 3KQSA 3R0QA 4DMGA 1P1CA 4RTKA 3PFHA 5E2BA 4YV2A 5D1NA 1U2ZA 1VQ1A 3I64A 4GC5A 1JG4A 2AVDA 3EMDA 2UYQA 2BZGA 3LDUA 4DZRA 2UYCA 3EVFA 2ADMA 5CVJA 4U7PB 2QE6A 1VIDA 2PWPA 2P35A 2QYOA 3GRVA 1YF3A 5ICFA 4PGGA 4DQ0A 3LDGA 3OFJA 5F2KA 1O9GA 3DOUA 4PINA 2BH2A 3R9XB 5GIPE 1BOOA 3CCFA 2VDWA 3BWCA 3EMBA 2IBTA 1RI1A 2NP6A 4E2XA 3FUUA 2P40A 2XYVA 3E23A 3C3PA 3BGDA 1FP2A 4JXJA 3UFBA 1O9HA 2O05A 1NBIA 2GA9A 3KU1A 3Q87B 4PYNA 1P39A 5E9QA 3LECA 2YXLA 2FHPA 2Q41A 1Z3CA 3CJTA 4XUEA 4RVFA 5EEGA 1G55A 1VP3A 3DXZA 2R6ZA 3G7UA 2AVNA 3KKZA 3GIWA 1D2GA 3P9KA 5CUQA 5K0EA 5DX1A 4RTLA 4QTUB 4EQZA 1Q0SA 5JUWA 1EAMA 9MHTA 2FYTA 3FUTA 4M38A 1P91A 4PYLA 3HCCA 4QQKA 4R8RA 4POOA 1R74A 3PLAE 5KVAA 3HCFA 1BC5A 4KIGA 1G6Q1 2OZVA 2C7QA 5CD1A 4AX8A 5K01A 1ZG3A 3NDJA 3NVKI 1EG2A 1ZQ9A 4PCAA 3FRIA 1PRYA 5K0CA 4GUAA 3OU7A 3HA3A 1PJZA 3BZBA 3MB5A 1QANA 5DM4A 5LQRA 3FRHA 5DTRA 2OPBA 4YUYA 3P2KA 4GOOD 3FUWA 2IP2A 3ID6C 3LX6A 4BP3A 1KPIA 2PVCA 3NTVA 4EKIA 1IM8A 1G38A 2HR1A 4PYMA 4RTMA 4IV8A 1YFJA 5EIWA 5IH3A 4YMHA 3HVJA 2CMGA 2BM9A 3MTIA 5EKUA 1QAMA 2ZIGA 4PYOA 3O31A 3M33A 1DCTA 4FR0A 3AXTA 1TW3A 1AQJA 2ORED 3HVIA 1SQGA 4KW7A 2C7RA 4DCMA 1RJDA 1JQEA 3M6VA 4O29A 5DXAA 3K0BA 1ZKDA 5LQUA 5CVUA 5LQCA 3OE5A 1SUIA 2I6GA 3OU6A 3KQWA 4R05A 3S68A 3G5TA 3CJQA 3VC1A 4FT4A 3SR4A 2O07A 2VDUE 3G8AA 1AF7A 3M6UA 4QVKA 4RTOA 5HFJA 4YV0A 4P58A 5HZMA 3HA7A 4IV0A 3DXYA 3QOXA 3SM3A 2PXCA 5FTWA 5K0LA 2NXNA 1F3LA 5GP1A 5EGSA 4YUWA 4PYKA 3ER9A 2ZW9A 1YFLA 5M5BA 1VP9A 3V8VA 3EPPA 3HVKA 4ISCA 4XUCA 3NMUF 3I53A 3UJ9A 1EIZA 4DF3A 4EVIA 5CIYA 3PS9A 4AZWA 2H1RA 5GIOE 3FTFA 3PT9A 5U4XA 4FS8A 1X1DA 3EGVA 8MHTA 1FPQA 1I4WA 1L1EA 3D2LA 3KQMA 4BLWA 4HTFA 2HV9A 3KHKA 5KQSA 1L3CA 3KPJA 4BLVA 5IKMA 2GLUA 2FCAA 3LBFA 5K05A 2V7EA 3ORHA 4OBXA 4WVLA 5E9WA 3FTEA 3KPWA 2PT9A 4PYQA 2C7OA 1XTPA 2AS0A 3C3YA 3CC8A 3NWEA 4HSGA 5P8WA 2OBFA 2I9KA 3MAGA 3THRA 3GU3A 5H02A 2B78A 2PV0A 1NBHA 3KPVA 5FQNA 4CTKA 1NW3A 5EG5A 2JH9A 2PX5A 5EOVA 1XDSA 4GBED 1KPHA 3OE4A 3P9CA 4E2YA 2BR4A 2N47A 4ER6A 1RI5A 2NP7A 3P71T 3DMGA 1I9GA 3DULA 3KR2A 1MJFA 1T43A 3ANXA 5EMMA 1KP9A 4PCLA 1M6EX 5LQAA 2G72A 3EVGA 4E32A 1DL5A 3BKXA 5EQJB 1JSXA 2BM8A 2PBFA 2ZZKA 2AZTA 4KDRA 3G2OA 3EEYA 2XYRA 3UJCA 3SSOA 4GF5A 3DH0A 2K4MA 2UYOA 1R18A 4P7KA 3TOSA 4DM3A 3JWJA 3GRUA 1INLA 3UJAA 2YUIA 3G2PA 4FP9A 3KQVA 2CKDA 3HEMA 5GM1A 2PX2A 4RV9A 4RTRA 2P41A 3C0KA 5DM0A 3L8DA 3SXJA 4C06A 5HIKA 1N7JA 2B2CA 1NW8A 1XCJA 5EMJA 2XYQA 3DP7A 5EHGA 3UJBA 1UFKA 5CCBA 2WA1A 4P7JA 1YUBA 4RSRA 4E2WA 5GINE 3TMAA 2FRXA 5JR3A 5T64A 4CXMA 2HTEA 4AZVA 1B42A 3G2MA 1X1CA 3GDHA 4R6WA 1R00A 3A27A 2QRVA 2F8LA 3TM4A 3DXXA 3LKZA 3HP7A 1WG8A 3KR1A 4HC4A 1KYWA 3P2EA 2PWYA 4ATNA 2IGTA 2IH4A 2VP3A 3PX2A 5FHRA 2ONYA 4M37A 5EIFA 4MWZA 1SUSA 2OB1A 4M36A 4KVZA 5DRYA 4QDKA 5GOZA 4V0RA 5CM2Z 3CJRA 2JHAA 3KPUA 1ZHFA 4OQEA 4PGHA 3T7RA 2YX1A 3F4KA 3M70A 2AOUB 2H00A 2ZBPA 5DLYA 4GQBA 2Z6QA 3PVCA 1D2CA 3RODA 5LQKA 5EVJA 1KXZA 2QY6A 3U81A 4CKEA 2YR0A 3C6KA 4FSDA 2P3LA 3BGIA 4BLUA 3IHTA 4RVGA 2AOTB 1TPYA 1SG9A 1XXLA 4LECA 1UIRA 5F2OA 3FPEA 2YVLA 3B3GA 3BXOA 3K6RA 3P9NA 5DX0A 5FHQA 5FQOA 3EVEA 2ZSUA 4ER5A 3HCBA 3REOA 5LR6A 1YZHA 2EX4A 3OZRA 5CVVA 4DKJA 4F84A 3P8ZA 1FJXA 5K0BA 3SX0A 1P1BA 4E2ZA 3GCZA 2OY0A 5C9ZA 3HVHA 5D1HA 5K0NA 3BT7A 3FYDA 4LWOA 1JG3A 1R8YA 5HIMA 1M6YA 4R8SA 4OX9Y 3IEIA 3UJ8A 2ZZMA 1WXXA 1KPGA 3H2BA 4AZSA 5FCDA 2NXJA 2Z6AA 3TKAA 3EGIA 4X1OA 3ELWA 2Z6UA 5GWXA 4AUKA 3UBTA 4PIPA 4PYIA 5K8VA 1NT2A 3I9FA 5K09A 5DXJA 3GRRA 1KHHA 2YTZA 4BY9E 2WK1A 3JWIA 2PY6A 3A25A 4KDCA 2O57A 4U7TB 2FK7A 3LPMA 2JH8A 2R3SA 3AWIA 5FWAA 4PIMA 3E7PA 3EGEA 1XVAA 2UZ4A 3M4XA 1JTEA 1NKVA 3NDIA 2JJQA 2LD4A 1KIAA 5EPEA 4Z2YA 2ZBRA 3UJDA 3SSNA 2VDVE 5E1OA 3TQSA 2OKCA 4CKCA 1G60A 4GC9A 4YUVA 1D2HA 5FUBA 2AOWA 1EQAA 2ONZA 3EVAA 5KYGA 2ZLBA 4AZTA 3FPJA 1ZGJA 4C07A 5BW4A 4GOMD 3A26A 3KPYA 4CTJA 1L9KA 2CMHA 2ZWVA 3DLCA 4OA5A 5G02A 3KR0A 2YQZA 4GOND 4NECA 3HCDA 4MTLA 3GNLA 4KWCA 4Y2HA 2WA2A 2PXAA 2P1DA 2VS1A 2OO3A 3AXSA 4QVGA 3LL7A 2DPMA 4CWAA 2IIPA 4A6EA 2IDKA 5T67A 3B3FA 5BW5A 5DTMA 1JR4A 4QPNA 3UWPA 5FADA 5E2AA 2ZBQA 2XVMA 2XVAA 5ERGB 1KYZA 4HGYA 1HMYA 5F2NA 4IWNA 1ORIA 2CL5A 2ERCA 3O7WA 3OZSA 5EMLA 3A4TA 4UOEA 3SMQA 3X0DA 2ESRA 4Y30A 1NV9A 4LG1A 4B17A 1RJEA 4OBWA 4DCGA 1AQIA 2BR5A 3GXOA 1SVUA 3UJ7A 3HCAA 4ER3A 5K03A 2G8NA 2AN5A 4LWPA 2HWKA 2EJTA 3R6TA 2DULA 1YB2A 1R6AA 3EVZA 3LCCA 3FYCA 3PTAA 3HNRA 5HILA 1WY7A 5DSXA 2H11A 2OYRA 3MTEA 2HNKA 3P9IA 4X63A 2NXEA 4YUZA 3GWZA 3BKWA 2GPYA 4K6MA 4RVDA 3GRYA 1NW5A 1YZ3A 4RTJA 3A7DA 3M6XA 3TFWA 2IBSA 3HM2A 4MHTA 2YXDA 2B25A 4ER7A 3HA5A 3QV2A 1O54A 2JHCA 4P7GA 2AOUA 1KR5A 4FSXA 3OFKA 4QTTB 1FBNA 3B3JA 2IDJA 4RTNA 3G2QA 1V39A 2PKWA 3ERCA 4ER0A 1WS6A 3UZUA 3G5LA 3TKYA 2OB2A 1JQ3A 5E8RA 3A7EA 4XCXA 5DT2A 4OA8A 2AR0A 3FUVA 2KW5A 3ELUA 2EJUA 4V0QA 5EMKA 4WXHA 4X41A 3TR6A 1HNNA 2AOXA 2ZULA 5DX8A 5B1SA 5DM2A 5CCXA 5E8JA 3PFGA 2AOVA 3FTCA 4RWZA 3LCVB 2ZVJA 4EK9A 5CVEA 5ICGA 1WXWA 3T7TA 5DWQA 2O0LA 2FK8A 3BUSA 3GGDA 4CKBA 3PB3A 1JTFA 1N2XA 1IXKA 5HIIA 2PT6A 3RIEA 3FUXA 4EKGA 10MHA 3CVOA 3E05A 4YV1A 2B3TA 5MHTA 2NNWB 4X60A 4ZTBA 5FA8A 1G8SA 5C0OE 3VC2A 5LQNA 3UA4A 2PGXA 2ZCJA 3HTXA 4HG2A 4P7FA 4HGZA 3LDFA 3IV6A 3P2IA 5BP7A 3B7PA 4RX1A 3FPHA 2GH1A 2PSSA 4PONA 5CVDA 4MQ4A 2Y1XA 3T7SA 4F86A 3DTNA 4PNEA 4E33A 3I5UA 2A14A 2PJDA 4FT2A 5FULA 2IH2A 3OU2A 5E1DA 4E30A 4DA4A 3CBGA 3R3HA 4IKPA 4F85A 2ZIFA 2QRVB 1L3IA 3O4FA 2JG3A 3G89A 3KQTA 1RJFA 1JQDA 3FPGA 2VZ9A 3CKKA 1L3BA 1TW2A 5KS2A 4YMGA 1Y8CA 3GO4A 1OR8A 3OZTA 1X19A 3BWMA 1ORHA 3CGGA 3DR5A 3ELYA 5LSAA 1N7IA 5ICEA 3MCTA 2P3OA 5GM2A 2P8JA 3VSEA 4PWYA 3BWYA 2I62A 1X1AA 1NV8A 4YUXA 3DMHA 5KQRA 3FPFA 3KQQA 4A6DA 1SKMA 3JWGA 4MIKA 5DTQA 2ZZNA 2V74B 3DLIA 1EJ6A 3NW9A 1H1DA 3SVZA 1VE3A 2ZWAA 2CWWA 3TRKA 3KR9A 1BHJA 2P7HA 1UWVA 1R8XA 4QDJA 5HEKA 3EVBA 4C08A 2XBMA 1QAQA 4M7RA 3JWHA 3LKDA 3M6WA 4RTQA 1G8AA 3AY0A 4RTPA 2EG5A 2ZIEA 2YXEA 3NJRA 3NWBA 4E31A 1AV6A 3ELDA 3T0IA 5K0GA 4OQDA 3LBYA 5K0JA 1EJ0A 2P7IA 3B5IA 5DPMA 2GB4A 3I58A 2EFJA
chains in the Genus database with same CATH superfamily
4JJGA 1M34E 4DLBA 3RSOA 1I7PA 1YKGA 3NYWA 4CVNA 3Q9SA 3KYCB 4XDZA 3STUA 3VDMA 1LH0A 2J3MA 3A9CA 3LW8A 1J0AA 1PFGA 2V6JA 1NJ1A 3JARB 3E35A 1T1GA 4INOA 3U7QA 3C24A 3NDPA 4B5LA 2Y1KA 2BGNA 4Q1BA 2WDPA 2ZBGA 1JI3A 3W0LB 2QRMA 5HBGA 2YZKA 4WZAA 5H80A 3BFPA 3F90A 1Z17A 3VGJA 2B6HA 2FZCA 1QAOA 3RFTA 4E5UA 4ZA2A 4FIZA 5M29A 2AJCA 1U3GA 1ZK3A 4QO8A 2HHLA 1Q3KA 1UMDB 3BJZA 3KJGA 1TQ4A 2M9MA 2VKTA 4RJKA 4BP1A 1D9ZA 1MGOA 1OKKD 4KXUA 4QPPA 2X5JO 4CJXA 1IB0A 1ZRMA 5J47A 3LNTA 2YMMA 4OXIA 1J99A 3LH5A 4P3NA 5GGXA 5A06A 2E4VA 2IXBA 1BVHA 3UV3A 1VBKA 5BN3B 3U1BA 2ZDGA 4C4AA 1YI8A 3AFOA 3DTTA 5IM5A 3ADKA 4Q1AA 3VPHA 4DMCA 5KNDD 1DCMA 1SBIA 4UVEA 2UYHA 1SQ5A 2JASA 3PU6A 2FPGB 5EXTA 5LKRA 3FF4A 1Z45A 5LC1A 4H7EA 1HNXB 1C8KA 1M34A 1N57A 4X84A 1C1XB 3I8XA 4OFBA 4IJQA 1VBFA 1IE3A 1Y42X 4C03A 9ABPA 3U16A 3E8SA 1G4HA 2B98A 1F8GA 4YRLA 1RS0A 4GEKA 4HH3C 1N5MA 4K28A 1UJ4A 4RUKA 3CRQA 2H1WA 3MGCA 4N18A 4PCUA 2ORVA 1K6EA 2D1TA 2GJ4A 5CEEA 1GITA 1Y3FE 4GZ5A 4Q4AA 4MROA 1GGJA 4NJMB 5HKLA 5TQVA 3W34A 2C4TA 2Y9MB 1O58A 3A3YA 3HJAA 3N6XA 5H83A 3LT2A 1QTRA 5I6DA 1PQ4A 1JR2A 2OR3A 3I2FA 4OBBA 4WNYA 4CIBA 3HFSA 1WZNA 5KNCA 5DNEA 3IB6A 1MABA 2VC2B 1SD5A 1LB1B 1U9IC 4HNHA 3BMOA 5F9MA 3TLJA 3J7AC 5JQGB 2ZUWA 1RIIA 4PLGA 3L7KA 5KNBA 1H1TA 5KOJA 1UK8A 3CUWA 4HRYA 4YJ2F 4ZJUA 4AKTA 2X2EA 2RGWA 4I1IA 2VDMB 5JNTA 3IDAA 1UODA 2C9ZA 1V9LA 2YZ2A 3KV1A 3LX8A 1JSRA 2A5JA 4YRZA 4OQPA 3RRJA 1QGED 3MYYA 5CVJA 2ZXUA 4AF7A 5CJ2A 1GVHA 2XYPA 4ZVKA 3UW3A 4AIIA 4JXKA 3I6QA 4WLUA 2V9ZA 2BH2A 4JOQA 3CCFA 1HDRA 3DGFC 4YCLA 3BRWD 1JEEA 1U99A 2QYTA 3TRDA 2WLSA 2XYVA 3BDIA 3K0AB 3Q87B 4RZHA 1K4KA 5FPPA 5KINB 4XFDA 4UVHA 4YMWA 5L3SB 4F06A 1KAGA 1S9DA 2OKGA 4Q9IA 4EI7A 4EWLA 3C7AA 2R6ZA 5EHQA 1Y8RB 3EXHA 5DJ5A 7YASA 2ACEA 3VZCA 1JIJA 2PSDA 3N8KA 3O9ZA 3P27A 1Q0SA 3O8OA 2Y8EA 3GMDA 3M4NA 1KTIA 4K6KA 4YRFA 5TVKA 3AR5A 3MCWA 4O02B 3E84A 3JRNA 2NW6A 4GX1A 1LXCA 4DIOA 4MYHA 3WL3A 3ZYCA 1B6GA 1BVYF 3NGMA 3T5TA 2H4WA 2OG1A 1D7OA 3A4YA 3FMGA 2RONA 3OF2A 4ZVTA 4EEXA 3NHKA 3FRIA 4I7EA 3R77A 4AQ7A 1KTVA 2JA1A 4JJ8A 1ESCA 4C4SA 1TAHA 1KPIA 2O2EA 3MJTA 1EHCA 1LVGA 1N78A 4M1SA 1N0WA 1RLMA 3P2JA 5IH3A 3OPYB 2E21A 4UUMA 4WEOA 2FP4A 4DR5B 3K6SB 4LRQA 1QH8A 1USUA 4ZT4A 1JMYA 3BZUA 3IPXA 3BCHA 4ZV4A 3FNEA 3R20A 1LX6A 3K0BA 1ZOSA 2NSHA 2XUPA 4P3OA 4LF6B 3WLKX 2FSPA 1K3TA 4K6FA 4JMPA 1ACJA 3C3AA 3X2SA 2DEUA 2QRPA 1KEUA 4QULA 4INAA 5LNK1 4KV9A 1W6UA 2OFOA 2X8BA 3S2ZA 3WYGA 1M73E 3O1JC 2FR8C 1ADJA 3PXDA 2XW6A 4X97A 1V8PA 4RJ2A 1A9ZA 2YJTD 4H1UA 2ZSKA 4ZODA 1CY1A 3WWYA 1T36A 3QNUA 2CJWB 4QDTA 4UUNA 1TB4A 1S2MA 3ICCA 5TVGA 3L0SA 4ESOA 3AC0A 4M8NE 2C5LA 3ROTA 2B2NA 5EJAA 3CNNA 1OPRA 4FUQA 3WJAA 1EFVB 1A0OA 1L3CA 2Z95A 4CMJA 2QPTA 5IJ0B 3ZCSA 3GZNA 4Q9AA 4D3YA 4MB2A 5FEMA 3KSRA 5JG7A 2Q5QA 3C3YA 1VECA 3MD0A 1TIPA 4XLLA 1Z0FA 3FXAA 2OBNA 1JJVA 4PSVA 3UF0A 2EX1A 1JP7A 2EC5A 1Y5MA 1TUIA 4O4LB 1NZFA 4EPXA 4UCXA 5HQJA 2JH9A 3P2OA 3H5VA 3DZFA 2FKNA 1VMKA 1NUSA 2N47A 3DBRB 1HBJA 1PHRA 4JOCA 3X43A 1H8ED 4JZYA 1T1EA 2P4UA 2VF7A 2BYTA 2DM6A 4J1QA 2H7CA 5JQGF 4BBZA 4L75A 5JSYA 3VZPA 1WBDA 3CTPA 3K31A 3GR6A 4IGIA 2VAPA 1IJBA 3BIOA 5DTIA 2LVBA 1EQUA 1B6RA 1U3DA 2JBAA 3H2SA 2HJWA 3AONB 5JAHA 3AM1A 4TMFA 1RPAA 1Z7WA 2WSLA 4DM3A 3ZE7A 3WGHA 3JWJA 4OMDA 3ZWMA 2NU8A 1ZITA 4KNVA 3LXMA 4FP9A 4K26A 2YC4C 2O59A 2CKDA 1QIHA 4KJZA 2ZS9A 3UV7A 2C7RA 1PK8A 4TSRA 3KZKA 1AV7A 5EHGA 1UFKA 2OCKA 3GQVA 2GRAA 3FGPA 4V0KA 3C4JA 2L82A 4GBGA 3GBPA 3C8DA 1Q6YA 3TEJA 4K3UA 4ML3A 2Y1OA 1Y3DE 4P7BA 1I3KA 3WKDA 1U3TA 1I2BA 4DUGD 3G6KA 4GW3A 1ID8A 3HVUA 3T9AA 5EUQB 3LZDA 1EUCA 2A1TR 2HZ7A 5KU1A 1SHLA 4LC0A 3P2EA 4ATNA 5KX5A 1UKCA 2Z9CA 1POXA 1L4EA 4L51A 3KJIA 4MAFA 3T5CA 3HWRA 1BH6A 4QYWA 3K94A 1KI1A 3H9BA 2OB1A 1MCZA 2XCUA 1ZD9A 3T4XA 1GPLA 1FXSA 1PYDA 4BEWA 3KPUA 4HNAB 4RAOA 1VHLA 4HQ6A 3TSOA 4OQEA 4CLRB 5ITZA 2Q6VA 4OHZA 2B1GA 5ARDA 5KC9A 3KWLA 4Q7KA 2HYIC 3AVQA 2XMSA 3GAZA 1D2CA 2VCYA 3E81A 4INJA 1VZ2A 4IFTA 1ORDA 1Q77A 3N3AC 2P3LA 3UPDA 3WRWA 4QDUA 3FOZA 2I6FA 4F60A 2X0KA 3AEZA 4XGKA 3WL8A 3RVPA 3JZAA 1WWKA 3BXOA 3P9NA 4ICIA 4LI0A 3K1YA 3L0ZA 4Z86A 5H7XA 4LMBA 4KZPA 5CXSA 5EWLA 4ZT6A 3VR2D 4EOGA 3AY7A 2WJPA 2CXPA 4WK6A 5DCLA 1YA6A 2VZEA 4C0BA 3H2HA 3ZE1B 4QFMA 3U61B 3CX6A 4HGRA 4QGAA 5HM6A 3JAWB 3EF3A 1AS0A 2C20A 2J3KA 3E6AA 5AVTA 2M6KA 1IN4A 1GARA 4OX9Y 1GG9A 3GPDG 5JXWA 4OLAA 3H9EO 1Z4MA 1DJNA 3UMFA 3M5WA 3X1XA 1EFKA 1M9NA 1XZFA 1CQIB 1E2GA 3K1JA 4XLZA 3W6UA 5J4HA 3B6EA 1IZZA 1LRKA 3ELWA 2Z6UA 1YR9A 1H42A 2BKAA 2OQRA 5GWXA 1JWBB 4MGZR 3AJAA 4P93A 3UBTA 1FSSA 1NWHA 1QS0A 2EFEB 2IU4A 1XI2A 3AQIA 3NT4A 4MVJP 3D4IA 2COEA 1KAOA 3THWB 1KP3A 4HDNA 1GCAA 4G8BA 4IFEA 1C2TA 3E1KA 3LPMA 1HSZA 4BFSA 2MR5A 1AN9A 3OPXA 3C8HA 1W7AA 2E5FA 3DQZA 1RJWA 1LPNA 3B13B 1NKVA 3LIIA 4MCHA 5ALNA 4B3BA 4Y9TA 4H77A 2IYUA 2KLBA 5JDIA 1ZDMA 4TRMA 2A7XA 1PJRA 4W9NC 4XPZA 4K8RB 1A88A 2AFHE 4N7BA 1RXSA 1AZTA 1RWMA 4GLBA 3GEPA 2H85A 4HXGA 2EOAA 4UMEA 5DHPA 4G1VA 3SJAA 4YECA 4QOFA 3ROFA 4D3DA 4J75A 2YQZA 2RJOA 2XMDA 3G2HA 3OOSA 2XUIA 1E9EA 3C6YA 4HK4A 3RS5A 1G9XA 4AMUA 2W0MA 4ZGGA 3MWGA 3QEAZ 1WU7A 4B43A 3TQRA 4R5MA 5EZ5A 2II6A 4DV5B 1IEWA 3R6DA 2GCEA 1DAOA 4TZKA 3RUAA 3G0HA 2QAJA 1MC1A 4LX8A 5DTMA 4BVJA 5JAQA 2A30A 2V8BA 4LTDA 4TS1A 4AWXA 1Q91A 3Q7SA 3RYIB 1ODLA 3GD7A 4Q3DA 1V7ZA 4Q6BA 2R7LA 4QREA 3W1VA 3L8HA 4XQ9A 3WLSA 1W25A 3VYRB 1A2QA 1U0GA 2ERCA 3ROQA 2Y3IA 4QEDA 1ZWKA 2GK4A 3MTQA 1EMDA 4H0FA 3S81A 1JLLB 1K97A 4JV5B 3L93A 2WYHA 2P5SA 2YCLA 5JASA 2ESRA 4E88A 4LRSB 1ZJWA 4LF9B 1W4ZA 4XB6B 3HFJA 4HZUB 2UUPA 1MORA 3OM0A 3OZCA 5DSZA 2HFJA 3AQ4A 3N28A 1OV4A 1XTRA 3IAS6 1EDZA 4HO1X 5MFZA 2AFHA 4M99A 4TLLB 4ER3A 2VVTA 3NC1C 2EEZA 5H4GA 2V0CA 3NBAA 5H81A 4MDEA 3VHXB 1H5QA 3LCCA 1GPUA 1NN1A 3QHAA 2CXNA 2H11A 4LYAA 4DLYA 5CFLA 1B8OA 1H85A 1E0AA 2DR2A 2NTJA 2FR0A 3ZW8A 2I7TA 4GRIA 2NXEA 4V3CA 4YEDA 5B1DA 5E0OA 4ASUA 1ZGCA 2APJA 4JMLA 3EQ8A 2HIHA 3S29A 3IO5A 5D6NA 3TTXA 4ZVVA 5B64A 1N5KA 3ZD6A 1DKMA 3EJWA 4I55A 4HGPA 1E8DA 5CJPA 4AZ3A 2EXXA 1IXZA 5CR9A 1NOKA 4DA7A 2IDJA 4RTNA 3G2QA 4XSGA 4QM7A 4C30A 2XMZA 2BMAA 5AI0A 5DYWA 3GUCA 2YBDA 4CQLA 4MA5A 2EQAA 3JAMA 4KKVA 2NZJA 3W9UA 5J1TB 1R3UA 2H2FA 4HWOA 4EARA 1U4OA 2PVPA 4KVAA 2WM3A 3D7MA 4MS4B 2VPTA 3EQ9A 3V1UA 5B3KA 2V03A 5C4IA 5HW0A 1NNUA 2B4TO 1QK4A 2ZEJA 1QKKA 2DUMA 4OIFA 4DMUB 2WAMA 1DAHA 1PT6A 1GYRA 2A5YB 2FXIA 4JC4A 4M22A 1Z4OA 4NV0A 4PLCA 2QIPA 3NTOA 4S1NA 1G8MA 1GA4A 1ZY2A 2GUGA 3V8NA 2PT6A 1OH8A 1VG1A 3MXOA 4LJ9A 4XX0A 10MHA 3GFOA 1Q2XA 4N7RA 4I1YA 4YV1A 4BX8A 3AR7A 2Q6OA 1F7VA 2DX7A 2LUOA 3TIVA 2AZDA 4QYIB 5ALWA 4EA7A 3UHFA 2VHQA 1H23A 5BP7A 3B7PA 4Z4CA 2W4IA 3C5VA 3W5IA 1U7PA 2NTVA 3DKKA 3WGKA 3I5UA 5ALOA 3KE9A 3NQ41 3JQ9A 4V2UA 3J80A 1BG6A 1SHTX 2XNKA 1X1EA 3DNMA 3P94A 2ZIFA 4YN3A 3OTIA 4IMRA 2JAPA 3NGLA 4ZICA 2REQB 4LWQA 3AFIA 4JXXA 1ZEJA 4BMCA 1E3EA 1UWKA 2A57A 2NZUG 1NDHA 3G85A 1XPOA 3VV2A 3BWMA 2G9NA 1TXGA 3GV0A 2E1PA 2AEEA 2QTZA 3I4LA 3TN7A 1VJ0A 3FSEA 2G9RA 2P3OA 4N54A 5CT4A 2TYSB 3IMEA 4TT8A 5FAKA 1VLVA 2P4EA 3W5JA 5D3MB 3AUKA 5GJBA 4BPBA 4JUDX 2JLRA 3TF5A 1K4MA 1S2OA 1Z37A 2RGCA 1VE9A 3RS4A 4CU5A 2PGJA 1KO1A 1NYQA 3ZK8A 1L1QA 5HSGA 2DPYA 2RHCA 2XUKA 3F6SA 1EJ6A 3IR5A 3RS9A 3EXHB 1QXSA 2K87A 4AVYA 2A33A 3KR9A 3KETA 1GZHB 1KMIY 3O8OB 1EP3B 4TMVA 1QAQA 1MX9A 1Z3IX 1GUAA 2XGGA 4GDMA 8ABPA 3M5PA 1UJ5A 2Q2OA 5AVZA 1XSEA 3DAGA 2AWOA 1RBYA 1KS2A 1Z6PA 4KX3A 3DEAA 4MEAA 4MLPA 2ZUFA 1VFNA 2I4LA 3EGCA 4OQDA 5DGXA 3T1OA 1W581 2YHBA 1Z62A 4RY0A 3N2GB 2GPSA 2H7XA 2HDHA 4H4EA 3T7JA 7REQA 5IJXA 1IWPB 4WZBE 5AOCA 5HS6A 1QWSA 1UUFA 2BHSA 5AVSA 2Q1XA 2R8PA 4L0QA 2XXAB 3D3WB 3AU8A 1GAXA 1LDEA 5AYVA 2EG9A 3QVKA 5DP1A 4E12A 3ELBA 3TGPA 3K53A 1Z7GA 5E38A 3R0IA 1GR0A 4UMDA 1W8IA 4FX2A 2VJMB 5DW0A 4TPKA 2P9QA 1RLTA 5FWDA 1MQAA 3GOQA 3QPDA 5E9JA 3L9WA 4TTAA 1VXOA 4BJ5A 5FWNA 3BEDA 1Q3HA 1L7VC 5KYXA 1E60A 4G25A 2NG1A 1FMTA 5DM1A 5CB4F 4JI4B 1DJOA 4FBMA 6ABPA 3OT1A 3KB1A 2EU8A 2PJZA 4G07A 4MKZA 4TS4A 3OBIA 1XIVA 3ZWWA 4EL0A 1X1BA 4LY6A 1HURA 1XLVA 3PD1A 2P2YA 3JQGB 4L6AA 2Y2UA 2VWPA 1E3WB 3MELA 3UA3A 4LMRA 3I39X 5KMGB 3BRWA 5K0ZA 2NO9A 2P2GA 3VR6D 1GAEO 1NSFA 2JJ2A 3ABOB 3GT3A 1EX1A 4PTLA 2ZSAA 5KNLA 1DX6A 1BA2A 1ZKMA 2WTMA 2ZSEA 2ZXEA 4R3NA 5GVSA 4Y2GA 1RXVA 5ETJA 5HJ2A 4WGGA 3TOVA 2IPMA 2Y1WA 3Q11A 4XA8A 3X1JA 4EDHA 3HK2A 4WZBA 2H4XA 2QTHA 3HU2A 3EGOA 3L8ZA 4JXZA 2ZANA 4M6WA 1FUIA 4JQYA 3ILVA 2QG6A 2I8LA 2HHHB 2Y9PB 1MQ9A 5TSDA 4EFMA 3GZNB 4TMYA 3U3XA 1T4CB 2HMWA 3PQ4A 3EJ6A 3OESA 2GI4A 1R9NA 2RBGA 4G4GA 5IKEA 1T3HA 3QF4A 1RJGA 2I2WA 2VG8A 1SMKA 2WJAA 3T3DA 1QCDA 1GUBA 2WT4A 4EUHA 3CO5A 5COAA 1SPBS 4U6SA 3EE6A 4JU8A 4JP1A 3ZKAA 5ADVA 3OM1A 3FKSD 3E58A 1J0DA 3I0MA 1Y3HA 5K3FB 1VGRA 1UEJA 2Y1GA 1M6HA 3DDUA 3L0BA 4LV5B 4J3NA 3T3EA 1IN1A 4N6NA 2QIOA 3PRKE 1ZN9A 5CCEA 1YWGO 2PLRA 4KQKA 6ADHA 3TQTA 4AMZA 3E5RA 1G63A 3RHSA 3RHZA 3WHPA 2JGKA 3IAEA 2BUCA 1EP9A 1T9CA 1P1CA 2C92A 1BGXT 3BGWA 3FNFA 3L6DA 1N5RA 4L0DA 3WBBA 5BN5A 4GVLA 2WFZA 1DIRA 2FOXA 3DFIA 1S1CA 4P80A 5ESXA 3D4BA 3ADBA 4GVPA 1W85A 2LP4Y 3EMDA 4NG5A 3TGWA 5HKBA 3MM4A 3SK0A 3AJEA 2J3JA 1HEYA 3Q72A 1JKMA 4FJ2A 2P35A 1EVEA 3U4GA 3OFJA 4ZRNA 4ZWNA 3AL2A 3UATA 3R0ZA 1GQYA 4I14A 4RFSA 2KPOA 5K2OA 1FNCA 3PIDA 3HBJA 1CUYA 1E4EA 3ILSA 2MSEB 2BZ1A 1XKTA 1IY8A 4OUKX 3RRFA 5CVCA 1BYIA 5I47A 2Y0EA 1E1CA 2ZI5A 4QU9A 1Z3CA 2HLNA 2UZ1A 3CJTA 1NFFA 2HA3A 1G55A 3FJOA 3JXEA 4PLHA 2ANCA 2I4IA 2PZKA 3WWPA 2D1RA 1RYYA 2FEWB 4QTUB 3KTAA 5KSPA 1GIAA 2AN9A 4F2DA 2XDWA 1CRQA 2JLAA 1Q84A 2OV3A 5JCJA 2FFJA 2JI8A 3UFXA 1E79A 1XBTA 3GK3A 4MITA 2X3UA 3HU5A 2BGRA 5JY1A 1DRJA 2BDUA 4AJOA 1G6Q1 4PX3A 3V7UA 1Y1TA 3NVKI 1ZXBA 4K9OA 3S2IA 1WLSA 1QQAA 1XU7A 2OM6A 3MB5A 5DM4A 4R2LA 3T06B 1TJ5A 1NUUA 1TYAE 3JASA 4UHJA 4Q02A 5L7YA 2F3UA 3QKRB 3T0GA 1HDEA 3DEJA 2JFZA 4GBMA 4YMUA 1O0BA 4RTMA 1CVIA 2CLSA 4E5PA 2X3FA 3OTHA 1U0SY 1E7RA 3TRJA 3H2ZA 5DN6D 1NY5A 5KWSA 3F7NA 2Y0CA 2BBSA 2CDBA 1KETA 1LVHA 2XQJA 4WLNA 3UYLA 4AMGA 4Q21A 4YAEA 1DIAA 1JXOA 2C31A 4I9NA 5CVUA 3IILA 4AJNA 3OEED 2ZREA 1Y8QA 4WJZA 2OGSA 3BXHA 4O25A 2NAFA 3UCFA 5F7XA 4L4RA 4TMZA 5T4BA 4XOIA 3GA5A 4FYXA 1AF7A 1FDOA 3OOYA 3IOMA 3SM3A 2G9UA 4WCFA 5CLFA 2NWQA 5D5HA 4BQFA 3B20A 3OA0A 4JP2A 4XWAA 5GZ6A 4C6TB 1QS0B 3LUJA 4WLOA 3AZPA 3GPCA 1MKYA 4NJEA 5K6AC 3QUSA 4DEVA 3KBOA 1EIZA 3SAJA 3ZXXA 1UMBB 3OA2A 3Q15C 1T9HA 3GEBA 2GXUA 1RFLA 1W4AA 1P1KA 3SHTA 5IHXA 3ND6A 2OM2A 5ICSA 1V5WA 2IYZA 4D25A 3PCTA 2BPOA 4GLJA 3W8EA 1WUTA 3EBOA 3FB1A 4YQYA 4YIKA 1FTWA 2FEOA 2VJOA 3GW8A 2YYYA 3CH7A 2RG1A 2V6BA 4OBXA 1E3DA 4RM3A 3C4QA 3U09A 1ECLA 4MP8A 1RAGA 2AS0A 3ZN2A 1QZXA 1Z25A 1J23A 1TRHA 2JFFA 4TYMA 2Q7XA 1DADA 5I9BA 5CFMA 4UNNA 1G0NA 3T35A 4DCOA 1AS2A 5DI9A 5TPWB 5A71A 1MEEA 1WMFA 3ZTWA 3Q2KA 4CQMA 1YS4A 4YK7A 3TK1A 1F12A 3OOEA 4BDTA 5CB8A 1C1HA 2F9FA 3P71T 1GTRA 1VYTA 3ANXA 4DMRA 5L53A 1M6EX 1SFRA 2D3TA 2ZWPA 2MYPA 5KQGA 3Q3IA 5NLLA 1UM9B 3GHHA 5G1NA 1X7GA 1U1DA 4KDRA 4LYDA 1JR3E 5C1DA 1EU1A 2PXHA 3HB0A 4M46A 2EKQA 4LNAA 2IS1A 4GF5A 3WDSA 4E5YA 4BXOB 2P6NA 4DJAA 1S0UA 2BE9A 2C96A 5D85A 1RXWA 4G4IA 1V1RA 4B6OA 3RKUA 2FB9A 4HYQA 4XFJA 3N9IA 1ZVKA 1EQ2A 2X9VA 3L40A 1U9JA 1A5TA 4O4JB 3VNQA 4EA6A 4J29A 4PTZA 4YC7A 4RTRA 3ESDA 1GUZA 4TXHA 1NQUA 2JAHA 2B2CA 2GEJA 4EL5A 2RD2A 2LIVA 1WXIA 2R84A 4UXIA 5SZKB 2HQRA 2G7MC 2AZ4A 4GKVA 2FRXA 1YMQA 3GLUA 4CXMA 3IPCA 5K8CA 4NVRA 2XAUA 1ZS9A 1EG7A 2YH2A 4UD6A 3MJVA 1DO8A 4CMCA 2W90A 4Y2VA 4AY2A 3PHJA 2HREA 2PO7A 1DFHA 3SQOA 3H7AA 4ZU3A 3WIVA 1O6ZA 3RF6A 3T3PB 4EW6A 1YC2A 2W6IA 1SUEA 2ZIZA 4P53A 1GPBA 2PK3A 2CYAA 3L2OB 5FHRA 5JCOC 5KX5F 5MGNA 1K06A 3A28A 1FX1A 5AKEA 5ECGC 4E6PA 1WXQA 2KYRA 3IHLA 4FFBB 2WUWE 5A7GA 3OJOA 1QO0A 1FQKA 1MG5A 2JHAA 2X2PA 3OZVA 4HMOA 4ZDJA 5LQDA 1JR3A 1QHIA 1BXGB 5KNDH 4D46A 4AZ3B 4OJQA 3VOSA 5L9AA 5LNK6 3F5SA 1IY1A 2AXNA 3B1FA 2H1FA 3SDZA 4B75A 2RHLA 1EBFA 1PEKE 3KLBA 3FDJA 5LQKA 3LTNC 4GT1A 1QYIA 2WD9A 2YR0A 4MO2A 1UKVY 3AETA 3AUXA 3ITEA 5CURA 1K68A 3AYZB 3JTMA 9LDTA 4MS1B 2ROQA 3JD3A 4NU0A 4QGGA 3TDNA 3K0EA 2ODWA 4RVUA 3SIRA 4L5AA 1P7PA 1LV7A 1RCTE 5JU6A 5CVVA 1WB9A 4ZD6A 2BCJQ 3CNLA 4K9RA 3KRTA 3N7TA 4MW2A 3OZ7A 4PRZA 4RKQA 5HMMA 4V1CI 1FSPA 2FPIA 2PD3A 5JATA 1OX4A 4CBVA 3KEQA 3U56A 2N3ZA 2X7HA 3D6NB 4LUCA 1FUKA 3TTSA 3TMYA 4B3TB 3LJKA 1R8YA 1WQ1R 3INNA 1PNRA 4JI1B 2R6R1 1GKYA 3RB8A 1T9KA 4BZZA 1S89A 1AA6A 1QPZA 1GCGA 1US8A 1N9GB 3H2BA 2H8KA 1Q83A 3DCYA 3BXGA 2XTAA 3KD2A 4IWYA 1ZXLA 3W1WA 1BSVA 2BE7A 4R84A 1OTXA 4CL3A 3VA7A 4D5EA 1PS0A 4E21A 1W0JA 3PGA1 3S27A 3FBWA 2GPWA 4E03A 3IKVA 4E7OA 2XOKD 1XG5A 2WFLA 4FW9A 2YINC 4I0WB 1LBEA 2WK1A 1GTVA 4REMA 5C1PA 3O8RA 1FXUA 1H3FA 3EBLA 3OIVA 1AOXA 5FWAA 3N76A 4TMXA 4C0JA 4P8RA 5A4MS 2YHSA 2YIDA 2BZSA 3DL7A 2IYSA 1U28A 3DTYA 4EVQA 4O8ZA 3CPHA 2J0VA 3SSNA 1P2GA 3SPXA 3DLTA 3INRA 5E1OA 1AUPA 4PV7A 5FV4A 1M33A 1BMQA 3KALA 1GLNA 2AOWA 2GVZC 2P9TA 4WW0A 5LJLA 1ENYA 1TMKA 1UKYA 3QFSA 2QUAA 3X44A 2A67A 1M7GA 1L9KA 2VNJA 4IRUB 5T7BA 3DLCA 5F12A 3IAHA 4HNQA 1Y4DE 2MOKA 4MI9A 1MT0A 3ASYA 3FE2A 1DQNA 3KM0A 5D2CA 4AKEA 4FB4A 4Y2HA 2OG2A 2WA2A 4N8DA 1TAUA 1ZMRA 3DD5A 2R8ZA 4JP3A 1M8PA 4X6XA 1IL0A 4MEJA 3MB8A 1GZ6A 1CQWA 1GRQA 1XRSB 2VYVD 3CINA 4QPNA 3UWPA 1C8VB 3DZDA 4R4JA 3KE8A 1K27A 1HI9A 1D2AA 1EI9A 1FU7A 5F2NA 3TYXA 2OA0A 3O7WA 2GEFA 4FQ7A 1T1RA 1YDMA 4UATA 4E46A 2EVWX 1V11A 4DRXB 2Y05A 1YS6A 4C4OA 2C7GA 1KARA 2XJ4A 4N5NA 3RRXA 3QW4B 1HE3A 3NUZA 1RAHA 3VYUB 5JXIA 1NJ8A 3PKIA 3FI9A 3JQBA 2VXBA 3I2HA 3IPRA 2MSWA 4IRXA 4UDNA 3CF4A 4A8HA 5LWQA 1QP0A 2P2CA 2YJ4A 1OF1A 2V1XA 2ZUCA 2R7NA 2AMLA 3EZ7A 1IC6A 4UJ3A 5T3UA 4C6HA 3WWEA 1E0KA 4MZXA 5EFZA 2GCNA 4EUNA 2FW9A 1HSOA 4H7PA 1SCUB 3AVWA 2KBEA 2BGTA 5GVRA 1AGYA 4QJ3A 3P9IA 1UMKA 4URWR 4LQ4A 1JPUA 2I87A 2H1IA 2XVZA 1UMCB 3TNLA 3IDFA 4LXYA 1YAJA 1KZ7B 2PA0A 1ZESA 1PJSA 4L7QA 1ULTA 3DOIA 3ENKA 2JZOA 4I55F 3D0KA 1QFYA 2OXRA 1E3SA 5ALQA 4HX2A 4JQSA 4BB5A 3ZY4A 3B3JA 4BV2A 1P8AA 3V1TC 3KOOA 3MIZA 1N2GA 5BOSA 3PR1A 4KO1S 3W5VA 2FPPB 1KERA 4J2OA 3HV0A 4IIBA 2H5IA 1VSVA 3KCNA 2BCGY 5DT2A 3L77A 1CR4A 4AMVA 4D9CA 5J40A 1J25A 1Q0LA 2KW5A 1A27A 4IZOA 4M4SA 4WZBB 3CE9A 4G6ZA 4UBKA 1NBMD 4HH1A 4DJJA 1YL5A 1GL9B 1DFGA 1P75A 3G9ZA 4K9NA 4C7XA 4NR0A 1NDUA 3C7TA 4LFCB 5DTEA 1N0VC 3CB4A 4ZZ3A 4UE3S 1YJ8A 4MVXA 3BUSA 1KH3A 2I99A 2PL1A 4U02A 4HDOB 3G5UA 4RMNA 3U1VA 3I42A 1R5NA 1YZUA 1GTG1 1FUEA 3O1IC 3WL7A 2O7SA 3O2SB 3WKCA 2FVXA 2RHRA 1NXSA 1DKUA 3D7RA 2XA1A 2GZHA 2Y93A 2WIKA 4FHDA 1RQNA 1LBSA 1PQYA 2IOHA 4LOLA 4RACA 4RIHA 5IBPA 3SKVA 1PZFA 3ZEAA 2EWVA 1UQTA 1LY1A 3H19A 2H4FA 2G4VA 1Y9EA 3LT5A 5ABPA 5E1DA 4TYWA 1BMTA 3GDOA 1Q15A 1C1DA 3C6ZA 3COPA 1M5RA 1YACA 2HSGA 3CG4A 3CLRC 4GVXA 4IKEA 3UPUA 3CRNA 1YZYA 4K9MA 4EG8A 2WKPA 1W85B 1UDBA 2H65A 4DTIA 3KJNA 4PN3A 2Q2VA 2I3ZA 2Q0SA 2R00C 1SIUA 4IM7A 2MYUA 1A1SA 2Q4RA 2V4MA 5FO1A 1YH3A 2A3NA 3CWZA 3UK0A 4F92B 4EDFA 1O96A 4CHTA 3C8MA 3OEHD 2F1RA 3S0JA 3UANA 4CDRA 3TZ6A 2XMQA 3CH4B 1QM5A 2VT3A 4Y1FA 2PL5A 4DMLA 4EZBA 1L4MA 3D59A 4CLOB 4CIDA 2MSCB 4ZZIA 3QITA 1P72A 4ETNA 2X5KO 4PANA 4Q9DA 4YLGA 5FJIA 2UZ1B 4OHKA 4MIKA 2O8NA 2QHXA 1Z26A 1CRWG 2XMBA 3KOXA 1YOVA 4I8XA 3PPIA 1V7CA 3SVZA 4FGUA 3PQ7A 4MVJE 1ZISA 1GCOA 2P7HA 1TJ4A 1C7IA 2QTWB 1R0WA 1ONBA 1NNSA 3JWHA 2RK3A 1Q1GA 3WV5A 4PPYA 3FWPA 5BRJA 1IHDA 4I1SA 3NJRA 4E31A 1A1VA 2XQGA 4TVKA 1IY0A 3TPFA 3ZWOA 4DG9A 1NMZA 3T61A 1AHIA 4DXDA 1IZ7A 4PZLA 3NM4A 2WE7A 3B5IA 3I58A 2V7GA 1XCGB 4D8TA 1K8QA 1IH8A 4IZHA 3FZGA 4PQEA 3JASB 1QE3A 2BKLA 4IEFB 1ZUNB 3VO8A 1QZZA 4AF6A 2JFYA 2JFOA 1PGPA 1LFDB 4MUYA 4ZJZA 1W94A 2VATA 1EEHA 2WWYA 5MN5A 8ADHA 5EYPA 4EHIA 1YZNA 2GHTA 1MB2A 3LVQE 1H0HA 3BDVA 5ELMA 3HYLA 2IOFA 5HWSA 1TECE 3BWBA 4HKTA 4BNXA 1A2KC 4OHRA 1G5HA 4O33A 1J90A 4JJ7A 4UEWA 3UENA 5EC8A 3KCQA 4E7PA 3F3YA 4D4MA 1GPMA 3PNPA 4MVJA 3BBPA 3JTEA 1IDN1 1A7JA 3OOJA 4IR7A 2BFPA 4U2BA 1V8DA 5C2JB 4WCFB 3AVOA 1U98A 4KQWA 2ZYVX 1RTTA 2QXUA 4FK8A 4MIEA 1IULA 4WXMA 5E1MA 3TPZA 3O92A 1KYQA 1XQVA 2XLCA 4NJEB 1WHSB 4X6YA 2E4ZA 4GOLD 2VNIA 3HI4A 4MYCA 1LNSA 4G56A 1UPXA 4KRGA 4UAVA 3PHCA 2C07A 1XJ5A 5K3DA 1OH6A 2IYLD 3K0FA 4MRVA 3UXYA 1I24A 4E07A 1Q0TA 4RF5A 1HYQA 3V55A 3QSYA 1JG1A 1K7YA 1R66A 2ICAA 2HT1A 1YVPA 2DOKA 3VNUA 1KI6A 1QNLA 3W79A 4RYLA 2VPPA 4TSKA 1CDZA 1SB8A 3L7OA 4PAGA 2BOVA 2L0XA 3BXFA 3NOVA 3G8BA 4NEQA 1I2AA 1QJ4A 2G8LA 1N0IA 4RV4A 2CSUA 5DOVA 1VLMA 3K2IA 4ZVPA 4R5HA 1FA9A 3BTOA 1E2QA 1RI2A 4UCQA 4CQMB 4MRNA 1PDVA 3LHDA 1W93A 4HFMA 4Z1MD 1ZIPA 3OIYA 3WWZA 3CRMA 2OC9A 4QGHA 4FZRA 4TRNA 1G8HA 4DLRA 2DETA 4C89A 4ENWA 2UUCB 4BVKA 1KZ4A 1X74A 2YN4A 4KO4S 4TLCA 2MHCA 1XV5A 2R6AA 4XRRA 4I50A 4IOKA 5I8ZA 3ROZA 3AG6A 4AYWA 4ECEA 4OLJA 1W49A 2FJPA 2FWIA 2OCXA 3MILA 3PPXA 5TIIA 2CFSA 4KP7A 4RTKA 1NNEA 4DARA 5TQJA 1RPNA 1VGVA 2ZR0A 5T57A 5EXSA 3SJZA 1QHNA 1Q20A 1XYGA 2OBBA 4LTNA 4DZRA 3CCBA 4HAZA 2OILA 3PJFA 5ED4A 2H51A 5EP1A 4GMGA 3SVLA 2RCNA 2MYNA 2X15A 4BCDA 2ZR8A 1UAYA 4EMBA 3WIUA 1XR3A 1DQPA 3PA6A 2BJHA 2CW5A 4Y2TA 3V1NA 5EMNA 1TKCA 3LOUA 1M72A 5HJEA 3H8VA 1NI4B 3C7DB 2O6LA 3H1AA 3WISA 4B6JA 3TL6A 2MJLA 5E7QA 2JFVA 4C0LA 4ZCRA 4G5GA 1NX9A 2QTAA 1MTZA 2NVBA 3IEPA 3JQ7A 3V1YA 4EELA 5KYKA 1KFJB 4XUEA 5A3SA 4DQXA 2I1WA 1N4DA 3MUOA 3O4HA 2EL9A 3WGTA 4PAMA 2YOGA 3P9KA 4EQZA 4ZHQA 3A6DA 3FFXA 3MT9A 3ZXSA 1VB5A 2ID4A 3ABZA 4PYLA 5JYBA 4X62B 3EZFA 3AEYA 1SGWA 4HUQB 4KO2S 5DF1A 1ZI9A 3AESA 3ED5A 5A7FA 1Y9AA 5K20A 5CD1A 3HXLA 1I32A 2YCBA 3WE7A 4U6QA 3KC2A 3PVSA 4Y6GB 1W35A 3EDYA 1D8AA 1SD2A 3GPIA 1CNFA 1K5GA 2R1ZA 4H0CA 4JOSA 4DWJA 5BR1A 3QXGA 2P4QA 2Y27A 2QT9A 3FRHA 2PR2A 1YVEI 5B3JC 2P91A 4LYYA 3T9CA 1GO2A 1KEZA 3SZ3A 3QUAA 4FYWA 1QZ3A 1IBSA 4LC9A 2KS6A 1TO2E 1NATA 1CFJA 1QAMA 4IDNA 4J4TA 4ZCIA 1TM2A 1B16A 1O95C 3P0RA 5CTJA 1RJDA 1GFZA 3WX0A 3TOCA 1I4OA 3AW9A 1I1QB 3FTQA 3NWPA 1ZGZA 2R68A 2W4MA 2I6GA 4GQIA 4INZA 4QEKA 1A7KA 4R05A 1TZ2A 2G3YA 2Y92A 5DB4A 5EXDA 1GDTA 2A0YA 4KN6A 4FT4A 4TUYA 2C83A 3MUEA 4PQYA 4KXLA 4AP9A 1K7CA 4D4HA 4NMHA 3N5CA 3I01M 4BGEA 2I03A 2MDTA 4Z3OA 4LMAA 4Y6LA 3FFBA 4NCHA 2WZCA 3S2EA 3TCKA 3TQIA 2VJAA 3DUFA 4NQRA 1SQ0A 2WTUA 2BN4A 4HS4A 2FN9A 3BMQB 3NX4A 4XQGA 2AYXA 5CK5A 5AHOA 4ZRDA 5AM2A 3K0KA 5E6UB 4Z4FA 4M83A 2ODBA 3LLUA 2IXFA 5C8XA 5U4XA 1WP4A 2RGBA 4D99A 4RK0A 4BZPA 4LS3A 1FRQA 1G3IA 1GQSA 4QTXA 3TG2A 2PKQO 3LBFA 4CM9A 3G2LA 2OK7A 3CUTA 1I6MA 3PQ3A 3GJ4A 5JSUA 3GLIE 1YBFA 3FN4A 3LQ2A 2JFQA 2COKA 2W6MA 4W6ZA 2NV2B 2KSQA 2FUNB 1Q1BA 4HSGA 4Q7JB 3V6LA 2I4RA 4W1RA 1ISPA 1QUEA 1II8B 3B1JA 1RBMA 1MDBA 1NLMA 1UC4B 1LPAB 3IOCA 1J2EA 3L0CA 4QZVA 1WKVA 1B73A 4JI0B 2HMSA 3IHWA 3W3AH 4EPWA 1X9GA 4IJKA 3GFBA 1KDOA 1XLTA 1AC5A 1ORWA 1C2YA 1CHDA 4FOLA 5EMMA 3VPSA 3W2FA 4XGNA 2PUGA 221PA 2JDID 3LQKA 1CQXA 1JIUA 4J2TA 2DFPA 3MRSA 4MWDA 4KMMA 1XN4A 3GUYA 4O5OA 3HNPA 4B7XA 5I9NA 3HYTA 2ZZKA 5LPNA 3R6GA 3CM0A 5D6OA 1W4LA 3AIMA 3HWSA 3LO8A 4L1KA 5ALFA 5FLKA 3RSFA 4C78A 3GPLA 2W2KB 4MINA 3COWA 4YXWA 5JPCA 4B8ZA 3R3YA 1TJYA 1K7EB 3OE7D 4H7DA 4MQEB 3WWDA 4CFSA 4KIJA 3RANA 1V11B 4Q12A 4IH4A 5IRCD 4EF5A 1I0IA 2BEWA 4LV6A 2YXNA 4PZUA 4KFCA 3P4UA 5DM0A 3L7MA 5BQXA 3C3MA 4LDZA 3V3KA 3W2IA 1N3BA 2OZEA 2XYQA 1QYXA 4IDGA 2Z8YM 5FXMA 4KTVE 5HP4A 4CEHA 1Z7BA 2EJBA 1ZINA 4RSRA 2CE2X 4E2WA 4RIFA 3V4RA 1XNQB 1RMYA 2OZLA 4RE6A 2ZJ4A 4TL6A 4QXPA 1A8UA 1GG2A 2JFUA 4V02A 4Y2XA 4NRDA 3EMVA 1D2MA 3FOCA 2GETA 4FTWA 4MI6A 4MUXA 2H08A 1AE1A 3PX2A 4X7BA 4KR3A 3H2GA 5AW1A 2ONYA 4HTAA 3USZA 1MB0A 2WV7A 3NALA 3S7TA 1N3LA 1MW8X 4B44A 3EXG1 4R1LA 1CIJA 4WKBA 4ZI3A 4KOEC 3RGGA 1NP6A 2O0KA 3UGJA 1OE0A 3IV7A 3F4KA 4HPJB 3G1WA 3AF5A 5HOEA 4L5CA 4MJLA 4UBMA 1CEXA 3PJGA 4HXFB 5BOSB 1HETA 5HRUA 1AKNA 3IHKA 4QICA 3Q0EA 1G16A 1TPYA 2BFMA 4LECA 5F2OA 5HYVA 3FPEA 2QUKA 3IUMA 2A94A 2V0GA 2CXOA 4ER5A 1TZMA 5DHRA 4CM8A 2O7RA 4UDYX 3P8ZA 4WY2A 1GQRA 3EFBA 3L7AA 2QVBA 1S3SA 1P7CA 4QC2A 4FWTA 4ZVRA 2JI9A 4EI9A 5BR4A 2W8ZA 1MGPA 3L0PA 4YMVA 5BV2P 5IM4A 4KYIB 3F9IA 3HCWA 4FMCB 4JT9A 3BT7A 3FYDA 3KZXA 2IHVA 2VHZA 4X8HA 1QONA 1HRKA 4JNKA 3RVBA 4EAAA 3F73A 5K3EA 1WXXA 3T4UA 2P9ZA 2GNAA 4REQA 4AZSA 3ZQ6A 2W22A 1JG7A 1ATZA 4LJYA 1AZWA 1G2OA 1OXTA 3OJFA 1CETA 1H2FA 4ZTZB 2WU0A 5CYPA 2J9YB 2QMEA 4ESEA 3ZVLA 1C30A 3FFAA 3GRRA 4LE2A 4IPTA 5JS2A 4BY9E 3OLYA 3ZTYA 1X94A 1C1DB 4J0DA 1VOTA 2JH8A 1R10A 3EASA 3IUBA 5EE0A 3UH1A 1HDYA 4Z54A 4CEJB 3C97A 4OGLA 1BN6A 5KBYA 3VH3A 3EPJA 2CXTA 3OSZA 1MUUA 4H7HA 4F45A 1IZ9A 4JJKA 1OWPA 1IPHA 1X7WA 1UF9A 3H5WA 5HFNA 4D9GA 3GJRA 1A8PA 3E9ZA 2XCQA 4MYTA 4TROA 4X1YB 3DT8A 1QF6A 1D2HA 2ONZA 3LKBA 3Q8LA 1HG1A 5B1IA 5HJ5A 5KQPA 4LJAA 2VP0A 4PO9A 4QDOA 4ZU6X 3TX2A 4ENTA 4IQ0A 3JS5A 3JR3A 1YJCA 3USCS 2FE4A 3KR0A 2QTVA 3SR3A 4D0GA 3TIXB 1UAGA 1KAHA 1KGSA 1QQ7A 3QRWA 4CLHA 1NHWA 2ARKA 2Q1UA 3LT0A 2RDMA 3AXSA 5WRFA 1OLSA 4B84A 4CN9A 4WT7A 4IIUA 4IIEA 1XL0A 1FNMA 3T34A 1P5ZB 3C6XA 4A6EA 1YOVB 2XZOA 3GJXC 5J5VA 4YVFA 4BLOA 1TCAA 1GY8A 4FCVA 1C3XA 4XOUA 3A05A 1TVEA 5ERGB 4GWLA 5FWYA 2Z09A 1SR8A 2AEFA 4P38A 2AJ8A 3DMNA 3ROKA 3ESRA 1WCV1 2Q3FA 3A4TA 3GB9A 3OKPA 3PEEA 1YUMA 3WOHA 2QAGA 4FZ3A 1EK6A 1ZCJA 3SMQA 4CDNA 2Y99A 4ZIRA 3QEKA 1G8YA 1UBFA 1NF8A 1XDBA 2C9YA 4NULA 1W0KA 5C5EA 4Z9FA 4AURA 4WY8A 1RHRA 2P69A 2XTMA 1LS1A 3G0DA 2NUPB 2YZMA 3R8XA 4CT5A 4MAAA 1CY8A 1AD2A 5JCZA 4A36A 1I4EB 2BR5A 1H4VB 3W6ZA 1SVUA 3T1YB 1TCVA 1QHHA 2IUYA 3D7SA 3CMCO 2BFBA 1MHPA 2Q99A 3GT0A 3PTAA 1OZFA 4HR7A 3GT7A 5F3DA 5G0SA 3KDSE 4R7ZA 1CVLA 2YMPA 3HN6A 1TUBB 3HRHA 3MTEA 4QO7A 3IJEB 4LOIA 5EYPB 5SYNA 2JGLA 4W5HA 5T8KC 3WK5A 1NU6A 3SMVA 4E08A 2AQ8A 1JLRA 3NEAA 1UBLS 5DWDA 4CG2A 2GPYA 2C0QA 3HY3A 3DQPA 4D6YA 5B6PA 1KSHA 1YR3A 4NENB 2JBHA 3K1AB 4GXTA 2W42A 1PZEA 1R5BA 3WMGA 1V96A 4DDWA 4ZYYA 5JZVA 1T6XA 2RI0A 2HJGA 4CNBA 1F60A 4X0EA 4EJ0A 1QRTA 4ODIA 4MLCA 3ZV7A 3W2EA 4HYTA 3IOEA 2AXPA 4OQ4A 4RQUA 3UWMA 1JHMA 3PQDA 1OZGA 4ZRMA 3O3NB 4ER0A 1F6BA 2P30A 2G1AA 3CVUA 1Y34E 1Z4NA 3D8NA 3DOOA 5AKXA 5E8RA 3S99A 1P3Y1 1IIRA 1QBKC 1PW7A 1N6NA 4YAOA 4L02A 2AR0A 3VUFA 2H63A 4OY3A 3ELUA 3DHEA 2DQSA 4KE7A 2BM1A 4IIJB 3ZWVA 2AOXA 2GHIA 2W2VA 4LKRA 1WB5A 4M9UA 2ZB8A 4DSZA 1TMYA 3LT1A 3OM9A 1N0HA 5AKKA 3SC4A 2C3MA 3UKJA 2O0LA 3NYQA 3WAKA 4C7MA 5IN4A 3RBXA 5G40A 3UQZA 2NU7A 3OD5A 1IXKA 4W5WA 4CKBA 1EXDA 4Z53A 4HAXA 3DEIA 5BYJA 2XBLA 2O50A 4EG6A 3NRJA 2O2DA 2IKQA 1MVNA 1C9NA 1YCFA 5CYOA 4MDHA 3NTRA 3SEFA 2PGXA 3RV3A 3JX9A 1L4KA 4FE3A 4WNIA 1DWQA 4FOOA 4HG2A 1L5NA 4A73A 2G88A 1NASA 1IPEA 4BFYA 4JB8A 2JANA 3I5MA 4UM5A 5H0IA 1LSJA 1E66A 2V45A 2WICA 4F86A 4F4CA 1QTQA 4P4SB 1XNGA 5DBFA 5C8YA 5AVUA 1ZH4A 4CEIB 4K7JA 3H5LA 3AI3A 3FNQA 2SKEA 4NOJA 3WHLA 5AQ1A 2Z4RA 2HDNB 5E7MA 4RK7A 3QENA 1PQWA 2XE8A 4YX9A 3LK7A 5FOTA 2EV9A 4I1PA 5TJ9A 3M6AA 5HVNA 3A1NA 3KT6A 3OHMA 3D3JA 4RENA 4CCSA 3LQFA 1WMDA 4BX9A 4DNFA 3MJDA 3P0JA 5IDQA 1UKAA 1C0PA 2GEDA 3A36A 3ZC3A 1JR6A 3PWSA 4F2PA 4DR2B 4MYDA 4ZPXA 1BQ4A 2PFGA 1D6MA 1OASA 3BXXA 1P7YA 3OC6A 1KYTA 3MIIA 3WIEA 5B4VA 2XA2A 3JY6A 4TZTA 1P19A 4D0RA 1ECBA 4EGQA 1QKJA 3A1CA 3MJEA 3RVOA 5CB0A 4RULA 4A03A 3MEQA 3KT3A 3NM6B 5KC8A 2I6XA 3JVIA 4D3ZA 3EPKA 4YALA 3CRRA 2ZZNA 2QLBA 1UBMS 5HZKA 3NW9A 3SM9A 3SLKA 4LGYA 1BX0A 1W75A 4FR5A 3BF8A 1JJBA 4M0UA 1E4YA 3TRKA 3PXCX 4CKZA 1GM5A 4JGGA 4DNQA 1TK9A 2XBMA 1W88B 4HN2A 5AJUA 1KJNA 1KOFA 2OYSA 2X3YA 2FDXA 3PDUA 4KFUA 3WMEA 1QRSA 4NCBA 3OJCA 2GARA 2EG5A 4FCWA 4ZQIA 2YXEA 3TX6A 4OIMA 1YR1A 1LZLA 1E5QA 1XAJA 2CEAA 3Q5EA 3QPWA 2WYIA 1ENPA 3TSCA 1F51E 4TWZA 3RQIA 3H97A 5B12A 4TT3D 3SZGA 3Q3CA 1WNTA 3C8UA 1JG2A 4IY1A 4MUNA 4QAQA 1SBTA 3TXXA 4AG6A 1O0SA 1X0VA 4CMBA 3F46A 4GD3Q 4GQAA 4RD3A 2QTTA 1PR3A 3T5PA 2QM3A 3ROGA 3F7OA 4RDIA 2O06A 4C7BA 1NF3A 3VYTB 3UCEA 3NOOA 5DMHA 5ALIA 2BFWA 1NE7A 1YXMA 3IMGA 4M8IA 3AINA 1KVTA 4OQXA 1KDTA 5DEOA 5A3RA 5T4EA 1Q0HA 1R2QA 5AI9A 1ZYUA 1KWKA 1NVTA 4YJGB 2AEMA 1ZN2A 4FHGA 4HBZA 4EA9A 4QWWA 1OFHA 3KJFA 4MVJF 1KEVA 3VH4A 1XMPA 2Q5IA 1N1DA 2XGSA 4NBNA 3V7YA 1WW8A 2PUWA 5LZ9A 2H5LA 5C4MA 3AO0B 2XKKA 4V0NA 3IE1A 1OOEA 1QX4A 1XDUA 4PXYA 4DV7B 4DAEA 1VA4A 3L4EA 2VUIB 3E53A 4I3FA 3FWKA 2JLQA 3OCJA 3M4JA 4MR8B 3TBFA 3TLEA 1E5LA 4R8LA 4IO1A 5K0FA 2HA2A 3IELA 1ESDA 4HSEA 3MT7A 1VPTA 2PX4A 1Z83A 3N8NA 3KQYA 4AJIA 5JYDA 2HXSA 4BVBA 3U6KA 1UJMA 1SIOA 1VGQA 1YULA 2BJWA 3DBHA 3F5MA 4R2MA 3LOPA 2PMDA 1OYOA 3BHMA 4LYFA 2ECKA 2C03A 3WGLA 3AT1A 1UC5B 2IVFA 3U4HA 3B1ZA 3B1XA 3BIFA 3DUWA 5DCUA 4UZEA 3LDHA 2SHKA 1SVKA 2DBZA 3LA8A 4R9NA 3VR5H 5CEJA 3HADA 1F38A 3LSTA 4CE6A 5K8JB 1AUVA 3EDRA 2PZGA 4Q9JA 2ZYIA 2H17A 3IJPA 2BRUC 1X3SA 2QR3A 2Z0MA 4KQ2A 2I76A 3OCCA 1P2BA 3GUHA 4IGKA 1ZVVA 1R9GA 3CLRD 4ZEXA 3EHEA 4W99A 1J2UA 4X66B 2I65A 1XPRA 2WU4A 1OI7A 3DMDA 4I50F 1T9AA 2ZXFA 3QVGA 4ZAGA 5IG2A 2W6NA 3NHPA 5LMNB 1N5LA 2NTEA 4EYGA 3IGFA 4EGJA 2O3SA 1NP7A 2E4UA 1TZJA 2F1HA 5D1NA 2E7ZA 3R9WA 4ZT7A 2B8WA 4UXJA 4YAGA 2GBCA 2BEWB 1RU3A 1RKVA 2OCPA 2BMWA 2GM9A 4L0MA 4RESA 5ICFA 1XDWA 3BQ9A 4JU9A 1VCIA 3FPBA 4PGGA 4R01A 4YCJA 4CEHB 1SURA 3TZEA 1T1SA 2QNBA 3MF4A 3ZCXA 1L5ZA 5H9WA 3EMBA 2NP6A 2IBTA 3HR7A 2WHPB 2P40A 2G5TA 4OGGA 2FN4A 3HJFA 1V26A 1P39A 2HF8A 2B36A 1EDEA 1ZJYA 3MJSA 3QBDA 1CIVA 2RAVA 1WF3A 3CEPB 2XBUA 1XEAA 2R1TB 4L07A 3LP8A 3GIWA 1A8IA 1YR7A 2R79A 5KWEA 3V4OA 3ORYA 1ZGHA 3RRMA 3DV2A 4ZHQF 3EH2A 4M38A 3TI9A 4BWVA 3T52A 2ZRHA 3WAJA 1G3RA 2HK9A 4OHVA 2O8EA 1R0ZA 3P20A 4NEHB 4AX8A 4AYXA 1YIAA 1QOQB 3T3GA 4RMJA 1J2JA 2EFYA 3ZU5A 4KPYA 3O7MA 3PNBA 1R4MB 2FV8A 3R1IA 3E22B 4EG3A 2YXBA 3KQUA 4GZ6A 4QLOA 4DQVA 4EMTA 4MRAA 3GN1A 2QL5A 2XEXA 3MS2A 4KYVA 4RHYA 5BT8A 4ND6A 3LQ4A 2HMVA 4HDKB 2ZVPX 3LY7A 2BM9A 3HDTA 1BH2A 4RL6A 5A5GA 2J7PA 5B7GA 3O31A 1EVLA 1ZC4A 3A1UA 3BWVA 3IUEA 5H4HA 3IB3A 3Q2OA 4JOBA 1SQGA 2HJRA 2H2GA 3P4YA 2C1EA 1T10A 2HUPA 4GOJA 1BRTA 5INTA 5LQUA 2DQKA 2H1SA 3VMFA 5F5LA 3F1KA 1E94E 2IIQA 3OLZA 3W8RA 4B2LA 3HR4A 3I2GA 3BJRA 2O3UA 3CPSA 4P0TA 4BGIA 4FINA 1L9XA 1PWHA 3KWJA 4D41A 2WSIA 4MKGA 1BDBA 4TQGA 1BWQA 4REQB 5E7IA 4ZZ1A 721PA 4E5SA 4HHEA 4LZPA 2P5TB 4TUYF 5EVCA 4A1FA 5KYNA 2X5OA 2ORIA 3QHQA 3QOXA 2IK8A 2OD9A 2RHMA 1SXGA 3HUUA 3L1IA 4NYJR 4TQ9A 1H69A 2WI8A 3IRVA 2RAPA 5K3BA 4WXRA 4C3OB 2ONKA 3WA6A 1B3RA 1K6XA 1QDEA 1KQ3A 3EB9A 5EQFA 3EA4A 3PFIA 2DZDA 4YT2A 1KXJA 2PTGA 4QYXA 4FM9A 3FCCA 3KQMA 1CUWA 1TA0A 3I28A 1NBAA 2G5CA 1Y1RA 3KPJA 5IKMA 2FCAA 4R40A 1GGKA 3HA2A 4TQAA 1KJQA 5JFGA 1W34A 3OZUA 4AYTA 1E1QD 3X1YA 3LVBA 4ZOQI 4L6CA 2XMRA 5EHZA 1UXJA 1YQXA 3TFQA 1OV6A 4WEQA 3KPVA 5FDFA 5JSFA 5AM0A 4M1KA 2QTVB 4JLMA 2YWBA 3P9CA 4JT8A 2QR2A 4U2CA 2GDJA 3PX7A 2H59A 3KFVA 1KIMA 4NKRA 1QC5A 1FX0A 3TVTA 4KHPB 1V35A 4P92A 3WLEA 1PZGA 1YBHA 2HI0A 4PCLA 5HNKA 5GONA 4ARVA 4OL9A 1PJQA 5FBHA 5HIAA 3OIUA 4XFKA 2W9XA 4MYSA 1SBCA 2J3QA 2P6OA 1WQ4A 5DNVA 5EKDA 3ZHZA 1TCBA 1HOTA 4BO8A 4EG4A 2CXQA 4HWKA 1QIGA 4KQGA 2D74A 4D0LB 5IJWA 2R11A 1R18A 2W7TA 3OE1A 4I46A 4D74A 1CZNA 5D51S 5HCUA 3T0FA 2Q5OA 4U0JA 3HBFA 1UANA 3G8DA 2WQ7A 2A9PA 3M6IA 2QN7A 1MB9A 4F1WA 1BDHA 1ESNA 5I3ZA 2JFGA 3D8HA 2WJIA 4HQOA 2JNWA 3EG9A 4G01B 4U5XA 4YJ3A 1DI0A 2WZBA 4KODA 3Q10A 5BV7A 4TV8A 3WQQA 2L19A 4BFLA 1AKVA 3TMAA 1NNLA 3EZNA 2CLFB 4GP7A 1B42A 2FEXA 4TTSA 2J6HA 2UV8A 4BYGA 1KC1A 3OJEA 4P4LA 1T6BY 4W1QA 4BWFB 4O2AA 3R9IA 1F0KA 3JVVA 3KO8A 1DAIA 1FUYB 1OAKA 1SBZA 2IGTA 4G5QA 1W52X 4KO8A 5JE8A 4F3YA 5A2GA 4RPGA 5AW0A 4R68A 4AXBA 5MN4A 1T0JB 3ES9A 5BQPA 1Y80A 2K5UA 1UBSB 2AMFA 1Q92A 1GLGA 3T7RA 4FDTA 1SKYE 4BO0A 2BY4A 1AKYA 4CM6A 5HJ7A 2ZTMA 3HXOA 4XAQA 4BKOA 1B23P 2KBFA 1E6MA 1NJ5A 2CJFA 1NVBA 3IA2A 1UK9A 3IUSA 4DOMA 3DG9A 1TJPB 1UBHS 3ZE9A 4EW2A 2ZPUA 4CYMA 3FY4A 3WB2A 2XA9A 4R41A 1S4QA 3GJ0A 1TCCA 4I36A 1NWCA 1UPUA 4I8IA 3V4PB 2R8OA 3HABA 1KY2A 5JTUA 2ODQA 2P77A 1FYFA 1E5XA 5D5QA 4C0WA 3JQAB 3ZYZA 1O95D 1WR8A 2BJVA 1G8KA 2J0UB 5CH5A 3WI7A 4FILA 4J7UA 2AMJA 1EP2B 4RH0A 5K0BA 2FFBA 4HQRA 1KJ8A 2C2OA 5FL7D 2FLKA 1JU3A 2OZPA 2Q9AA 3HVHA 3BXEA 4K86A 4M7PA 3Q8MA 4LRTB 5IM4F 1H9BA 2QSJA 3JD4A 3N2KB 1A9SA 4IDOA 4XM0A 2VHXA 2VNKA 2ZR7A 2ENUA 4RL4A 2B1RA 2L2QA 4IVPA 4QRHA 1PS9A 3L01A 2VHJA 3WL5A 1N2IA 5K4GA 3KZNA 2Q5CA 1A2BA 5CNKA 1MOQA 3NEPX 1YS1X 2LCIA 2YVAA 1USIA 3PXEA 4BOYA 1R9MA 1GRVA 4GX5A 4RXUA 5LP6C 3HI6A 2OO5C 5TQ2B 1YQDA 4RF2A 2WWXA 2QX9A 2CB0A 2RGXA 3REQA 4B4WA 3AWIA 3LUPA 4QFCA 3TIGA 3ZBUA 3ZV3A 3PDJA 4O4IF 4PZYA 4DIKA 1FDTA 4CU2A 2V3WA 2VAXA 4BFCA 1EWTA 1RM0A 5EPEA 1NFRA 3SCZA 4Q3LA 2V7QD 3I0ZA 5BO5A 3UMBA 3OC0A 1Q1AA 4MV5A 2VPIA 1OLOA 2XTJA 1J7KA 5THKA 1RLJA 1HT1E 5KYGA 4RXTA 1Z39A 4AZTA 4BZXA 1TMOA 2AQHA 3QY0A 4MWSA 4RPIA 4X90A 1RQRA 2BSXA 1JEYA 2WZDA 1Y33E 2FWBA 4GOND 2YOFA 1LW6E 1OAOC 4OHPA 2A2ZA 3GY0A 3TH5A 2X1LA 1Y37A 3HY6A 2QN2A 3UMSA 1W48A 4LQLA 1P44A 3LYLA 1LFAA 2C98A 3TQQA 1VZ3A 1GQFA 3BIWA 4PZCA 3DL2A 4QU5A 1UK6A 4YPVA 2FJUA 3LY5A 4UHKA 1NZJA 2ZBQA 2W2XA 1S8NA 4ARZB 5CDGA 1EP1B 5KI6A 4BYMA 1JQAA 4YJKA 2IEAA 5BWLA 1JXAA 4LRXA 4C6SA 5HUQA 5SY6A 3VKWA 1KI4A 1CC1S 2B4AA 3ZDQA 2GO1A 1DBIA 4ZAXA 1MJGA 3BH7A 1X7ZA 3RIMA 3X0DA 1WHTA 3CE6A 3E8XA 2CXHA 3QLEA 5DGHA 4U1RA 5AQEA 2RHTA 3HN7A 3GL9A 1FRFS 2O7VA 5FPHA 1FTNA 4E4TA 2R7KA 1QH1A 4BNYA 2GVNA 2QN6A 3GXOA 3UXMA 1M7HA 3WSVA 2NVUB 2XUHA 4D9JA 5K03A 1CJTC 1DHRA 2O2HA 2ADFA 2X1VA 1YB2A 2DULA 2IEBA 5D3ZA 2GESA 4J94A 1SEVA 2PEYA 2ZRNA 3L4BA 3VJMA 1GV1A 1E69A 5HILA 3ZNQA 4CT4B 1NJGA 1NBWB 1Z5ZA 4LF7B 5HGXA 1Y4ZA 1YK0A 1GOTA 2FMUA 2IF0A 1Z56C 4YUZA 1YFKA 4FNGA 1QB8A 1IXRC 3GJSA 5EE9A 2ADOA 1KJ9A 3DKRA 3KDPA 2ZJ8A 3M5DA 3W4KA 4ZN6A 3IXMA 3EXAA 2XUOA 3KWMA 4JLAA 1U0LA 4V0OA 3OETA 3W6PA 2IL1A 5EKTA 1L1RA 2FZ5A 3ZS9A 4TYNA 4DLTA 1T8WA 3I2KA 3GLFB 1G98A 4PSKA 1W2GA 4KLRA 4Q18A 3RI3A 5JD5A 1WZ2A 3LF2A 1YRHA 1KU6A 5EA2A 1UK7A 1V39A 2PGNA 2W5UA 3LBIA 2ZG6A 4J16A 4QLAA 4R7TA 5SY9A 1EYZA 1XTJA 2VRBA 3GLIB 4KR0A 5M7EA 4FC6A 1D3AA 3NETA 1LUAA 3IVGA 1A9XB 4P4UA 1JJIA 2WAXA 3P9ZA 3T5DA 4BAGA 4DSNA 3ZDYB 1DC6A 4PZ9A 4KH0A 2NUAA 5B1SA 4Y2UA 5LP6B 1M2GA 2E1RA 4WESB 4GL2A 4MVYA 5BVGA 1J6UA 1KI2A 2QZ9A 3DBHB 5J2UA 2BSQA 2AG0A 2DQ4A 2P6UA 3MW8A 5AKHA 1ECJA 2NSDA 1LK7A 1JTFA 4PR0A 5TS2A 4DT1A 1XMSA 1DCKA 1Z2OX 2QDXA 4F04A 1RLUA 2ZYHA 4F9EA 1K7XB 3WDKA 4TT3A 1WUIS 1SHJA 3ZNOA 4BB6A 4UTRA 3BH6A 1D1PA 4Q48A 3PCXA 4U9IS 2RGNC 4JJ6A 1SC6A 4P7FA 1XMIA 1M1YE 1SQSA 3A06A 1PGNA 2QVZX 4QBIA 3CA8A 3PUVA 1I7SB 2PSSA 2PS0A 2J67A 3T7SA 4B3RB 4REOA 3DT6A 1EFHA 4PAOA 2GPJA 3JQDA 5K9ZA 2PJDA 2IKSA 1W5EA 3R3XA 1L7RA 3DW3X 1FNBA 4KX5A 4P08A 4X92A 2QV0A 1WPXA 2DP4E 3DCJA 2VQSA 3HKBB 3OIGA 3R3HA 4R9RA 4F2WA 4KAJA 4DDUA 3HLKA 1NI5A 1H4SA 4RHCA 4TKUA 4CR6A 2GAOA 2BMVA 1TW2A 1ODCA 1S01A 3TOXA 4BQOA 3NXKA 5KSZA 2GSWA 3GO4A 4PYRA 4DC0A 5LUAA 1I94B 3MQ4A 2GCOA 3R23A 2C1ZA 4HAIA 1ISHA 4FLMA 1P5HA 1XUOA 1T3TA 5F78A 1IDOA 1JX6A 3R3ZA 3UWDA 4YRJA 3O8QA 4WJLA 1USVA 2G40A 1E5VA 4F5EA 3EXG2 3AUSA 1BOFA 3SU8A 3IRUA 1E2UA 1T9GS 4FEEA 2JB9A 1XZGA 1Z74A 4XD7A 5EY5B 1R0KA 3VPBA 3EDOA 1M2VA 1ODSA 1JQ5A 5EE5B 2UVPA 5K3AA 2SCUA 3AVPA 1U7ZA 4R8MA 3DLIA 3NNDA 3ZJ5A 4DIBA 1EX6A 1M1YA 5CH8A 1R0XA 1KRXA 3O26A 2XIJA 3TD2A 4GPD1 2V96A 2RGYA 3HMQA 3VZBA 3LC2O 2HU7A 5IU6A 1OAAA 2ONCA 3AY0A 3EGXB 1F20A 2LDBA 3IA7A 4AS2A 3ABQB 3OICA 2G0NA 2O8EB 5EGNA 5AKJA 3K0CA 1H65A 3GFFA 1IJEA 1PAUA 4DR1B 4DCJA 3TUJC 5DOZA 2HMUA 1W36C 2B2XA 1BFUA 4OYYA 5FP0A 1M66A 3FCXA 4AF8A 1TCUA 4AL4A 4XVQA 1MX3A 1CUGA 4YI3A 4BHTA 4YUAA 1M0EA 2DRIA 2DUJA 3QVXA 1ZICA 2GX6A 5A7HA 2JHPA 4KLCA 2VWGA 3F8SA 3Q7EA 3QI7A 4YO7A 4ZOCA 1ST3A 4CT0A 2O2XA 2GZMA 1T0BA 1YJXA 3KKQA 5IFKA 1USKA 1K5DA 3VUEA 3VISA 4ACBA 3WGMA 3BULA 1P0IA 3FGZA 1RWWA 2VJLA 2W83A 4ZXPA 1Z6ZA 1MNQA 2R6GA 5JHHB 1N36B 2B34A 5K4AA 3PX3A 3O91A 1K1EA 2HTFA 4MGHA 3BCSA 2CFIA 3ZZNA 4HNVA 2FZVA 2EW1A 4Y1GA 5KZMB 3OUUA 1FYWA 1JFFA 3P2YA 4QD3A 1QR6A 2E5WA 4Y6QA 3HCEA 3UK2A 1BKYA 1GNQA 1XDZA 3VYVA 3GUVA 3RVDA 5DRTA 5CX4A 1UT6A 1O4WA 3HYSA 1RFGE 2LR0A 5HKKD 4OO3A 2OXTA 1VHQA 5AKZA 1RZRD 1ND6A 1L5FA 3A3KA 5KEIA 2LV8A 4GECA 1QOZA 1OGYA 1F2TA 5EIHA 1JHQA 2PMCA 2WP0A 4K3VA 1TM4E 3OM8A 1BMFA 3QFTA 1E2MA 3EVCA 2ENWA 4FDMA 4C88A 4RGBA 2H54A 2H7YA 2ERYA 3TTTA 3EWAA 3WGIA 4ZI2A 3LVFO 4GE0A 1T15A 2NX2A 4XJTA 5GMOA 5KDDA 3CUUA 4G5HA 3D8BA 5DU2A 4B2IA 2CV2A 4MA4A 4U3JA 1Y8AA 2OENG 1WSDA 2J6BA 3CLKA 3D6MA 1JEAA 5SICE 3U2QA 2REBA 5GONB 4EMSA 3LCMA 3IBTA 1Y7LA 1VG0B 2J59A 1CRLA 2OFFA 1NVKA 3AK4A 3DPSA 3PFHA 3OD1A 2IIBA 5F7JA 4D4KA 1CR0A 2BZGA 2C4HA 5KOIA 4OTZA 2ADMA 1TLLA 3FD8A 3S70A 4QTYA 4AY4A 5JH7B 3TZBA 5KB3A 5EIXA 2C59A 2I2AA 2YZNA 1YF3A 1JYSA 3EG9B 4X6LA 4ZU1X 5F2KA 1E5TA 1E6KA 2A58A 2BP7A 3LXUX 3OCZA 4YJ3B 3K4HA 2IZ0A 4U9HS 4B3DA 3W9YA 3W5AA 2G1JA 1APBA 4COOA 4RK6A 2BFCA 5H82A 2D1FA 2ZPTX 3Q4GA 4GPIB 3WLHA 3HXQA 1W36B 2XXBA 1QYCA 3E23A 1ABFA 3UFBA 5TARA 1TFRA 5E9QA 3TL2A 1R37A 1S2IA 5DNAA 3T1HB 4F4DA 3F96A 5EEGA 2CWDA 2X0RA 3G7UA 4RA9B 5G1OA 3JR7A 1WDWB 3GZJA 4L3OA 5JUWA 2XR1A 2OV1A 3BSSA 4QUIA 4EW1A 4WBNA 2V7WA 2WJWA 3PDWA 4S2UA 1LBHA 1DXHA 3D2BA 1T5OA 4TXJA 1R74A 3KUKA 5CPFA 4DTCA 4J2HA 2XH8A 3I9OA 4JYBA 4LHSA 5CTAA 3WMWA 4O3MA 3DE4X 3VOBA 3T7IA 4W5RA 4OHYA 1LTHR 3FIUA 3MTDA 1PTKA 3DOFA 3NDJA 1ADYA 1JHOA 4X1IA 2OLJA 1EG2A 5LZ4A 1UADA 4LJ7A 4Y0AA 2VEDA 5ALRA 3CGWA 1U0NA 3RWMB 1N2JA 2IS6A 2D2IA 1T3SA 2V97A 2FNAA 2PVCA 3N39C 4FOSA 4RKFA 1IWBB 1RRFA 4UXHA 2HR1A 4MJ3A 1YFJA 1CQZA 5JCPA 1BHQ1 1J9GA 5CB6A 2PEZA 3QMMA 1DBSA