4RTSA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gtcta)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 81
structure length 243
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtsA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtsA01
3B5IA 3VC2A 4MWZA 3MTIA 5DM1A 1NW8A 4AZTA 3OU7A 5MHTA 1NBIA 2P8JA 2PVCA 4M7RA 1G38A 2G70A 3WSTA 4RTSA 3KR9A 1N2XA 1INLA 3GRRA 3D2LA 2HWKA 2ZWVA 3GNLA 3R24A 5DM4A 1KYZA 2OB2A 4QPPA 5K09A 3G89A 3H2BA 5GIPE 4MTLA 1RI5A 3BGDA 3EGVA 4AZVA 3UBTA 4OX9Y 3BWMA 1XTPA 2BZGA 5DT2A 1L3CA 3TLJA 1UIRA 4DA4A 3KPUA 3MCTA 5DTMA 3M6WA 2OPBA 3C3PA 1VLMA 2O07A 4R6WA 5HFJA 2OXTA 3CCFA 2C7PA 2YXDA 2IIPA 2O06A 4RV9A 3FRHA 8MHTA 5FADA 1VIDA 1P91A 4KW7A 2PT6A 3KQVA 2G8NA 2YTZA 4OBXA 7MHTA 3A7DA 1Q0SA 3L8DA 2UYHA 5K0CA 1SG9A 3UJDA 5BW5A 2GB4A 1R8YA 5FULA 5T6BA 2BR5A 1JSZA 5GINE 2FK8A 5P8WA 5K01A 3FTEA 2YQZA 1QYRA 5G02A 3DOUA 1RJFA 4FT4A 2VDUE 4GOLD 5K0GA 5GWXA 1KR5A 4GOND 1P1CA 4QDJA 3ANXA 4V0QA 5EMKA 3VC1A 4X1OA 5CCBA 1G6Q1 4FP9A 5K0EA 1Z3CA 3E8SA 4EVIA 4LWPA 2AN3A 2EJUA 2P1DA 5KQRA 4QQNA 4PYLA 2BM9A 5LQRA 3FPGA 5DTQA 2JH8A 4PYMA 4OA5A 3UJBA 1L1EA 2PY6A 3FRIA 2PJDA 4B17A 4C07A 1D2HA 3K0BA 1R8XA 3P9NA 1SQGA 3BGVA 2G72A 2NXEA 3BKWA 5DM0A 1QZZA 4QVGA 4ER0A 1F38A 2PSSA 3BZBA 3EVZA 3EMDA 3LSTA 5T64A 3P2KA 1D2GA 4K6MA 2H1RA 3KQPA 4C08A 5BXYA 3LHDA 5BW4A 2C7RA 3BT7A 2PKWA 1R00A 2CMGA 4XUCA 2B2CA 5FTWA 3SSNA 2ZCJA 1ZGJA 2FHPA 3PFHA 5EHIA 2IDJA 2PX8A 4PIPA 3PX2A 3TQSA 5ICEA 3I53A 4E2YA 5KQSA 3LKZA 3OZRA 3G2PA 5DM2A 4DCGA 5BP7A 2QM3A 2VDWA 4F85A 1NKVA 4Y2HA 4RTPA 1EG2A 1NV8A 3KR1A 3UJ7A 2OBFA 3NVKI 3NTVA 4PYIA 4E33A 2P41A 3FUXA 5DSXA 2PWPA 4HGYA 1KIAA 5EVJA 1G8AA 1T43A 2AN5A 3V97A 5T67A 1RJEA 4CKBA 1R6AA 4U7TB 1ORHA 10MHA 3UA3A 1XDZA 3FZGA 4PYQA 5FUBA 5LQKA 3C6MA 3NW9A 5DX1A 1NW7A 3KR0A 5LQJA 5U4XA 2EG5A 3NDIA 2YR0A 3HVKA 2C7QA 3GGDA 1RJDA 3UWPA 1YUBA 1RI2A 2EFJA 5LQUA 1L9KA 4GOMD 2P3OA 4GUAA 3LBYA 4RVHA 2GA9A 1FBNA 3AXTA 3HA3A 2JH9A 5HZMA 3GCZA 4DF3A 4MHTA 2VP3A 3LDUA 4R05A 2FPOA 4X63A 5FQOA 3HVHA 3CVOA 3QV2A 5EPEA 4RVGA 4E2WA 2ZZMA 2GAFA 3FPFA 3HCAA 3KQMA 3UJ9A 4ATNA 5F2KA 5FQNA 4EK9A 5FCDA 5DX0A 2I7CA 4FGZA 3EVGA 4E2ZA 3OU2A 1NE2A 1X1AA 3GWZA 1KPGA 2PX5A 1I4WA 4QDKA 2BH2A 3FYDA 3OE4A 3ME5A 3HVIA 3SXJA 3CJQA 2I6GA 3M6XA 5LQCA 4PNEA 2A14A 3SSMA 5K0NA 1YZHA 2Y1WA 2WK1A 1TW2A 2IH4A 3B3GA 5KVAA 4CKCA 5CCXA 4KWCA 5EKXA 1SUSA 3P9KA 3NDJA 4GF5A 3U81A 2ZIGA 3KPYA 2IGTA 3QOWA 2C7OA 4ISCA 3PT9A 2PXXA 4U7PB 3EVDA 4C06A 2NP6A 5E1DA 4RTJA 2I9KA 2NXCA 5EMJA 5K0LA 3KPJA 4AZSA 3G2QA 1KPIA 3CJTA 4IV0A 4PINA 1WXWA 3OPNA 3O7WA 1L3IA 3E7PA 5EG5A 3LCUA 3B3JA 3PS9A 2P3LA 2BM8A 5HIKA 3JWIA 5CM2Z 1ZGAA 3PTAA 4LWOA 1KPHA 5K0BA 1N7JA 4DCMA 1JTEA 3FUUA 4RTMA 4UOEA 1QAMA 5H02A 3KHKA 4YUVA 2XYVA 3QOXA 1PJZA 3GIWA 3KKZA 2P7HA 1WY7A 3FYCA 4KIFA 2I62A 2PXAA 1I9GA 2ZVJA 5EHGA 5LSAA 4PIMA 3DP7A 4RTOA 4OQEA 4HC4A 5DSTA 3TPZA 4CWAA 3EMBA 5EIFA 2IPXA 2IP2A 3TM4A 2KW5A 3O4FA 4X41A 1WZNA 3DTNA 2ADMA 2FYTA 3V8VA 5FWDA 3HVJA 4XUDA 5DRYA 2QRVA 1DCTA 2OB1A 2NXJA 2Z6QA 1EJ0A 5E9WA 3PLAE 1O9GA 3LKDA 5FHRA 3NMUF 5D1HA 3FTFA 2PWYA 1N7IA 1DUSA 3G88A 3GU3A 3O31A 1L3BA 4ER3A 1JQEA 5EOVA 1U2ZA 2V74B 4KIGA 2ONYA 3R3HA 4KDRA 5CVUA 2O05A 2QE6A 5EIWA 4YUWA 2UZ4A 4CTJA 1SQFA 3IHTA 4P7FA 4HH4A 5K8VA 3EVBA 3LECA 1JTFA 2YVLA 2ZBPA 4DZRA 4YV0A 4E31A 4FSXA 2AR0A 2R3SA 1KHHA 5E1MA 5HEKA 2UYQA 4KRGA 5EC8A 5GOZA 1VQ1A 2YX1A 3LCVB 5E8RA 4YV2A 3UJ6A 3TOSA 1D2CA 2VS1A 4OQDA 4GQBA 1UWVA 3BWBA 4RTRA 1JG3A 1XVAA 2HTEA 2QYOA 4A6EA 4RTNA 4LECA 5LQAA 3HNRA 2QRVB 3REOA 4P7JA 5ERGB 3AWIA 1WXXA 3THSA 3MTEA 3ERCA 4RTLA 2P35A 2B9EA 3I64A 4G56A 3A7EA 1JG2A 4MQ4A 4R8SA 1DL5A 5E9QA 3M4XA 5CIYA 1EIZA 3UA4A 3CKKA 1NV9A 1QAOA 3HCEA 5EZSA 3VYWA 2IDKA 3IV6A 3CC8A 3CGGA 1NW5A 3FPHA 1WS6A 5M5BA 4X60A 2JHAA 3HCBA 2EJTA 2ONZA 2PX4A 4XUEA 5FA5A 3A4TA 4PCAA 3JWHA 3PVCA 5GM2A 3R9XB 2H00A 3GRVA 3NWEA 4PWYA 1M0EA 3EEOA 4CKEA 3EPPA 3S68A 3LPMA 5EGSA 3B89A 3T7RA 3I58A 3HCDA 3ELDA 2CKDA 5E9JA 4C05A 2YXLA 1VPTA 2XYQA 3ORHA 2ESRA 1AQIA 5HIIA 3GRYA 3MQ2A 1JQDA 1JG1A 3MERA 3BGIA 4KDCA 5HILA 3OZSA 5DLYA 3DMFA 3EGIA 3OE5A 3TFWA 3FUTA 2JHPA 2AOVA 4GC5A 4JXJA 4LG1A 2LD4A 4H0NA 3EGEA 1JR4A 2PLWA 4P7KA 4RWZA 3SM3A 2NP7A 9MHTA 4E70A 1YF3A 4XCXA 3KPWA 3TKAA 1BHJA 2IH2A 3TR6A 4PGHA 2R6ZA 1RJGA 1UFKA 5EQJB 3MGGA 2VZ9A 4O29A 4R6XA 3LX6A 5FHQA 1KXZA 3B7PA 1BC5A 2CMHA 2AN4A 1O54A 2E5WA 2GS9A 2ZIFA 4OA8A 5IKMA 3ID6C 1Q0TA 1H1DA 2ZFUA 4Y30A 1XCJA 2AOUA 3RODA 4RTKA 2ERCA 3LDGA 4FSDA 1R18A 1YB2A 2AVDA 3HA7A 4HRAA 4YMGA 1MHTA 2AVNA 3C0KA 3HEMA 2OKCA 1XXLA 3EVFA 3GJYA 4QTUB 3UJCA 5CUQA 2Z6UA 2F8LA 2XYRA 2UYOA 1IXKA 2WA1A 3KQTA 2ZTHA 5EZQA 4E32A 5GIOE 1SUIA 4PYKA 1X1CA 1HMYA 5KYGA 1VE3A 4RVFA 2B25A 1FP2A 3G5TA 4EKIA 5HIJA 1NBHA 3FTDA 2ZIEA 5K03A 1PRYA 5K0FA 3AY0A 2QY6A 5DX8A 2VDVE 3DMHA 3T0IA 3HP7A 3DXXA 3B3FA 3FTCA 3G8AA 2GH1A 3A26A 4IWNA 5CVJA 3BKXA 5C1IA 3M6VA 3RW9A 3FUVA 3OFJA 1EJ6A 2XVMA 3IEIA 1JQ3A 1YZ3A 3DUWA 4BLWA 4F86A 5LQNA 4EMSA 2BR4A 3MCZA 4PGGA 4YUYA 4HGZA 3PB3A 4WVLA 3A25A 5EMLA 3PX3A 3EVAA 3ELWA 4ER7A 2AOUB 4ER5A 1IM8A 4HSGA 3HCCA 5CVEA 4FR0A 2AOTA 3I5UA 1VP9A 3OCJA 4RSRA 4DKJA 1ZHFA 3EVEA 4HTFA 5EKUA 5LR6A 4GC9A 3BXOA 1FPQA 3DLIA 3KR2A 4RYLA 3P9CA 4RX1A 3KQYA 3ELYA 2IBSA 3P71T 2PGXA 3GDHA 2P40A 2PV0A 3AXSA 5DXJA 5E1OA 2G71A 4PCLA 1NW3A 3LGAA 1IY9A 5E2AA 4DQ0A 3CJRA 2ZBQA 1X19A 4YUZA 3SVZA 1I1NA 1X1DA 5DPMA 3M33A 4GOOD 3EEYA 1YFJA 3GO4A 2AOXA 5C0OE 4GEKA 2XVAA 3A27A 2HNKA 1M6EX 3PFGA 2GPYA 2FK7A 4AUKA 4M37A 2G1PA 4F84A 1G55A 3X0DA 3DR5A 3OZTA 5E8JA 5HOQA 5K0JA 2PT9A 1FJXA 1RI1A 4IKPA 4BLVA 5EEHA 3SX0A 4HG2A 3R0QA 5CVVA 2PX2A 5C9ZA 1M6YA 3BWCA 2PBFA 1NT2A 2AOTB 5EEGA 1KP9A 4X61A 3DH0A 4HTFB 4BLUA 1FP1D 5F2NA 4CTKA 4ER6A 2HV9A 5B1SA 3KQSA 2ZWAA 3DMGA 2FCAA 2P3QA 4BY9E 3NJRA 1HNNA 1AQJA 4PYNA 2IBTA 3KU1A 4MIKA 4AZWA 1JG4A 2ORED 3GXOA 1VP3A 3MB5A 4WXHA 5FA8A 4BP1A 4YMHA 4CXMA 3IYLW 1AV6A 4C03A 2OO3A 2N47A 2PXCA 3BUSA 2Z6AA 3E05A 5E1BA 3E23A 2O0LA 1XDSA 4P58A 4M38A 5JUWA 1OR8A 3HA5A 2B78A 3TMAA 4C04A 3KQOA 4R8RA 1RI3A 2NXNA 4DMGA 2ZZNA 2V7EA 3JWJA 3ER8A 3P8ZA 3DULA 2OY0A 4YUXA 5GP1A 3OFKA 3KQWA 5DRTA 2ZULA 4KVZA 3G2OA 3G8BA 1AF7A 1RI4A 3SSOA 2HR1A 3JWGA 5CVDA 5DTRA 3VSEA 3F4KA 5K05A 2EX4A 1Y8CA 4RTQA 1BKYA 4QTTB 1SVUA 5ICCA 3HTXA 5IH3A 3SR4A 1R74A 5F2OA 4L7VA 5DWQA 1XDUA 4E2XA 3GRUA 1TW3A 3RIEA 2YUIA 1ORIA 4V0RA 3THRA 1SKMA 1X1BA 4RVDA 4BP3A 3HCFA 5GM1A 5D1NA 1XJ5A 3P9IA 1QAQA 3C3YA 4GBED 2JJQA 3DLCA 3KQQA 4M36A 4P7GA 1BOOA 4EKGA 2CWWA 2FRXA 4Z2YA 2JHCA 2Y1XA 3BWYA 2IFTA 1YFLA 2CL5A 3LL7A 5EMMA 2ZBRA 4POOA 2IH5A 2DPMA 2ZZKA 3DXYA 4AX8A 2JG3A 2B3TA 1ZKDA 3SMQA 3T7TA 1JSXA 2GLUA 2ZSUA 2XBMA 2NYUA 3LCCA 1WG8A 5FWAA 3SGLA 5DXAA 3T7SA 3UJAA 4ZTBA 3AJDA 3I9FA 3DXZA 3G2MA 3P2EA 4FZVA 1P39A 3K6RA 4NECA 3M70A 3TKYA 3TRKA 3ER9A 3R6TA 1TPYA 1B42A 3LBFA 3OU6A 2AS0A 4OBWA 1MJFA 2K4MA 2ZW9A 5CD1A 3HM2A 5JR3A 2P7IA 4PYJA 2AOWA 2NNWB 4FS8A 4PONA 3C6KA 4A6DA 1NW6A 2UYCA 3CBGA 3Q7EA 1P1BA 4QPNA 3UZUA 1VBFA 3UFBA 4C4AA 4EQZA 3FPJA 3MAGA 3LDFA 2WA2A 3Q87B 3FPEA 3P97A 3KPVA 1QANA 3M6UA 2BR3A 2ZLBA 1XCLA 3NWBA 3UJ8A 3GRZA 1VL5A 5E2BA 4DM3A 3G5LA 2DULA 2HMYB 4FT2A 5HIMA 2OYRA 2AZTA 2YXEA 3FUWA 2OZVA 1F3LA 5KS2A 2O57A 4QVKA 3EVCA 3NVMB 1ZQ9A 1EAMA 3P2IA 3MHTA 1V39A 5ICGA 3TM5A 1EQAA 5ICFA 4IV8A 2Q41A 1G60A 1ZG3A 4YV1A 2H11A 4PYOA 1O9HA 4E30A 1KYWA 4QQKA 3ELUA 1G8SA 3G7UA
chains in the Genus database with same CATH superfamily
1AK1A 4KYTA 5C8YB 3I76A 4AZTA 3HCOA 4N7JA 3EIOA 3JX9A 4WXYB 3EOZA 1CUHA 1W9MA 5A5GA 2DZDA 3NHSA 4MVWA 4XD2A 5HX7A 1HE3A 2ZE6A 4HTAA 4QBGB 3WADA 5DM4A 5CXUA 4Y2RA 1JT9A 2I2WA 3C16C 4E5VA 1N2CA 3TMKA 1E2EA 2P69A 4OI0A 5TJHA 5GJWC 4MTLA 1RI5A 2HPHA 2W2LD 4YXWD 3QHAA 4KFCA 4G4SP 1YVPA 5HRCA 1J9ZA 3RYFB 3CPHA 3VNVA 4M1WA 5DTMA 5JVDA 5KYKA 4MPRA 4YY3B 2VK1A 2AJ8A 1VIYA 2ASVA 4JOCA 4YA6A 4DPKA 3S2EA 3TE6A 1W34A 3LIIA 3D6NB 5CTJA 3UJ3X 4KW7A 5IT5A 4JI0B 3HM9A 4JUDX 1CP3A 2YTZA 1KO4A 2Z43A 3GLTA 3NPAA 1IUKA 3ON5A 2VHQA 3KAJA 4RQAA 1MN6A 3JQDA 3Q3GE 1VB3A 1M2HA 3T4PA 1QMGA 2R1VB 4I3FA 2PVPA 4MCJA 4Y9TA 3HB1A 3FCAA 3QYAA 4AWXA 5MN5A 5I9BA 1K9SA 2X8BA 4D42A 4X1OA 1E0AA 3BS4A 3MGBA 4BCBA 3LUJA 4BCCA 4AMUA 3J81k 2NUPB 2HMWA 2LRHA 3WB2A 4XE5A 5KQRA 4YHHB 1A5BB 1P6XA 4GPIB 3QLUC 4AZ0B 1OFHA 4JJEA 4WKCA 2XGSA 3QELA 4NYMQ 3L0YA 1M10A 4YRQA 2HJVA 5IXSA 1M2OA 1XELA 1R8XA 5BVHB 2ZIUB 2YV3A 1MJGM 3BKWA 2XRMA 2WT4A 1EFPA 2X2PA 4HDMB 1QZZA 4Y2TA 1UJ4A 4B5LA 2Q6KA 4TVBA 1C3EA 1DFGA 5F77A 4ALMA 2FWNA 1FA9A 3LHDA 2XQIA 2PMKA 5DTEA 4XQ0A 4B5KA 3F3KA 1KA9H 4X62B 5LL6P 2KLBA 2QP4A 3R3JA 4R81A 4KPEC 2BGRA 2Q27A 1N77A 4C1BA 2ZG6A 3TQFA 4RV5A 1TQ6A 3NH6A 3Q5GA 3VX4A 4N5DA 5U9CA 1NV8A 3EODA 3RS8A 5A2GA 4DIFA 1SULA 3BTUA 3ICWA 4V2IA 3IHLA 3KCNA 4HLNA 3LXMA 2H2WA 4I3GA 3ZN2A 2Q4TA 3P2JA 4I4TF 3WMEA 2QROA 2H9AA 3Q3CA 1WU7A 4CU2A 1L8OA 5ITVA 4HUQB 5B64A 3QYPA 2G06A 3RDPA 5LQJA 4LZWA 3HB4X 1ODIA 2Y76A 4XM1A 5CA0F 3X2SA 4CIYA 4OLAA 1RJDA 5DBGA 6Q21A 3L07A 1KI4A 2JAOA 4HWTA 2VXBA 5IAKA 3P9PA 4CMGA 3IT1A 5T3YA 1OSNA 2CXPA 1ZM3A 4XIYA 1CB7A 1NM5C 3S27A 3W79A 3B2EA 1PQUA 4XX0B 5DYIA 4DA8A 4RCVA 2PIDA 1BHSA 3RTAA 4DF3A 3B8EA 1A1VA 4ZOEA 4P86A 2JGDB 1M73E 2TMDA 2APJA 2BMJA 2XE4A 3OZFA 5JZSA 1SVKA 5LZ9A 1EVJA 3DEIA 3FPFA 4R2LA 3NZEA 4LRTB 2AXQA 5AI6A 1JH9A 2CF6A 4WOBA 1NF8A 3U7QB 1XZKA 4D9JA 3BHJA 3I28A 4Y0VA 3TGPA 4UEQA 3Q41A 4QDKA 3E0QA 2GNPA 4ITUA 4BGUA 4EI9A 1YJAA 2R6JA 1IWOA 3GDOA 5C1DA 3PNMA 3CX8A 2OEPA 1FYWA 1B1AA 3AFIA 4HAOA 4HDNB 4WTOA 1K5HA 1NVTA 5GV7A 3S7ZA 1TJNA 3BGSA 4DIUA 5K4HA 1UDXA 1DX4A 5LPNA 1NI4B 3JRWA 3O8LA 4UNPA 5CR9A 3AZOA 2F1KA 3OHMA 1TQ4A 4B44A 1RYHA 2GJ9A 1J42A 2C4KA 2WDZA 2YNMC 3CT6A 2AMYA 4C14A 1W87A 2AMLA 2P2SA 4ITVA 3PNLA 4JDUA 1BWSA 3AIMA 2IEIA 2XPCA 3IESA 2ZPUA 3KKKA 3LLVA 1VYVA 4R2XA 1YU9A 4XAQA 1JYEA 2IYTA 2G36A 1A77A 3QVWA 4PM4A 3BRSA 3CEMA 4TTIA 3K70D 3BE5A 1NMYA 1TEZA 1WCV1 1ZRNA 3I9NA 1SCUB 3BL6A 1MB9A 4NCHA 3VU0A 2A5FA 3O7MA 1OD6A 1UJ6A 2A3NA 3CRZA 2J9FB 3GRCA 2OAQ1 4MI3A 3W6ZA 2JJ2D 2AW5A 5CDUA 1DKLA 2I03A 1I2BA 3I8XA 1TLTA 5BUZA 3TB6A 4J8PA 2OZLA 2WYIA 1HORA 5CNMA 2Q5QA 3EMBA 2F9LA 4XVRA 5TPWB 2DY0A 3TGWA 3WBFA 1CY0A 2D0IA 4H0FA 3SC3A 2CZGA 2OQIA 5BSKA 1P5HA 2ERYA 1KQNA 1J21A 2ZIZA 4AU1A 3BFXA 1E1KA 2CYCA 2O1WA 3RVNA 4EL5A 3M0EA 2JFUA 1SVMA 5E7IA 1TCBA 1YOVA 2NVWA 5K8UA 4AULA 2VDKB 2YC2C 4UEOA 2X7XA 1KHTA 1O9GA 5FHRA 2DUUA 5JMTA 1JMVA 2DFKB 3Q3IA 3QF4A 3F6YA 3FFBA 5DHFA 1Z0FA 3IEUA 4CTMA 1HRDA 3H4VA 5JYEA 3D3WA 1UOPA 3FN4A 1NJ1A 2G88A 4JMPA 3M1IA 4Z1MA 3GARA 3LY5A 1OFIA 3TSCA 1QLHA 5TGTA 3LI2A 3MFQA 3QEJA 2YVLA 4CI0B 1XRSB 2V58A 5A1JA 1U02A 1NR1A 2IUTA 2OLJA 4UNSA 1C8LA 1M74A 2WFZA 4W6ZA 3W5JA 3ZDEA 4B8WA 4DMFA 3OJCA 1RYDA 4RMHA 5A2QA 1M5RA 1ENZA 3LCVB 4NK5A 4C4OA 1R50A 1WB4A 5JH7A 1QRTA 1QE0A 2R85A 5KDDA 2IVZA 5F23A 2BFAA 3AHDA 1FRVA 1SG0A 4BGDA 3LUKA 2VZLA 4ODIA 4KPUB 4U0KA 2AI2A 3H4TA 1H94A 3KTOA 3W5UA 2WWRA 1GU0A 3SZUA 4MWOA 2HK8A 3V7WA 3WDSA 2YMMA 4Q21A 4I1OA 4M7WA 4R8SA 3I6ZA 3QUAA 2JZOA 4U00A 5E9QA 3UATA 2FR1A 2JLQA 2YH2A 4RHCA 4X6XA 4OI1A 4R3UC 4C2UA 3ODPA 2ABWA 3ZGNA 1BFKA 4BQRA 1II9A 4KAFA 1V25A 2CLDX 1TF5A 1ISSA 1NW5A 4XWTA 3GBSA 4D8XA 1UADA 4GX0A 5LMZA 2D5BA 4P33A 3A4TA 1PGJA 2GMWA 2OE2A 3V4ZA 3R9XB 4H7JA 4PWYA 5KKNB 4JR0A 3UOGA 3K2BA 1GEEA 3B89A 3D64A 1UPAA 1EFRD 1N6OA 2Q45A 4QSMA 1YUMA 3WRYA 3K9NA 5HRAA 1CETA 3GLRA 4WT7A 4JZYA 3OVMA 2OENG 4UXHA 5B1YA 5ENVA 5DDIP 2PMEA 4EG3A 4YRSA 2QVBA 3EA0A 3OZSA 2HA3A 3I01A 4QGHA 1TZBA 4YQEA 4ZK2A 4LZLA 4QM6A 1IZYA 1OX4A 3S55A 2GFQA 4DR6B 3LBIA 2PRIA 2OV2A 4RWZA 1NYQA 4I55F 1MKYA 4CKWB 2M6KA 4A2WA 2HHHB 1QF9A 5F4ZA 4ED9A 3ZPXA 2ZSIA 3PDUA 3JQAD 1AUPA 1XKLA 3PEVA 3EGXA 5DNVA 1PU2A 4WE3A 5A05A 4O0LA 3QHQA 4B4WA 4NICA 3I3SR 5DP2A 2XB9A 3GD7A 3N5KA 3BH6A 3GZNA 2EEZA 1Y1LA 3RV3A 3S4YA 1TM1E 3BILA 3HU3A 2VDMB 1VHWA 2ZIFA 1O0SA 2Z8XA 1SPBS 4ANFA 4CT0A 1IPFA 1NN3A 3RLIA 1KBZA 3OICA 1FEZA 3B1KA 3GP5A 1XCJA 1NLFA 4N3BA 3H2IA 4YQFA 4FE7A 4BWFB 1VGVA 1G8FA 1YGPA 5IABA 4G5FA 4EW2A 2AVDA 1T4GA 2G04A 1DZIA 2A78A 3J80A 1ZOSA 3UJCA 2IYWA 4EGJA 1EAYA 2F8LA 2UYOA 5JZ9A 4KO4S 2V0CA 1Q22A 2XNDD 1YE8A 3I6QA 3D1JA 3OBBA 5AI8A 1STOA 1X1CA 3JALB 3K72B 4CVNA 1KEZA 2CLSA 2I80A 3A04A 4O5OA 1CUEA 1EGQA 1Z8DA 3B1YA 3G9TA 3DNFA 3ABOB 1B16A 4QTZA 1L6RA 1M76A 1Z6TA 3M6LA 4MPDA 4J4BA 4MVYA 4NR0A 4K9LA 1RFGE 2BMEA 1HEIA 1WB6A 1WE2A 2XJ4A 3L7DA 4TGLA 1T6YA 4EA7A 3ORRA 3N1UA 3QFFA 4I4NA 1U2DA 4JI8B 1Z7EA 2H1SA 4ZI7B 3KFLA 3ELWA 5CH8A 4TRNA 4D92A 4ER7A 1CEEA 1T5DX 1P80A 4HH3C 2ENUA 3B2NA 3I5UA 4RSRA 5ERYA 1WZUA 1JEEA 3R7DA 3ZR4B 4YMUA 4G1VA 1CJTC 2IP1A 5LLDA 2F55A 1XSEA 5JSZA 2VWPA 1SBNE 4RX1A 3BEDA 3LIPA 3GY0A 2B69A 3FCOA 4OMCA 1HFKA 2B4QA 5E1OA 2QRUA 2G71A 1LDBA 1FLVA 2QMQA 5DPMA 2HUNA 3T7EA 3DTVD 4R71A 4BNLA 3RU7A 1TEHA 2GDZA 5ARDA 1K8RA 4QRHA 4WGGA 1FTWA 1YBFA 3CBQA 2GPYA 4MB6A 4MWCA 3DWEX 1L9XA 1P1KA 1JLRA 3C3XA 3NNSA 4TSRA 3QVVA 2X2OA 3OZTA 2GZ2A 1W4AA 5JY6A 1RI1A 1U3WA 4GL2A 2PM8A 2FF7A 2GN8A 3DM9B 1AGXA 1JZSA 1K08A 4XGIA 4M1MA 4Y6QA 1WHSA 3T99A 3ZWDA 5ADUS 3NM6B 4MYSA 4X61A 1KC1A 1DXYA 4FFPA 5AVSA 1CK4A 1D1QA 1Z0IA 4R1SA 4W82A 4OK6A 1JR3D 2HV9A 4R5HA 2JK0A 2D2XA 3EGDA 2GT1A 4RPCA 1OCEA 2FUEA 4AYTA 1XMQB 2PGDA 2B5WA 3CZCA 5HR5A 3ZDAA 3BMQA 1KOLA 4IZHA 3Q3HA 5LP6B 3C4VA 1WVMA 3LPAA 2N47A 5FTMA 5TGZA 3R75A 1E2MA 1SBTA 1J97A 2VPYA 4C5CA 2V5UA 3HU2A 1PEDA 1TJYA 4Q4HA 1J06A 2A5YB 4CNQA 1HR0B 1YTUA 2XXJA 1TMYA 4ZFNA 1NVGA 2I87A 3K0FB 3KL4A 1DEXA 2ZI4A 1D5CA 3JQ9C 4RGQA 2QWXA 3G0BA 1A9OA 2CNBA 4G5GA 4UDOA 4NZYA 1E7MA 5EMNA 5TT0A 1A8SA 1GYQA 1R0CA 2PKQP 2WSMA 3WQHA 1XNHA 3HBFA 2ZJ7A 3U7JA 5T4EA 4BKOA 1JB1A 3GVHA 3Q3VA 3I4CA 5IJWA 1JJVA 1X9GA 3U3DA 5JAIA 1IZ9A 1T3GA 4TROA 4UJ5A 1E2PA 4QPDA 3MMZA 3WB0A 2I3BA 1U1FA 4G37A 2VF7A 4RD1A 2H8KA 4EX7A 5EIHA 2VUIB 2CV2A 2WG1A 1NF3A 3LUBA 4X1YB 2EZ8A 2CXSA 3USES 3AVYA 1XDUA 3KSBC 4AJKA 4V0RA 5AHKA 4E6EA 1LWNA 2KJQA 2LCFA 2ZUSA 4FCTA 3NHPA 4OEHA 4E5YA 3BSFA 4MQFA 5E7QA 1VB5A 2EU8A 5FF9A 3COPA 4YT4A 1HV8A 1NSYA 2XAAA 3DZDA 5AD1A 4FFSA 2ZI6A 3MLAA 3CQ9A 1J8DA 3U4MA 2EQ5A 4ZI2A 3FDZA 2W6ZA 1GR1A 3FMIA 3QH4A 4I50F 4KBFA 4MUMA 4N7RA 4E5MA 9LDTA 4LZNA 1G7RA 4NBUA 1JH8A 1JPJA 2CL5A 3N0XA 1I32A 5EJAA 3R9IA 4BMVA 2EJBA 2AK3A 3W5SA 5IBCA 2OK8A 5JALA 2VHXA 5LWHA 3LKVA 3KUDA 2PFSA 2YWEA 4IFBA 2BKVA 2NZUG 5FWXB 1CR4A 1IQ0A 3QEBZ 1FE8A 1LI5A 4EAQA 5EZYB 3PE6A 3TKYA 2QT1A 2G8LA 1XPUA 1T9GS 1GNQA 3D6MA 1V11B 3E27A 3AETA 5TPZA 1R0XA 2GBGA 1YDGA 4Q6BA 3VDMA 2XE7A 4DLUA 1P1BA 1DC4A 3FNGA 1G2PA 1RKXA 4QOHA 2JARA 1KE2A 1U0RA 1E9EA 2WA2A 4P4GA 5EYPA 2F64A 1F9EA 3A58B 5B3KA 3FCUB 1JQBA 4C2TA 1WBBA 3I8SA 4YCDA 1N5JA 3OQVA 1CUWA 1GHTA 3PENA 1Y34E 1DKPA 4RIFA 1O03A 1EFVB 3DLAA 4FBMA 1C4XA 1PS0A 2JJYA 3L7CA 1PJTA 5BVGA 3NI2A 1UK9A 6ADHA 1EBBA 4QVKA 3O9ZA 1ESDA 5FPPA 1PKXA 4XPZA 3RRXA 5A4MS 5C53B 4C7OB 1Z22A 2CNKA 4KX5A 4CG0A 1TC1A 4GLFA 6YASA 1D0IA 3CKMA 4EUHA 3GUZA 1VJ1A 2HSDA 1TVKA 2PO5A 3G7UA 3DUFA 4MWZA 1JHXA 1ZD9A 4LSMA 3GEBA 3L7OA 4KXWA 3VUEA 1G2OA 4X93A 1XQ9A 3T0FA 1G38A 1XG5A 3EUAA 3OM9A 5JSFA 1C5KA 1C14A 3L6OO 4YJHB 2ZSAA 3X43A 3G1TA 5DI3A 3UAVA 3H2BA 1JZQA 4K6KA 3HXKA 4WKBA 4CKZA 4B84A 3C5VA 4UREA 1EQ2A 2AUNA 3GLGB 1SIWA 2X9NA 1KAEA 1UIRA 3T38A 2DT8A 2EV9A 3M6WA 2C58A 3GLFB 4ZPXA 4EQ6A 2WPNA 4H1WA 1SBYA 1JIUA 3CCFA 1PG5A 4KQJA 3W8NA 4BGIA 3D1VA 2G8NA 4XLTA 4BZQA 4IWYA 2FPIA 3KAPA 4FYPA 1JLHA 4FZ3A 4WUVA 1N8TA 1SG9A 3C8MA 3WWPA 5CLGA 4EFMA 4GWKA 5YASA 2DF8A 2ALJA 2BKEA 1I7SB 1ZCBA 3JYHA 3MS7A 4MRSA 1RXWA 1GRQA 2C5GA 5CK4A 3KQUA 3PQDA 3CB4A 4X85A 1KI3A 1QZ3A 3DE5X 3DOOA 3EDCA 3HYCA 2FMXA 3PQ3A 3INTA 5GWXA 3RUCA 5BO5A 2YYYA 5CCBA 2OGWA 3A4LA 4GMDA 3U56A 4EUFA 4B8ZA 2A0YA 4PGMA 3IPLA 2HOQA 1XNGA 2Z09A 4BNXA 4HDAA 4J9VA 1Q0HA 3A3OA 4GQAA 1FX0A 3QEMB 4PYMA 4QXQA 5DYWA 5HGXA 2Q1TA 2AN9A 3RIMA 2Q4RA 3IQIX 3KUXA 1TUBB 1QZTA 5IRCD 1R4ZA 1XD8A 4MUYA 3KQNA 1E77A 3VHQA 5CA1F 2QTBA 5SYAA 1QOZA 1R5JA 3ORFA 2E37A 5CIWA 4P0PB 3QLUA 3KT6A 4WY5A 2P9YA 4N9WA 2WZCA 3H05A 4XWGA 3BT7A 2H1RA 1PGQA 2XBLA 2BI7A 1X39A 3EA4A 5D3QA 3GMTA 5JWHA 2D1YA 1VL1A 2QL9A 3SC4A 3I3OA 1U80A 4FHGA 4RZ3A 3UMGA 2XUGA 2BP7B 1BE6A 4NU5A 1NRJB 4E12A 3AI2A 3HKBB 5KVSA 5BN4B 3N7TA 3KT8A 3OZRA 1AHNA 2VDWA 1NLZA 2IPNA 2JL1A 5ADWA 1PWZA 3DCNA 1A0OA 5C8DA 5LYJF 3GOHA 5AJWA 2BMAA 2V6MA 3B1ZA 4DCCA 4MUHA 4KAXA 3U37A 3JZIA 4DAEA 3EYWA 1OF1A 5AM1A 3OJ0A 4IIUA 5GV8A 1YO6A 3DG9A 4QFBA 1EINA 2W2NA 3F67A 2X4IA 5LOVA 1PNRA 2H3EA 2QTCA 1ZXBA 1XTQA 3IUEA 3RAPR 1QB7A 1RXVA 5CB4F 3KQKA 2JCVA 4G1FA 4MVJI 5DNUA 1H4QA 1Q19A 4CL2A 2O8CB 4ZEWA 2HCTA 2WWVD 3ITDA 1M54A 1BHQ1 4YRGA 3TUJC 4R5MA 4W9NC 4XPIA 2PNJA 3WLQA 4GOMD 4HDQB 3DHEA 5FPTA 4MULA 4EPTA 1ZUHA 1TK3A 2IL1A 1JGTA 2XVXA 4J7UA 3SFZA 2OECA 4TTRA 2K5UA 4BQNA 2WF6A 1MC1A 1VI5A 2CFCA 1EUZA 4J9UE 3W3AD 3FKSD 2VBGA 3SIRA 4JJAA 2BJHA 5L6LB 1TCCA 4GP9A 1NM5A 2DWUA 4L28A 2XD4A 4OPMA 3TSYA 3UJ9A 1V48A 4YR7A 5JXIA 1QS0A 2YZMA 4UUPA 3H1FA 1XT6A 1KMNA 2JJ1A 1EXMA 3PFFA 4E2ZA 2D06A 1F51E 4C3ZA 3TX2A 4MJXA 2ODAA 3ICOA 3NVDA 3WNBA 5CDYA 2CFOA 2F90A 3CPSA 3I83A 2ZJ4A 1Z7WA 4AKTA 5D86A 1N34B 1VCOA 4N8SA 3SSMA 2Y1WA 1TW2A 1DTWA 3GBVA 1T3HA 2J3KA 2WWWA 5JCOC 1M2FA 1YQEA 4KWCA 4D9KA 2VHZA 3PXUA 4TN5A 3W8EA 3OD1A 3PT9A 1OMOA 3EVDA 4O4HB 1P2UA 2I9KA 2Z5VA 3OY7A 2VP0A 4OHUA 4OOFA 4WAUA 5DCUA 1XNRB 4KE7A 4RHUA 4ZYYA 2W43A 3CJTA 1V9LA 4EF4A 4ZT7A 1N2EA 1NIPA 1XZBA 2NT3A 3NBKA 4YROA 1UBLS 2A1TR 2YNMA 3JW8A 5JECA 3QKUA 1YQ9A 3V4SA 2GLTA 1YIDA 4U2CA 2IE0A 2GBPA 3BHMA 4IF4A 4MDHA 3ROPA 3VZCA 4CF7A 1GZUA 3ZNOA 1FVHA 4D8VA 1K7FB 1NUPA 3MJRA 4YLEA 2CVPA 1NVAA 1GNTA 4PG6A 6PFKA 1PT6A 3FYCA 3EFBA 3D7RA 3K8ZA 5BURA 1I9GA 3A1DA 2BV3A 3NIBA 3OZVA 4AY5A 3T5PA 1PNQA 4N54A 1K4KA 2IPXA 2MMCA 1E2JA 1GDDA 5C8ZA 3R0XA 1R0BA 1UEIA 1SGWA 4EB6A 1PQPA 3KSZO 4CM3A 5J2UF 4QBHA 1QPGA 1J2YA 2BFBA 5FWDA 1K3TA 4RQBA 3FHTA 4AX4A 1DDOA 4J0FA 2OB1A 4K03A 1A9XA 1PKEA 2DRIA 2RHRA 3QLEA 1W36D 1VCNA 4KDFA 2PUDA 2V7VA 1U1DA 1U7TA 3HEAA 1EZZA 1U2ZA 3WL3A 3GZJA 1ETHA 2GZDA 4FZRA 5CVUA 5EWJB 5IMSA 3IKJA 2D6FA 4UBKA 4W8OA 1KOJA 3ZHVA 1SKYE 3GVCA 5CH3A 3QVKA 3DAYA 1U99A 1PI3A 1SJ9A 4Z4CA 5EIAA 1BA2A 3WI7A 3WR5A 1P4GA 3SOZA 4HVCA 2ERXA 2R3SA 1JA9A 4JGBA 2BFOA 2VPTA 2QN8A 3F4LA 4NQRA 5EINA 5HEKA 4IEIA 4WD3A 4DC0A 4ARZB 3TLMA 1RRPA 4RHXA 1VYTA 1H2WA 5EJEA 1VQ1A 2ORVA 4HLQB 3ASUA 4OB7A 5D8DA 3TJRA 3K31A 2J08A 1BYIA 2IZ7A 2QRHA 1IUOA 2J5BA 1WVIA 2NTJA 3TQRA 1CUYA 2EHDA 4F6RA 3TIIA 2JS7A 3NS7A 4KV9A 4YJ3B 1QX3A 3UT5B 3UV6A 4URVR 2ZTSA 4ZOLF 2BGKA 2GSDA 1MO3A 4QQFA 3W9BA 4JI4B 2UXCB 5G4LA 1JALA 4Z8XA 4BX2A 3ZE1B 2QD1A 1JDPA 1OZ0A 1OH6A 1WS6A 5JS6A 1TK9A 1YJ5A 4J49A 2ONZA 2E2WA 4DCOA 5DGDA 1PWXA 2N3ZA 2XB2A 3KTAB 4Q1EA 5H83A 3BF7A 5MN6A 2XNKA 3F47A 2I3AA 4PTYA 1PR9A 1CQJA 3HCDA 3I58A 1KDRA 2ZU6A 3B53X 3OY2A 4HB0A 3AKEA 4U7JA 3VZBA 4ZCTA 5I8WA 5J4HA 1Z8FA 3WP1B 1GAEO 2QAGB 4DW8A 4ZDKA 1RXYA 3OE5A 2IOFA 3REGA 1VMKA 3A6KA 4DLNA 4IDGA 3D5QA 1IBMB 3IBGA 1KJJA 2YFQA 4IGEA 5GPBA 2PLWA 1KZHA 3IDAA 4JXKA 4O2AA 5ALJA 1NW4A 4PYRA 1P5FA 3G2LA 1G9SA 4C2AA 4ZI3A 3MSXA 3WVNA 1SN7A 4PGHA 3SWWA 2BZ1A 3IEKA 4XVHA 2C78A 1E60A 1NSTA 1G1MA 1TU3A 3I9MA 2PYZA 4NVRA 4UE6A 3NHBA 3REQA 3OTOB 4FILA 1GDTA 1HQYE 1JVSA 1MC5A 1Q11A 1SXJD 4YH1A 4W8HA 5LMUB 5JSHA 3ZV6A 1E2KA 5EESA 2NZXA 4ZV9A 3IMEA 2MCFA 1TM7E 4KKXB 3RODA 2OESA 4UM9B 2CKMA 1LSUA 2JVJA 4DV1B 2O7NA 1JLMA 4YMGA 1K3UB 1H2XA 5AKXA 5FRDA 4Q4AB 3ZLUA 3ZKWB 3NEPX 2X5NA 3BE6A 1LTHR 1SVSA 3AR2A 4FLEA 2OD2A 1ECJA 3F8TA 3LTEA 4F7WA 1G5QA 3GI1A 3AP2A 1RMQA 3DYBA 3F73A 3G2JA 4GMHA 4LVNA 4LZZA 3S8EA 1X8LA 3ZY6A 1YS9A 1O9BA 1PQWA 3AY0A 3ORYA 2VDVE 1TI7A 4GZMA 4JEIA 4UMFA 1U81A 1N8SA 3GV0A 3G8AA 3QVOA 4QNNA 2GH1A 4PS0A 5AKYA 4BO1A 2YQ4A 3E15A 1LGYA 2N46A 1M1YB 2H4HA 3GT0A 3GCXA 4DLLA 1R37A 1R4MB 5JS2A 2G4CA 3A25A 3BRWA 5IBPA 4L07A 3V46A 1B6RA 3H17A 4P36A 3WYFA 3CNBA 4KXNA 4QJ4A 4BKMA 3RWOA 2PUAA 1KFJB 2H63A 4BV9A 5CXQA 1KZGB 4EPVA 4WJZA 1KWGA 1MAVA 2W6JD 3P71T 2BGWA 4JJZA 4V2UA 1KH1A 3S99A 5KNDA 1ZIDA 2H5IA 2YCLA 3CNEA 4Q3DA 2HDNB 3KVOA 2R6GA 4KVGA 5L3SA 4DJDC 2P6NA 1K97A 2HHAA 3JATA 3CRRA 4LXGA 4X7MA 3SVZA 4AP6A 4BS9A 3AQIA 3KOXA 2VPPA 2Y1KA 3L43A 4GSLA 5ESRA 4QC2A 1UK8A 4NE9A 2UUOA 3O94A 5I7FA 2D62A 1I7PA 3RBZA 1BXZA 4OMUA 3SSAA 3FH0A 1KMIY 4A6PA 5JOQA 1MC4A 1Y81A 4G0MA 1ZVKA 3WWZA 1NAHA 3RWBA 3FSEA 4IKPA 4INZA 4KSBA 1SPXA 3B6ZA 4J0DA 5FH9A 3HCWA 4PFSA 2AOTB 1UBSB 2XTZA 1F2TB 3EF3A 3RSOA 1EUQA 4IXNA 4ESOA 4JY7A 3LY8A 4GR4A 1G21A 2O0MA 1ONBA 1LDEA 1TTQB 2VH5R 3BMNA 3TOVA 4EI2A 2O2EA 4F5DA 6GPBA 4YQYA 3LT1A 4KQWA 4V0LA 3GXOA 1BXKA 4G89A 3NT5A 4OKSA 1G20B 3DO8A 2P78A 3L0SA 4TTPA 1OA0A 3EXFA 3MMSA 4GI1A 3ZS9A 4UQPA 3O9MA 2EZ9A 2B8NA 4IHAA 4RXMA 4EY5A 4I4CA 1BH2A 4Y67A 3WLHA 4FDAA 2G67A 2QRNA 3SYMA 4AN0A 4RS4A 4JQYA 3H8JA 1ARZA 4N7BA 5KTTA 3DC7A 3KDAA 1RWNA 2X8AA 3DE3X 1FNBA 3OPYB 2W2XA 1RI3A 4M1KA 2Q5LA 2C42A 1UBJS 4Z1MD 1JVBA 4JBWA 1QK3A 4UBIA 3CLKA 2O0HA 4KWEA 1NQAO 4NCJA 4ZDWA 1QG6A 1SU4A 1SB9A 3G8BA 4JLDA 5J59A 4JN6B 1NDQA 1L5GB 2CUZA 4DV5B 3JQ9A 4RGBA 3RE1A 3QKRA 1LDGA 2WIKA 3T3MB 2GETA 4OHRA 5EKDA 2OHHA 2IV2X 5ICCA 5KINB 1N32B 2GK6A 2DERA 4FFRA 1X13A 3DEFA 5L3ZA 3SR4A 1D6MA 3EN0A 4X64B 1S2MA 2IA5A 1KRHA 1U2QA 1IVYA 1GA6A 1QVVA 1FVOA 3GRUA 1XALA 4Z4QA 3AB8A 1BVYF 1GAQA 4NYIR 4RVDA 3V2GA 1QHYA 3A36A 3UB2A 4RNCA 4P3NA 4CT5A 4UASA 1SOVA 2Q4DA 4IIFA 3L7YA 3KSAC 1QAQA 2RHOA 4RY2A 2GAAA 3RHTA 4P3YA 3FLEA 3A70A 4JB0A 4X7BA 5PNTA 1CY4A 1FFWA 5KTOA 3BWDD 4K1XA 4IZOA 5KQGA 2E89A 3BXFA 1EGVB 4K3UA 3SJZA 5DHUA 2OV1A 2X0IA 2FX2A 2YN4A 2ZRNA 1NLMA 4CYMA 2JK1A 1H8EA 1YR8A 2OXFA 1KSJA 2CCJA 3BFKA 1VZ3A 4L4UA 3OH8A 3EIUA 3ZNPA 4PY2A 4Q3CA 2HX1A 3QFRA 3H2YA 3SFVA 4U2FA 1SBCA 2WHPA 3OM8A 1XP8A 1X7DA 1I1OA 1XEAA 2FN4A 5J5VA 2R5NA 4LCEA 1MW9X 1YJBA 1A5SB 1HDGO 2QJWA 4FFMA 4FCCA 4PPNA 2K6GA 3HXTA 4C0LA 4XWOA 1XCBA 3HKCB 4KE6A 4NECA 4GOJA 4ZAGA 3JPWA 1IEXA 3HLKA 2ZRFA 3FDJA 3UV3A 3VM6A 2C2ZA 4G1MB 1D5WA 1OLUB 4QBIA 4D26A 1ABFA 1VPLA 2F4NA 5C8YA 2CNNA 5JR3A 3KOZA 1N6LA 2EAUA 4UBOA 4JFRA 3EQ2A 3CBGA 4OQQA 1EWQA 2D3WA 1GL7A 1GGVA 4FM9A 3KEFA 4ZQFA 2ACEA 3G68A 3L8GA 2X4DA 5CT9A 5FTNA 4F3YA 3U16A 1XZGA 2BR3A 3GDWA 2IY7A 4ZQEA 4G07A 3N9IA 2DLDA 4UPDA 3K2IA 1M6VB 2FWMX 3HZHA 5F3RA 4AYWA 4F8EA 3JS5A 3ZGOA 2QQ5A 1Z0KA 2GEVA 1N7HA 2EIHA 3L6CA 3KE8A 4N3GA 5DLEA 3RYFA 5E6SB 5SY4A 4CLXA 1YCGA 2VA8A 4AJJA 1QIFA 2RGEA 5G41A 3ENQA 4E5NA 1YB5A 3CLHA 3DZHA 2CFSA 3P2IA 1OILA 1U90A 4IR7A 4L6IA 4LI3X 4M1YA 1SHZA 4OFWA 3UWOA 2CUKA 1GQSA 1R6DA 4J2HA 2AX3A 4GKVA 1LRJA 2W6NA 3BN3A 5EE5B 1TM5E 3LYAA 3Q9LA 4DLPA 3MJEA 4C29A 1E8DA 4IIGA 3L3BA 2R8BA 1PGPA 3EZLA 2O8DB 5KHAA 1TM2A 4K9SA 5NLLA 5KU7A 2ZBVA 5H9VA 3UXMA 3NETA 5CDSA 2FZEA 2R1VA 3ADPA 1C3VA 1XA3A 1ECCA 3DBVO 3ET4A 3LQRA 3ZI4A 4NCXA 2OM2A 4DABA 3ZTWA 2OB2A 1ORWA 3UC9A 2HMTA 3CX3A 3PXBA 4GLJA 4AAYA 2NUPA 4OX9Y 2WWHA 1DELA 2ZAGA 4CKYA 4KVFA 1P0FA 4AZ0A 1J8QA 3PUVA 1QYWA 3GJ8A 3MJSA 3DXFA 1QFJA 2OFWA 1OBHA 5CBPB 1X6VA 1E61A 4R6WA 1H2RS 5BVHA 4D9EA 1ZEJA 3G8YA 3DWGA 3OG9A 2JGRA 5HE9A 2ZJFA 4DUGA 4AY2A 4HDMA 1ML4A 1N0WA 3CG4A 1UT5A 4X45A 3BAFA 3OT4A 1W8DA 1CNMA 3E0XA 3Q10A 2FV8A 3CG0A 4KYIB 1HEYA 3ZJ5A 3WGJA 1NNEA 5KKCA 2HH9A 3KVVA 1JHMA 3N2IA 5LP1A 1CRZA 3M5WA 4LYYA 5FULA 4DJAA 1YJQA 3QJGA 1UZLA 2D1FA 4RZIA 4URWR 3PUWA 4M46A 1MNQA 4XM0A 4GQIA 3ZE9A 3E2IA 2JGIA 4OQLA 2Q2QA 3R0JA 1DBSA 1U1GA 2WAMA 5IJ9B 3GLSA 3KQHA 5JQGB 2GM9A 2AMJA 4DC9A 1IL0A 1CUXA 2MSEB 3IS3A 4FU0A 3ZY4A 4MDEA 3JZAA 2Z3VA 3VR4H 2CZQA 1CKEA 1MPTA 2LWIA 3PP8A 4XSGA 1YRYE 1OHHD 2HGSA 4HUQA 3TE7A 2PL9A 2ASEA 2FXIA 3C48A 5IBQA 1CYEA 3TLCA 5CEJA 1JEAA 4B0PA 1T9BA 2PBLA 2YWRA 1WPQA 2AH5A 1Y7PA 2XLCA 1YJXA 2AXNA 2ZB2A 3LPCA 1IEWA 3OJOA 1I5EA 1D8AA 1GL3A 1W5SA 2X41A 2DUMA 2OUKA 4ENUA 4ASUA 2YFYA 1VL8A 1SK9A 1EX7A 2ZSFA 4L9RA 4BXOB 1S8OA 1UCFA 1LJUA 4FMDB 4PCVA 3V4LA 4XX0A 4UU8A 4B87A 5FI0B 1Y6QA 3PFHA 4PIPA 3EK2A 5A04A 4R1NA 3M34A 3SBOA 5CG2A 2FPXA 5DM2A 3G2PA 3GJ3A 1XMVA 2JGDA 4LXIA 5FOVA 4DCGA 3R41A 1G5IA 2DFVA 3AI3A 1Y89A 3FCXA 4IIEA 2OKGA 3UB3A 3MILA 3NTVA 1LPNA 4I19A 1YWGO 1MFZA 1SZJG 3NNDA 4LYJA 5DSXA 1J8VA 1EHYA 5IVDA 3E03A 1RJEA 1UPFA 4J0GA 4N7MA 5DN9A 1ORDA 1UWKA 1PWHA 3UWKA 3FPBA 1T2DA 4M0LA 4AF8A 1W7AA 3PRHA 3I9KA 4LHZA 3NDIA 4HDNA 3D4OA 1BMDA 2G07A 1ZPDA 2XA2A 1XEXB 3HVKA 3O0TA 4LEIA 3U3OA 4EHNA 1RI2A 2YFHA 5HBRA 4L4RA 1PS8A 1C0KA 1NI4A 2B4KA 3JRXA 3W77A 2BFWA 3QA9A 1T9HA 2SBTA 3D4PA 1GU7A 4AB1A 1DXQA 3LBYA 2QGFA 3TL2A 2IJGX 2E49A 2GA9A 2QK4A 2V8BA 3ROTA 3CLSD 4DPMA 1UBOS 2GD6A 4M1OA 5IJAA 4F4CA 1NMSA 3WJ1A 4LF5B 2FUCA 1S0UA 2X0KA 4X63A 1A72A 1JXQA 1P4AA 2PUHA 2X6RA 2EYUA 4NF2A 5THXA 1H1TA 3HACA 3V3KA 2ZZMA 3A1TA 2B0JA 2ZJ0A 1N75A 2E4XA 3B9PA 5KAPA 1PR4A 4RF5A 3WLNA 4CGZA 3ADDA 2I7CA 4FW8A 3PPXA 3F6RA 3TGLA 3V32A 1A9RA 4BFSA 3F1LA 3R76A 2NO7A 4TM8A 3GWZA 5KWSA 4MA5A 1SCUA 4URZR 2HRZA 2RONA 4G9GA 1ZR2A 1FS4A 1W0JA 5AXDA 3RFTA 2J9FA 2NZJA 1FOEB 3NOVA 1R9MA 2IF2A 2NZ8A 3B85A 3FMOB 2J3LA 1NUSA 1JQAA 2VUHB 4MLDA 3TW6A 5HVNA 3TL3A 1BN7A 2VR1A 1DRUA 1I8TA 4M2LA 2WMDA 5P21A 3RJ9A 3AIKA 3P0JA 5TPWA 1V45E 4GF5A 2FHSA 4MYUA 3FSGA 9ATCA 1RQXA 3WGUA 1GPJA 1AU9A 3B1WA 1VMAA 3NKLA 3LJKA 5SICE 3NP9A 2P90A 2O3RA 1DTSA 1NZDA 4OKIA 3TINA 3V4FA 5HFNA 1P44A 3JVUA 4NBLA 2FPMA 5EG5A 5ALGA 3GYGA 1AGPA 2OTCA 4OHOA 3NV7A 4N8DA 2JFXA 5DH9A 5K99A 4AYXA 3OWOA 4F1JA 1KPHA 3T3OA 1E3LA 2BUAA 4C3OB 5KPJA 2D0PB 2YICA 2OGSA 2Y8EA 4D4LA 2VBIA 1KYXA 1F8XA 1SVNA 2KYRA 3P9SA 4O08A 4RH1A 4ZO8A 1T2AA 3ZWXA 3SBDA 3WLAA 5JCZA 3GRKA 1U0OC 2B94A 2H16A 3DF9A 1L4YA 2W2KB 1Y6ZA 2C8VA 3EBPA 4UXJA 1DIBA 1YR7A 2UUPA 3VI3B 2OCPA 4CWAA 4HNTA 3RT9A 4EW1A 3ITKA 3K9HA 4CM9A 2AX4A 4FYXA 4CFYA 1M1XB 2QPLA 1IWPB 3K32A 3O4VA 3CLUC 5AK4A 1IRXA 4ENPA 5E4JA 5JO9A 1JU9A 2H5JA 4N8EA 4TM7A 2X0JA 3ESBA 1DX6A 2YBEA 3HVJA 4KPUA 4O4LB 1RMTA 1JJBA 1P3DA 4TLMB 3UAXA 3O4GA 3U2QA 3ROZA 1GKUB 2ANBA 3E5MA 4BFCA 2HMVA 1S02A 1VIAA 2R8OA 4CUKA 1YQWA 2Q5FA 2UYYA 1FTYA 4C22A 2J9YB 1DUSA 2A7XA 2OP1A 2WF7A 2D2FA 1VE7A 3KTFA 4QYIB 4FYJA 1Z4JA 1L1FA 5C51B 2HZ7A 3GIDA 1KQFA 3AM1A 1E9CA 1WCXA 5FOTA 1JHQA 4QICA 3QLTA 3ULKA 3SMVA 2I67A 3VUFA 4BDTA 1G18A 3WLKX 5LA6B 2XGMA 3ZZ1A 4DG5A 4P0QB 2ZS8A 2Y27A 3JSXA 2WUFA 4DZRA 3R9XA 3BJIC 3LU1A 4OSEA 2YUTA 4MWDA 2H2GA 1XZHA 4LXHA 1QLJA 1ZSVA 1JZTA 2I66A 2VSOA 1WP9A 3OQHA 4I46A 3G0DA 5DW0A 3ZWVA 1DAKA 2EFGA 3R9WA 5GOZA 2PUTA 2E4YA 3KLMX 2NVUB 2YX1A 2VZEA 1D6SA 2R48A 4ND3A 1E63A 3UJ6A 2UUBB 2YINC 3NVAA 3DAGA 1B7GO 3A1WA 2BHSA 4A6EA 4A2PA 2C07A 2H52A 4B85A 4OJQA 4EENA 2PJZA 4KZPA 4LDNA 3ERCA 1MCZA 1H5UA 4CKWA 3Q8XB 5EHQA 3CU5A 2NN3C 1WZ2A 4XQ9A 5IARA 4RWEA 5AKJA 1U9ZA 4QXOA 1NV9A 1ONPA 4Y2PA 3VH2A 3W5BA 2NQ8A 5D3MB 3A9CA 4JT4A 2C3PA 3TNFA 3WYEA 4IF6A 2GPAA 5FR2A 4PFJA 4ZXPA 3H83A 3T06B 2Y1DA 1FJ2A 1WV0A 3I01M 5FA5A 4BBPA 3PIRA 4PCAA 1DXHA 2HI0A 5JNTA 3ZNNA 4YJ2F 5F9MA 1M7BA 4G1EB 2GK7A 2PH5A 2WJWA 3ZXUB 3AUFA 4HRXA 1HT1E 1Q2XA 2ATCA 3LP6A 4KUHA 3UUFA 1KTVA 2O2ZA 1JG1A 1JEQB 1BVRA 3M5CA 1WXFA 2HJHA 4IPTA 4P2GA 1MR3F 5A9SB 2O3TA 5AVKA 1QSGA 2XQJA 3THXB 4KN9S 4J03A 4GC5A 4JXJA 4LG1A 2ES4A 1GFZA 3O38A 3NTUA 1SBIA 2R2AA 4RCZA 4AJIA 1UAAA 3C87A 2HLDA 1XHEA 4CEHB 5JD6A 1UH5A 1AKUA 2GJSA 4KTVE 4AMZA 1QIKA 2Q3FA 2R6ZA 4EVSA 1Z5WA 5EQJB 5KNCD 2VZ9A 1Y6GA 3DFKA 2CLCX 2GX6A 3PIIA 2Q5JA 2ZE7A 4LBVA 1HNWB 2DG2A 3RYCB 4RF2A 4DNXA 4DGSA 3B7PA 1Y1TA 4LRXA 1C2YA 1FMTA 2CMHA 4K9RA 3MGCA 3C3WA 4BN4A 4JJIA 4X91A 1UINA 3I2GA 3VHRA 2H07A 4ZI7A 4NESA 1JWLA 2ID7A 1FMLA 1BOFA 3CVWA 3AYZB 5G0WA 2V7WA 3FSRA 2O20A 2QKYA 4NOKA 1FPMA 3KHSA 4FSDA 4QJ5A 4RVNA 1R4AA 2D1TA 2JHFA 3BXZA 3VKWA 1IPHA 1KGDA 1L6IA 2PGNA 3I09A 4QTUB 1TMGE 4MVJH 4UD2A 4F9FA 2F3PA 4BEJA 1OB5A 4CMEC 1M33A 1IBRA 1GO2A 4MICA 5K6AC 2B99A 4ERXA 1JKIA 3TW4A 1J0EA 2FQXA 5HQ3B 3TSZA 2WWGA 1HMYA 2VAPA 2VRBA 3P26A 4C0SA 1P61B 2B25A 5JFTA 5JNVA 4RJ2A 1I10A 2HBRA 1L7QA 3ETCA 2O4UX 4MCAA 4LQ4A 1H2ZA 4M0FA 4Z9FA 4JBGA 4N47A 5JPDA 5K03A 4IIHA 3U3RA 1WXIA 5B3JC 2VTBB 1B1CA 3K2EA 3L8YA 4XOUA 2WY2D 1B2RA 1HL3A 4JLBA 1PNTA 1ATIA 1PR0A 1RWKA 3VV2A 2ZSEA 1I4TD 1QKIA 3IEIA 2DFNA 4BMNA 1MW8X 4ZYWA 3N39C 3LUDA 1MDBA 3HDYA 4RKRA 3ZV3A 2I34A 1MOPA 1UF9A 1CRLA 4JUIA 1GGHA 4UKDA 1P60A 2C2HA 4C7XA 1F9AA 4ARCA 4BQOA 2Q1WA 2KX7A 3WGMA 1X87A 1MIOB 3J7TA 1L5KA 3MWKA 1MB0A 5EKUA 5A9RA 2XMZA 2ZI7A 3ASZA 4DM7A 2JKVA 1O6GA 4IWXA 3T61A 4H60A 4TYQA 5DTIA 4MDYA 2C1ZA 2J9XB 2LDBA 2QR3A 3DQQA 4LNUB 3ILHA 2P9TA 4DBVO 5LP6A 2Z8YA 2DVMA 1QZXA 2C4VA 5CT4A 1WEKA 4PLCA 2JLBA 4NK4A 1T2EA 1W5BA 4BN5A 3F98A 1LA2A 3D9QX 4KX3A 3K0FA 1ZEMA 3TBFA 1G17A 4KHZA 2NZVG 4LOHA 4WBNA 3A2NA 1I33A 2CNOA 2VQ3A 3CCCA 1P6UA 3QOFA 3KSRA 5GADl 4W5TA 3VKGA 1AO3A 2R1TB 4E3WA 3PQ5A 1JRLA 2IP4A 3TNDA 3ED5A 4DR3B 4QHSA 4CN9A 3DAPA 1ONOA 2Q9UA 4QJIA 2XXAB 5LWQA 5IVPA 2UVPB 3CWZA 4FKBA 5KOHB 2BKXA 2EX0A 4HEHA 2DR2A 2XMRA 2BUCA 3E3MA 3W7BA 3STXA 1N6KA 2E4VA 2W70A 5JFOA 5C5IA 3SS7X 3UM9A 2GI4A 4JSRA 1JQ5A 4X1YA 4HT3B 2GARA 2PZMA 3HJRA 4W4TA 4K86A 2BE7A 3HKEB 4YQZA 1LV8A 1Q7GA 3IYLW 3CVYA 1N3YA 2YN0A 2X5JO 2IYPA 1VJGA 3E23A 3VR2D 5IZCC 2DCMA 4X5OA 1XLUA 5HTOA 1H3FA 1OR8A 5DMHA 4HMQA 2WNSA 3HDQA 2WYWA 1ODSA 2HV8A 4R8RA 5KC9A 4HDRB 3A1FA 2QTTA 3S1SA 3LQFA 1FDOA 3U62A 2JLUA 2AR9A 1PR2A 2WJHA 3IP7A 3LFHA 3ONFA 3AO0B 1AK9A 3ZLVA 5JQWA 1I2MA 2CHUA 2ZS7A 4CMAA 1A8HA 1S89A 1J70A 1G2QA 3OZWA 4JA0A 4QM7A 3R6WA 5IKOA 1C9DB 4FNGA 2FZCA 4E3ZA 4BJHB 4ZO7A 3A1VA 3SKYA 2ARKA 4NCBA 4YECA 5CVDA 4RK6A 1OFGA 3ANMA 3F4KA 5FWXA 2AF3C 1PK7A 3VPXA 4AF6A 1Z7BA 4IHJB 5EMHA 5EZYA 5HTKA 3EEQA 2FW9A 2ZRAA 1DWPA 2LP4Y 2NACA 3KJQA 4FLMA 1GTVA 4MLZA 4Y6RA 3OOEA 3T3IA 1O4WA 1V11A 3ENVA 5ED0A 5IFLA 3SQWA 5F9HA 2PH1A 1GSHA 1YMQA 4RDCA 5CVCA 3I1IA 3K9QO 2ZQYA 3Q8LA 5GM1A 2ZRLA 3BK7A 1AUXA 3CVJA 5IYZF 3ZWAA 1Z47A 4BRWA 2PFKA 2VPIA 4EKGA 3AGPA 4MJ7A 3ZDYB 2YXNA 3E5HA 2ZETA 3SC6A 2ZSBA 4YRIA 1JWAB 4HQOA 1XF9A 2NZYA 1KK0A 4IKEA 4WNYA 5K3SA 3P4XA 5KJ6A 2Y1XA 4UBLA 1YFLA 3R7WB 3RS2A 4POOA 1GRNA 2GVZC 1EFVA 2IU6A 2JCGA 1OY1A 3FVTA 3KL2A 3PNKA 1TM3E 3PLRA 1VYHA 4YRJA 3T5MA 4RE6A 2GLUA 3PUXA 1UR5A 2BCJQ 3LCCA 3ZOKA 4DLBA 4ZCIA 4C7OA 4RY8A 1G8HA 1B41A 4UFPA 2DT5A 2XOEA 3L41A 2VSYA 4MPPA 4NOJA 1NBWB 3VGPA 5EJ5A 5BRNA 1MOZA 1N2IA 4NV0A 2ZW9A 1R5OA 2VSQA 3AX6A 1BWQA 1TZKA 4TS1A 1ADGA 1NONA 4PONA 3SU8A 4AECA 5I3ZA 2NAPA 3D43A 1WUTA 1U8YA 4NCNA 3UFBA 3QVMA 2VYNA 4YTEA 3OLZA 3KVRA 3NEYA 3PQEA 4YJHA 4GKBA 3LC1O 1E1MA 3L06A 3L1HA 3CVXA 3EY4A 3GRZA 5HKKD 3GK3A 1BMTA 1LLDA 1U9JA 5E2BA 1N2JA 2WJ6A 5HA5A 4JCCA 3CR8A 3B9BA 3G5LA 3OJLA 5DW3A 3PWKA 3BPSA 3BA6A 3GUUA 2OMEA 4FHDA 2F2TA 4KTTE 4OHFA 3T9EA 1L8QA 2G83A 2XHEA 4H0CA 2C95A 4D74A 4DJJA 3GLFA 4X97A 1HDYA 1NTOA 3N8IA 3DYIA 4ILEA 1OXUA 3NVMB 4OB6A 4R9NA 1ULUA 2JLYA 1F2VA 1I2DA 3G7NA 2Y92A 4BEWA 2GD1O 3CLTD 3CR7A 4IFEA 4GD3Q 2RHCA 3Q9NA 2BKAA 2ECQA 1L5WA 4X8HA 5JE8A 1L7OA 2PQ2A 4PRYA 4E5UA 4RZQA 1OYWA 1A4UA 1LJLA 3UO8B 4A92A 1F0YA 3UYKA 1DEOA 2MYTA 1IIRA 2IUSA 1Z74A 2E1RA 1X1SA 3HDVA 2RE8A 4PLFA 2C5EA 4UTXA 3DLBA 1GUZA 2XDYA 3AHIA 3HP4A 4RFVA 3OPVA 4QYTA 2EFYA 4UXIA 3TNYA 3QNMA 2CLEB 5B58T 4G5QA 3UMMA 5A9TA 3C70A 5I5GA 4A2QA 2ZDQA 1TZMA 2V1UA 3QEMA 5HPYB 3K71B 4JUBA 1TUBA 1U2SA 2HA5A 2Q6LA 4RV4A 4F3RA 2YHIB 2ZBFA 2YBDA 2R1UA 4J91A 3T9BA 1XD2B 4RELA 2PT6A 1A8IA 3C41J 2V6JA 1NBMA 5EUMA 4XWAA 2UVQA 4EPRA 4K8OA 1BHO1 4HAUA 2Q9BA 2LUOA 2HJ9A 4JDPA 3PNVA 3A1CA 5IEBA 4DEVA 1SR8A 4MA4A 2H5LA 1PYOA 1W0CA 4K6FA 4LF6B 3X1ZA 2BP7A 4AIIA 2BJVA 2YQZA 3OFND 3HKBA 4JA2A 4PCUA 4R2HA 3RRNA 5BN4A 5DYYA 3W8DA 2ZJ6A 3KQLA 4OMFG 3F8WA 1XV5A 3GC6A 1YR6A 5TQVA 4BO4A 1J7KA 1EG7A 5FBWB 3UVEA 5CPFA 1XWWA 2XYGA 1Z3CA 1GNRA 1GKIA 2MYUA 1M1NB 1Z2EA 2B61A 3RRFA 3VV3A 2QNBA 1QTNA 2B21A 3L7MA 4HFRA 5DTQA 3UMVA 5LQRA 2VDNB 3KZKA 1UEJA 1TXGA 1QIHA 3IILA 3IXQA 1UDRA 3UGKA 3WFIA 2C29D 4OJYA 4JL5A 3OWHA 2O8CA 1EWYA 4KXVA 5B6PA 5A4DA 1JAYA 1JN0A 2XTNA 5FWNA 2QG9A 3LF2A 1G63A 1G64A 3F97A 1MJ5A 4FGLA 1YBVA 2C9BA 3ZQ4A 5I7SA 4S24A 1XMIA 3FFAA 3WRWA 1SHJA 2O54A 5EHIA 3UT6A 1T1IA 3R6LA 2XMDA 3ITEA 2ZRGA 5HS6A 1QCYA 2IEDA 2C7VA 3FA2A 3S8YA 3T8YA 2WV7A 2ZRDA 3I9V1 2RSLA 5LN1A 3NWOA 5EN4A 3Q5DA 1TEVA 1DDGA 1PZEA 1OFUX 2G1KA 1S3SA 4KJZA 4E33A 4RFLA 4BNHA 3ZY3A 1VFNA 2QJTA 1Y3DE 5H8WA 4D0LB 4CMBA 4N48A 10MHA 2QENA 4TTSA 2FGJA 2QL5A 5HKBA 1G8GA 2ZRIA 1ODLA 5BR7A 1XTJA 1RFLA 2Z3ZA 2NUAB 1FUEA 1LW7A 2YR0A 3BTVA 2C7QA 3GJTA 4JOSA 4Q1AA 3VKHA 4E13A 2WPDA 2H7YA 1QQ5A 1YS1X 3H5AA 3RRZA 1O8CA 3VDXA 1VBMA 1DIOB 3R4CA 4OJKA 1U7PA 2CL6X 2P3OA 1YZQA 4ZI5A 2RHJA 5COAA 4O4HA 5CFMA 2FEWB 3RF7A 4RH0A 4BFWA 2HJSA 2COKA 2H7XA 2JH9A 5J2TB 5AW4A 1NQTA 4LQLA 4GI3A 4MHTA 3W6OA 5JPIA 2FPOA 3ADKA 4G0QA 1U8TA 5FQOA 4C3UA 2ETVA 3OJWA 5AJHA 4UTRA 4RVGA 5LLTA 3BXGA 4BFZA 1O7JA 3IV9A 4UZEA 1UL1X 3MYRA 3X1MA 4M76B 5KUTA 4LF8B 3R74A 1KKMA 4YP9A 4AO7A 2CXUA 4C0KA 1RRMA 1L7PA 1Z29A 1H8ED 2VF8A 4NAUA 5HF8A 3U13A 2IGBA 5BSHA 5KX5F 1U2TA 4TQUS 3HY3A 4H7IA 2JD2A 5K0NA 5L7WA 3ETJA 5CT8A 2ACKA 2VG8A 4MW7A 5IU6A 5IK2A 4IGIA 3RTDA 3WKBA 4DIBA 1FU8A 5TV2A 3HJHA 1ZH2A 3IV7A 4DEXA 3VNUA 2VHYA 4BV3A 5IEJA 2J30A 2X13A 1II8B 1RXIA 3PYMA 4RNDB 3I1JA 2X8JB 4G01B 2IS6A 5HYVA 2YDYA 4YO8A 5BQ3A 1ANKA 4KSCA 3C4QA 3D4NA 4PAOA 3PGJA 3KXIA 1YA4A 2H7VA 5K8CA 1F12A 1WNFA 2E82A 3SQDA 3P5BA 4CHTA 3PS9A 5B6IA 4MS4B 2ZCVA 3LLMA 2ZYWX 3CVUA 3KUKA 1V4NA 1WABA 3QWFA 4CQNA 5EXEA 5EWJA 5I7EA 4LWOA 3H4MA 1PV1A 4GP6A 5K0BA 4XTCS 1CY2A 1CZNA 3O75A 3HMKA 1XEWX 5F7JA 3KKZA 5AFSA 5ENZA 2VBFA 4E1VA 4BO6A 4FFDA 4RE5A 4J0KA 1RZUA 4ZRDA 4ARZA 1LPOA 2SHKA 4EX6A 3DZCA 1XCGB 1Z68A 5FD8A 5LMNB 3G9UA 5HF6A 1UBCA 2WJJA 3A06A 3GRPA 3ORSA 1UBFA 2ADMA 4CV1A 1W85B 2HYIC 2YHSA 1WOYA 3F3YA 4LMPA 1ZH8A 2YQ5A 3DPUA 4Y2UA 3KJIA 3K1JA 5JBQA 2YJ5A 4Z7NB 3WIBA 1ZM9A 3QMMA 4ZAXA 4YJ3A 3UT5A 2A5LA 3G2HA 2VJYA 5BV8A 4TZ0A 2A9JA 4PX2A 3O31A 4ER3A 4IO0A 1JQEA 5M04A 5EOVA 2A5DA 2QN9A 4B46A 1QF6A 3LS2A 4BASA 2P0YA 3R3HA 3M5PA 4IDAA 3L8FA 1BCSB 1Z6ZA 3PWZA 3EVBA 1OWMA 1NF2A 3HN6A 4TQAA 3KTAA 2AR0A 2H2HA 2HJWA 2C00A 5L6MB 1GSIA 1UT6A 1QB8A 4FUTA 8ATCA 1ZD4A 5B4TA 4DS3A 4DUGD 2V5AA 2QTZA 1ZVQA 3K9WA 3KKOA 1VG9B 4PU0A 1P1IA 2VS1A 4QT0A 4TTAA 1XVAA 4BLQA 2GCEA 1HDOA 3QX9A 5EHGA 3RVLA 1JMYA 2QX6A 2Y1EA 2C5SA 4RKEA 2P6UA 1JDBB 3PJEA 4XDGA 1ZR4A 1QO0D 4U63A 3RSCA 1FFEA 1E1RA 2GBIA 4V02A 3PUIA 3DZIA 1ITZA 2C8LA 3M9WA 1P6QA 3I1YA 4PHFA 3U9LA 3IE1A 2EFEB 2V98A 3G8DA 3GGOA 3KU4A 3OI7A 3PEUA 5BQ5A 1E1CB 1K8ZB 1DBRA 1UXJA 1XRRA 3D0OA 1TOAA 5ALEA 2B92A 1DMRA 4KR2A 4XXHA 1T13A 1K8QA 2M1XA 3LDAA 2YJ3A 3MG9A 1GSAA 5DCLA 4Z0TA 3ZX4A 3OPXA 1MEJA 4Y98A 3LPMA 3F5DA 3IAFA 5IM4F 2G7MC 1E32A 2Q5HA 1CF9A 2QAIA 2FFRA 1PIWA 3CRW1 3HNPA 3I37X 2BBSA 3ONDA 4AS1A 3PZBA 1ADCA 1VFPA 1IXRC 2I7XA 3ZQKA 4X24A 3WKEA 4COOA 4ID9A 4LRWA 4GRIA 4LZOA 3DHWC 5KVCA 3GD5A 3ZKWA 3FDIA 4IOLA 3E82A 2GTIA 4RD2A 3G0IA 4MGKR 4CEJA 3KFXA 4WK6A 3H11B 3GN2A 1VPWA 4QARA 1LDNA 1Y4UA 3KKEA 4Q3LA 1TZ2A 1UFKA 2J6HA 2ACVA 3E1GA 4DDKA 4YBZA 1LBEA 4G23A 1O5TA 2HRQA 1PSDA 4R16A 4FR5A 3RSSA 4ACBA 2F3SA 2ZR9A 4P6VF 2QIPA 3O1HB 1M1YA 3IQWA 5DGHA 3TTXA 1LU9A 5KYVA 1OXVA 3WJ2A 5I4KA 4H7HA 4DVGA 5JASA 4I36A 3I9V6 5AT1A 3HHPA 1W35A 3JTMA 5IZ4A 3MXTA 3IJEB 3UWSA 2V7QA 2QW8A 3IIKA 4K9DA 1T3SA 3AK4A 3TRIA 2AVNA 3ZE0B 4YCNA 1NE7A 4BQPA 4QDZA 3NXKA 16PKA 4QUJA 4TN1A 2AK2A 3U0VA 1FFHA 3A6DA 4B80A 1KFKB 1IXKA 3O3OB 4FEGA 4LX0A 4BTVA 1WHTA 4GRDA 4B34A 1B15A 2EW2A 3TXXA 2C9DA 5KYNA 3SZ3A 3LA8A 3G9XA 4GP7A 1JDNA 3NT2A 3B20A 2I65A 3A6EA 3RRYA 2WLSA 4RVOA 3E1KA 2QG4A 5KB3A 1RRCA 4TSKA 2VP9A 1UC4B 2XA1A 3ICQB 5K6AA 1Y8QB 4ZC8A 3RSGA 1B23P 1J9GA 4IQ0A 2C82A 1A95A 1I01A 3RK0A 3DLHA 3K5PA 4LBWA 4F86A 1IXZA 1SWWA 5LQNA 3TVDA 1W0JD 2YV4A 3H9BA 1GNSA 2OCAA 5B3JA 1EA7A 3EVAA 3TOXA 4D1YA 2J3HA 1E62A 4ER5A 1IM8A 5AVTA 1WUKS 2ISQA 2NPOA 2AOTA 1F2TA 1SZPA 1KVQA 3PQCA 5EJ8A 3AHHA 2QRZA 3EVEA 2P2ZA 1QKJA 2XUKA 3H2SA 1M8PA 1VSBA 2H48A 1TQHA 1WSWA 3DLIA 4IIJA 4K9QA 4KQKA 2E7ZA 3R3VA 5HJEA 4D8UA 5LXTF 4HD8A 1T9AA 4PCLA 3NOOA 4L8WB 1IY9A 2IVFA 2AEFA 3N2EA 1BFDA 3HRHA 8LDHA 1M8FA 4YUZA 1KU6A 3INYA 3JPYA 2R87A 1SUPA 1SVWA 4G5OA 3I2YX 4J0IA 5D01A 7ADHA 3K70B 3OESA 2H2IA 2D54A 4P3XA 3ESYA 1PWEA 1AN9A 2HNKA 3AOEA 3OPYA 1V7ZA 3PHBE 1XQXA 3WHIA 4F4UA 1U0EA 3HBNA 1CDOA 1GG9A 4WWHA 5E3JA 3ZGVA 2I99A 1BW9B 3P4YA 4XB6B 3SX0A 3IUNA 4CR6A 2A9KA 5AW2A 3LUPA 4TWAA 4G3XA 2OXCA 3V4PB 3NAMA 4HTFB 3RSLA 4WCVA 3F8SA 1BKDR 1N3BA 3FOBA 3N28A 3PF8A 4RPGA 5H81A 5DM60 4F5YA 1VMDA 1Q12A 3P9RA 4KYUA 3BRCA 4MIKA 1GUDA 3OFVA 4K88A 4LDPA 2J9RA 1TECE 5JC8A 5FBKA 1SU6A 4EVRA 4C6HA 4QU8A 1CV2A 4LVOA 4LGVA 4DMLA 1E4OA 2DC1A 1C30B 1JUDA 1HC7A 1X15A 1RM0A 1I4LD 2PT7A 2GJ4A 2V7EA 1XTZA 2H9IA 2ZT6A 1RVDA 4EEXA 1KNQA 2X1LA 2QBYA 3LHFA 2PL3A 3NFRA 3LK6A 3OFKA 1Z2CA 2DETA 4HY3A 1RWMA 3F3SA 3I52A 1R4NB 3QBJA 5B3AA 3U9TA 5E95A 3ZH9B 1RSZA 1RI4A 2FOLA 3JQBC 4EI8A 3NTRA 4ZC1A 1DQZA 3FI9A 1U8EA 4ALLA 2ZJAA 4HYEA 1JYFA 3ZVLA 4CLRA 1B6GA 3WL4A 4DTIA 2RH5A 3EZ6A 3L9XA 1U7HA 4MJ3A 4R9SA 4BO3A 3T4UA 3HK2A 5FYQA 3ZQJA 2TRSB 3HKCA 1VKNA 2Y1FA 1UJ2A 2OSVA 5IZCA 5EUCA 3ZK8A 2ORIA 2JI7A 4E2XA 5T8KC 2OXIA 2Y6VA 1S2OA 4M9ZA 1OLUA 1SKMA 5C2JB 2C54A 4CL3A 3BC1A 1EFCA 4NOMA 4CIAA 4N01A 3GEHA 3WSWA 3PTLA 2HU7A 5I8ZA 4MLPA 1Z56C 3EZFA 4ZQIA 1BRMA 1GNPA 1Z4IA 2WLTA 1L5QA 1VSQA 3DDSA 4FFWA 1OLSB 3CO0S 1M6VA 4LZJA 2CSUA 4XLZA 3T12A 2MINB 3TFQA 2ZSHA 2ZVQX 2BGMA 2VF2A 1YH3A 3L4KA 1R9NA 5KVQA 2I4RA 3WYCA 3WQQA 1JR3E 1SC1A 4GYYA 2X9GA 4ZCSA 5JMWA 1DWQA 4E2FA 4MUIA 4CETA 2ZYSA 2HKIA 3UKJA 1LLCA 4RADA 3ZYZA 4XASA 2QUKA 4O2LA 3TLGB 1AHHA 1FDUA 4B32A 3EZ2A 4MV8A 1H6AA 4ZQCB 3DFIA 2EP8A 1LBSA 5JDCA 2EX1A 1I2AA 2O8DA 4B4UA 1C81A 4MWGA 2Q8QA 3HM2A 2CL7X 3PGXA 2A57A 4OP2A 5D3ZA 2HLDD 1D1TA 1SD5A 2V6GA 1DKMA 1IC6A 2XF2A 3Q7EA 4J1QA 2HADA 4Q0MA 3JQAB 2QV0A 2RDMA 3UUEA 2XUHA 2BFPA 3GGCA 2FN8A 4RABA 4R7TA 4FYVA 1VHTA 1QANA 1EMDA 4QBFA 4NYJR 2QMZA 1J1IA 2BCGY 2ZYIA 1PQ4A 2CCKA 2IY8A 2OILA 3OCXA 5IWAB 1D09A 3K5IA 1GQRA 3L4BC 1L4KA 2Q62A 4Y9UA 2WOOA 4UVDA 4R51A 2GVDC 3QKIA 2PU7A 1V3TA 5CBPA 1GGMA 4DXDA 1NVVR 1R8JA 2V96A 3DPSA 1LC0A 1Q3TA 5KS2A 1EAMA 3ZIUA 3CE6A 3QPAA 2FZLA 4LV6A 2ZB7A 4MITA 4MV6A 3EDOA 4CNBA 3SNHA 3AG6A 3QU9A 2DKFA 5FOUA 4Q03A 4HCJA 3T1QA 1LSSA 4HVAA 2YDXA 4HAIA 1NXWA 3A1NA 1XCMA 2QEQA 4HQRA 1C7FA 2YY7A 1L7NA 4QQKA 2GAIA 4TL7A 4XW2A 3RANA 3B5IA 1Y3FE 3HNOA 5B7PA 4WBNF 4EYOA 2AXPA 3PUJA 3OU7A 3DZJA 1XTBA 1QIEA 4M1TA 2J6BA 5A7GA 5TSDA 2GEKA 3SYRA 3RK1A 1XKQA 2AGVA 2BONA 4NAHA 4MVXA 4MQ5A 1J2EA 4YXFA 2VT3A 5IJ9A 1GGFA 2JPDA 5JQGA 5JXWA 1J49A 4DGQA 3EDRA 3IHWA 5G3ZA 1FJGB 1N3IA 3U17A 4Z4FA 4LJ9A 5HJ7A 2VHTA 2UZ3A 3QITA 1NXSA 4PQGA 1C1HA 3CH6A 3VA7A 3TD6A 4F6LA 4KQIA 5HFJA 1DUVG 3ZCVA 1AKMA 2EFHB 5FADA 1E9RA 5LKRA 3D6JA 2CJYA 3ESRA 5EE9A 4FB5A 5K3OA 4P0TA 2IQIA 1RYBA 3IA7A 3EBOA 4R9VA 4Y2SA 4BXOA 2GB4A 4FKMA 5T4FA 3SE7A 1I51A 1ZA1A 3D59A 3GA5A 5T5QA 1R64A 2PAAA 3I9JA 2EWWA 3KJHA 1B0UA 3KOOA 3L7KA 4UBNA 1GZ5A 1J20A 3OKFA 5FTKA 1PSWA 1ESMA 2BGNA 3FY4A 3AR3A 3DP9A 4IZ6A 3ZDBA 1QGYA 4IG4A 4F93B 1B3RA 1P18A 3AF2A 3AIOA 2J3DA 3OMWA 3VYUB 3NC0C 2JZNA 3VR5A 5CFNA 5AWFC 1USUA 5JCJA 4G0OA 3WAGA 4ROSA 4MR8B 1YAJA 3PI7A 3ENKA 3EQ8A 1JDSA 2NXWA 4MUBA 3P9NA 2OHJA 2UZ1B 2Z9BA 4LDRA 4O4JF 4TMKA 2G72A 3Q7QA 3VVLA 3GQBB 1T1SA 4N6GA 5C5DA 2E5FA 4QVGA 1USKA 2PUVA 3K3PA 4F38A 4NNJA 3C8UA 1D2GA 1TAHA 2FGKA 1WSAA 4PZYA 2C7RA 3BQNB 1E9DA 1WO8A 2BPOA 4IX1A 4LYHA 2H9YA 2G1UA 1XLWA 2Z9CA 4XUCA 3V8NA 3CXRA 5JBIA 3AIIA 5FWYB 5B12A 4HWKA 3F9IA 1DAEA 2GF9A 3MGKA 4HX9A 3MA0A 3SM9A 3VBCA 1XN4A 5A3VA 4OQ4A 2RHWA 4KU4A 2OBFA 1JIXA 4DR4B 1GY8A 4LISA 1RCFA 2OGUA 1EDOA 5T67A 3WTCA 1ZLXA 1R6AA 2Q49A 3AKZA 1ESCA 1H1LB 1U9CA 2N1MA 2W2TA 1KJNA 1ZISA 3MBIA 521PA 5ELMA 4CLOB 1NW7A 3KR0A 3RSHA 1IZ0A 2F9FA 2JC3A 4JZKA 2ZE8A 3S2YA 2OCGA 3E9NA 3UY4A 1QJCA 2YN2A 2DPHA 4MQBA 3NYRA 3RGWS 1Z16A 4YT5A 1CQXA 2W2OA 1Q16A 1TJ4A 3NORA 3OP1A 4NH0A 1NPTO 4ZAZA 3UJPA 5FI5A 2NUBA 1DQPA 3AB3A 2IX9A 2W48A 2PD6A 3IQXA 2CGEA 2WIGA 2ZKLA 5KCMA 1OBOA 2QVYX 2I6TA 2OGTA 3Q7RA 2PWBA 3NDPA 1E2NA 1ECPA 4I6JA 2F8MA 4UTVA 1DS6A 1PQYA 3HO6A 4XJXA 1MO4A 5CT5A 1PDVA 5CW2A 2H17A 2IXAA 1GV0A 5F33A 1RPZA 2I76A 3LFTA 4FVTA 5FQNA 1AQYA 4PC6A 1YNSA 2DJ5A 2O9JA 4FGZA 4JYMA 2WTBA 4ME6A 6REQB 3DZ8A 1T0JB 4FGJA 2BWJA 3KZMA 4H27A 4DLKA 2EG9A 3D7SA 1ABEA 1PT7A 2VP4A 3BGOS 3EJ6A 1Y5RA 4OBBA 5FFMA 5M3BA 3SXJA 2EATA 2JLZA 2I6GA 1CDEA 3FJ1A 4NAVA 5T4BA 1ZUD1 1PJCA 3GZ4A 2W2KA 3HBJA 4Y2YA 2HDOA 1ZU4A 2JLRA 4ZZ3A 1UQUA 4S12A 1CJCA 5ICMA 1L0BA 3NBMA 1HSOA 5LJLA 2HU8A 1E79D 2ZIGA 3DMNA 4FK8A 3ISVA 4FNMA 4A6XA 5KJ1A 3UXYA 4FI3F 4W7IA 4DJ5X 1Z4MA 4O4LA 3CWQA 4RTJA 3IIJA 3RUAA 2WD7B 1FYEA 1YKSA 3UH0A 3F49S 3ND6A 1KPIA 3MWEB 1CUAA 4JD5A 3VJRA 3VH1A 3ZI0A 5JAOA