4RTVA

Crystal structure of the src tyrosine kinase sh3 domain s94a/q128r mutant in complex with the high affinity synthetic peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYEARTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the Src tyrosine kinase SH3 domain S94A/Q128R mutant in complex with the high affinity synthetic peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding, signaling protein
total genus 13
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtvA00
4F14A 1YN8A 1PKTA 1T3LA 2KYMA 4RTUA 1BBZA 1E6GA 4X1VA 1AWXA 1SHGA 2HDAA 3EG1A 4HVWA 4E6RA 2CH4A 1CKAA 3ULRB 2JS0A 2DL5A 1AD5A 1TUDA 2DE0X 2KGTA 3NPFA 4AG1C 1K76A 2DRKA 1JO8A 4CC7A 4QT7A 4J9IA 2VKNA 2GGRA 2KYBA 4LN2A 3RBBB 1AWJA 2ED1A 2RQWA 3VRZA 5EC7A 2CT4A 2AK5A 5IHKA 3I9QA 3O5ZA 3FJ5A 4JJBA 4RTXA 1MV0B 3VS1A 2O2OA 3EG3A 3C0CA 3CQTA 4D8DA 5IXFA 2CUBA 2DYBA 2DLPA 2O31A 2ROTA 4FSSA 1NYFA 1UJ0A 3KFVA 1ZUKA 2EYZA 1OV3A 1BU1A 4HVUA 3LH5A 1LCKA 1IO6A 2EPDA 2FG0A 2J7IA 4IIOA 2L3PA 4J9CA 1RLPC 2HCKA 2MIOA 2RPNA 4RUGA 5IXBA 2DA9A 1VYUA 1X2KA 3M0UA 1UFFA 2X3WD 4ZNXA 2ABLA 3TVTA 4A63B 1UDLA 1CKBA 1X2QA 1N5ZA 2DMOA 5IHIA 1G2BA 3IQLA 3M0SA 1OOTA 2P4RA 4CC2A 4AFZC 1OPKA 3TSWA 2EYYA 2M0YA 4Z89A 4KRTA 3QWXX 2SRCA 3EG2A 1JU5C 3NGPA 1UGVA 1M3CA 3VS4A 1VA7A 1YCSB 3M0PA 2RMOA 1ABQA 2LX7A 4J9DA 1AZGB 2YUQA 2OI3A 2RF0A 2EGAA 2OAWA 2FRWA 1X43A 1WDXA 2MCNA 4CC4B 1YNZA 2LJ3A 2EBPA 2K6DA 2PZ1A 3VS7A 1UHFA 2KRSA 1M3BA 4EIKA 2A28A 3SHWA 2YSQA 5ECAA 2D8HA 1TG0A 2VVKA 3UA7A 3VRYA 1X69A 1K1ZA 1NG2A 2RQVA 1KIKA 2LNHB 1UHCA 1YP5A 2K9GA 2L3SA 1X27A 1CSKA 2DILA 1QKWA 1JXMA 1I1JA 3NHNA 2NUZA 1UUEA 2EYWA 4JJDA 2NWMA 3M0RA 1AEYA 2C0TA 1U3OA 4ESRA 5FWBA 1W1FA 2DVJA 3JV3A 2JTEA 2DJQA 2KEAA 1QLYA 2YUNA 1GBQA 3M0QA 3H0IA 1JXOA 1GFDA 4LE9A 1H3HA 4AG2C 1ZLMA 2ESWA 2KT8A 2K79A 4J9BA 2DBMA 2BZYA 2HEQA 2QDLA 1GCQC 1OPLA 2AZVA 1YWOA 3I35A 2IIMA 3I5SA 1GFCA 4JZ4A 2EGEA 1GBRA 2RNAA 4LNPA 2CUDA 2CDTA 1SEMA 1RUWA 2E5KA 2M51A 2BTTA 1K9AA 1NLPC 2RQRA 2JT4A 2VWFA 2H8HA 2X3XD 1NYGA 1BK2A 4RTYA 4DEXA 1T0JA 1RLQC 2EKHA 1GCQA 4HVVA 3VS0A 2SEMA 2LJ0A 5I22A 1UECA 2YDLA 1E7OA 3GBQA 1TUCA 1GCPA 1UG1A 4OMQA 4RTVA 3REAB 3REBB 1WX6A 1NM7A 2D1XA 1S1NA 2J6OA 2PTKA 1PRLC 2JM8A 4R0KA 4AFUC 2DNUA 1GL5A 1Z9ZA 1QWEA 4JZ3A 2HBWA 5GJVB 1B07A 2YT6A 1AWWA 2DM1A 1U06A 1MUZA 1GRIA 1I07A 1WI7A 2JM9A 1ARKA 2DL4A 2CSIA 1UJYA 1BB9A 5HCKA 1XOVA 2MOXA 4J9FA 3TSZA 2FPEA 2BZ8A 1V1CA 3ZL7C 1G83A 1JQQA 2KE9A 4OMLA 1EFNA 3H0HA 4CC3A 2CREA 2LMJA 3UA6A 2V1RA 1UTIA 1ZSGA 2JMAA 2O9VA 4AFSC 4RTTA 3EHRA 1KJWA 1PRMC 1WA7A 4RTWA 1UE9A 2EVRA 2AZSA 4K11A 1KSWA 5GJWB 1A0NB 3I5RA 1PNJA 1Y57A 1SRLA 2EQIA 3VS2A 2EYXA 2K7AA 2J05A 2W10A 2KT1A 1M30A 4ORZA 2LJ1A 1JEGA 3EG0A 1YWPA 3U23A 4M4ZA 3UATA 3VS3A 3PVLA 1I0CA 2YUPA 2KROA 2J6KA 2GTOA 2ROLA 4JPBW 2F2WA 2A08A 3H0FA 2J06A 1W6XA 2KNBB 3A98A 5FW9A 2DF6A 2DBKA 2C0IA 2LZ6B 2CT3A 2KBTA 1WXTA 4RTZA 4JJCA 2FPFA 1RI9A 2FO0A 3PE0A 2K3BA 2A36A 4GLMA 2F2XA 4LUDA 1M27C 2J6FA 4F16A 1WLPB 1PKSA 1QWFA 1SPKA 4J9EA 4OMNA 2C0OA 4OMMA 2AKLA 2DRMA 1NEGA 1H8KA 1Z9QA 4AFQC 1K4US 2CSQA 2DL8A 2AKKA 2DL3A 1K0SA 2L0AA 4Z88A 4Y92A 4OMOA 1SRMA 1AZEA 1U5SA 2KXDA 2FEIA 1AWOA 2LCSA 1MV3A 1PWTA 3H41A 1T0HA 1W70A 2KRNA 1E6HA 2JS2A 4D8KA 4OMPA 2A37A 2RQTA 5FWCA 1HJDA 1J3TA 1WXBA 4DEYA 3QWYA 2L2PA 5IHNA 3RNJA 1OEBA 1WYXA 2KRMA 3EHQA 4J9GA 2DL7A 2BZXA 4IIMA 1B3QA 1NEBA 2GQIA 4HCKA 4Z8AA 1WFWA 2OJ2A 4F17A 5L23A 2B86A 3THKA 1HSQA 2RQUA 1M3AA 1QKXA 3NMZC 5IH2A 2KXCA 2LP5A 1X6GA 3R6NA 2FRYA 1VYTA 2D8JA 2G6FX 1AOJA 2ED0A 1FMKA 2O9SA 1NLOC 2V1QA 3PVQA 3EGUA 2EGCA 1WXUA 2YUOA 2LQNA 2O88A 1FYNA 2GNCA 2GTJA 2W0ZA 3UF4A 4HXJA 2XMFA 1H92A 3VS6A 2HSPA 1ABOA 1HD3A 1M8MA 1K0XA 2F2VA 4J9HA 2I0NA 2FPDA 2JMCA 1AVZC 4GBQA 3M0TA 2CH4W 3SEMA 5I11A 1SSHA 1ZX6A 2PNIA 1SHFA 2ECZA 2JW4A 3VS5A 1KFZA 1WIEA 2GBQA 1VYVA 2RN8A 1ZUYA 2L3QA 2LQWA 1T3SA 2D0NA 2K2MA 4WCIA 2DX1A 1QCFA 1ZBJA 1PHTA 4LUEA 2ENMA 2JXBA 1ZUUA 2EW3A 1X6BA 1Y0MA 2KR3A
chains in the Genus database with same CATH superfamily
1PKTA 1O75A 4X1VA 5GAOp 3CCUA 4ZN1A 3INZA 3OYNA 2KDSA 3EG1A 4E6RA 3JCMg 2KK4A 2DL5A 2YLBA 1AD5A 4Y28E 1TUDA 3JCMh 2KGTA 4DBQA 3LGLA 3D7SB 4AG1C 1JO8A 1UGSB 4OB1B 4QT7A 1VQ9A 2VKNA 1AWJA 2R58A 2CT4A 3E1SA 5KYUB 2HQHA 3UWNA 1NPRA 4UC4A 3FJ5A 3AHUA 2NUPB 1WJQA 3WVDB 1JJ2A 2O31A 4KGZB 2X9HA 2EAYA 2BE9B 3KUFA 3JCMc 1ZUKA 4B9XA 2M02A 3QSUA 3GNGA 2V8KA 1OV3A 2K3YA 4HVUA 1N8RC 3LH5A 2JZ2A 3EH2A 2FG0A 4QW2A 1VQ4Q 2AT1B 2YRDA 1IHWA 4E7KA 2C06A 4Z02A 2MIOA 4RUGA 1Q81R 2FL7A 2JNGA 1BI2A 1X2KA 4BI3A 4V2SA 3VJPA 2VUBA 2DFUA 2K4YA 5GAN5 4E7IA 5GMKj 5KCOA 2WACA 3V7SA 4CC2A 4AFZC 1OPKA 2DYIA 3TSWA 2M0YA 4Z89A 4BE2A 2FZGB 3QWXX 2SRCA 3SWNC 4JS4A 1M3CA 3CC7T 2VXFA 1PCXA 1WQWA 2LCLA 4J9DA 4FT4A 4C0DC 2EGAA 2QDYB 1WDXA 4CC4B 2DIQA 4M77E 4OP0A 2PZ1A 3FLGA 3NTHA 1VQ4A 2KMTA 3EFOA 3JCMJ 4A4KA 1M3BA 3OYDA 1NJIC 3SHWA 2EYQA 3UA7A 3DLMA 1K8AC 4C8QE 3CPFA 1X69A 2EJFA 1EX4A 1K1ZA 1NG2A 4II1A 5GAOr 2CP2A 1KIKA 2QTVA 1UHCA 1YP5A 2KI7A 2E64A 1M90R 1CSKA 3CC7Q 1QKWA 1XTDA 1VUBA 4LDUA 1KG1A 3ZBDA 5DLOA 4DQ2A 1N9RA 4ESRA 4CRIA 2DD4A 1BIBA 4MDXA 1R8OB 2DTOA 3JSCA 2DVJA 5FWBA 2JTEA 2DJQA 4N4HA 1QLYA 4E7JA 2EWNA 3M0QA 2WSEE 3P8BB 5KYWA 3OS1A 1KHIA 1H3HA 1ZLMA 2MK5A 3QZ5B 3TEEA 2LX9A 5CKDA 2EQUA 5CR2A 1N6AA 4PK4A 4O6JA 4XTVA 3X28B 4A4GA 4LDWA 3ZFJA 2LDMA 3M5AA 4C92A 2O01E 4LNPA 2CUDA 2CDTA 4KULA 1IGQA 1RUWA 1VQMQ 3CBPA 3CC7A 4RG2A 3OYMA 4ELYC 2RHIA 1NYGA 2CKKA 3VKIA 3EFSA 1Y96B 1T0JA 2EKHA 2CP0A 4M7AD 2XK0A 3OS5A 5I22A 1VQOT 4RCCA 2YDLA 2LNVA 2NYSA 2Y4YA 4RTVA 4PLLA 2P0KA 2PTKA 4QVZA 2JM8A 3QJYA 5GAN4 3MKDA 4Q5WA 2DNUA 2MI6A 3OBWA 1V76A 3RKWA 2HBWA 3CC4Q 2A3LA 1AWWA 2DM1A 1U06A 4KT0E 3JCMb 1ARKA 2ZPBB 5D7UA 2RHXA 2CSIA 4E47A 2HL3A 3L2VA 2RI5A 2DJZA 4J9FA 5LJ3d 1V1CA 4FW1A 3ZL7C 2BIVA 2DD5A 3JCMV 1JQQA 2KE9A 1KQSP 4C0FA 1VQMA 4M78F 3JB9J 1ZSGA 4PJOC 4AFSC 3BE3A 4M75G 2V8IA 3C95A 4A53A 1WA7A 3G71Q 2EVRA 4E7SA 4BI4A 1RAEB 5GJWB 1M1FA 1PNJA 4EMKC 1Y57A 4TVRA 3OBYA 3VS2A 1UEBA 3GNFB 2K7AA 2W10A 1M30A 4QVCA 2CP3A 3MO8A 4M7DA 5IN1A 3JCMd 2DIGA 4C92F 2XIDA 3U23A 4M4ZA 5FU7C 3VS3A 1I0CA 3MJXA 2K2VA 1WQ7A 2YUPA 3P8HA 3DB3A 5AYFA 4HT9A 3FC3A 3G6ET 2J06A 1W6XA 2OTLT 1VQOA 3A98A 3BFMA 4O5VA 2DBKA 1Q82C 2FO0A 1QQJA 4JRPA 3G71A 2EFIA 2A36A 4GLMA 5CKEA 4LUDA 3SB2A 2J6FA 5GAN6 8AT1B 4J9EA 4OMNA 4J6XA 2AKLA 4D6WA 2K5FA 1Z9QA 1K4US 2CSQA 2E10A 5GANf 1U5SA 4DBRA 2LCSA 2DETA 3LW5E 1MV3A 1PWTA 2F5KA 1OULA 3G6EQ 3TU4K 2OTLQ 5KCHA 5KYYA 2A37A 3QHSA 1WXBA 1VQ5Q 4XTXA 3S3OA 1OEBA 3QXEB 4L5GA 4LDYA 4L59A 3LWHA 2FYKA 1OI1A 4IIMA 1Q81U 5LJ3e 2H3EB 4HCKA 1IHVA 3T9NA 2NLUA 2LCCA 1UB4A 3FIFA 3HKSA 2LP5A 3CBOA 2DXTA 4M7DF 1G3SA 2G6FX 5J26A 2VB6A 3V8JA 3OYCA 2JJ9A 1NBEB 1TXQA 2GNCA 4EPCA 3M58A 2VC8A 2GFAA 2HZYA 2RHUA 3ZEHA 3L2RA 2FHDA 4PJOB 2I0NA 1AVZC 3RMSA 3SEMA 2E12A 3QKJA 3G6EA 2OTLA 2PVDB 3UDCA 1ZX6A 2PNIA 1SHFA 3CCLQ 2IG0A 2K57A 3JCMe 4HCBA 5GMKe 4EMKB 3HSBA 3G7ZA 4FYWB 4RG8A 2L3QA 1T3SA 2D0NA 2K2MA 4M77C 2DX1A 4M7AA 1QCFA 2RK1A 1W2BS 3QBYA 4LUEA 3OYHA 2MF2A 3FEOA 2JXBA 3L2ZA 3VV0A 4M78B 1N9SA 5CVIA 4LD6A 1WJSA 2WSCE 2KR3A 3QG1A 4C8QC 2R57A 1DJ7B 1JRIA 1VQLT 1HYOA 3VYHB 1M90U 3RERA 1YN8A 3HFOA 1T3LA 2KYMA 4RTUA 1E6GA 1MMNA 2O4XA 1AWXA 1K73U 2ZAEA 4JLIA 2HDAA 4HT8A 1QVFS 1CKAA 2QTXA 2JS0A 3MP1A 2XDPA 1B7TA 1UGQB 2DTHA 2DE0X 1R77A 5GMKl 3L2UA 1VQNQ 2DRKA 4KUIA 3BDLA 1OX8A 5KE3A 3CCLA 5FROA 1BIAA 4XU3A 2KAFA 3UT1A 2ED1A 4MMLA 2AK5A 3I9QA 1U8RA 4A4EA 2YHTA 2XI9A 4JJBA 1MV0B 1ZSZA 3EG3A 3C0CA 3CQTA 3SD4A 3URGA 2CUBA 2DYBA 2ROTA 2M0OA 4HCCA 2HD0A 3M57A 3CCUT 1BI1A 1C1AA 2QA4Q 3QJ6A 1P92A 1TH7A 3FDRA 3FJPA 4ZN3A 1LCKA 1Y7XA 2EPDA 4AT1B 1UGPB 2JVVA 4J9CA 3EFRA 1VQ9T 2XKOC 4OGEA 2RPNA 5LJ5f 3QIIA 2X51A 5GAN8 4PJOD 1VQNA 2CP7A 4PLIA 1UFFA 3C94A 4A63B 1X2QA 1N5ZA 3NTKA 4NS5A 5IHIA 1G2BA 3M0SA 2P4RA 3TREA 3P8DA 2QAZA 2QEXQ 1BCMA 2XDDA 2VASA 4PJOE 3EG2A 4N0AA 1JU5C 3NGPA 1LOJA 2DXBA 1UGVA 4J83A 3VS4A 3V8LA 4B9WA 2RMOA 2QA4A 1AZGB 1ZA1B 2OI3A 2X4XA 4BE0A 2OAWA 2FRWA 2CZ6B 1SKUB 2MCNA 1WHKA 3HRSA 1I81A 1Y71A 2X35A 1K9MC 2KRSA 4F04B 3SWNA 5J3BA 4M78E 1YIJT 2A28A 1RABB 3WVEB 3EG9B 2VVKA 4MDWA 3L2WA 2E4HA 1QMCA 4M75C 2QI2A 3VYGA 3EGDA 3OMCA 2V26A 1W2BP 2X4WA 2X4YA 3OQ5A 3CBMA 2DILA 1Q86C 2XICA 3BW1A 2NUZA 5DY9A 3OYLA 1UUEA 4P5NA 2AIRB 2EQKA 3OSVA 2E70A 3OW2S 5LJ5g 4C92G 5GMKh 2CZ0B 2RI3A 1OX9A 2KEAA 3PMTA 1VQ4T 2YUNA 1QVFP 2QQRA 1D3BB 5L8RE 1GBQA 1JXOA 1TUGB 1YIJQ 2M9UA 2QGFB 2EJ9A 2M16A 4A4HA 4LE9A 3QO3A 4AG2C 5KYXB 2KT8A 4J9BA 3CCQQ 2XU8A 5I2MA 5CKFA 1GCQC 2A0FB 1OPLA 2DZCA 1GXIE 4J6YA 4HKEA 1C6VX 2DERA 3BY7A 2EGEA 3M53A 2DEQA 2RNAA 1KQ1A 2NUTA 3EGXA 3PGGA 2E5KA 2BTTA 1NLPC 2PUKB 2JOYA 2RQRA 2I2LA 2H8HA 2X3XD 1BK2A 1KQSA 1WNLA 4PFPA 4DEXA 1D1CA 2GF7A 1Q82U 1KC8C 3ASKA 5CO7A 2COYA 1YCYA 1OZ2A 3GBQA 1GCPA 4OMQA 1WX6A 1NM7A 1S72Q 4MZTA 2D1XA 1YIJA 3VUBA 4OB2B 5LJ5j 1GRIA 3CCQA 1M1KC 4M77D 1KQSS 2YXYA 2RB6A 4OMFB 2ZPEB 4LXCA 5HK0A 3TSZA 2FPEA 2BZ8A 2IVWA 2FZCB 4JRQA 1IZ6A 2RI2A 4C8QD 4M7DG 3CCEQ 1D0YA 1EFNA 5GAOn 3H0HA 4CC3A 2CREA 3HFNA 3KXTA 1UTIA 3QDRB 4RTTA 3OYGA 3S3MA 4N4IA 1IGUA 2BE7D 3PFSA 5FU6B 2EQMA 2QYZA 4M75B 4XU2A 1S72A 2ZCFB 2F5TX 2AZSA 2RJDA 5GAMf 1KSWA 3I5RA 2O4XB 3GF5A 2DEUA 2EYXA 4C5IA 2RD1A 2KT1A 4ORZA 2LJ1A 2L3RA 4LDVA 1K73R 1M4ZA 3G4ST 3HRTA 1VQ7Q 1VQMT 2H3JA 3PVLA 1NJIR 2XDBA 2Y4XA 1HK9A 2J6KA 2GTOA 2ROLA 2F2WA 3X24B 2A08A 2L5QA 3CCEA 2CP6A 2G3RA 3OW2P 2DF6A 3Q1JA 4MMKA 2P0QA 2LZ6B 1PG5B 2FPFA 1I8FA 1LVKA 2K3BA 1YI2Q 2F2XA 2RK2A 1WLPB 4N4GA 3CC4T 1RAFB 2DRMA 1MMDA 3CCJT 3OY9A 3G4SQ 2EIFA 4OGCA 4AFQC 2DL8A 2DL3A 4Z88A 2QQBA 1SRMA 2KXDA 1AWOA 2BUDA 2EQJA 1B34A 2DO3A 1TSFA 2KRNA 3QYHB 1E6HA 4FYXB 4D8KA 4OMPA 4FT2A 1Q7YC 2HSEB 2RQTA 1HJDA 1QVPA 3RNJA 1WYXA 4IUPA 5GAMg 3OMGA 2ZPHB 1Q95G 3G71T 1B3QA 1PSFA 1XJWB 4Z8AA 2RH2A 3CCJQ 3HP9A 1WFWA 5L23A 2K5IA 2B86A 3THKA 4E7LA 1QKXA 5IH2A 2KXCA 1YI2A 1VYTA 3CCSQ 1FX7A 4M75D 2V1QA 5HK3A 3G4SA 1KD1C 3EGUA 4M7AG 1WXUA 4ATOA 4JLGA 1FYNA 1M2VA 2GTJA 2W0ZA 5D6XA 1H92A 3GP8A 1PD1A 3VS6A 4DOWA 3JB9F 1YHQT 1XNIA 2CH4W 4M75E 4AMCA 4ZGEB 3DLLA 1WIEA 3LH0A 2LT4A 4PFZA 2RN8A 4J7IA 4IKFA 1BKBA 1D0XA 3CC4A 5D6YA 3RIRA 3CCJA 4NL3A 4M78C 5GAMj 1PC0A 2ATCB 4BDZA 4F14A 1SF9A 3CCSA 1YHQQ 1BBZA 4LDXA 3J7AF 3I56T 5FRNA 4HVWA 4M77A 4E7ZA 2DPPB 2KQWA 5C0MA 1VQ5T 3HPWA 2DVEA 1O9SA 1VIFA 3CMAQ 1K76A 2GFUA 4C8QA 4QQ6A 4C92C 2NUTB 4J9IA 2GGRA 2KYBA 4LN2A 4XTWA 2RQWA 3KBGA 3VRZA 5EC7A 2IPOB 1NE8A 5IHKA 1IXDA 2K3XA 3A8OB 2XG8D 2O2OA 2PQWA 2D6FA 3KFVA 3I56Q 2DXCA 4C5HA 1Q82R 1QVGS 2Z0WA 1YHQA 1LNXA 1BU1A 5CKHA 2FVUA 3MCAB 5KYUA 3HRUA 3OYFA 1ZHIA 4BD3A 4C5GA 2PVOB 1M2OA 3LGFA 1IO6A 2J7IA 4IIOA 2L3PA 2NUPA 4XAXB 3CCLT 2HCKA 1LJOA 3MHXA 5IXBA 3SFMA 2DA9A 2VV5A 1VYUA 4MZMA 2LC4A 3CMAA 2JTMA 2X3WD 4ZNXA 1AHJB 5KYNA 1CKBA 1NPPA 2DMOA 3A8GB 4ZGDB 3IQLA 2E65A 3A5ZB 7AT1B 1W2BA 1N8RU 2EJGA 1VQPT 3EFOB 3PNWC 2HL5C 4XU1A 1VQ8T 3I56A 1IB8A 2KVQG 1YCSB 3WXMB 1WHGA 4C0ZA 3J80E 2LX7A 1C0MA 1VQ5A 2RM4A 4C0GA 3X26B 4IUQA 2YUQA 1X43A 2F1LA 1QVFA 1YNZA 4JJNK 2LJ3A 1OQKA 2EBPA 5LJ5e 1VQNT 4M7DC 3VS7A 1UHFA 5GANg 4LD9K 4EIKA 1WPYA 2YSQA 5ECAA 1V29B 2QGGA 4A4FA 4BDYA 4DBFA 2KY9A 2WSFE 4A54A 1VQPQ 2RO0A 2RQVA 1NZ9A 2LNHB 3M54A 3X20B 2K9GA 3J81E 1VQ8Q 5KYWB 1X27A 1MHNA 3CD6T 4NL2A 1D1BA 3NHNA 4IURA 2QA4T 2EYWA 2NWMA 3M0RA 3GPLA 2ZPGB 2ZGWA 1NJIU 2QASA 3RKYA 1K8AU 1F1BB 1ACMB 5FLXE 4QKUA 2PU9B 4C92B 3H0IA 3MEWA 3LLRA 2ZPIB 4FM4B 2JTFA 4QQGA 5CIUA 2K79A 2DBMA 4OB0B 1YJWQ 2HEQA 5CAIA 4FL6A 2XHCA 5LJ3f 3GIBA 2AZVA 3CD6Q 3I35A 3NFCA 2QEXT 2IIMA 4KUDK 1VQPA 4JZ4A 5KH6A 2LVMA 5GANj 1VQ6T 5CQYA 4ZTJA 2M51A 1VQ8A 5GAMd 3A8MB 2K5LA 2E3HA 1JB0E 2EKOA 4RTYA 3I55Q 3FRNA 4FU6A 1RLQC 1QVGP 1GCQA 3VS0A 2SEMA 2LJ0A 3ME9A 2GQVA 1E7OA 1TUCA 3REBB 3REAB 4EDUA 4M7AF 2J6OA 4ME7A 3RDVA 4R0KA 4AFUC 4GLKA 3JCMf 1Z9ZA 5HKCA 4FYYB 1AT1B 1OU9A 1B07A 1MUZA 1I07A 1WI7A 2YRVA 1Y96A 2JM9A 1YJWA 1G3YA 1VQ6Q 4BB7A 1ZBXA 3CD6A 1BB9A 5HCKA 1VQKQ 2MOXA 2B8AA 4FCYA 4M78D 3MPUB 3TCJA 2OTJQ 3QUIA 1QCNA 1G83A 4BY6B 1FMVA 1RACB 2BKDN 2PUOB 2LMJA 4XU0A 3V7CA 4M7DB 3I55A 3PIPA 2M1HA 2V1RA 2HBPA 3OW2A 2MPXC 3E2UA 4Y91A 1KJWA 5CQXA 3CPWS 3E9GA 1BI0A 1PRMC 3QYGB 3JB9G 2FB7A 5FU6C 5GAOq 4K11A 3CCQT 2MYSA 4IUUA 1A0NB 1IREB 5GAN7 3OS0A 4C92D 5D6WA 1KD1U 3JB9H 3L1AA 3OYYA 4J7FA 1RAGB 2QEXA 4E2FB 1YWPA 1VQ6A 4KH1B 1VQKA 2CZ7B 3CXCS 1MNDA 4C92E 5LJ5h 2OTJA 1YFNA 4JPBW 3CC2T 4F7UA 1X01A 2HKNA 3LWIA 1ZSZC 5IT9E 1MMAA 2C0IA 1S72T 2CT3A 3LX7A 1Q86R 3E9FA 2D9TA 3PE0A 5GAMe 5KYYB 1YJ9Q 3EAEA 1M27C 1PKSA 1QWFA 2AHJB 3JAME 2C0OA 1NEGA 1YJNT 3OB9A 1QP2A 5GAOm 2QQAA 3NTIA 1Q81C 4Y92A 4OMOA 5LJ3j 1AZEA 3A8LB 3CC2Q 1W70A 3CCET 2JS2A 3OYAA 4IUVA 1SSFA 5FWCA 4FIBA 1J3TA 1I5LA 1IRXA 3QWYA 5J39A 1OU8A 2L89A 3EHQA 3QDFA 4HCZA 4J9GA 3EH1A 2DL7A 3DKMA 2COWA 3PIOA 2CS7A 3CMET 4N0AC 1YJNQ 4M7DD 2OJ2A 4F17A 1N8RR 1JJ2S 4R56A 1YJ9A 5A0DA 4RMOA 3S6WA 3PMIA 3R6NA 1KC8R 3MEAA 1AOJA 3JRZA 4C5EA 1FMKA 3PVQA 2O9SA 2QG9B 2YUOA 2LQNA 3CEYA 1VQ7T 2O88A 1G5VA 4HXJA 4M7DE 4M7AB 4XTYA 1ZQ1A 4VUBA 2HSPA 1ABOA 1HD3A 1M8MA 1K0XA 5M9OA 4PJMA 4XTZA 4J9HA 4GBQA 2FPDA 2JMCA 5CCAA 5GANd 3M0TA 3CC2A 4F7UF 1SSHA 2ECZA 1M90C 4QQDA 1M1KR 4JDSA 3CMEQ 5CK9A 3M55A 1KFZA 4M77G 1K73C 2GBQA 6AT1B 1ZUYA 1U1TA 3CPWP 4KBMB 4FSXA 2E1HA 1YI2T 3JCMW 2LRQA 3UPUA 5I2SA 1ZBJA 1M5Q1 3HL8A 2LTOA 4C8QG 1YJNA 2ENMA 4PJOA 1TWBA 1ZUUA 2EW3A 3OYJA 3M9QA 3E19A 3MP8A 4J8OA 4EMKA 1K8AR 1SHGA 3CCRT 1ZSZB 2CH4A 1QCOA 3ULRB 3CXCP 3PT9A 1I4K1 3MEUA 5A0GA 4X9CA 3NPFA 4M78A 2E3IA 3F70A 1EZZB 2RHYA 3LYIA 4CC7A 3VU3C 2VXEA 1M1GA 3CMEA 4DOVA 1SG5A 3RBBB 3GLXA 3META 4PJJA 2QQSA 4JUVA 3O5ZA 4RTXA 3VS1A 2MWOA 1VIEA 2LQKA 4D8DA 5IXFA 2DLPA 3CCST 4FSSA 1NYFA 2YWWA 1UJ0A 4BUGA 1VQ7A 3CCRQ 2MAMA 2EYZA 3M4YA 4JRKA 2OX7A 3RUXA 4PKCC 4J6WA 2P84A 2YRCA 3S3NA 3BDUA 1BCOA 1JBMA 2YLCA 2MMPA 3JCMX 3TQ7P 3M4GA 1WHHA 5GAMh 1RLPC 2DZ9A 3M0UA 2RJCA 4RCBA 3H6ZA 3JCMP 3OA6A 3PTAA 3VUZA 2ABLA 3TVTA 1UDLA 3SDZA 4PJOF 1X75C 5GANe 1Q7YR 1OOTA 1JJ2P 5KE2A 2JN0A 4M7AE 4BE1A 2EYYA 4RKUE 4IUTA 4KRTA 3SWNB 3HTRA 1D09B 1VA7A 4GY5A 3CCRA 3M0PA 3C12A 1ABQA 3EGDB 5A0LA 4C0DB 3A8HB 2RF0A 1VQOQ 1U1SA 2K6DA 3CMAT 3X25B 1KD1R 2DAQA 2DKGA 4KGXB 1QW1A 3CCMT 1KK7A 2D8HA 1TG0A 5I21A 1YITT 1W4SA 3VRYA 5LJ5d 2P4TA 4FYVB 4HA8A 4JRIA 3OYBA 2L3SA 1H3ZA 4PFOA 4F7UB 2HNIA 1LPLA 2P0PA 1JXMA 1I1JA 1G8XA 2DTIA 4R55A 1K9MU 4JJDA 1AEYA 2QXFA 2C0TA 1U3OA 3L42A 2F69A 3EG9A 1W1FA 3JV3A 5FRMA 1QVGA 4EMGA 3EGXB 4OB3B 1GFDA 1HXDA 2R5AA 3CCMQ 1M9SA 1YITQ 1PSEA 2ESWA 3N5BB 1Q86U 1VOMA 2XD0A 1I5OB 1EIFA 2BZYA 5C6SA 2QDLA 2FZKB 1R0BG 1YWOA 1MGQA 1MMGA 3I5SA 1GFCA 1GBRA 1D3BA 1G3WA 1SEMA 1K9AA 2JT4A 2VWFA 2LT1A 5KYXA 3FB9A 4DA4A 2HQEA 4KGVB 2HQXA 3QPHA 1PD0A 4HVVA 1YBYA 5A2QE 2LQ8A 5DM7R 1RL2A 1UECA 4WTOB 2X4JA 1UG1A 1TOVA 1TS9A 1S1NA 4ELZC 2GCXA 1PRLC 2CGHA 1D0ZA 3CCMA 3M59A 5IAYA 1GL5A 1YITA 1QWEA 3CCVT 4JZ3A 4YTLA 3DB4A 5GJVB 2YT6A 3RKXA 1FXXA 1OZ3A 2DL4A 3O8VA 3H9NA 1UJYA 1KC8U 1XOVA 3MP6A 4OF1A 4M77F 4BI8B 2E5QA 5HY6A 4OMLA 4PJNA 4MZPA 4L6V5 4BY6C 2VGNA 3MEVA 1ZA2B 2RA2A 2CYZB 4QVDA 3UA6A 2ZZDA 4C8QF 3V8KA 1PM3A 2JMAA 2O9VA 2A7YA 3EHRA 1RAAB 4E7HA 3RR6A 1M1KU 2E6ZA 4RTWA 5GANh 3CCVQ 1UE9A 2E41A 4B6MA 4EMHA 4F7UG 2CP5A 1YJWT 1SRLA 2EQIA 4F7UE 4XK8E 3C4SA 1OYXA 2J05A 3G1JA 3ER0A 4PL6A 1KHCA 4PNOA 1JEGA 3EG0A 1WGSA 5FU7B 3UATA 4ANJA 4OVAA 3OYEA 4M75A 3I55T 3GOXA 2QK0A 1RI0A 2KROA 1WHJA 3OYIA 3QZ9B 1WHMA 4XTUA 5GMKi 2E6NA 3H0FA 2KNBB 4X9DA 3RESA 9ATCB 5FW9A 2D0QB 3OS2A 5CKBA 2KBTA 1WXTA 8ATCB 1B34B 4RTZA 4JJCA 4PJLA 2V8JA 1RI9A 4CI0C 2COZA 4DBHA 1X6OA 3CCVA 2DK3A 4F16A 1SPKA 4OMMA 1H8KA 2MWPA 3M56A 4J5YA 1BYMA 3OYKA 1K0SA 2AKKA 1RADB 2L0AA 4ZTFA 1VQKT 1KQ2A 1G3TA 2L8DA 1VQLQ 2FEIA 2OTJT 2DXUA 3H41A 3R6OA 1T0HA 2KSSA 3HHTB 1FWZA 4DEYA 2RJEA 2L2PA 4XQ3A 5IHNA 3A1PA 1FMWA 2QQ9A 2KRMA 4X34A 5GMKm 2BZXA 1Y07A 1M2VB 1N27A 1NEBA 2GQIA 1MNEA 1TTHB 3CPWA 5GAN2 4KH0B 1WHLA 1HSQA 2RQUA 1M3AA 1UGRB 3V7RA 3NMZC 1WJRA 1X6GA 1Q7YU 2FRYA 2D8JA 2ED0A 5AT1B 4WF2A 2CZ1B 5LL6S 1NLOC 2ZPFB 3CCUQ 2EGCA 3JB9D 4PJOG 2VYTA 1D1AA 5DLQE 3UF4A 2R5MA 4M75F 4M7AC 1VQLA 5GAN3 2XMFA 3L2QA 2F2VA 2PVGB 1TU0B 3CXCA 5I11A 1RAIB 1BI3A 2HAXA 1R0CB 5LJ3g 3AT1B 2JW4A 2RHZA 1VQ9Q 1WZOA 3VS5A 4FW2A 4JS5A 5LJ3h 1H641 4BACA 1M8VA 3JCMQ 2HMAA 3OSSC 1VYVA 3H8ZA 2LQWA 1YJ9T 4WCIA 4M77B 4NOYA 4M78G 5EG2A 2OAUA 1PHTA 3RMQA 4ZGJB 1XQHA 1X6BA 5GAOl 1RAHB 2JUFA 2HKQB 1QP3A 1K9MR 1Y0MA 3JB9I 4C8QB 2Y90A 2RJFA 2VGMA
chains in the Genus database with same CATH topology
4F14A 1YN8A 1PKTA 1T3LA 2KYMA 4RTUA 1BBZA 1E6GA 4X1VA 1AWXA 1SHGA 2HDAA 3EG1A 4HVWA 4E6RA 2CH4A 1CKAA 3ULRB 2JS0A 2DL5A 1AD5A 1TUDA 2DE0X 2KGTA 3NPFA 4AG1C 1K76A 2DRKA 1JO8A 4CC7A 4QT7A 4J9IA 2VKNA 2GGRA 2KYBA 4LN2A 3RBBB 1AWJA 2ED1A 2RQWA 3VRZA 5EC7A 2CT4A 2AK5A 5IHKA 3I9QA 3O5ZA 3FJ5A 4JJBA 4RTXA 1MV0B 3VS1A 2O2OA 3EG3A 3C0CA 3CQTA 4D8DA 5IXFA 2CUBA 2DYBA 2DLPA 2O31A 2ROTA 4FSSA 1NYFA 1UJ0A 3KFVA 1ZUKA 2EYZA 1OV3A 1BU1A 4HVUA 3LH5A 1LCKA 1IO6A 2EPDA 2FG0A 2J7IA 4IIOA 2L3PA 4J9CA 1RLPC 2HCKA 2MIOA 2RPNA 4RUGA 5IXBA 2DA9A 1VYUA 1X2KA 3M0UA 1UFFA 2X3WD 4ZNXA 2ABLA 3TVTA 4A63B 1UDLA 1CKBA 1X2QA 1N5ZA 2DMOA 5IHIA 1G2BA 3IQLA 3M0SA 1OOTA 2P4RA 4CC2A 4AFZC 1OPKA 3TSWA 2EYYA 2M0YA 4Z89A 4KRTA 3QWXX 2SRCA 3EG2A 1JU5C 3NGPA 1UGVA 1M3CA 3VS4A 1VA7A 1YCSB 3M0PA 2RMOA 1ABQA 2LX7A 4J9DA 1AZGB 2YUQA 2OI3A 2RF0A 2EGAA 2OAWA 2FRWA 1X43A 1WDXA 2MCNA 4CC4B 1YNZA 2LJ3A 2EBPA 2K6DA 2PZ1A 3VS7A 1UHFA 2KRSA 1M3BA 4EIKA 2A28A 3SHWA 2YSQA 5ECAA 2D8HA 1TG0A 2VVKA 3UA7A 3VRYA 1X69A 1K1ZA 1NG2A 2RQVA 1KIKA 2LNHB 1UHCA 1YP5A 2K9GA 2L3SA 1X27A 1CSKA 2DILA 1QKWA 1JXMA 1I1JA 3NHNA 2NUZA 1UUEA 2EYWA 4JJDA 2NWMA 3M0RA 1AEYA 2C0TA 1U3OA 4ESRA 5FWBA 1W1FA 2DVJA 3JV3A 2JTEA 2DJQA 2KEAA 1QLYA 2YUNA 1GBQA 3M0QA 3H0IA 1JXOA 1GFDA 4LE9A 1H3HA 4AG2C 1ZLMA 2ESWA 2KT8A 2K79A 4J9BA 2DBMA 2BZYA 2HEQA 2QDLA 1GCQC 1OPLA 2AZVA 1YWOA 3I35A 2IIMA 3I5SA 1GFCA 4JZ4A 2EGEA 1GBRA 2RNAA 4LNPA 2CUDA 2CDTA 1SEMA 1RUWA 2E5KA 2M51A 2BTTA 1K9AA 1NLPC 2RQRA 2JT4A 2VWFA 2H8HA 2X3XD 1NYGA 1BK2A 4RTYA 4DEXA 1T0JA 1RLQC 2EKHA 1GCQA 4HVVA 3VS0A 2SEMA 2LJ0A 5I22A 1UECA 2YDLA 1E7OA 3GBQA 1TUCA 1GCPA 1UG1A 4OMQA 4RTVA 3REAB 3REBB 1WX6A 1NM7A 2D1XA 1S1NA 2J6OA 2PTKA 1PRLC 2JM8A 4R0KA 4AFUC 2DNUA 1GL5A 1Z9ZA 1QWEA 4JZ3A 2HBWA 5GJVB 1B07A 2YT6A 1AWWA 2DM1A 1U06A 1MUZA 1GRIA 1I07A 1WI7A 2JM9A 1ARKA 2DL4A 2CSIA 1UJYA 1BB9A 5HCKA 1XOVA 2MOXA 4J9FA 3TSZA 2FPEA 2BZ8A 1V1CA 3ZL7C 1G83A 1JQQA 2KE9A 4OMLA 1EFNA 3H0HA 4CC3A 2CREA 2LMJA 3UA6A 2V1RA 1UTIA 1ZSGA 2JMAA 2O9VA 4AFSC 4RTTA 3EHRA 1KJWA 1PRMC 1WA7A 4RTWA 1UE9A 2EVRA 2AZSA 4K11A 1KSWA 5GJWB 1A0NB 3I5RA 1PNJA 1Y57A 1SRLA 2EQIA 3VS2A 2EYXA 2K7AA 2J05A 2W10A 2KT1A 1M30A 4ORZA 2LJ1A 1JEGA 3EG0A 1YWPA 3U23A 4M4ZA 3UATA 3VS3A 3PVLA 1I0CA 2YUPA 2KROA 2J6KA 2GTOA 2ROLA 4JPBW 2F2WA 2A08A 3H0FA 2J06A 1W6XA 2KNBB 3A98A 5FW9A 2DF6A 2DBKA 2C0IA 2LZ6B 2CT3A 2KBTA 1WXTA 4RTZA 4JJCA 2FPFA 1RI9A 2FO0A 3PE0A 2K3BA 2A36A 4GLMA 2F2XA 4LUDA 1M27C 2J6FA 4F16A 1WLPB 1PKSA 1QWFA 1SPKA 4J9EA 4OMNA 2C0OA 4OMMA 2AKLA 2DRMA 1NEGA 1H8KA 1Z9QA 4AFQC 1K4US 2CSQA 2DL8A 2AKKA 2DL3A 1K0SA 2L0AA 4Z88A 4Y92A 4OMOA 1SRMA 1AZEA 1U5SA 2KXDA 2FEIA 1AWOA 2LCSA 1MV3A 1PWTA 3H41A 1T0HA 1W70A 2KRNA 1E6HA 2JS2A 4D8KA 4OMPA 2A37A 2RQTA 5FWCA 1HJDA 1J3TA 1WXBA 4DEYA 3QWYA 2L2PA 5IHNA 3RNJA 1OEBA 1WYXA 2KRMA 3EHQA 4J9GA 2DL7A 2BZXA 4IIMA 1B3QA 1NEBA 2GQIA 4HCKA 4Z8AA 1WFWA 2OJ2A 4F17A 5L23A 2B86A 3THKA 1HSQA 2RQUA 1M3AA 1QKXA 3NMZC 5IH2A 2KXCA 2LP5A 1X6GA 3R6NA 2FRYA 1VYTA 2D8JA 2G6FX 1AOJA 2ED0A 1FMKA 2O9SA 1NLOC 2V1QA 3PVQA 3EGUA 2EGCA 1WXUA 2YUOA 2LQNA 2O88A 1FYNA 2GNCA 2GTJA 2W0ZA 3UF4A 4HXJA 2XMFA 1H92A 3VS6A 2HSPA 1ABOA 1HD3A 1M8MA 1K0XA 2F2VA 4J9HA 2I0NA 2FPDA 2JMCA 1AVZC 4GBQA 3M0TA 2CH4W 3SEMA 5I11A 1SSHA 1ZX6A 2PNIA 1SHFA 2ECZA 2JW4A 3VS5A 1KFZA 1WIEA 2GBQA 1VYVA 2RN8A 1ZUYA 2L3QA 2LQWA 1T3SA 2D0NA 2K2MA 4WCIA 2DX1A 1QCFA 1ZBJA 1PHTA 4LUEA 2ENMA 2JXBA 1ZUUA 2EW3A 1X6BA 1Y0MA 2KR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F14 A;  1YN8 A;  1PKT A;  1T3L A;  2KYM A;  4RTU A;  1BBZ A;  1E6G A;  4X1V A;  1AWX A;  1SHG A;  2HDA A;  3EG1 A;  4HVW A;  4E6R A;  2CH4 A;  1CKA A;  3ULR B;  2JS0 A;  2DL5 A;  1AD5 A;  1TUD A;  2DE0 X;  2KGT A;  3NPF A;  4AG1 C;  1K76 A;  2DRK A;  1JO8 A;  4CC7 A;  4QT7 A;  4J9I A;  2VKN A;  2GGR A;  2KYB A;  4LN2 A;  3RBB B;  1AWJ A;  2ED1 A;  2RQW A;  3VRZ A;  5EC7 A;  2CT4 A;  2AK5 A;  5IHK A;  3I9Q A;  3O5Z A;  3FJ5 A;  4JJB A;  4RTX A;  1MV0 B;  3VS1 A;  2O2O A;  3EG3 A;  3C0C A;  3CQT A;  4D8D A;  5IXF A;  2CUB A;  2DYB A;  2DLP A;  2O31 A;  2ROT A;  4FSS A;  1NYF A;  1UJ0 A;  3KFV A;  1ZUK A;  2EYZ A;  1OV3 A;  1BU1 A;  4HVU A;  3LH5 A;  1LCK A;  1IO6 A;  2EPD A;  2FG0 A;  2J7I A;  4IIO A;  2L3P A;  4J9C A;  1RLP C;  2HCK A;  2MIO A;  2RPN A;  4RUG A;  5IXB A;  2DA9 A;  1VYU A;  1X2K A;  3M0U A;  1UFF A;  2X3W D;  4ZNX A;  2ABL A;  3TVT A;  4A63 B;  1UDL A;  1CKB A;  1X2Q A;  1N5Z A;  2DMO A;  5IHI A;  1G2B A;  3IQL A;  3M0S A;  1OOT A;  2P4R A;  4CC2 A;  4AFZ C;  1OPK A;  3TSW A;  2EYY A;  2M0Y A;  4Z89 A;  4KRT A;  3QWX X;  2SRC A;  3EG2 A;  1JU5 C;  3NGP A;  1UGV A;  1M3C A;  3VS4 A;  1VA7 A;  1YCS B;  3M0P A;  2RMO A;  1ABQ A;  2LX7 A;  4J9D A;  1AZG B;  2YUQ A;  2OI3 A;  2RF0 A;  2EGA A;  2OAW A;  2FRW A;  1X43 A;  1WDX A;  2MCN A;  4CC4 B;  1YNZ A;  2LJ3 A;  2EBP A;  2K6D A;  2PZ1 A;  3VS7 A;  1UHF A;  2KRS A;  1M3B A;  4EIK A;  2A28 A;  3SHW A;  2YSQ A;  5ECA A;  2D8H A;  1TG0 A;  2VVK A;  3UA7 A;  3VRY A;  1X69 A;  1K1Z A;  1NG2 A;  2RQV A;  1KIK A;  2LNH B;  1UHC A;  1YP5 A;  2K9G A;  2L3S A;  1X27 A;  1CSK A;  2DIL A;  1QKW A;  1JXM A;  1I1J A;  3NHN A;  2NUZ A;  1UUE A;  2EYW A;  4JJD A;  2NWM A;  3M0R A;  1AEY A;  2C0T A;  1U3O A;  4ESR A;  5FWB A;  1W1F A;  2DVJ A;  3JV3 A;  2JTE A;  2DJQ A;  2KEA A;  1QLY A;  2YUN A;  1GBQ A;  3M0Q A;  3H0I A;  1JXO A;  1GFD A;  4LE9 A;  1H3H A;  4AG2 C;  1ZLM A;  2ESW A;  2KT8 A;  2K79 A;  4J9B A;  2DBM A;  2BZY A;  2HEQ A;  2QDL A;  1GCQ C;  1OPL A;  2AZV A;  1YWO A;  3I35 A;  2IIM A;  3I5S A;  1GFC A;  4JZ4 A;  2EGE A;  1GBR A;  2RNA A;  4LNP A;  2CUD A;  2CDT A;  1SEM A;  1RUW A;  2E5K A;  2M51 A;  2BTT A;  1K9A A;  1NLP C;  2RQR A;  2JT4 A;  2VWF A;  2H8H A;  2X3X D;  1NYG A;  1BK2 A;  4RTY A;  4DEX A;  1T0J A;  1RLQ C;  2EKH A;  1GCQ A;  4HVV A;  3VS0 A;  2SEM A;  2LJ0 A;  5I22 A;  1UEC A;  2YDL A;  1E7O A;  3GBQ A;  1TUC A;  1GCP A;  1UG1 A;  4OMQ A;  4RTV A;  3REA B;  3REB B;  1WX6 A;  1NM7 A;  2D1X A;  1S1N A;  2J6O A;  2PTK A;  1PRL C;  2JM8 A;  4R0K A;  4AFU C;  2DNU A;  1GL5 A;  1Z9Z A;  1QWE A;  4JZ3 A;  2HBW A;  5GJV B;  1B07 A;  2YT6 A;  1AWW A;  2DM1 A;  1U06 A;  1MUZ A;  1GRI A;  1I07 A;  1WI7 A;  2JM9 A;  1ARK A;  2DL4 A;  2CSI A;  1UJY A;  1BB9 A;  5HCK A;  1XOV A;  2MOX A;  4J9F A;  3TSZ A;  2FPE A;  2BZ8 A;  1V1C A;  3ZL7 C;  1G83 A;  1JQQ A;  2KE9 A;  4OML A;  1EFN A;  3H0H A;  4CC3 A;  2CRE A;  2LMJ A;  3UA6 A;  2V1R A;  1UTI A;  1ZSG A;  2JMA A;  2O9V A;  4AFS C;  4RTT A;  3EHR A;  1KJW A;  1PRM C;  1WA7 A;  4RTW A;  1UE9 A;  2EVR A;  2AZS A;  4K11 A;  1KSW A;  5GJW B;  1A0N B;  3I5R A;  1PNJ A;  1Y57 A;  1SRL A;  2EQI A;  3VS2 A;  2EYX A;  2K7A A;  2J05 A;  2W10 A;  2KT1 A;  1M30 A;  4ORZ A;  2LJ1 A;  1JEG A;  3EG0 A;  1YWP A;  3U23 A;  4M4Z A;  3UAT A;  3VS3 A;  3PVL A;  1I0C A;  2YUP A;  2KRO A;  2J6K A;  2GTO A;  2ROL A;  4JPB W;  2F2W A;  2A08 A;  3H0F A;  2J06 A;  1W6X A;  2KNB B;  3A98 A;  5FW9 A;  2DF6 A;  2DBK A;  2C0I A;  2LZ6 B;  2CT3 A;  2KBT A;  1WXT A;  4RTZ A;  4JJC A;  2FPF A;  1RI9 A;  2FO0 A;  3PE0 A;  2K3B A;  2A36 A;  4GLM A;  2F2X A;  4LUD A;  1M27 C;  2J6F A;  4F16 A;  1WLP B;  1PKS A;  1QWF A;  1SPK A;  4J9E A;  4OMN A;  2C0O A;  4OMM A;  2AKL A;  2DRM A;  1NEG A;  1H8K A;  1Z9Q A;  4AFQ C;  1K4U S;  2CSQ A;  2DL8 A;  2AKK A;  2DL3 A;  1K0S A;  2L0A A;  4Z88 A;  4Y92 A;  4OMO A;  1SRM A;  1AZE A;  1U5S A;  2KXD A;  2FEI A;  1AWO A;  2LCS A;  1MV3 A;  1PWT A;  3H41 A;  1T0H A;  1W70 A;  2KRN A;  1E6H A;  2JS2 A;  4D8K A;  4OMP A;  2A37 A;  2RQT A;  5FWC A;  1HJD A;  1J3T A;  1WXB A;  4DEY A;  3QWY A;  2L2P A;  5IHN A;  3RNJ A;  1OEB A;  1WYX A;  2KRM A;  3EHQ A;  4J9G A;  2DL7 A;  2BZX A;  4IIM A;  1B3Q A;  1NEB A;  2GQI A;  4HCK A;  4Z8A A;  1WFW A;  2OJ2 A;  4F17 A;  5L23 A;  2B86 A;  3THK A;  1HSQ A;  2RQU A;  1M3A A;  1QKX A;  3NMZ C;  5IH2 A;  2KXC A;  2LP5 A;  1X6G A;  3R6N A;  2FRY A;  1VYT A;  2D8J A;  2G6F X;  1AOJ A;  2ED0 A;  1FMK A;  2O9S A;  1NLO C;  2V1Q A;  3PVQ A;  3EGU A;  2EGC A;  1WXU A;  2YUO A;  2LQN A;  2O88 A;  1FYN A;  2GNC A;  2GTJ A;  2W0Z A;  3UF4 A;  4HXJ A;  2XMF A;  1H92 A;  3VS6 A;  2HSP A;  1ABO A;  1HD3 A;  1M8M A;  1K0X A;  2F2V A;  4J9H A;  2I0N A;  2FPD A;  2JMC A;  1AVZ C;  4GBQ A;  3M0T A;  2CH4 W;  3SEM A;  5I11 A;  1SSH A;  1ZX6 A;  2PNI A;  1SHF A;  2ECZ A;  2JW4 A;  3VS5 A;  1KFZ A;  1WIE A;  2GBQ A;  1VYV A;  2RN8 A;  1ZUY A;  2L3Q A;  2LQW A;  1T3S A;  2D0N A;  2K2M A;  4WCI A;  2DX1 A;  1QCF A;  1ZBJ A;  1PHT A;  4LUE A;  2ENM A;  2JXB A;  1ZUU A;  2EW3 A;  1X6B A;  1Y0M A;  2KR3 A; 
#chains in the Genus database with same CATH topology
 1PKT A;  1O75 A;  4X1V A;  5GAO p;  3CCU A;  4ZN1 A;  3INZ A;  3OYN A;  2KDS A;  3EG1 A;  4E6R A;  3JCM g;  2KK4 A;  2DL5 A;  2YLB A;  1AD5 A;  4Y28 E;  1TUD A;  3JCM h;  2KGT A;  4DBQ A;  3LGL A;  3D7S B;  4AG1 C;  1JO8 A;  1UGS B;  4OB1 B;  4QT7 A;  1VQ9 A;  2VKN A;  1AWJ A;  2R58 A;  2CT4 A;  3E1S A;  5KYU B;  2HQH A;  3UWN A;  1NPR A;  4UC4 A;  3FJ5 A;  3AHU A;  2NUP B;  1WJQ A;  3WVD B;  1JJ2 A;  2O31 A;  4KGZ B;  2X9H A;  2EAY A;  2BE9 B;  3KUF A;  3JCM c;  1ZUK A;  4B9X A;  2M02 A;  3QSU A;  3GNG A;  2V8K A;  1OV3 A;  2K3Y A;  4HVU A;  1N8R C;  3LH5 A;  2JZ2 A;  3EH2 A;  2FG0 A;  4QW2 A;  1VQ4 Q;  2AT1 B;  2YRD A;  1IHW A;  4E7K A;  2C06 A;  4Z02 A;  2MIO A;  4RUG A;  1Q81 R;  2FL7 A;  2JNG A;  1BI2 A;  1X2K A;  4BI3 A;  4V2S A;  3VJP A;  2VUB A;  2DFU A;  2K4Y A;  5GAN 5;  4E7I A;  5GMK j;  5KCO A;  2WAC A;  3V7S A;  4CC2 A;  4AFZ C;  1OPK A;  2DYI A;  3TSW A;  2M0Y A;  4Z89 A;  4BE2 A;  2FZG B;  3QWX X;  2SRC A;  3SWN C;  4JS4 A;  1M3C A;  3CC7 T;  2VXF A;  1PCX A;  1WQW A;  2LCL A;  4J9D A;  4FT4 A;  4C0D C;  2EGA A;  2QDY B;  1WDX A;  4CC4 B;  2DIQ A;  4M77 E;  4OP0 A;  2PZ1 A;  3FLG A;  3NTH A;  1VQ4 A;  2KMT A;  3EFO A;  3JCM J;  4A4K A;  1M3B A;  3OYD A;  1NJI C;  3SHW A;  2EYQ A;  3UA7 A;  3DLM A;  1K8A C;  4C8Q E;  3CPF A;  1X69 A;  2EJF A;  1EX4 A;  1K1Z A;  1NG2 A;  4II1 A;  5GAO r;  2CP2 A;  1KIK A;  2QTV A;  1UHC A;  1YP5 A;  2KI7 A;  2E64 A;  1M90 R;  1CSK A;  3CC7 Q;  1QKW A;  1XTD A;  1VUB A;  4LDU A;  1KG1 A;  3ZBD A;  5DLO A;  4DQ2 A;  1N9R A;  4ESR A;  4CRI A;  2DD4 A;  1BIB A;  4MDX A;  1R8O B;  2DTO A;  3JSC A;  2DVJ A;  5FWB A;  2JTE A;  2DJQ A;  4N4H A;  1QLY A;  4E7J A;  2EWN A;  3M0Q A;  2WSE E;  3P8B B;  5KYW A;  3OS1 A;  1KHI A;  1H3H A;  1ZLM A;  2MK5 A;  3QZ5 B;  3TEE A;  2LX9 A;  5CKD A;  2EQU A;  5CR2 A;  1N6A A;  4PK4 A;  4O6J A;  4XTV A;  3X28 B;  4A4G A;  4LDW A;  3ZFJ A;  2LDM A;  3M5A A;  4C92 A;  2O01 E;  4LNP A;  2CUD A;  2CDT A;  4KUL A;  1IGQ A;  1RUW A;  1VQM Q;  3CBP A;  3CC7 A;  4RG2 A;  3OYM A;  4ELY C;  2RHI A;  1NYG A;  2CKK A;  3VKI A;  3EFS A;  1Y96 B;  1T0J A;  2EKH A;  2CP0 A;  4M7A D;  2XK0 A;  3OS5 A;  5I22 A;  1VQO T;  4RCC A;  2YDL A;  2LNV A;  2NYS A;  2Y4Y A;  4RTV A;  4PLL A;  2P0K A;  2PTK A;  4QVZ A;  2JM8 A;  3QJY A;  5GAN 4;  3MKD A;  4Q5W A;  2DNU A;  2MI6 A;  3OBW A;  1V76 A;  3RKW A;  2HBW A;  3CC4 Q;  2A3L A;  1AWW A;  2DM1 A;  1U06 A;  4KT0 E;  3JCM b;  1ARK A;  2ZPB B;  5D7U A;  2RHX A;  2CSI A;  4E47 A;  2HL3 A;  3L2V A;  2RI5 A;  2DJZ A;  4J9F A;  5LJ3 d;  1V1C A;  4FW1 A;  3ZL7 C;  2BIV A;  2DD5 A;  3JCM V;  1JQQ A;  2KE9 A;  1KQS P;  4C0F A;  1VQM A;  4M78 F;  3JB9 J;  1ZSG A;  4PJO C;  4AFS C;  3BE3 A;  4M75 G;  2V8I A;  3C95 A;  4A53 A;  1WA7 A;  3G71 Q;  2EVR A;  4E7S A;  4BI4 A;  1RAE B;  5GJW B;  1M1F A;  1PNJ A;  4EMK C;  1Y57 A;  4TVR A;  3OBY A;  3VS2 A;  1UEB A;  3GNF B;  2K7A A;  2W10 A;  1M30 A;  4QVC A;  2CP3 A;  3MO8 A;  4M7D A;  5IN1 A;  3JCM d;  2DIG A;  4C92 F;  2XID A;  3U23 A;  4M4Z A;  5FU7 C;  3VS3 A;  1I0C A;  3MJX A;  2K2V A;  1WQ7 A;  2YUP A;  3P8H A;  3DB3 A;  5AYF A;  4HT9 A;  3FC3 A;  3G6E T;  2J06 A;  1W6X A;  2OTL T;  1VQO A;  3A98 A;  3BFM A;  4O5V A;  2DBK A;  1Q82 C;  2FO0 A;  1QQJ A;  4JRP A;  3G71 A;  2EFI A;  2A36 A;  4GLM A;  5CKE A;  4LUD A;  3SB2 A;  2J6F A;  5GAN 6;  8AT1 B;  4J9E A;  4OMN A;  4J6X A;  2AKL A;  4D6W A;  2K5F A;  1Z9Q A;  1K4U S;  2CSQ A;  2E10 A;  5GAN f;  1U5S A;  4DBR A;  2LCS A;  2DET A;  3LW5 E;  1MV3 A;  1PWT A;  2F5K A;  1OUL A;  3G6E Q;  3TU4 K;  2OTL Q;  5KCH A;  5KYY A;  2A37 A;  3QHS A;  1WXB A;  1VQ5 Q;  4XTX A;  3S3O A;  1OEB A;  3QXE B;  4L5G A;  4LDY A;  4L59 A;  3LWH A;  2FYK A;  1OI1 A;  4IIM A;  1Q81 U;  5LJ3 e;  2H3E B;  4HCK A;  1IHV A;  3T9N A;  2NLU A;  2LCC A;  1UB4 A;  3FIF A;  3HKS A;  2LP5 A;  3CBO A;  2DXT A;  4M7D F;  1G3S A;  2G6F X;  5J26 A;  2VB6 A;  3V8J A;  3OYC A;  2JJ9 A;  1NBE B;  1TXQ A;  2GNC A;  4EPC A;  3M58 A;  2VC8 A;  2GFA A;  2HZY A;  2RHU A;  3ZEH A;  3L2R A;  2FHD A;  4PJO B;  2I0N A;  1AVZ C;  3RMS A;  3SEM A;  2E12 A;  3QKJ A;  3G6E A;  2OTL A;  2PVD B;  3UDC A;  1ZX6 A;  2PNI A;  1SHF A;  3CCL Q;  2IG0 A;  2K57 A;  3JCM e;  4HCB A;  5GMK e;  4EMK B;  3HSB A;  3G7Z A;  4FYW B;  4RG8 A;  2L3Q A;  1T3S A;  2D0N A;  2K2M A;  4M77 C;  2DX1 A;  4M7A A;  1QCF A;  2RK1 A;  1W2B S;  3QBY A;  4LUE A;  3OYH A;  2MF2 A;  3FEO A;  2JXB A;  3L2Z A;  3VV0 A;  4M78 B;  1N9S A;  5CVI A;  4LD6 A;  1WJS A;  2WSC E;  2KR3 A;  3QG1 A;  4C8Q C;  2R57 A;  1DJ7 B;  1JRI A;  1VQL T;  1HYO A;  3VYH B;  1M90 U;  3RER A;  1YN8 A;  3HFO A;  1T3L A;  2KYM A;  4RTU A;  1E6G A;  1MMN A;  2O4X A;  1AWX A;  1K73 U;  2ZAE A;  4JLI A;  2HDA A;  4HT8 A;  1QVF S;  1CKA A;  2QTX A;  2JS0 A;  3MP1 A;  2XDP A;  1B7T A;  1UGQ B;  2DTH A;  2DE0 X;  1R77 A;  5GMK l;  3L2U A;  1VQN Q;  2DRK A;  4KUI A;  3BDL A;  1OX8 A;  5KE3 A;  3CCL A;  5FRO A;  1BIA A;  4XU3 A;  2KAF A;  3UT1 A;  2ED1 A;  4MML A;  2AK5 A;  3I9Q A;  1U8R A;  4A4E A;  2YHT A;  2XI9 A;  4JJB A;  1MV0 B;  1ZSZ A;  3EG3 A;  3C0C A;  3CQT A;  3SD4 A;  3URG A;  2CUB A;  2DYB A;  2ROT A;  2M0O A;  4HCC A;  2HD0 A;  3M57 A;  3CCU T;  1BI1 A;  1C1A A;  2QA4 Q;  3QJ6 A;  1P92 A;  1TH7 A;  3FDR A;  3FJP A;  4ZN3 A;  1LCK A;  1Y7X A;  2EPD A;  4AT1 B;  1UGP B;  2JVV A;  4J9C A;  3EFR A;  1VQ9 T;  2XKO C;  4OGE A;  2RPN A;  5LJ5 f;  3QII A;  2X51 A;  5GAN 8;  4PJO D;  1VQN A;  2CP7 A;  4PLI A;  1UFF A;  3C94 A;  4A63 B;  1X2Q A;  1N5Z A;  3NTK A;  4NS5 A;  5IHI A;  1G2B A;  3M0S A;  2P4R A;  3TRE A;  3P8D A;  2QAZ A;  2QEX Q;  1BCM A;  2XDD A;  2VAS A;  4PJO E;  3EG2 A;  4N0A A;  1JU5 C;  3NGP A;  1LOJ A;  2DXB A;  1UGV A;  4J83 A;  3VS4 A;  3V8L A;  4B9W A;  2RMO A;  2QA4 A;  1AZG B;  1ZA1 B;  2OI3 A;  2X4X A;  4BE0 A;  2OAW A;  2FRW A;  2CZ6 B;  1SKU B;  2MCN A;  1WHK A;  3HRS A;  1I81 A;  1Y71 A;  2X35 A;  1K9M C;  2KRS A;  4F04 B;  3SWN A;  5J3B A;  4M78 E;  1YIJ T;  2A28 A;  1RAB B;  3WVE B;  3EG9 B;  2VVK A;  4MDW A;  3L2W A;  2E4H A;  1QMC A;  4M75 C;  2QI2 A;  3VYG A;  3EGD A;  3OMC A;  2V26 A;  1W2B P;  2X4W A;  2X4Y A;  3OQ5 A;  3CBM A;  2DIL A;  1Q86 C;  2XIC A;  3BW1 A;  2NUZ A;  5DY9 A;  3OYL A;  1UUE A;  4P5N A;  2AIR B;  2EQK A;  3OSV A;  2E70 A;  3OW2 S;  5LJ5 g;  4C92 G;  5GMK h;  2CZ0 B;  2RI3 A;  1OX9 A;  2KEA A;  3PMT A;  1VQ4 T;  2YUN A;  1QVF P;  2QQR A;  1D3B B;  5L8R E;  1GBQ A;  1JXO A;  1TUG B;  1YIJ Q;  2M9U A;  2QGF B;  2EJ9 A;  2M16 A;  4A4H A;  4LE9 A;  3QO3 A;  4AG2 C;  5KYX B;  2KT8 A;  4J9B A;  3CCQ Q;  2XU8 A;  5I2M A;  5CKF A;  1GCQ C;  2A0F B;  1OPL A;  2DZC A;  1GXI E;  4J6Y A;  4HKE A;  1C6V X;  2DER A;  3BY7 A;  2EGE A;  3M53 A;  2DEQ A;  2RNA A;  1KQ1 A;  2NUT A;  3EGX A;  3PGG A;  2E5K A;  2BTT A;  1NLP C;  2PUK B;  2JOY A;  2RQR A;  2I2L A;  2H8H A;  2X3X D;  1BK2 A;  1KQS A;  1WNL A;  4PFP A;  4DEX A;  1D1C A;  2GF7 A;  1Q82 U;  1KC8 C;  3ASK A;  5CO7 A;  2COY A;  1YCY A;  1OZ2 A;  3GBQ A;  1GCP A;  4OMQ A;  1WX6 A;  1NM7 A;  1S72 Q;  4MZT A;  2D1X A;  1YIJ A;  3VUB A;  4OB2 B;  5LJ5 j;  1GRI A;  3CCQ A;  1M1K C;  4M77 D;  1KQS S;  2YXY A;  2RB6 A;  4OMF B;  2ZPE B;  4LXC A;  5HK0 A;  3TSZ A;  2FPE A;  2BZ8 A;  2IVW A;  2FZC B;  4JRQ A;  1IZ6 A;  2RI2 A;  4C8Q D;  4M7D G;  3CCE Q;  1D0Y A;  1EFN A;  5GAO n;  3H0H A;  4CC3 A;  2CRE A;  3HFN A;  3KXT A;  1UTI A;  3QDR B;  4RTT A;  3OYG A;  3S3M A;  4N4I A;  1IGU A;  2BE7 D;  3PFS A;  5FU6 B;  2EQM A;  2QYZ A;  4M75 B;  4XU2 A;  1S72 A;  2ZCF B;  2F5T X;  2AZS A;  2RJD A;  5GAM f;  1KSW A;  3I5R A;  2O4X B;  3GF5 A;  2DEU A;  2EYX A;  4C5I A;  2RD1 A;  2KT1 A;  4ORZ A;  2LJ1 A;  2L3R A;  4LDV A;  1K73 R;  1M4Z A;  3G4S T;  3HRT A;  1VQ7 Q;  1VQM T;  2H3J A;  3PVL A;  1NJI R;  2XDB A;  2Y4X A;  1HK9 A;  2J6K A;  2GTO A;  2ROL A;  2F2W A;  3X24 B;  2A08 A;  2L5Q A;  3CCE A;  2CP6 A;  2G3R A;  3OW2 P;  2DF6 A;  3Q1J A;  4MMK A;  2P0Q A;  2LZ6 B;  1PG5 B;  2FPF A;  1I8F A;  1LVK A;  2K3B A;  1YI2 Q;  2F2X A;  2RK2 A;  1WLP B;  4N4G A;  3CC4 T;  1RAF B;  2DRM A;  1MMD A;  3CCJ T;  3OY9 A;  3G4S Q;  2EIF A;  4OGC A;  4AFQ C;  2DL8 A;  2DL3 A;  4Z88 A;  2QQB A;  1SRM A;  2KXD A;  1AWO A;  2BUD A;  2EQJ A;  1B34 A;  2DO3 A;  1TSF A;  2KRN A;  3QYH B;  1E6H A;  4FYX B;  4D8K A;  4OMP A;  4FT2 A;  1Q7Y C;  2HSE B;  2RQT A;  1HJD A;  1QVP A;  3RNJ A;  1WYX A;  4IUP A;  5GAM g;  3OMG A;  2ZPH B;  1Q95 G;  3G71 T;  1B3Q A;  1PSF A;  1XJW B;  4Z8A A;  2RH2 A;  3CCJ Q;  3HP9 A;  1WFW A;  5L23 A;  2K5I A;  2B86 A;  3THK A;  4E7L A;  1QKX A;  5IH2 A;  2KXC A;  1YI2 A;  1VYT A;  3CCS Q;  1FX7 A;  4M75 D;  2V1Q A;  5HK3 A;  3G4S A;  1KD1 C;  3EGU A;  4M7A G;  1WXU A;  4ATO A;  4JLG A;  1FYN A;  1M2V A;  2GTJ A;  2W0Z A;  5D6X A;  1H92 A;  3GP8 A;  1PD1 A;  3VS6 A;  4DOW A;  3JB9 F;  1YHQ T;  1XNI A;  2CH4 W;  4M75 E;  4AMC A;  4ZGE B;  3DLL A;  1WIE A;  3LH0 A;  2LT4 A;  4PFZ A;  2RN8 A;  4J7I A;  4IKF A;  1BKB A;  1D0X A;  3CC4 A;  5D6Y A;  3RIR A;  3CCJ A;  4NL3 A;  4M78 C;  5GAM j;  1PC0 A;  2ATC B;  4BDZ A;  4F14 A;  1SF9 A;  3CCS A;  1YHQ Q;  1BBZ A;  4LDX A;  3J7A F;  3I56 T;  5FRN A;  4HVW A;  4M77 A;  4E7Z A;  2DPP B;  2KQW A;  5C0M A;  1VQ5 T;  3HPW A;  2DVE A;  1O9S A;  1VIF A;  3CMA Q;  1K76 A;  2GFU A;  4C8Q A;  4QQ6 A;  4C92 C;  2NUT B;  4J9I A;  2GGR A;  2KYB A;  4LN2 A;  4XTW A;  2RQW A;  3KBG A;  3VRZ A;  5EC7 A;  2IPO B;  1NE8 A;  5IHK A;  1IXD A;  2K3X A;  3A8O B;  2XG8 D;  2O2O A;  2PQW A;  2D6F A;  3KFV A;  3I56 Q;  2DXC A;  4C5H A;  1Q82 R;  1QVG S;  2Z0W A;  1YHQ A;  1LNX A;  1BU1 A;  5CKH A;  2FVU A;  3MCA B;  5KYU A;  3HRU A;  3OYF A;  1ZHI A;  4BD3 A;  4C5G A;  2PVO B;  1M2O A;  3LGF A;  1IO6 A;  2J7I A;  4IIO A;  2L3P A;  2NUP A;  4XAX B;  3CCL T;  2HCK A;  1LJO A;  3MHX A;  5IXB A;  3SFM A;  2DA9 A;  2VV5 A;  1VYU A;  4MZM A;  2LC4 A;  3CMA A;  2JTM A;  2X3W D;  4ZNX A;  1AHJ B;  5KYN A;  1CKB A;  1NPP A;  2DMO A;  3A8G B;  4ZGD B;  3IQL A;  2E65 A;  3A5Z B;  7AT1 B;  1W2B A;  1N8R U;  2EJG A;  1VQP T;  3EFO B;  3PNW C;  2HL5 C;  4XU1 A;  1VQ8 T;  3I56 A;  1IB8 A;  2KVQ G;  1YCS B;  3WXM B;  1WHG A;  4C0Z A;  3J80 E;  2LX7 A;  1C0M A;  1VQ5 A;  2RM4 A;  4C0G A;  3X26 B;  4IUQ A;  2YUQ A;  1X43 A;  2F1L A;  1QVF A;  1YNZ A;  4JJN K;  2LJ3 A;  1OQK A;  2EBP A;  5LJ5 e;  1VQN T;  4M7D C;  3VS7 A;  1UHF A;  5GAN g;  4LD9 K;  4EIK A;  1WPY A;  2YSQ A;  5ECA A;  1V29 B;  2QGG A;  4A4F A;  4BDY A;  4DBF A;  2KY9 A;  2WSF E;  4A54 A;  1VQP Q;  2RO0 A;  2RQV A;  1NZ9 A;  2LNH B;  3M54 A;  3X20 B;  2K9G A;  3J81 E;  1VQ8 Q;  5KYW B;  1X27 A;  1MHN A;  3CD6 T;  4NL2 A;  1D1B A;  3NHN A;  4IUR A;  2QA4 T;  2EYW A;  2NWM A;  3M0R A;  3GPL A;  2ZPG B;  2ZGW A;  1NJI U;  2QAS A;  3RKY A;  1K8A U;  1F1B B;  1ACM B;  5FLX E;  4QKU A;  2PU9 B;  4C92 B;  3H0I A;  3MEW A;  3LLR A;  2ZPI B;  4FM4 B;  2JTF A;  4QQG A;  5CIU A;  2K79 A;  2DBM A;  4OB0 B;  1YJW Q;  2HEQ A;  5CAI A;  4FL6 A;  2XHC A;  5LJ3 f;  3GIB A;  2AZV A;  3CD6 Q;  3I35 A;  3NFC A;  2QEX T;  2IIM A;  4KUD K;  1VQP A;  4JZ4 A;  5KH6 A;  2LVM A;  5GAN j;  1VQ6 T;  5CQY A;  4ZTJ A;  2M51 A;  1VQ8 A;  5GAM d;  3A8M B;  2K5L A;  2E3H A;  1JB0 E;  2EKO A;  4RTY A;  3I55 Q;  3FRN A;  4FU6 A;  1RLQ C;  1QVG P;  1GCQ A;  3VS0 A;  2SEM A;  2LJ0 A;  3ME9 A;  2GQV A;  1E7O A;  1TUC A;  3REB B;  3REA B;  4EDU A;  4M7A F;  2J6O A;  4ME7 A;  3RDV A;  4R0K A;  4AFU C;  4GLK A;  3JCM f;  1Z9Z A;  5HKC A;  4FYY B;  1AT1 B;  1OU9 A;  1B07 A;  1MUZ A;  1I07 A;  1WI7 A;  2YRV A;  1Y96 A;  2JM9 A;  1YJW A;  1G3Y A;  1VQ6 Q;  4BB7 A;  1ZBX A;  3CD6 A;  1BB9 A;  5HCK A;  1VQK Q;  2MOX A;  2B8A A;  4FCY A;  4M78 D;  3MPU B;  3TCJ A;  2OTJ Q;  3QUI A;  1QCN A;  1G83 A;  4BY6 B;  1FMV A;  1RAC B;  2BKD N;  2PUO B;  2LMJ A;  4XU0 A;  3V7C A;  4M7D B;  3I55 A;  3PIP A;  2M1H A;  2V1R A;  2HBP A;  3OW2 A;  2MPX C;  3E2U A;  4Y91 A;  1KJW A;  5CQX A;  3CPW S;  3E9G A;  1BI0 A;  1PRM C;  3QYG B;  3JB9 G;  2FB7 A;  5FU6 C;  5GAO q;  4K11 A;  3CCQ T;  2MYS A;  4IUU A;  1A0N B;  1IRE B;  5GAN 7;  3OS0 A;  4C92 D;  5D6W A;  1KD1 U;  3JB9 H;  3L1A A;  3OYY A;  4J7F A;  1RAG B;  2QEX A;  4E2F B;  1YWP A;  1VQ6 A;  4KH1 B;  1VQK A;  2CZ7 B;  3CXC S;  1MND A;  4C92 E;  5LJ5 h;  2OTJ A;  1YFN A;  4JPB W;  3CC2 T;  4F7U A;  1X01 A;  2HKN A;  3LWI A;  1ZSZ C;  5IT9 E;  1MMA A;  2C0I A;  1S72 T;  2CT3 A;  3LX7 A;  1Q86 R;  3E9F A;  2D9T A;  3PE0 A;  5GAM e;  5KYY B;  1YJ9 Q;  3EAE A;  1M27 C;  1PKS A;  1QWF A;  2AHJ B;  3JAM E;  2C0O A;  1NEG A;  1YJN T;  3OB9 A;  1QP2 A;  5GAO m;  2QQA A;  3NTI A;  1Q81 C;  4Y92 A;  4OMO A;  5LJ3 j;  1AZE A;  3A8L B;  3CC2 Q;  1W70 A;  3CCE T;  2JS2 A;  3OYA A;  4IUV A;  1SSF A;  5FWC A;  4FIB A;  1J3T A;  1I5L A;  1IRX A;  3QWY A;  5J39 A;  1OU8 A;  2L89 A;  3EHQ A;  3QDF A;  4HCZ A;  4J9G A;  3EH1 A;  2DL7 A;  3DKM A;  2COW A;  3PIO A;  2CS7 A;  3CME T;  4N0A C;  1YJN Q;  4M7D D;  2OJ2 A;  4F17 A;  1N8R R;  1JJ2 S;  4R56 A;  1YJ9 A;  5A0D A;  4RMO A;  3S6W A;  3PMI A;  3R6N A;  1KC8 R;  3MEA A;  1AOJ A;  3JRZ A;  4C5E A;  1FMK A;  3PVQ A;  2O9S A;  2QG9 B;  2YUO A;  2LQN A;  3CEY A;  1VQ7 T;  2O88 A;  1G5V A;  4HXJ A;  4M7D E;  4M7A B;  4XTY A;  1ZQ1 A;  4VUB A;  2HSP A;  1ABO A;  1HD3 A;  1M8M A;  1K0X A;  5M9O A;  4PJM A;  4XTZ A;  4J9H A;  4GBQ A;  2FPD A;  2JMC A;  5CCA A;  5GAN d;  3M0T A;  3CC2 A;  4F7U F;  1SSH A;  2ECZ A;  1M90 C;  4QQD A;  1M1K R;  4JDS A;  3CME Q;  5CK9 A;  3M55 A;  1KFZ A;  4M77 G;  1K73 C;  2GBQ A;  6AT1 B;  1ZUY A;  1U1T A;  3CPW P;  4KBM B;  4FSX A;  2E1H A;  1YI2 T;  3JCM W;  2LRQ A;  3UPU A;  5I2S A;  1ZBJ A;  1M5Q 1;  3HL8 A;  2LTO A;  4C8Q G;  1YJN A;  2ENM A;  4PJO A;  1TWB A;  1ZUU A;  2EW3 A;  3OYJ A;  3M9Q A;  3E19 A;  3MP8 A;  4J8O A;  4EMK A;  1K8A R;  1SHG A;  3CCR T;  1ZSZ B;  2CH4 A;  1QCO A;  3ULR B;  3CXC P;  3PT9 A;  1I4K 1;  3MEU A;  5A0G A;  4X9C A;  3NPF A;  4M78 A;  2E3I A;  3F70 A;  1EZZ B;  2RHY A;  3LYI A;  4CC7 A;  3VU3 C;  2VXE A;  1M1G A;  3CME A;  4DOV A;  1SG5 A;  3RBB B;  3GLX A;  3MET A;  4PJJ A;  2QQS A;  4JUV A;  3O5Z A;  4RTX A;  3VS1 A;  2MWO A;  1VIE A;  2LQK A;  4D8D A;  5IXF A;  2DLP A;  3CCS T;  4FSS A;  1NYF A;  2YWW A;  1UJ0 A;  4BUG A;  1VQ7 A;  3CCR Q;  2MAM A;  2EYZ A;  3M4Y A;  4JRK A;  2OX7 A;  3RUX A;  4PKC C;  4J6W A;  2P84 A;  2YRC A;  3S3N A;  3BDU A;  1BCO A;  1JBM A;  2YLC A;  2MMP A;  3JCM X;  3TQ7 P;  3M4G A;  1WHH A;  5GAM h;  1RLP C;  2DZ9 A;  3M0U A;  2RJC A;  4RCB A;  3H6Z A;  3JCM P;  3OA6 A;  3PTA A;  3VUZ A;  2ABL A;  3TVT A;  1UDL A;  3SDZ A;  4PJO F;  1X75 C;  5GAN e;  1Q7Y R;  1OOT A;  1JJ2 P;  5KE2 A;  2JN0 A;  4M7A E;  4BE1 A;  2EYY A;  4RKU E;  4IUT A;  4KRT A;  3SWN B;  3HTR A;  1D09 B;  1VA7 A;  4GY5 A;  3CCR A;  3M0P A;  3C12 A;  1ABQ A;  3EGD B;  5A0L A;  4C0D B;  3A8H B;  2RF0 A;  1VQO Q;  1U1S A;  2K6D A;  3CMA T;  3X25 B;  1KD1 R;  2DAQ A;  2DKG A;  4KGX B;  1QW1 A;  3CCM T;  1KK7 A;  2D8H A;  1TG0 A;  5I21 A;  1YIT T;  1W4S A;  3VRY A;  5LJ5 d;  2P4T A;  4FYV B;  4HA8 A;  4JRI A;  3OYB A;  2L3S A;  1H3Z A;  4PFO A;  4F7U B;  2HNI A;  1LPL A;  2P0P A;  1JXM A;  1I1J A;  1G8X A;  2DTI A;  4R55 A;  1K9M U;  4JJD A;  1AEY A;  2QXF A;  2C0T A;  1U3O A;  3L42 A;  2F69 A;  3EG9 A;  1W1F A;  3JV3 A;  5FRM A;  1QVG A;  4EMG A;  3EGX B;  4OB3 B;  1GFD A;  1HXD A;  2R5A A;  3CCM Q;  1M9S A;  1YIT Q;  1PSE A;  2ESW A;  3N5B B;  1Q86 U;  1VOM A;  2XD0 A;  1I5O B;  1EIF A;  2BZY A;  5C6S A;  2QDL A;  2FZK B;  1R0B G;  1YWO A;  1MGQ A;  1MMG A;  3I5S A;  1GFC A;  1GBR A;  1D3B A;  1G3W A;  1SEM A;  1K9A A;  2JT4 A;  2VWF A;  2LT1 A;  5KYX A;  3FB9 A;  4DA4 A;  2HQE A;  4KGV B;  2HQX A;  3QPH A;  1PD0 A;  4HVV A;  1YBY A;  5A2Q E;  2LQ8 A;  5DM7 R;  1RL2 A;  1UEC A;  4WTO B;  2X4J A;  1UG1 A;  1TOV A;  1TS9 A;  1S1N A;  4ELZ C;  2GCX A;  1PRL C;  2CGH A;  1D0Z A;  3CCM A;  3M59 A;  5IAY A;  1GL5 A;  1YIT A;  1QWE A;  3CCV T;  4JZ3 A;  4YTL A;  3DB4 A;  5GJV B;  2YT6 A;  3RKX A;  1FXX A;  1OZ3 A;  2DL4 A;  3O8V A;  3H9N A;  1UJY A;  1KC8 U;  1XOV A;  3MP6 A;  4OF1 A;  4M77 F;  4BI8 B;  2E5Q A;  5HY6 A;  4OML A;  4PJN A;  4MZP A;  4L6V 5;  4BY6 C;  2VGN A;  3MEV A;  1ZA2 B;  2RA2 A;  2CYZ B;  4QVD A;  3UA6 A;  2ZZD A;  4C8Q F;  3V8K A;  1PM3 A;  2JMA A;  2O9V A;  2A7Y A;  3EHR A;  1RAA B;  4E7H A;  3RR6 A;  1M1K U;  2E6Z A;  4RTW A;  5GAN h;  3CCV Q;  1UE9 A;  2E41 A;  4B6M A;  4EMH A;  4F7U G;  2CP5 A;  1YJW T;  1SRL A;  2EQI A;  4F7U E;  4XK8 E;  3C4S A;  1OYX A;  2J05 A;  3G1J A;  3ER0 A;  4PL6 A;  1KHC A;  4PNO A;  1JEG A;  3EG0 A;  1WGS A;  5FU7 B;  3UAT A;  4ANJ A;  4OVA A;  3OYE A;  4M75 A;  3I55 T;  3GOX A;  2QK0 A;  1RI0 A;  2KRO A;  1WHJ A;  3OYI A;  3QZ9 B;  1WHM A;  4XTU A;  5GMK i;  2E6N A;  3H0F A;  2KNB B;  4X9D A;  3RES A;  9ATC B;  5FW9 A;  2D0Q B;  3OS2 A;  5CKB A;  2KBT A;  1WXT A;  8ATC B;  1B34 B;  4RTZ A;  4JJC A;  4PJL A;  2V8J A;  1RI9 A;  4CI0 C;  2COZ A;  4DBH A;  1X6O A;  3CCV A;  2DK3 A;  4F16 A;  1SPK A;  4OMM A;  1H8K A;  2MWP A;  3M56 A;  4J5Y A;  1BYM A;  3OYK A;  1K0S A;  2AKK A;  1RAD B;  2L0A A;  4ZTF A;  1VQK T;  1KQ2 A;  1G3T A;  2L8D A;  1VQL Q;  2FEI A;  2OTJ T;  2DXU A;  3H41 A;  3R6O A;  1T0H A;  2KSS A;  3HHT B;  1FWZ A;  4DEY A;  2RJE A;  2L2P A;  4XQ3 A;  5IHN A;  3A1P A;  1FMW A;  2QQ9 A;  2KRM A;  4X34 A;  5GMK m;  2BZX A;  1Y07 A;  1M2V B;  1N27 A;  1NEB A;  2GQI A;  1MNE A;  1TTH B;  3CPW A;  5GAN 2;  4KH0 B;  1WHL A;  1HSQ A;  2RQU A;  1M3A A;  1UGR B;  3V7R A;  3NMZ C;  1WJR A;  1X6G A;  1Q7Y U;  2FRY A;  2D8J A;  2ED0 A;  5AT1 B;  4WF2 A;  2CZ1 B;  5LL6 S;  1NLO C;  2ZPF B;  3CCU Q;  2EGC A;  3JB9 D;  4PJO G;  2VYT A;  1D1A A;  5DLQ E;  3UF4 A;  2R5M A;  4M75 F;  4M7A C;  1VQL A;  5GAN 3;  2XMF A;  3L2Q A;  2F2V A;  2PVG B;  1TU0 B;  3CXC A;  5I11 A;  1RAI B;  1BI3 A;  2HAX A;  1R0C B;  5LJ3 g;  3AT1 B;  2JW4 A;  2RHZ A;  1VQ9 Q;  1WZO A;  3VS5 A;  4FW2 A;  4JS5 A;  5LJ3 h;  1H64 1;  4BAC A;  1M8V A;  3JCM Q;  2HMA A;  3OSS C;  1VYV A;  3H8Z A;  2LQW A;  1YJ9 T;  4WCI A;  4M77 B;  4NOY A;  4M78 G;  5EG2 A;  2OAU A;  1PHT A;  3RMQ A;  4ZGJ B;  1XQH A;  1X6B A;  5GAO l;  1RAH B;  2JUF A;  2HKQ B;  1QP3 A;  1K9M R;  1Y0M A;  3JB9 I;  4C8Q B;  2Y90 A;  2RJF A;  2VGM A; 
#chains in the Genus database with same CATH homology
 4F14 A;  1YN8 A;  1PKT A;  1T3L A;  2KYM A;  4RTU A;  1BBZ A;  1E6G A;  4X1V A;  1AWX A;  1SHG A;  2HDA A;  3EG1 A;  4HVW A;  4E6R A;  2CH4 A;  1CKA A;  3ULR B;  2JS0 A;  2DL5 A;  1AD5 A;  1TUD A;  2DE0 X;  2KGT A;  3NPF A;  4AG1 C;  1K76 A;  2DRK A;  1JO8 A;  4CC7 A;  4QT7 A;  4J9I A;  2VKN A;  2GGR A;  2KYB A;  4LN2 A;  3RBB B;  1AWJ A;  2ED1 A;  2RQW A;  3VRZ A;  5EC7 A;  2CT4 A;  2AK5 A;  5IHK A;  3I9Q A;  3O5Z A;  3FJ5 A;  4JJB A;  4RTX A;  1MV0 B;  3VS1 A;  2O2O A;  3EG3 A;  3C0C A;  3CQT A;  4D8D A;  5IXF A;  2CUB A;  2DYB A;  2DLP A;  2O31 A;  2ROT A;  4FSS A;  1NYF A;  1UJ0 A;  3KFV A;  1ZUK A;  2EYZ A;  1OV3 A;  1BU1 A;  4HVU A;  3LH5 A;  1LCK A;  1IO6 A;  2EPD A;  2FG0 A;  2J7I A;  4IIO A;  2L3P A;  4J9C A;  1RLP C;  2HCK A;  2MIO A;  2RPN A;  4RUG A;  5IXB A;  2DA9 A;  1VYU A;  1X2K A;  3M0U A;  1UFF A;  2X3W D;  4ZNX A;  2ABL A;  3TVT A;  4A63 B;  1UDL A;  1CKB A;  1X2Q A;  1N5Z A;  2DMO A;  5IHI A;  1G2B A;  3IQL A;  3M0S A;  1OOT A;  2P4R A;  4CC2 A;  4AFZ C;  1OPK A;  3TSW A;  2EYY A;  2M0Y A;  4Z89 A;  4KRT A;  3QWX X;  2SRC A;  3EG2 A;  1JU5 C;  3NGP A;  1UGV A;  1M3C A;  3VS4 A;  1VA7 A;  1YCS B;  3M0P A;  2RMO A;  1ABQ A;  2LX7 A;  4J9D A;  1AZG B;  2YUQ A;  2OI3 A;  2RF0 A;  2EGA A;  2OAW A;  2FRW A;  1X43 A;  1WDX A;  2MCN A;  4CC4 B;  1YNZ A;  2LJ3 A;  2EBP A;  2K6D A;  2PZ1 A;  3VS7 A;  1UHF A;  2KRS A;  1M3B A;  4EIK A;  2A28 A;  3SHW A;  2YSQ A;  5ECA A;  2D8H A;  1TG0 A;  2VVK A;  3UA7 A;  3VRY A;  1X69 A;  1K1Z A;  1NG2 A;  2RQV A;  1KIK A;  2LNH B;  1UHC A;  1YP5 A;  2K9G A;  2L3S A;  1X27 A;  1CSK A;  2DIL A;  1QKW A;  1JXM A;  1I1J A;  3NHN A;  2NUZ A;  1UUE A;  2EYW A;  4JJD A;  2NWM A;  3M0R A;  1AEY A;  2C0T A;  1U3O A;  4ESR A;  5FWB A;  1W1F A;  2DVJ A;  3JV3 A;  2JTE A;  2DJQ A;  2KEA A;  1QLY A;  2YUN A;  1GBQ A;  3M0Q A;  3H0I A;  1JXO A;  1GFD A;  4LE9 A;  1H3H A;  4AG2 C;  1ZLM A;  2ESW A;  2KT8 A;  2K79 A;  4J9B A;  2DBM A;  2BZY A;  2HEQ A;  2QDL A;  1GCQ C;  1OPL A;  2AZV A;  1YWO A;  3I35 A;  2IIM A;  3I5S A;  1GFC A;  4JZ4 A;  2EGE A;  1GBR A;  2RNA A;  4LNP A;  2CUD A;  2CDT A;  1SEM A;  1RUW A;  2E5K A;  2M51 A;  2BTT A;  1K9A A;  1NLP C;  2RQR A;  2JT4 A;  2VWF A;  2H8H A;  2X3X D;  1NYG A;  1BK2 A;  4RTY A;  4DEX A;  1T0J A;  1RLQ C;  2EKH A;  1GCQ A;  4HVV A;  3VS0 A;  2SEM A;  2LJ0 A;  5I22 A;  1UEC A;  2YDL A;  1E7O A;  3GBQ A;  1TUC A;  1GCP A;  1UG1 A;  4OMQ A;  4RTV A;  3REA B;  3REB B;  1WX6 A;  1NM7 A;  2D1X A;  1S1N A;  2J6O A;  2PTK A;  1PRL C;  2JM8 A;  4R0K A;  4AFU C;  2DNU A;  1GL5 A;  1Z9Z A;  1QWE A;  4JZ3 A;  2HBW A;  5GJV B;  1B07 A;  2YT6 A;  1AWW A;  2DM1 A;  1U06 A;  1MUZ A;  1GRI A;  1I07 A;  1WI7 A;  2JM9 A;  1ARK A;  2DL4 A;  2CSI A;  1UJY A;  1BB9 A;  5HCK A;  1XOV A;  2MOX A;  4J9F A;  3TSZ A;  2FPE A;  2BZ8 A;  1V1C A;  3ZL7 C;  1G83 A;  1JQQ A;  2KE9 A;  4OML A;  1EFN A;  3H0H A;  4CC3 A;  2CRE A;  2LMJ A;  3UA6 A;  2V1R A;  1UTI A;  1ZSG A;  2JMA A;  2O9V A;  4AFS C;  4RTT A;  3EHR A;  1KJW A;  1PRM C;  1WA7 A;  4RTW A;  1UE9 A;  2EVR A;  2AZS A;  4K11 A;  1KSW A;  5GJW B;  1A0N B;  3I5R A;  1PNJ A;  1Y57 A;  1SRL A;  2EQI A;  3VS2 A;  2EYX A;  2K7A A;  2J05 A;  2W10 A;  2KT1 A;  1M30 A;  4ORZ A;  2LJ1 A;  1JEG A;  3EG0 A;  1YWP A;  3U23 A;  4M4Z A;  3UAT A;  3VS3 A;  3PVL A;  1I0C A;  2YUP A;  2KRO A;  2J6K A;  2GTO A;  2ROL A;  4JPB W;  2F2W A;  2A08 A;  3H0F A;  2J06 A;  1W6X A;  2KNB B;  3A98 A;  5FW9 A;  2DF6 A;  2DBK A;  2C0I A;  2LZ6 B;  2CT3 A;  2KBT A;  1WXT A;  4RTZ A;  4JJC A;  2FPF A;  1RI9 A;  2FO0 A;  3PE0 A;  2K3B A;  2A36 A;  4GLM A;  2F2X A;  4LUD A;  1M27 C;  2J6F A;  4F16 A;  1WLP B;  1PKS A;  1QWF A;  1SPK A;  4J9E A;  4OMN A;  2C0O A;  4OMM A;  2AKL A;  2DRM A;  1NEG A;  1H8K A;  1Z9Q A;  4AFQ C;  1K4U S;  2CSQ A;  2DL8 A;  2AKK A;  2DL3 A;  1K0S A;  2L0A A;  4Z88 A;  4Y92 A;  4OMO A;  1SRM A;  1AZE A;  1U5S A;  2KXD A;  2FEI A;  1AWO A;  2LCS A;  1MV3 A;  1PWT A;  3H41 A;  1T0H A;  1W70 A;  2KRN A;  1E6H A;  2JS2 A;  4D8K A;  4OMP A;  2A37 A;  2RQT A;  5FWC A;  1HJD A;  1J3T A;  1WXB A;  4DEY A;  3QWY A;  2L2P A;  5IHN A;  3RNJ A;  1OEB A;  1WYX A;  2KRM A;  3EHQ A;  4J9G A;  2DL7 A;  2BZX A;  4IIM A;  1B3Q A;  1NEB A;  2GQI A;  4HCK A;  4Z8A A;  1WFW A;  2OJ2 A;  4F17 A;  5L23 A;  2B86 A;  3THK A;  1HSQ A;  2RQU A;  1M3A A;  1QKX A;  3NMZ C;  5IH2 A;  2KXC A;  2LP5 A;  1X6G A;  3R6N A;  2FRY A;  1VYT A;  2D8J A;  2G6F X;  1AOJ A;  2ED0 A;  1FMK A;  2O9S A;  1NLO C;  2V1Q A;  3PVQ A;  3EGU A;  2EGC A;  1WXU A;  2YUO A;  2LQN A;  2O88 A;  1FYN A;  2GNC A;  2GTJ A;  2W0Z A;  3UF4 A;  4HXJ A;  2XMF A;  1H92 A;  3VS6 A;  2HSP A;  1ABO A;  1HD3 A;  1M8M A;  1K0X A;  2F2V A;  4J9H A;  2I0N A;  2FPD A;  2JMC A;  1AVZ C;  4GBQ A;  3M0T A;  2CH4 W;  3SEM A;  5I11 A;  1SSH A;  1ZX6 A;  2PNI A;  1SHF A;  2ECZ A;  2JW4 A;  3VS5 A;  1KFZ A;  1WIE A;  2GBQ A;  1VYV A;  2RN8 A;  1ZUY A;  2L3Q A;  2LQW A;  1T3S A;  2D0N A;  2K2M A;  4WCI A;  2DX1 A;  1QCF A;  1ZBJ A;  1PHT A;  4LUE A;  2ENM A;  2JXB A;  1ZUU A;  2EW3 A;  1X6B A;  1Y0M A;  2KR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...