4RTVA

Crystal structure of the src tyrosine kinase sh3 domain s94a/q128r mutant in complex with the high affinity synthetic peptide app12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
b'MTFVALYDYEARTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the Src tyrosine kinase SH3 domain S94A/Q128R mutant in complex with the high affinity synthetic peptide APP12
rcsb
source organism Gallus gallus
molecule tags Protein binding, signaling protein
total genus 13
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtvA00
1ZUKA 2A36A 1AOJA 3RNJA 4RTXA 4CC7A 2EVRA 4RTYA 1M3CA 2MIOA 2YT6A 2L2PA 1QWFA 2J05A 1UG1A 1UJYA 1YNZA 2ED1A 1ZLMA 2RNAA 4WCIA 2CH4W 4J9BA 2G6FX 1QLYA 1IO6A 2K79A 2VVKA 2M51A 1WDXA 4OMLA 3UA6A 1OPKA 1YWPA 1GFDA 1N5ZA 1OPLA 4LN2A 1SHFA 5GJWB 3ULRB 2W0ZA 4LNPA 3UF4A 2L3QA 1UJ0A 2F2VA 3RBBB 2L3SA 5I22A 4JJCA 4RTUA 1ZX6A 1AEYA 2JW4A 3PVQA 4JJDA 1ZSGA 2JM9A 2KXDA 4EIKA 2DBKA 1PRMC 3QWXX 2CSQA 2RQVA 1X43A 5IH2A 3GBQA 3VS1A 4JZ3A 1GRIA 3EHQA 1EFNA 2E5KA 4KRTA 2O31A 2RQUA 4LUDA 5IHIA 1WXBA 1VYTA 3CQTA 4RTWA 2V1RA 2GQIA 2CUBA 3ZL7C 2LJ1A 1JQQA 1FYNA 1WI7A 1WFWA 2D8HA 2HDAA 4Z8AA 1H92A 5IHNA 1TUCA 4J9HA 1LCKA 2ENMA 2CH4A 2QDLA 2DRKA 1T0HA 1JXOA 2VKNA 1ZUUA 1HSQA 3PE0A 1M8MA 1OEBA 3U23A 2OJ2A 4HCKA 2A28A 3REAB 2RPNA 3H0IA 5EC7A 5I11A 1AZEA 3EG2A 1YWOA 1VYUA 1K9AA 2YDLA 4J9EA 4IIOA 1X2KA 2PNIA 1YP5A 5FWBA 3VS0A 1JO8A 1WYXA 4ZNXA 1OOTA 1AWJA 2AKKA 4J9FA 1AZGB 2AZSA 3TVTA 1NM7A 3EG1A 1T3LA 1Y0MA 1KIKA 1WXUA 1XOVA 2ED0A 4QT7A 4Y92A 4OMOA 3LH5A 2EYZA 2DF6A 1B3QA 1PKSA 2PTKA 3I9QA 1W1FA 2OI3A 1G83A 4D8DA 1UFFA 2FRWA 1M30A 2J6FA 2LP5A 2DL4A 3M0PA 2F2WA 4J9GA 2FO0A 1JU5C 2FPFA 4AG2C 1RI9A 3EG0A 2FEIA 2XMFA 1MUZA 1UGVA 2H8HA 3VRYA 1AWWA 5FWCA 1E6HA 2JM8A 3UA7A 4OMMA 2GGRA 2DILA 3PVLA 2EW3A 2B86A 2DX1A 2AK5A 2ECZA 2X3XD 1ABOA 2HCKA 4AFQC 2KT8A 1UDLA 1H3HA 2LQWA 2KRMA 2JS0A 4IIMA 2LCSA 3VS6A 4M4ZA 2DMOA 4LUEA 4ORZA 3SHWA 4CC2A 5L23A 1K0SA 1A0NB 2KNBB 1X6GA 1HJDA 1U06A 3VRZA 1PRLC 1GCPA 4K11A 2KRSA 4J9DA 1BB9A 2D1XA 2EGEA 3EG3A 2KYBA 2A08A 2JTEA 1WX6A 1JXMA 1Z9QA 2YSQA 4Z88A 2C0TA 3O5ZA 1NEGA 2W10A 1I1JA 1Y57A 2O9SA 3EGUA 3M0SA 1KJWA 4F17A 1HD3A 1SEMA 1QCFA 1UUEA 3M0RA 1RLQC 2EYXA 2K2MA 3JV3A 2KROA 4DEXA 3M0UA 4F16A 2RF0A 3I35A 2EGAA 3NHNA 1YCSB 1X27A 1I07A 2DM1A 1GFCA 1M27C 4HVUA 1SSHA 3C0CA 5GJVB 2CDTA 2O2OA 1QKXA 1E7OA 4F14A 1B07A 1AWOA 2SEMA 4D8KA 1GBQA 1U3OA 1W70A 2M0YA 1K1ZA 3NPFA 2HBWA 1CSKA 1S1NA 1PKTA 2DL5A 4RTTA 1ZUYA 2DNUA 2DL8A 3TSZA 2LX7A 4JZ4A 1X2QA 1CKBA 2CT3A 1PWTA 4RTVA 3SEMA 2AKLA 4A63B 2PZ1A 4CC4B 1E6GA 1NG2A 2C0OA 3H41A 2DL7A 2BZ8A 2D0NA 1T0JA 1WA7A 3REBB 4ESRA 1KFZA 5IHKA 4RTZA 2MCNA 2DE0X 4CC3A 4E6RA 1X6BA 1PHTA 2NWMA 1OV3A 2KT1A 1K0XA 1T3SA 1K4US 1AWXA 3M0TA 2L3PA 1NLPC 3VS5A 4AG1C 2CUDA 3KFVA 2EQIA 2YUOA 5HCKA 2DVJA 4HVVA 5ECAA 1RLPC 2RMOA 2CT4A 2EYWA 1J3TA 2JMAA 2LMJA 1UHCA 2C0IA 1GCQA 1NEBA 2V1QA 2BZYA 2ABLA 1NLOC 1U5SA 2K3BA 1UHFA 2DBMA 4GBQA 2EGCA 4J9CA 1G2BA 2KGTA 1AD5A 4GLMA 2EPDA 1NYFA 2ROLA 2CSIA 2O9VA 1UE9A 1VA7A 1V1CA 1AVZC 4OMPA 1QKWA 2KBTA 3I5SA 1VYVA 1QWEA 2EYYA 5IXFA 3H0FA 2BTTA 2YUPA 4AFUC 2AZVA 1Z9ZA 1YN8A 2GTOA 3M0QA 2GNCA 1UTIA 1H8KA 1MV3A 2D8JA 4J9IA 1ABQA 4R0KA 1SPKA 4OMQA 2K9GA 2EBPA 2MOXA 1JEGA 1I0CA 1X69A 2J6KA 2A37A 2FPDA 4HXJA 4JPBW 1MV0B 4RUGA 3NGPA 2DA9A 1UECA 1SRMA 2RQTA 2DYBA 1BU1A 2J7IA 2L0AA 2I0NA 1TUDA 2J6OA 4FSSA 2P4RA 2LNHB 2DLPA 2HEQA 1NYGA 3VS4A 2KE9A 1WXTA 3R6NA 1ZBJA 2EKHA 1M3AA 2KRNA 1GCQC 4OMNA 3H0HA 2BZXA 4AFZC 1SRLA 2J06A 3QWYA 2DL3A 1K76A 1TG0A 3NMZC 1RUWA 1GL5A 2JXBA 1KSWA 1W6XA 3EHRA 1BBZA 3VS7A 4LE9A 2NUZA 4JJBA 4Z89A 1FMKA 2LQNA 1M3BA 4AFSC 1PNJA 2ESWA 2KYMA 2LZ6B 2RQRA 4DEYA 2IIMA 2FRYA 2LJ3A 1SHGA 4X1VA 2FG0A 3VS3A 2O88A 2X3WD 1GBRA 2LJ0A 2F2XA 2CREA 2HSPA 2DRMA 1BK2A 5IXBA 2DJQA 1WIEA 3VS2A 2KXCA 2YUQA 2K6DA 2KR3A 4HVWA 2RQWA 3IQLA 2SRCA 2GBQA 3FJ5A 5FW9A 2JMCA 2RN8A 2GTJA 3A98A 1WLPB 2OAWA 2JT4A 1CKAA 3THKA 1ARKA 2JS2A 2KEAA 2ROTA 2YUNA 2FPEA 2VWFA 3UATA 3I5RA 2K7AA 3TSWA
chains in the Genus database with same CATH superfamily
1ZUKA 2HQEA 3PT9A 1IXDA 1I81A 4RTYA 1Y07A 3CC2A 2L2PA 4RMOA 3M5AA 1YNZA 2RNAA 4WCIA 4FL6A 3CCUT 1TU0B 4E47A 2QXFA 2ZGWA 2K79A 1IO6A 3CXCA 5GANf 1OPKA 1YWPA 2CS7A 1QCOA 1Q86U 1XNIA 5GJWB 3L2WA 1Q81U 1BCMA 4OMFB 4F7UF 1I8FA 4NOYA 1M1FA 5A0GA 4EIKA 2LC4A 2JM9A 3CCEQ 4M78D 2CSQA 1C6VX 2K3XA 2RQVA 3QSUA 1X43A 4WTOB 4M78E 3JCMb 2M0OA 3I55T 1YITA 4M77G 4KRTA 3F70A 1LPLA 2CUBA 1FYNA 1WFWA 4C92A 1I5LA 1X6OA 1QVFP 1LCKA 2ATCB 3OYFA 2YXYA 3SFMA 4HCBA 3CC2T 1VQ8Q 4F7UB 1JXOA 1SSFA 2VKNA 1K8AR 1M8MA 5AT1B 3C94A 2VV5A 4HCKA 1O75A 3H0IA 2LRQA 1D0XA 2RHZA 5EC7A 1YJ9T 1R0CB 1K8AC 3EG2A 5D6XA 1VQ4Q 1K9AA 2EJ9A 5CQYA 3JCMh 3VS0A 1K73U 4HCZA 1AWJA 4J9FA 1AT1B 2RK1A 3TVTA 3QKJA 3GNGA 3V8JA 3EG1A 4XTUA 2DIQA 3CD6Q 3JCMe 4N4HA 4Y92A 3E19A 5LJ3e 1W4SA 2DF6A 1YITT 2OI3A 2J6FA 2LP5A 4FIBA 4DA4A 2YLCA 2FO0A 2FPFA 2M16A 3EG0A 5HKCA 4C92C 2XMFA 2CP6A 2H8HA 1D0ZA 2DPPB 1E6HA 1G3YA 1D3BA 1R77A 1TH7A 2JM8A 4OMMA 1GXIE 2X9HA 2GGRA 3OQ5A 1YI2T 3PVLA 3L1AA 2EW3A 2B86A 1QP2A 3UT1A 2DX1A 1EX4A 2X3XD 4OB2B 1MMNA 1JRIA 1ZQ1A 4IIMA 2CP5A 3VS6A 2OAUA 5GAOl 2DYIA 2DMOA 1AHJB 4CC2A 3OS0A 1U06A 3VRZA 4DOWA 1GCPA 3LGFA 2KYBA 2JTEA 1WX6A 1Z9QA 2OTJT 4MMLA 1Y57A 3MP6A 2O9SA 2L5QA 3CBPA 4EPCA 1M2OA 3LGLA 3EFOA 1QCFA 1UUEA 3M0RA 4M77A 3X26B 2DEUA 2XK0A 4J5YA 2FZGB 2EYXA 4C92B 2KROA 4PK4A 2VB6A 3MO8A 1IHVA 2RF0A 3OYYA 2CP0A 1NPRA 1N9RA 1IGUA 1X27A 1I07A 1S72Q 3CBOA 3JCMf 3JRZA 3A8MB 1V29B 4PLLA 1AWOA 3OYMA 4M7DA 4M75F 1W70A 3UDCA 3EGDA 2M0YA 2P0KA 2JUFA 2CP3A 3FDRA 3HHTB 1QVPA 1KQ1A 3M55A 2AHJB 1G3SA 4N0AA 1M1KU 2V8KA 4UC4A 4PFPA 1PWTA 4JRQA 2LCCA 4M7AG 4LD6A 4RTVA 2GQVA 2CZ6B 2AKLA 3CMET 1OI1A 3NFCA 4CC4B 4PJNA 3CPFA 3X28B 1NG2A 2C0OA 2DL7A 2E41A 1T0JA 1OU9A 3L2RA 4ESRA 1ZA1B 2PUKB 4M77C 2MCNA 4V2SA 4N4IA 4CC3A 4BE0A 3J81E 2GFUA 2JOYA 2NWMA 4YTLA 1WJQA 2E70A 1QCNA 3OYCA 1D3BB 2WSEE 4LXCA 2K2VA 4MZTA 3H8ZA 5GAOq 3GPLA 1J3TA 3X24B 2LMJA 3JCMd 4M7DC 1NEBA 1K9MC 2BZYA 4OP0A 5LJ3d 1RAAB 1HXDA 2EGCA 4PJOG 4KULA 4ATOA 2F5TX 1VQ6Q 3G1JA 1AD5A 4GLMA 2EPDA 1NYFA 1K9MU 1SG5A 1X01A 2ROLA 8ATCB 2V8IA 1VA7A 2RM4A 3FB9A 1QP3A 3CCMT 4OMPA 1QKWA 1KQSP 4ME7A 2CZ1B 5IXFA 3H0FA 2BTTA 2CZ0B 4N0AC 4E7HA 3QZ9B 3CCRA 2R5AA 2JTMA 1H8KA 2Z0WA 4M77B 2D8JA 2D0QB 2XICA 2K9GA 4OMQA 3G6ET 1N27A 3L2UA 1JEGA 1I0CA 4JPBW 3NGPA 2DA9A 3OYDA 1SRMA 2MWOA 1BU1A 5KYUA 2J7IA 3OW2S 4JS4A 1X75C 4M7DB 4FSSA 3CCJQ 3EGDB 1OX8A 4ZTJA 1BYMA 1LNXA 3CCSA 3A8LB 2YRDA 3O8VA 4ZGEB 3H0HA 1SRLA 3CEYA 2DO3A 2DL3A 1P92A 1GL5A 2JXBA 5KYWA 4M78G 3EHRA 1UGSB 3OYEA 2KVQG 1VQMA 3EFSA 4FYWB 1PG5B 3OSVA 4M7AA 2KYMA 2QEXT 1TUGB 2RQRA 2KQWA 1H641 2HQHA 2PU9B 2VYTA 3VU3C 2FG0A 3FEOA 3BW1A 1B34A 4KH1B 9ATCB 4FM4B 2HSPA 2XHCA 3T9NA 4C0DC 1WIEA 2RJCA 3G4SQ 4B6MA 2K6DA 3QO3A 2O4XA 1YIJA 1G8XA 3IQLA 2JMCA 4KGXB 2VASA 2P0PA 1SKUB 3VYHB 3THKA 3CC4A 2JS2A 1NE8A 2BKDN 4LDUA 4MDXA 2QASA 3CCST 3GOXA 2K7AA 2WSCE 5CCAA 3TSWA 2A36A 4PJOA 3E9FA 3NTIA 2QAZA 3S3MA 2EVRA 4VUBA 2VGMA 2MIOA 2GFAA 5AYFA 1UG1A 1W2BS 1RABB 1VQMT 3A8OB 4XTXA 1NPPA 4J9BA 3LWHA 1QLYA 2VVKA 1WDXA 1OU8A 4BY6C 1N5ZA 3JCMP 2JTFA 4M7AC 3E2UA 1OPLA 1QVFA 2EIFA 4C0DB 3ULRB 2EKOA 4LNPA 4OVAA 1UGPB 2MYSA 3RBBB 3L2VA 1VQ7Q 3VJPA 3OYAA 5FU6C 7AT1B 2EFIA 2JW4A 4JJDA 1ZSGA 4JRIA 1U8RA 2DBKA 2E3HA 1PRMC 1UGQB 3QWXX 5LJ5e 4JLGA 3LH0A 3GBQA 1M2VA 1KHIA 3VS1A 4JZ3A 3QYHB 4FW2A 4A4GA 1GRIA 2E5KA 3TQ7P 4B9XA 2JZ2A 3C95A 1WXBA 5IHIA 1VYTA 4RTWA 2BIVA 1C0MA 2MPXC 3OYGA 3P8HA 1MMAA 2D8HA 1Q82U 2QA4Q 2DIGA 5IHNA 3CCRQ 1EZZB 3HPWA 4PJOC 4LD9K 3N5BB 3SD4A 2ENMA 6AT1B 4LDVA 3RMSA 3OA6A 3MP1A 4KH0B 3CPWS 1V76A 4M78A 3EH1A 1VQNQ 4BY6B 1IHWA 2P0QA 1VQ9Q 2PQWA 1XTDA 4C5IA 4M7AB 1ZUUA 4FCYA 2A28A 3REAB 1AZEA 1B34B 5FU6B 2YDLA 2WACA 5GAN8 1QVGP 4XTZA 2CP7A 2NLUA 1WYXA 1N8RR 3L2QA 3QPHA 1KQ2A 4C8QD 4BB7A 1WXUA 3HP9A 4OMOA 5CK9A 5J26A 1PKSA 3I9QA 1VQ5A 2R58A 2HNIA 1G83A 4D8DA 2COZA 2K57A 2FRWA 1Y71A 4PJOB 1JU5C 1M90R 1Y7XA 3AHUA 4GY5A 2FEIA 3TREA 1VQ4T 2R57A 1PD1A 1UGRB 3PFSA 2YWWA 3D7SB 5LJ5f 3OYIA 3UA7A 3S3OA 2MK5A 2DILA 1YJWT 3CCVA 4M78C 3JAME 3ZBDA 2YRVA 1VIEA 5LJ3j 3JB9J 1ABOA 3CD6T 5KYYB 2KT8A 1YIJQ 2JS0A 2IG0A 4E7IA 1YJ9A 1VQOQ 3JCMX 3JB9H 5GMKi 2RHUA 4HT8A 3OB9A 2KSSA 3SHWA 5KYXA 5IAYA 1Q81R 3UPUA 1X6GA 1HJDA 2FHDA 3JCMg 1BB9A 3HKSA 5LJ3g 1M2VB 1BIBA 2A08A 2YSQA 4DBQA 1OULA 2W10A 3EGUA 1M5Q1 1VQ5T 3EGXA 4KGZB 5GAOn 2QQSA 1RLQC 4KT0E 2K2MA 3JV3A 1WHLA 4OB1B 4QQDA 1G5VA 3ZEHA 1UEBA 4BUGA 4PJJA 3DB4A 3I56Q 1YCSB 2IVWA 4M78B 3OYHA 2LT4A 4X34A 5GAN3 3EG9A 1WJRA 4A54A 2O2OA 3M9QA 3CCVT 5LJ5d 3GF5A 1B07A 4F7UE 2A3LA 1YI2A 4HT9A 4D8KA 4J7FA 1GBQA 2EQUA 2QGGA 2D6FA 5FROA 4RCBA 1K1ZA 1S1NA 2CGHA 2E12A 2L3RA 4OGCA 2HZYA 3J80E 2DNUA 5C0MA 3M53A 5CQXA 3CXCS 1WHMA 2DL8A 5LJ3h 3TCJA 4CI0C 1K8AU 2OX7A 4PJMA 4ZTFA 1NJIR 2NYSA 3JB9F 3LWIA 2YLBA 1RL2A 1RACB 1KC8R 1NJIC 4J6XA 1BCOA 4A63B 5HY6A 3OY9A 2OTJA 4NS5A 3SWNA 2LTOA 2RHIA 4J8OA 1KFZA 4FYVB 2VXEA 5CKDA 2KDSA 4RTZA 5IHKA 2QQBA 2DE0X 3CCUQ 1KQSA 1OV3A 1KK7A 1T3SA 1K4US 1AWXA 3M0TA 5GMKm 1NLPC 3VS5A 2EQIA 3G71Q 2DVJA 4BACA 2X35A 3A8HB 4HVVA 4PFOA 5A0LA 1RLPC 2ZPIB 2RMOA 5GAOm 1YJNQ 4C92F 8AT1B 2C0IA 1GCQA 4XU1A 2K3BA 2M9UA 1NLOC 1U5SA 3VUBA 2XU8A 3H9NA 1G2BA 3JCMc 2OTLA 1OZ2A 2KGTA 3WVEB 2QQAA 4ZGDB 4JJNK 2O9VA 1YBYA 5KCOA 2XDDA 1QWEA 3QJ6A 4EMHA 3I55Q 2EYYA 2P4TA 4AFUC 2FVUA 1YN8A 3ME9A 3OYBA 3M0QA 2C06A 1UTIA 3EGXB 3CMEA 4ELYC 2DD4A 2O01E 4R0KA 3MEVA 2DTIA 3CC2Q 3SWNC 3HRUA 1PSEA 3JB9I 1YHQT 2MOXA 2CKKA 2DXTA 2QTXA 2A37A 2LQKA 4HXJA 3KBGA 4XU0A 3X20B 3FRNA 3KXTA 1JJ2A 2I0NA 3URGA 1YJ9Q 2DLPA 1KD1R 2P84A 3VS4A 5LJ3f 2XDPA 3JCMW 2E1HA 4BDZA 4IURA 2EKHA 1WQ7A 4Y28E 1M3AA 5CVIA 3CMAT 1GCQC 2E4HA 2OTLT 2JJ9A 1BI1A 5DY9A 1TSFA 4AFZC 2J06A 3QWYA 1K76A 1H3ZA 3M4YA 1EIFA 4C5EA 3UWNA 2NUZA 1YITQ 2FB7A 3DLMA 4JJBA 3CCMA 4IUVA 2LQNA 5GAMe 1PNJA 1M1KR 2ESWA 3SWNB 2LZ6B 5D7UA 1I4K1 2FRYA 2LJ3A 4ZN1A 4JRPA 5IN1A 3CCLT 4M75D 4Y91A 4R55A 2X3WD 2BUDA 1GBRA 4E7LA 4IUQA 3G6EA 1BK2A 5GAOr 2KXCA 4M75E 1YI2Q 3FJPA 3PTAA 2MAMA 3V7SA 2ZZDA 2VXFA 4HVWA 1TWBA 2JN0A 2EJGA 2SRCA 3CC7A 3FJ5A 2EQJA 3QUIA 4M77F 1VQLA 3V8LA 1WLPB 2L8DA 2JT4A 1CKAA 1QQJA 1BKBA 3PGGA 5CKBA 3OYJA 2EQKA 2MWPA 1PCXA 2GCXA 4JUVA 3GLXA 3RNJA 4RTXA 4BE1A 3OS5A 1M3CA 2QQRA 4O5VA 2YT6A 1PM3A 1KHCA 2J05A 3Q1JA 4M7DF 1UJYA 1ZLMA 1WHHA 4C8QG 4QVCA 3QG1A 2CH4W 4R56A 2K5LA 2G6FX 3LYIA 1YFNA 2M51A 3UA6A 1GFDA 4F04B 3EFOB 2QEXA 1VQPA 1SHFA 2HL3A 3PIOA 2L3QA 4XU2A 1UJ0A 2DXBA 2F2VA 2FZCB 1OYXA 2L3SA 5I22A 1RADB 4GLKA 4JJCA 4RTUA 5A2QE 3PVQA 2FYKA 1Y96A 3CC7T 1OQKA 1VQLT 1D1AA 1EFNA 4M7DE 2RQUA 1QVGA 3EAEA 4FU6A 2V1RA 2GQIA 3CCQT 2E6ZA 3ZL7C 4BI8B 3TU4K 1WI7A 2V8JA 1H92A 4Z8AA 5FRNA 4J9HA 1VIFA 1DJ7B 2CH4A 4PNOA 2QDLA 1WGSA 5LJ5j 3EFRA 3G7ZA 2E6NA 1ZHIA 3E9GA 2COWA 4QQGA 2F1LA 3BE3A 4MMKA 5GAOp 4KBMB 2E65A 1VQPT 4A4FA 2LT1A 2NUTA 3JSCA 2NUPA 4J9EA 1X2KA 2PNIA 4HCCA 1YP5A 5LJ5g 1VQKT 3L2ZA 1TTHB 4ZNXA 4F7UG 2QA4T 4DOVA 1AZGB 2AZSA 3OBWA 1IREB 1NM7A 4JDSA 2XG8D 1XJWB 1Y0MA 4FW1A 1KIKA 4RKUE 1XOVA 2ED0A 4QT7A 2ZPEB 3LH5A 2EYZA 5GAMd 1N6AA 1B3QA 2YRCA 1VQ9T 2K4YA 4RG2A 1W1FA 2V26A 3FLGA 4BDYA 2X4XA 4J6WA 2RI3A 1Q7YR 1R8OB 2F2WA 4J9GA 3CCMQ 3MPUB 5CO7A 1RI9A 4LDWA 1Q7YC 2CYZB 3KUFA 1IZ6A 1MUZA 1UGVA 4L6V5 3VRYA 2COYA 2K5FA 3V7RA 4XTVA 3QXEB 1SF9A 1BI2A 2VGNA 4C8QA 2H3JA 2XDBA 2DXUA 4NL3A 3G6EQ 2ECZA 2HCKA 4AFQC 1H3HA 2LQWA 2I2LA 2M1HA 4L59A 5HK3A 5LJ5h 5DM7R 5A0DA 4ORZA 3OW2P 1K0SA 1A0NB 2KNBB 2RA2A 4XTYA 2DFUA 3VYGA 3SDZA 1Y96B 5I2MA 2KI7A 4M7AF 2KRSA 5KYUB 2D1XA 3MKDA 1JXMA 4Z88A 3O5ZA 5CKFA 1I1JA 1TXQA 3ZFJA 1VQ8A 3M0SA 1KJWA 4F17A 1HD3A 1PSFA 1SEMA 2X4WA 5CKHA 3M0UA 3C4SA 4F16A 2LVMA 3L42A 4JRKA 2EGAA 5KYWB 1VQ4A 1Q82R 1RI0A 1GFCA 1M27C 4HVUA 3QZ5B 3ER0A 1E7OA 4F14A 5GANe 1YJWA 2SEMA 4C8QC 3CCET 4PJOF 2NUTB 2X4JA 2EJFA 1Q95G 3CD6A 1KG1A 2NUPB 2HBWA 1CSKA 1BI0A 2R5MA 1PKTA 2B8AA 2VUBA 4Z02A 4RTTA 2WSFE 1D1BA 1ACMB 2LX7A 4FT4A 3QBYA 2O4XB 4E2FB 1WQWA 1FMVA 4C0ZA 4A4KA 4F7UA 1ZSZA 1QVFS 1X2QA 1CKBA 3CCSQ 4HA8A 1N8RC 1HK9A 4BD3A 4II1A 3SEMA 1VQ8T 2DZCA 1TS9A 2DTHA 1G3TA 4JS5A 4OF1A 1WHJA 2D0NA 2DETA 2AIRB 1WJSA 1M4ZA 3V7CA 5EG2A 1W2BP 1VQMQ 5IT9E 1PHTA 2DXCA 3MHXA 3QYGB 2L3PA 4AG1C 2CUDA 3PMIA 1I5OB 4C0GA 2Y90A 1M90C 5HCKA 4C8QB 2M02A 1QW1A 2JMAA 4RG8A 1D0YA 1UHCA 1U1SA 3X25B 2V1QA 2XKOC 1G3WA 2ABLA 4M75G 3BY7A 1UHFA 2DBMA 1R0BG 4C5GA 5GAN6 4J9CA 2MI6A 2RJDA 3P8BB 3VKIA 4M78F 4JLIA 4XQ3A 3RKYA 5GAN4 5CIUA 3HSBA 3S6WA 1Q86R 1UE9A 1V1CA 1AVZC 4D6WA 2DKGA 3I5SA 3RERA 3CC4Q 1Q86C 2GF7A 5GAN2 2AZVA 2QK0A 3QDRB 1ZSZC 3HL8A 1Q81C 3G71T 2GTOA 2RHYA 2FZKB 1S72A 2GNCA 3DLLA 2DK3A 5I21A 2KAFA 1MV3A 4J9IA 1YJNT 1ABQA 2HKQB 4IUTA 4PFZA 3NTHA 4RCCA 2BE7D 1JBMA 2EBPA 3EH2A 4B9WA 3CPWP 1FWZA 3OMGA 4N4GA 4RUGA 1UECA 3TEEA 2DYBA 4NL2A 3R6OA 4J6YA 4OGEA 4QQ6A 2P4RA 2HEQA 1NYGA 1M9SA 3RDVA 1WXTA 2HSEB 3R6NA 1ZBJA 1WHKA 2XIDA 1WNLA 2KRNA 3DB3A 4OMNA 2BZXA 2RO0A 4C5HA 2EWNA 3NMZC 4XTWA 1RUWA 1KSWA 1BBZA 1MGQA 1ZSZB 3MEWA 4PL6A 3RESA 4Z89A 4M7DG 2DVEA 1FMKA 1K73R 3META 2E64A 4AFSC 1S72T 4MZMA 1K73C 5GANd 4X1VA 1KC8C 1NJIU 5M9OA 2F2XA 3M58A 2CREA 2DRMA 3VUZA 1YJWQ 1YHQA 1KC8U 4DBHA 2RQWA 1VQ6A 5D6WA 1FXXA 1MMDA 5GAMj 3E1SA 2GTJA 3A98A 5KYNA 2QYZA 2RI2A 3OYKA 3JB9D 2CZ7B 3C12A 1U1TA 1ARKA 1MNEA 2KEAA 2ROTA 3OBYA 2FPEA 2VWFA 3UATA 4E7ZA 1O9SA 4FT2A 4M75A 1MMGA 3CMAA 3OSSC 1AOJA 1BI3A 4CRIA 2HAXA 2RH2A 2DERA 5KYXB 4CC7A 2ZPBB 5J3BA 5GAMg 1QWFA 4A53A 2AT1B 2ED1A 1VQ5Q 4C0FA 2DEQA 3FC3A 4OMLA 5GMKl 4FSXA 1M1GA 2RHXA 4ANJA 4KGVB 4LN2A 4E7KA 2W0ZA 3UF4A 4C92D 3CCJA 3CCLA 3HTRA 3CCVQ 3BDLA 1ZX6A 1AEYA 2KXDA 3VV0A 4C92E 1VQ6T 3EG9B 3RIRA 5D6YA 2ZAEA 2DAQA 5IH2A 5FRMA 4A4HA 1KQSS 3EHQA 2LNVA 2O31A 4LUDA 3M59A 3CQTA 3CXCP 1VOMA 3P8DA 2LJ1A 1JQQA 1KD1C 2HDAA 5GAMh 1TUCA 4M75C 4AMCA 2ZPGB 3HFOA 3NTKA 1KD1U 2DRKA 1T0HA 3AT1B 3RKWA 1IGQA 4IUPA 3BDUA 2EQMA 3J7AF 3G4SA 1VUBA 1HSQA 3PE0A 3M56A 1OEBA 3U23A 2OJ2A 3FIFA 1B7TA 2RPNA 1LJOA 3RKXA 5I11A 4AT1B 1YWOA 1VYUA 3CCJT 2HMAA 4IIOA 2HKNA 1IRXA 1M1KC 3CBMA 3OYNA 1XQHA 5FWBA 1JO8A 2QI2A 1OOTA 1JB0E 2AKKA 2PVDB 5C6SA 2E10A 2ZPFB 4ELZC 4BI4A 1T3LA 2RJEA 3JCMJ 3OMCA 4LDYA 2PTKA 4FYXB 2MF2A 5I2SA 4J83A 3OS2A 1N9SA 1UFFA 4EMGA 1M30A 4M75B 3OW2A 2DL4A 3M0PA 2F69A 1JJ2S 4AG2C 1FMWA 3CCQA 3MCAB 2JVVA 3PNWC 4J7IA 1AWWA 5FWCA 2OTJQ 2QG9B 1NZ9A 1K9MR 1VQ7A 3G4ST 2K3YA 5GMKj 3H6ZA 2AK5A 1YHQQ 4PKCC 4M77D 5KE2A 3RMQA 3V8KA 1UDLA 5L8RE 2KRMA 4EDUA 4DBFA 2CP2A 3MEUA 2LCSA 2A7YA 4M4ZA 1OZ3A 4M77E 4TVRA 4LUEA 4X9DA 3LLRA 5L23A 4OB3B 2D9TA 2JNGA 5DLOA 4OB0B 2QQ9A 2E5QA 1VQKA 1PRLC 4K11A 4J9DA 2EGEA 2QA4A 3EG3A 2H3EB 2C0TA 5GAMf 3CMAQ 1NEGA 4M7DD 1PD0A 3A1PA 2OTLQ 2KY9A 1VQNA 4X9CA 1VQ9A 2YHTA 4QVZA 1LOJA 2LQ8A 2QDYB 4MDWA 4DEXA 4HKEA 5FLXE 3PIPA 3A8GB 2LDMA 2G3RA 4QW2A 1M8VA 3I35A 3NHNA 4XU3A 3MP8A 2F5KA 2X51A 2DM1A 3CMEQ 4XAXB 1SSHA 2XI9A 3C0CA 5GJVB 2DTOA 1VQ7T 2CDTA 1QKXA 3CCLQ 3OYLA 2QTVA 1U3OA 1ZA2B 2DJZA 1NBEB 4L5GA 5DLQE 1D09B 1W2BA 3BFMA 3NPFA 2EAYA 5KH6A 2RD1A 4EMKA 4A4EA 2RI5A 4P5NA 2DD5A 2DL5A 5FU7C 1ZUYA 5GMKh 3TSZA 3HRTA 5KE3A 4DBRA 4JZ4A 1QMCA 3HFNA 2CT3A 3RUXA 3CCRT 3QDFA 1JJ2P 2KMTA 2BE9B 1FX7A 5GANj 5GMKe 2PZ1A 1VQNT 1E6GA 3H41A 2BZ8A 1WA7A 3REBB 4ZN3A 3S3NA 4E6RA 1X6BA 1RAFB 2PVGB 2E3IA 2KT1A 1K0XA 4QVDA 1VQOA 3KFVA 1QVGS 2YUOA 5GANg 4XK8E 2Y4XA 2L89A 5ECAA 1Q7YU 2CT4A 3WVDB 2EYWA 2VC8A 2ZPHB 3GNFB 3M54A 2RJFA 1OX9A 3CCEA 5FU7B 3CPWA 4GBQA 3GP8A 2PVOB 3M57A 5GAN7 3CC7Q 4EMKC 1TOVA 2CSIA 3JCMQ 1VQLQ 3A5ZB 1HYOA 5HK0A 2KBTA 1VYVA 5LL6S 2A0FB 2EYQA 4BI3A 1WHGA 2YUPA 1Z9ZA 3CCQQ 2KK4A 3WXMB 3LX7A 3JB9G 5CAIA 3I56A 2HBPA 4E7SA 5KYYA 3ASKA 1ZBXA 2DZ9A 3RR6A 1SPKA 1D1CA 2LX9A 3QJYA 4PJLA 1X69A 1BIAA 4KUDK 4O6JA 2HQXA 2J6KA 5GANh 3QHSA 1YIJT 2FPDA 4QKUA 2IPOB 2ZCFB 1MV0B 4BE2A 1VQOT 3INZA 2RQTA 4KUIA 2L0AA 4LDXA 2QEXQ 1VQPQ 1TUDA 2J6OA 4M7AD 1F1BB 5CKEA 3CC4T 2LNHB 1Q82C 2KE9A 1MNDA 2LCLA 1RAEB 3M4GA 2PUOB 2HL5C 1VQKQ 4M7AE 3HRSA 3DKMA 4PLIA 4EMKB 5CR2A 5KCHA 4C92G 2HD0A 2RK2A 3SB2A 1WZOA 2X4YA 1PC0A 1TG0A 4C8QF 1RAHB 1W6XA 2FL7A 3MEAA 3VS7A 4LE9A 3LW5E 4IKFA 3CCUA 1M3BA 1RAIB 3I56T 3G71A 4DEYA 2IIMA 1SHGA 1UB4A 3MJXA 2Y4YA 3VS3A 2O88A 4Q5WA 1MHNA 3QIIA 1IB8A 1YJNA 4WF2A 1N8RU 4PJOD 4MZPA 3PMTA 2LJ0A 2RB6A 5IXBA 2DJQA 4ZGJB 3VS2A 4DQ2A 5J39A 1YCYA 4IUUA 2QGFB 2YUQA 4PJOE 2KR3A 2MMPA 1LVKA 1WPYA 3GIBA 2GBQA 5FW9A 2RN8A 5GAN5 3OS1A 4C8QE 2OAWA 2XD0A 4FYYB 1C1AA 3I55A 1M90U 4E7JA 3JCMV 2YUNA 2K5IA 3I5RA 1RAGB
chains in the Genus database with same CATH topology
1ZUKA 2A36A 1AOJA 3RNJA 4RTXA 4CC7A 2EVRA 4RTYA 1M3CA 2MIOA 2YT6A 2L2PA 1QWFA 2J05A 1UG1A 1UJYA 1YNZA 2ED1A 1ZLMA 2RNAA 4WCIA 2CH4W 4J9BA 2G6FX 1QLYA 1IO6A 2K79A 2VVKA 2M51A 1WDXA 4OMLA 3UA6A 1OPKA 1YWPA 1GFDA 1N5ZA 1OPLA 4LN2A 1SHFA 5GJWB 3ULRB 2W0ZA 4LNPA 3UF4A 2L3QA 1UJ0A 2F2VA 3RBBB 2L3SA 5I22A 4JJCA 4RTUA 1ZX6A 1AEYA 2JW4A 3PVQA 4JJDA 1ZSGA 2JM9A 2KXDA 4EIKA 2DBKA 1PRMC 3QWXX 2CSQA 2RQVA 1X43A 5IH2A 3GBQA 3VS1A 4JZ3A 1GRIA 3EHQA 1EFNA 2E5KA 4KRTA 2O31A 2RQUA 4LUDA 5IHIA 1WXBA 1VYTA 3CQTA 4RTWA 2V1RA 2GQIA 2CUBA 3ZL7C 2LJ1A 1JQQA 1FYNA 1WI7A 1WFWA 2D8HA 2HDAA 4Z8AA 1H92A 5IHNA 1TUCA 4J9HA 1LCKA 2ENMA 2CH4A 2QDLA 2DRKA 1T0HA 1JXOA 2VKNA 1ZUUA 1HSQA 3PE0A 1M8MA 1OEBA 3U23A 2OJ2A 4HCKA 2A28A 3REAB 2RPNA 3H0IA 5EC7A 5I11A 1AZEA 3EG2A 1YWOA 1VYUA 1K9AA 2YDLA 4J9EA 4IIOA 1X2KA 2PNIA 1YP5A 5FWBA 3VS0A 1JO8A 1WYXA 4ZNXA 1OOTA 1AWJA 2AKKA 4J9FA 1AZGB 2AZSA 3TVTA 1NM7A 3EG1A 1T3LA 1Y0MA 1KIKA 1WXUA 1XOVA 2ED0A 4QT7A 4Y92A 4OMOA 3LH5A 2EYZA 2DF6A 1B3QA 1PKSA 2PTKA 3I9QA 1W1FA 2OI3A 1G83A 4D8DA 1UFFA 2FRWA 1M30A 2J6FA 2LP5A 2DL4A 3M0PA 2F2WA 4J9GA 2FO0A 1JU5C 2FPFA 4AG2C 1RI9A 3EG0A 2FEIA 2XMFA 1MUZA 1UGVA 2H8HA 3VRYA 1AWWA 5FWCA 1E6HA 2JM8A 3UA7A 4OMMA 2GGRA 2DILA 3PVLA 2EW3A 2B86A 2DX1A 2AK5A 2ECZA 2X3XD 1ABOA 2HCKA 4AFQC 2KT8A 1UDLA 1H3HA 2LQWA 2KRMA 2JS0A 4IIMA 2LCSA 3VS6A 4M4ZA 2DMOA 4LUEA 4ORZA 3SHWA 4CC2A 5L23A 1K0SA 1A0NB 2KNBB 1X6GA 1HJDA 1U06A 3VRZA 1PRLC 1GCPA 4K11A 2KRSA 4J9DA 1BB9A 2D1XA 2EGEA 3EG3A 2KYBA 2A08A 2JTEA 1WX6A 1JXMA 1Z9QA 2YSQA 4Z88A 2C0TA 3O5ZA 1NEGA 2W10A 1I1JA 1Y57A 2O9SA 3EGUA 3M0SA 1KJWA 4F17A 1HD3A 1SEMA 1QCFA 1UUEA 3M0RA 1RLQC 2EYXA 2K2MA 3JV3A 2KROA 4DEXA 3M0UA 4F16A 2RF0A 3I35A 2EGAA 3NHNA 1YCSB 1X27A 1I07A 2DM1A 1GFCA 1M27C 4HVUA 1SSHA 3C0CA 5GJVB 2CDTA 2O2OA 1QKXA 1E7OA 4F14A 1B07A 1AWOA 2SEMA 4D8KA 1GBQA 1U3OA 1W70A 2M0YA 1K1ZA 3NPFA 2HBWA 1CSKA 1S1NA 1PKTA 2DL5A 4RTTA 1ZUYA 2DNUA 2DL8A 3TSZA 2LX7A 4JZ4A 1X2QA 1CKBA 2CT3A 1PWTA 4RTVA 3SEMA 2AKLA 4A63B 2PZ1A 4CC4B 1E6GA 1NG2A 2C0OA 3H41A 2DL7A 2BZ8A 2D0NA 1T0JA 1WA7A 3REBB 4ESRA 1KFZA 5IHKA 4RTZA 2MCNA 2DE0X 4CC3A 4E6RA 1X6BA 1PHTA 2NWMA 1OV3A 2KT1A 1K0XA 1T3SA 1K4US 1AWXA 3M0TA 2L3PA 1NLPC 3VS5A 4AG1C 2CUDA 3KFVA 2EQIA 2YUOA 5HCKA 2DVJA 4HVVA 5ECAA 1RLPC 2RMOA 2CT4A 2EYWA 1J3TA 2JMAA 2LMJA 1UHCA 2C0IA 1GCQA 1NEBA 2V1QA 2BZYA 2ABLA 1NLOC 1U5SA 2K3BA 1UHFA 2DBMA 4GBQA 2EGCA 4J9CA 1G2BA 2KGTA 1AD5A 4GLMA 2EPDA 1NYFA 2ROLA 2CSIA 2O9VA 1UE9A 1VA7A 1V1CA 1AVZC 4OMPA 1QKWA 2KBTA 3I5SA 1VYVA 1QWEA 2EYYA 5IXFA 3H0FA 2BTTA 2YUPA 4AFUC 2AZVA 1Z9ZA 1YN8A 2GTOA 3M0QA 2GNCA 1UTIA 1H8KA 1MV3A 2D8JA 4J9IA 1ABQA 4R0KA 1SPKA 4OMQA 2K9GA 2EBPA 2MOXA 1JEGA 1I0CA 1X69A 2J6KA 2A37A 2FPDA 4HXJA 4JPBW 1MV0B 4RUGA 3NGPA 2DA9A 1UECA 1SRMA 2RQTA 2DYBA 1BU1A 2J7IA 2L0AA 2I0NA 1TUDA 2J6OA 4FSSA 2P4RA 2LNHB 2DLPA 2HEQA 1NYGA 3VS4A 2KE9A 1WXTA 3R6NA 1ZBJA 2EKHA 1M3AA 2KRNA 1GCQC 4OMNA 3H0HA 2BZXA 4AFZC 1SRLA 2J06A 3QWYA 2DL3A 1K76A 1TG0A 3NMZC 1RUWA 1GL5A 2JXBA 1KSWA 1W6XA 3EHRA 1BBZA 3VS7A 4LE9A 2NUZA 4JJBA 4Z89A 1FMKA 2LQNA 1M3BA 4AFSC 1PNJA 2ESWA 2KYMA 2LZ6B 2RQRA 4DEYA 2IIMA 2FRYA 2LJ3A 1SHGA 4X1VA 2FG0A 3VS3A 2O88A 2X3WD 1GBRA 2LJ0A 2F2XA 2CREA 2HSPA 2DRMA 1BK2A 5IXBA 2DJQA 1WIEA 3VS2A 2KXCA 2YUQA 2K6DA 2KR3A 4HVWA 2RQWA 3IQLA 2SRCA 2GBQA 3FJ5A 5FW9A 2JMCA 2RN8A 2GTJA 3A98A 1WLPB 2OAWA 2JT4A 1CKAA 3THKA 1ARKA 2JS2A 2KEAA 2ROTA 2YUNA 2FPEA 2VWFA 3UATA 3I5RA 2K7AA 3TSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUK A;  2A36 A;  1AOJ A;  3RNJ A;  4RTX A;  4CC7 A;  2EVR A;  4RTY A;  1M3C A;  2MIO A;  2YT6 A;  2L2P A;  1QWF A;  2J05 A;  1UG1 A;  1UJY A;  1YNZ A;  2ED1 A;  1ZLM A;  2RNA A;  4WCI A;  2CH4 W;  4J9B A;  2G6F X;  1QLY A;  1IO6 A;  2K79 A;  2VVK A;  2M51 A;  1WDX A;  4OML A;  3UA6 A;  1OPK A;  1YWP A;  1GFD A;  1N5Z A;  1OPL A;  4LN2 A;  1SHF A;  5GJW B;  3ULR B;  2W0Z A;  4LNP A;  3UF4 A;  2L3Q A;  1UJ0 A;  2F2V A;  3RBB B;  2L3S A;  5I22 A;  4JJC A;  4RTU A;  1ZX6 A;  1AEY A;  2JW4 A;  3PVQ A;  4JJD A;  1ZSG A;  2JM9 A;  2KXD A;  4EIK A;  2DBK A;  1PRM C;  3QWX X;  2CSQ A;  2RQV A;  1X43 A;  5IH2 A;  3GBQ A;  3VS1 A;  4JZ3 A;  1GRI A;  3EHQ A;  1EFN A;  2E5K A;  4KRT A;  2O31 A;  2RQU A;  4LUD A;  5IHI A;  1WXB A;  1VYT A;  3CQT A;  4RTW A;  2V1R A;  2GQI A;  2CUB A;  3ZL7 C;  2LJ1 A;  1JQQ A;  1FYN A;  1WI7 A;  1WFW A;  2D8H A;  2HDA A;  4Z8A A;  1H92 A;  5IHN A;  1TUC A;  4J9H A;  1LCK A;  2ENM A;  2CH4 A;  2QDL A;  2DRK A;  1T0H A;  1JXO A;  2VKN A;  1ZUU A;  1HSQ A;  3PE0 A;  1M8M A;  1OEB A;  3U23 A;  2OJ2 A;  4HCK A;  2A28 A;  3REA B;  2RPN A;  3H0I A;  5EC7 A;  5I11 A;  1AZE A;  3EG2 A;  1YWO A;  1VYU A;  1K9A A;  2YDL A;  4J9E A;  4IIO A;  1X2K A;  2PNI A;  1YP5 A;  5FWB A;  3VS0 A;  1JO8 A;  1WYX A;  4ZNX A;  1OOT A;  1AWJ A;  2AKK A;  4J9F A;  1AZG B;  2AZS A;  3TVT A;  1NM7 A;  3EG1 A;  1T3L A;  1Y0M A;  1KIK A;  1WXU A;  1XOV A;  2ED0 A;  4QT7 A;  4Y92 A;  4OMO A;  3LH5 A;  2EYZ A;  2DF6 A;  1B3Q A;  1PKS A;  2PTK A;  3I9Q A;  1W1F A;  2OI3 A;  1G83 A;  4D8D A;  1UFF A;  2FRW A;  1M30 A;  2J6F A;  2LP5 A;  2DL4 A;  3M0P A;  2F2W A;  4J9G A;  2FO0 A;  1JU5 C;  2FPF A;  4AG2 C;  1RI9 A;  3EG0 A;  2FEI A;  2XMF A;  1MUZ A;  1UGV A;  2H8H A;  3VRY A;  1AWW A;  5FWC A;  1E6H A;  2JM8 A;  3UA7 A;  4OMM A;  2GGR A;  2DIL A;  3PVL A;  2EW3 A;  2B86 A;  2DX1 A;  2AK5 A;  2ECZ A;  2X3X D;  1ABO A;  2HCK A;  4AFQ C;  2KT8 A;  1UDL A;  1H3H A;  2LQW A;  2KRM A;  2JS0 A;  4IIM A;  2LCS A;  3VS6 A;  4M4Z A;  2DMO A;  4LUE A;  4ORZ A;  3SHW A;  4CC2 A;  5L23 A;  1K0S A;  1A0N B;  2KNB B;  1X6G A;  1HJD A;  1U06 A;  3VRZ A;  1PRL C;  1GCP A;  4K11 A;  2KRS A;  4J9D A;  1BB9 A;  2D1X A;  2EGE A;  3EG3 A;  2KYB A;  2A08 A;  2JTE A;  1WX6 A;  1JXM A;  1Z9Q A;  2YSQ A;  4Z88 A;  2C0T A;  3O5Z A;  1NEG A;  2W10 A;  1I1J A;  1Y57 A;  2O9S A;  3EGU A;  3M0S A;  1KJW A;  4F17 A;  1HD3 A;  1SEM A;  1QCF A;  1UUE A;  3M0R A;  1RLQ C;  2EYX A;  2K2M A;  3JV3 A;  2KRO A;  4DEX A;  3M0U A;  4F16 A;  2RF0 A;  3I35 A;  2EGA A;  3NHN A;  1YCS B;  1X27 A;  1I07 A;  2DM1 A;  1GFC A;  1M27 C;  4HVU A;  1SSH A;  3C0C A;  5GJV B;  2CDT A;  2O2O A;  1QKX A;  1E7O A;  4F14 A;  1B07 A;  1AWO A;  2SEM A;  4D8K A;  1GBQ A;  1U3O A;  1W70 A;  2M0Y A;  1K1Z A;  3NPF A;  2HBW A;  1CSK A;  1S1N A;  1PKT A;  2DL5 A;  4RTT A;  1ZUY A;  2DNU A;  2DL8 A;  3TSZ A;  2LX7 A;  4JZ4 A;  1X2Q A;  1CKB A;  2CT3 A;  1PWT A;  4RTV A;  3SEM A;  2AKL A;  4A63 B;  2PZ1 A;  4CC4 B;  1E6G A;  1NG2 A;  2C0O A;  3H41 A;  2DL7 A;  2BZ8 A;  2D0N A;  1T0J A;  1WA7 A;  3REB B;  4ESR A;  1KFZ A;  5IHK A;  4RTZ A;  2MCN A;  2DE0 X;  4CC3 A;  4E6R A;  1X6B A;  1PHT A;  2NWM A;  1OV3 A;  2KT1 A;  1K0X A;  1T3S A;  1K4U S;  1AWX A;  3M0T A;  2L3P A;  1NLP C;  3VS5 A;  4AG1 C;  2CUD A;  3KFV A;  2EQI A;  2YUO A;  5HCK A;  2DVJ A;  4HVV A;  5ECA A;  1RLP C;  2RMO A;  2CT4 A;  2EYW A;  1J3T A;  2JMA A;  2LMJ A;  1UHC A;  2C0I A;  1GCQ A;  1NEB A;  2V1Q A;  2BZY A;  2ABL A;  1NLO C;  1U5S A;  2K3B A;  1UHF A;  2DBM A;  4GBQ A;  2EGC A;  4J9C A;  1G2B A;  2KGT A;  1AD5 A;  4GLM A;  2EPD A;  1NYF A;  2ROL A;  2CSI A;  2O9V A;  1UE9 A;  1VA7 A;  1V1C A;  1AVZ C;  4OMP A;  1QKW A;  2KBT A;  3I5S A;  1VYV A;  1QWE A;  2EYY A;  5IXF A;  3H0F A;  2BTT A;  2YUP A;  4AFU C;  2AZV A;  1Z9Z A;  1YN8 A;  2GTO A;  3M0Q A;  2GNC A;  1UTI A;  1H8K A;  1MV3 A;  2D8J A;  4J9I A;  1ABQ A;  4R0K A;  1SPK A;  4OMQ A;  2K9G A;  2EBP A;  2MOX A;  1JEG A;  1I0C A;  1X69 A;  2J6K A;  2A37 A;  2FPD A;  4HXJ A;  4JPB W;  1MV0 B;  4RUG A;  3NGP A;  2DA9 A;  1UEC A;  1SRM A;  2RQT A;  2DYB A;  1BU1 A;  2J7I A;  2L0A A;  2I0N A;  1TUD A;  2J6O A;  4FSS A;  2P4R A;  2LNH B;  2DLP A;  2HEQ A;  1NYG A;  3VS4 A;  2KE9 A;  1WXT A;  3R6N A;  1ZBJ A;  2EKH A;  1M3A A;  2KRN A;  1GCQ C;  4OMN A;  3H0H A;  2BZX A;  4AFZ C;  1SRL A;  2J06 A;  3QWY A;  2DL3 A;  1K76 A;  1TG0 A;  3NMZ C;  1RUW A;  1GL5 A;  2JXB A;  1KSW A;  1W6X A;  3EHR A;  1BBZ A;  3VS7 A;  4LE9 A;  2NUZ A;  4JJB A;  4Z89 A;  1FMK A;  2LQN A;  1M3B A;  4AFS C;  1PNJ A;  2ESW A;  2KYM A;  2LZ6 B;  2RQR A;  4DEY A;  2IIM A;  2FRY A;  2LJ3 A;  1SHG A;  4X1V A;  2FG0 A;  3VS3 A;  2O88 A;  2X3W D;  1GBR A;  2LJ0 A;  2F2X A;  2CRE A;  2HSP A;  2DRM A;  1BK2 A;  5IXB A;  2DJQ A;  1WIE A;  3VS2 A;  2KXC A;  2YUQ A;  2K6D A;  2KR3 A;  4HVW A;  2RQW A;  3IQL A;  2SRC A;  2GBQ A;  3FJ5 A;  5FW9 A;  2JMC A;  2RN8 A;  2GTJ A;  3A98 A;  1WLP B;  2OAW A;  2JT4 A;  1CKA A;  3THK A;  1ARK A;  2JS2 A;  2KEA A;  2ROT A;  2YUN A;  2FPE A;  2VWF A;  3UAT A;  3I5R A;  2K7A A;  3TSW A; 
#chains in the Genus database with same CATH topology
 1ZUK A;  2HQE A;  3PT9 A;  1IXD A;  1I81 A;  4RTY A;  1Y07 A;  3CC2 A;  2L2P A;  4RMO A;  3M5A A;  1YNZ A;  2RNA A;  4WCI A;  4FL6 A;  3CCU T;  1TU0 B;  4E47 A;  2QXF A;  2ZGW A;  2K79 A;  1IO6 A;  3CXC A;  5GAN f;  1OPK A;  1YWP A;  2CS7 A;  1QCO A;  1Q86 U;  1XNI A;  5GJW B;  3L2W A;  1Q81 U;  1BCM A;  4OMF B;  4F7U F;  1I8F A;  4NOY A;  1M1F A;  5A0G A;  4EIK A;  2LC4 A;  2JM9 A;  3CCE Q;  4M78 D;  2CSQ A;  1C6V X;  2K3X A;  2RQV A;  3QSU A;  1X43 A;  4WTO B;  4M78 E;  3JCM b;  2M0O A;  3I55 T;  1YIT A;  4M77 G;  4KRT A;  3F70 A;  1LPL A;  2CUB A;  1FYN A;  1WFW A;  4C92 A;  1I5L A;  1X6O A;  1QVF P;  1LCK A;  2ATC B;  3OYF A;  2YXY A;  3SFM A;  4HCB A;  3CC2 T;  1VQ8 Q;  4F7U B;  1JXO A;  1SSF A;  2VKN A;  1K8A R;  1M8M A;  5AT1 B;  3C94 A;  2VV5 A;  4HCK A;  1O75 A;  3H0I A;  2LRQ A;  1D0X A;  2RHZ A;  5EC7 A;  1YJ9 T;  1R0C B;  1K8A C;  3EG2 A;  5D6X A;  1VQ4 Q;  1K9A A;  2EJ9 A;  5CQY A;  3JCM h;  3VS0 A;  1K73 U;  4HCZ A;  1AWJ A;  4J9F A;  1AT1 B;  2RK1 A;  3TVT A;  3QKJ A;  3GNG A;  3V8J A;  3EG1 A;  4XTU A;  2DIQ A;  3CD6 Q;  3JCM e;  4N4H A;  4Y92 A;  3E19 A;  5LJ3 e;  1W4S A;  2DF6 A;  1YIT T;  2OI3 A;  2J6F A;  2LP5 A;  4FIB A;  4DA4 A;  2YLC A;  2FO0 A;  2FPF A;  2M16 A;  3EG0 A;  5HKC A;  4C92 C;  2XMF A;  2CP6 A;  2H8H A;  1D0Z A;  2DPP B;  1E6H A;  1G3Y A;  1D3B A;  1R77 A;  1TH7 A;  2JM8 A;  4OMM A;  1GXI E;  2X9H A;  2GGR A;  3OQ5 A;  1YI2 T;  3PVL A;  3L1A A;  2EW3 A;  2B86 A;  1QP2 A;  3UT1 A;  2DX1 A;  1EX4 A;  2X3X D;  4OB2 B;  1MMN A;  1JRI A;  1ZQ1 A;  4IIM A;  2CP5 A;  3VS6 A;  2OAU A;  5GAO l;  2DYI A;  2DMO A;  1AHJ B;  4CC2 A;  3OS0 A;  1U06 A;  3VRZ A;  4DOW A;  1GCP A;  3LGF A;  2KYB A;  2JTE A;  1WX6 A;  1Z9Q A;  2OTJ T;  4MML A;  1Y57 A;  3MP6 A;  2O9S A;  2L5Q A;  3CBP A;  4EPC A;  1M2O A;  3LGL A;  3EFO A;  1QCF A;  1UUE A;  3M0R A;  4M77 A;  3X26 B;  2DEU A;  2XK0 A;  4J5Y A;  2FZG B;  2EYX A;  4C92 B;  2KRO A;  4PK4 A;  2VB6 A;  3MO8 A;  1IHV A;  2RF0 A;  3OYY A;  2CP0 A;  1NPR A;  1N9R A;  1IGU A;  1X27 A;  1I07 A;  1S72 Q;  3CBO A;  3JCM f;  3JRZ A;  3A8M B;  1V29 B;  4PLL A;  1AWO A;  3OYM A;  4M7D A;  4M75 F;  1W70 A;  3UDC A;  3EGD A;  2M0Y A;  2P0K A;  2JUF A;  2CP3 A;  3FDR A;  3HHT B;  1QVP A;  1KQ1 A;  3M55 A;  2AHJ B;  1G3S A;  4N0A A;  1M1K U;  2V8K A;  4UC4 A;  4PFP A;  1PWT A;  4JRQ A;  2LCC A;  4M7A G;  4LD6 A;  4RTV A;  2GQV A;  2CZ6 B;  2AKL A;  3CME T;  1OI1 A;  3NFC A;  4CC4 B;  4PJN A;  3CPF A;  3X28 B;  1NG2 A;  2C0O A;  2DL7 A;  2E41 A;  1T0J A;  1OU9 A;  3L2R A;  4ESR A;  1ZA1 B;  2PUK B;  4M77 C;  2MCN A;  4V2S A;  4N4I A;  4CC3 A;  4BE0 A;  3J81 E;  2GFU A;  2JOY A;  2NWM A;  4YTL A;  1WJQ A;  2E70 A;  1QCN A;  3OYC A;  1D3B B;  2WSE E;  4LXC A;  2K2V A;  4MZT A;  3H8Z A;  5GAO q;  3GPL A;  1J3T A;  3X24 B;  2LMJ A;  3JCM d;  4M7D C;  1NEB A;  1K9M C;  2BZY A;  4OP0 A;  5LJ3 d;  1RAA B;  1HXD A;  2EGC A;  4PJO G;  4KUL A;  4ATO A;  2F5T X;  1VQ6 Q;  3G1J A;  1AD5 A;  4GLM A;  2EPD A;  1NYF A;  1K9M U;  1SG5 A;  1X01 A;  2ROL A;  8ATC B;  2V8I A;  1VA7 A;  2RM4 A;  3FB9 A;  1QP3 A;  3CCM T;  4OMP A;  1QKW A;  1KQS P;  4ME7 A;  2CZ1 B;  5IXF A;  3H0F A;  2BTT A;  2CZ0 B;  4N0A C;  4E7H A;  3QZ9 B;  3CCR A;  2R5A A;  2JTM A;  1H8K A;  2Z0W A;  4M77 B;  2D8J A;  2D0Q B;  2XIC A;  2K9G A;  4OMQ A;  3G6E T;  1N27 A;  3L2U A;  1JEG A;  1I0C A;  4JPB W;  3NGP A;  2DA9 A;  3OYD A;  1SRM A;  2MWO A;  1BU1 A;  5KYU A;  2J7I A;  3OW2 S;  4JS4 A;  1X75 C;  4M7D B;  4FSS A;  3CCJ Q;  3EGD B;  1OX8 A;  4ZTJ A;  1BYM A;  1LNX A;  3CCS A;  3A8L B;  2YRD A;  3O8V A;  4ZGE B;  3H0H A;  1SRL A;  3CEY A;  2DO3 A;  2DL3 A;  1P92 A;  1GL5 A;  2JXB A;  5KYW A;  4M78 G;  3EHR A;  1UGS B;  3OYE A;  2KVQ G;  1VQM A;  3EFS A;  4FYW B;  1PG5 B;  3OSV A;  4M7A A;  2KYM A;  2QEX T;  1TUG B;  2RQR A;  2KQW A;  1H64 1;  2HQH A;  2PU9 B;  2VYT A;  3VU3 C;  2FG0 A;  3FEO A;  3BW1 A;  1B34 A;  4KH1 B;  9ATC B;  4FM4 B;  2HSP A;  2XHC A;  3T9N A;  4C0D C;  1WIE A;  2RJC A;  3G4S Q;  4B6M A;  2K6D A;  3QO3 A;  2O4X A;  1YIJ A;  1G8X A;  3IQL A;  2JMC A;  4KGX B;  2VAS A;  2P0P A;  1SKU B;  3VYH B;  3THK A;  3CC4 A;  2JS2 A;  1NE8 A;  2BKD N;  4LDU A;  4MDX A;  2QAS A;  3CCS T;  3GOX A;  2K7A A;  2WSC E;  5CCA A;  3TSW A;  2A36 A;  4PJO A;  3E9F A;  3NTI A;  2QAZ A;  3S3M A;  2EVR A;  4VUB A;  2VGM A;  2MIO A;  2GFA A;  5AYF A;  1UG1 A;  1W2B S;  1RAB B;  1VQM T;  3A8O B;  4XTX A;  1NPP A;  4J9B A;  3LWH A;  1QLY A;  2VVK A;  1WDX A;  1OU8 A;  4BY6 C;  1N5Z A;  3JCM P;  2JTF A;  4M7A C;  3E2U A;  1OPL A;  1QVF A;  2EIF A;  4C0D B;  3ULR B;  2EKO A;  4LNP A;  4OVA A;  1UGP B;  2MYS A;  3RBB B;  3L2V A;  1VQ7 Q;  3VJP A;  3OYA A;  5FU6 C;  7AT1 B;  2EFI A;  2JW4 A;  4JJD A;  1ZSG A;  4JRI A;  1U8R A;  2DBK A;  2E3H A;  1PRM C;  1UGQ B;  3QWX X;  5LJ5 e;  4JLG A;  3LH0 A;  3GBQ A;  1M2V A;  1KHI A;  3VS1 A;  4JZ3 A;  3QYH B;  4FW2 A;  4A4G A;  1GRI A;  2E5K A;  3TQ7 P;  4B9X A;  2JZ2 A;  3C95 A;  1WXB A;  5IHI A;  1VYT A;  4RTW A;  2BIV A;  1C0M A;  2MPX C;  3OYG A;  3P8H A;  1MMA A;  2D8H A;  1Q82 U;  2QA4 Q;  2DIG A;  5IHN A;  3CCR Q;  1EZZ B;  3HPW A;  4PJO C;  4LD9 K;  3N5B B;  3SD4 A;  2ENM A;  6AT1 B;  4LDV A;  3RMS A;  3OA6 A;  3MP1 A;  4KH0 B;  3CPW S;  1V76 A;  4M78 A;  3EH1 A;  1VQN Q;  4BY6 B;  1IHW A;  2P0Q A;  1VQ9 Q;  2PQW A;  1XTD A;  4C5I A;  4M7A B;  1ZUU A;  4FCY A;  2A28 A;  3REA B;  1AZE A;  1B34 B;  5FU6 B;  2YDL A;  2WAC A;  5GAN 8;  1QVG P;  4XTZ A;  2CP7 A;  2NLU A;  1WYX A;  1N8R R;  3L2Q A;  3QPH A;  1KQ2 A;  4C8Q D;  4BB7 A;  1WXU A;  3HP9 A;  4OMO A;  5CK9 A;  5J26 A;  1PKS A;  3I9Q A;  1VQ5 A;  2R58 A;  2HNI A;  1G83 A;  4D8D A;  2COZ A;  2K57 A;  2FRW A;  1Y71 A;  4PJO B;  1JU5 C;  1M90 R;  1Y7X A;  3AHU A;  4GY5 A;  2FEI A;  3TRE A;  1VQ4 T;  2R57 A;  1PD1 A;  1UGR B;  3PFS A;  2YWW A;  3D7S B;  5LJ5 f;  3OYI A;  3UA7 A;  3S3O A;  2MK5 A;  2DIL A;  1YJW T;  3CCV A;  4M78 C;  3JAM E;  3ZBD A;  2YRV A;  1VIE A;  5LJ3 j;  3JB9 J;  1ABO A;  3CD6 T;  5KYY B;  2KT8 A;  1YIJ Q;  2JS0 A;  2IG0 A;  4E7I A;  1YJ9 A;  1VQO Q;  3JCM X;  3JB9 H;  5GMK i;  2RHU A;  4HT8 A;  3OB9 A;  2KSS A;  3SHW A;  5KYX A;  5IAY A;  1Q81 R;  3UPU A;  1X6G A;  1HJD A;  2FHD A;  3JCM g;  1BB9 A;  3HKS A;  5LJ3 g;  1M2V B;  1BIB A;  2A08 A;  2YSQ A;  4DBQ A;  1OUL A;  2W10 A;  3EGU A;  1M5Q 1;  1VQ5 T;  3EGX A;  4KGZ B;  5GAO n;  2QQS A;  1RLQ C;  4KT0 E;  2K2M A;  3JV3 A;  1WHL A;  4OB1 B;  4QQD A;  1G5V A;  3ZEH A;  1UEB A;  4BUG A;  4PJJ A;  3DB4 A;  3I56 Q;  1YCS B;  2IVW A;  4M78 B;  3OYH A;  2LT4 A;  4X34 A;  5GAN 3;  3EG9 A;  1WJR A;  4A54 A;  2O2O A;  3M9Q A;  3CCV T;  5LJ5 d;  3GF5 A;  1B07 A;  4F7U E;  2A3L A;  1YI2 A;  4HT9 A;  4D8K A;  4J7F A;  1GBQ A;  2EQU A;  2QGG A;  2D6F A;  5FRO A;  4RCB A;  1K1Z A;  1S1N A;  2CGH A;  2E12 A;  2L3R A;  4OGC A;  2HZY A;  3J80 E;  2DNU A;  5C0M A;  3M53 A;  5CQX A;  3CXC S;  1WHM A;  2DL8 A;  5LJ3 h;  3TCJ A;  4CI0 C;  1K8A U;  2OX7 A;  4PJM A;  4ZTF A;  1NJI R;  2NYS A;  3JB9 F;  3LWI A;  2YLB A;  1RL2 A;  1RAC B;  1KC8 R;  1NJI C;  4J6X A;  1BCO A;  4A63 B;  5HY6 A;  3OY9 A;  2OTJ A;  4NS5 A;  3SWN A;  2LTO A;  2RHI A;  4J8O A;  1KFZ A;  4FYV B;  2VXE A;  5CKD A;  2KDS A;  4RTZ A;  5IHK A;  2QQB A;  2DE0 X;  3CCU Q;  1KQS A;  1OV3 A;  1KK7 A;  1T3S A;  1K4U S;  1AWX A;  3M0T A;  5GMK m;  1NLP C;  3VS5 A;  2EQI A;  3G71 Q;  2DVJ A;  4BAC A;  2X35 A;  3A8H B;  4HVV A;  4PFO A;  5A0L A;  1RLP C;  2ZPI B;  2RMO A;  5GAO m;  1YJN Q;  4C92 F;  8AT1 B;  2C0I A;  1GCQ A;  4XU1 A;  2K3B A;  2M9U A;  1NLO C;  1U5S A;  3VUB A;  2XU8 A;  3H9N A;  1G2B A;  3JCM c;  2OTL A;  1OZ2 A;  2KGT A;  3WVE B;  2QQA A;  4ZGD B;  4JJN K;  2O9V A;  1YBY A;  5KCO A;  2XDD A;  1QWE A;  3QJ6 A;  4EMH A;  3I55 Q;  2EYY A;  2P4T A;  4AFU C;  2FVU A;  1YN8 A;  3ME9 A;  3OYB A;  3M0Q A;  2C06 A;  1UTI A;  3EGX B;  3CME A;  4ELY C;  2DD4 A;  2O01 E;  4R0K A;  3MEV A;  2DTI A;  3CC2 Q;  3SWN C;  3HRU A;  1PSE A;  3JB9 I;  1YHQ T;  2MOX A;  2CKK A;  2DXT A;  2QTX A;  2A37 A;  2LQK A;  4HXJ A;  3KBG A;  4XU0 A;  3X20 B;  3FRN A;  3KXT A;  1JJ2 A;  2I0N A;  3URG A;  1YJ9 Q;  2DLP A;  1KD1 R;  2P84 A;  3VS4 A;  5LJ3 f;  2XDP A;  3JCM W;  2E1H A;  4BDZ A;  4IUR A;  2EKH A;  1WQ7 A;  4Y28 E;  1M3A A;  5CVI A;  3CMA T;  1GCQ C;  2E4H A;  2OTL T;  2JJ9 A;  1BI1 A;  5DY9 A;  1TSF A;  4AFZ C;  2J06 A;  3QWY A;  1K76 A;  1H3Z A;  3M4Y A;  1EIF A;  4C5E A;  3UWN A;  2NUZ A;  1YIT Q;  2FB7 A;  3DLM A;  4JJB A;  3CCM A;  4IUV A;  2LQN A;  5GAM e;  1PNJ A;  1M1K R;  2ESW A;  3SWN B;  2LZ6 B;  5D7U A;  1I4K 1;  2FRY A;  2LJ3 A;  4ZN1 A;  4JRP A;  5IN1 A;  3CCL T;  4M75 D;  4Y91 A;  4R55 A;  2X3W D;  2BUD A;  1GBR A;  4E7L A;  4IUQ A;  3G6E A;  1BK2 A;  5GAO r;  2KXC A;  4M75 E;  1YI2 Q;  3FJP A;  3PTA A;  2MAM A;  3V7S A;  2ZZD A;  2VXF A;  4HVW A;  1TWB A;  2JN0 A;  2EJG A;  2SRC A;  3CC7 A;  3FJ5 A;  2EQJ A;  3QUI A;  4M77 F;  1VQL A;  3V8L A;  1WLP B;  2L8D A;  2JT4 A;  1CKA A;  1QQJ A;  1BKB A;  3PGG A;  5CKB A;  3OYJ A;  2EQK A;  2MWP A;  1PCX A;  2GCX A;  4JUV A;  3GLX A;  3RNJ A;  4RTX A;  4BE1 A;  3OS5 A;  1M3C A;  2QQR A;  4O5V A;  2YT6 A;  1PM3 A;  1KHC A;  2J05 A;  3Q1J A;  4M7D F;  1UJY A;  1ZLM A;  1WHH A;  4C8Q G;  4QVC A;  3QG1 A;  2CH4 W;  4R56 A;  2K5L A;  2G6F X;  3LYI A;  1YFN A;  2M51 A;  3UA6 A;  1GFD A;  4F04 B;  3EFO B;  2QEX A;  1VQP A;  1SHF A;  2HL3 A;  3PIO A;  2L3Q A;  4XU2 A;  1UJ0 A;  2DXB A;  2F2V A;  2FZC B;  1OYX A;  2L3S A;  5I22 A;  1RAD B;  4GLK A;  4JJC A;  4RTU A;  5A2Q E;  3PVQ A;  2FYK A;  1Y96 A;  3CC7 T;  1OQK A;  1VQL T;  1D1A A;  1EFN A;  4M7D E;  2RQU A;  1QVG A;  3EAE A;  4FU6 A;  2V1R A;  2GQI A;  3CCQ T;  2E6Z A;  3ZL7 C;  4BI8 B;  3TU4 K;  1WI7 A;  2V8J A;  1H92 A;  4Z8A A;  5FRN A;  4J9H A;  1VIF A;  1DJ7 B;  2CH4 A;  4PNO A;  2QDL A;  1WGS A;  5LJ5 j;  3EFR A;  3G7Z A;  2E6N A;  1ZHI A;  3E9G A;  2COW A;  4QQG A;  2F1L A;  3BE3 A;  4MMK A;  5GAO p;  4KBM B;  2E65 A;  1VQP T;  4A4F A;  2LT1 A;  2NUT A;  3JSC A;  2NUP A;  4J9E A;  1X2K A;  2PNI A;  4HCC A;  1YP5 A;  5LJ5 g;  1VQK T;  3L2Z A;  1TTH B;  4ZNX A;  4F7U G;  2QA4 T;  4DOV A;  1AZG B;  2AZS A;  3OBW A;  1IRE B;  1NM7 A;  4JDS A;  2XG8 D;  1XJW B;  1Y0M A;  4FW1 A;  1KIK A;  4RKU E;  1XOV A;  2ED0 A;  4QT7 A;  2ZPE B;  3LH5 A;  2EYZ A;  5GAM d;  1N6A A;  1B3Q A;  2YRC A;  1VQ9 T;  2K4Y A;  4RG2 A;  1W1F A;  2V26 A;  3FLG A;  4BDY A;  2X4X A;  4J6W A;  2RI3 A;  1Q7Y R;  1R8O B;  2F2W A;  4J9G A;  3CCM Q;  3MPU B;  5CO7 A;  1RI9 A;  4LDW A;  1Q7Y C;  2CYZ B;  3KUF A;  1IZ6 A;  1MUZ A;  1UGV A;  4L6V 5;  3VRY A;  2COY A;  2K5F A;  3V7R A;  4XTV A;  3QXE B;  1SF9 A;  1BI2 A;  2VGN A;  4C8Q A;  2H3J A;  2XDB A;  2DXU A;  4NL3 A;  3G6E Q;  2ECZ A;  2HCK A;  4AFQ C;  1H3H A;  2LQW A;  2I2L A;  2M1H A;  4L59 A;  5HK3 A;  5LJ5 h;  5DM7 R;  5A0D A;  4ORZ A;  3OW2 P;  1K0S A;  1A0N B;  2KNB B;  2RA2 A;  4XTY A;  2DFU A;  3VYG A;  3SDZ A;  1Y96 B;  5I2M A;  2KI7 A;  4M7A F;  2KRS A;  5KYU B;  2D1X A;  3MKD A;  1JXM A;  4Z88 A;  3O5Z A;  5CKF A;  1I1J A;  1TXQ A;  3ZFJ A;  1VQ8 A;  3M0S A;  1KJW A;  4F17 A;  1HD3 A;  1PSF A;  1SEM A;  2X4W A;  5CKH A;  3M0U A;  3C4S A;  4F16 A;  2LVM A;  3L42 A;  4JRK A;  2EGA A;  5KYW B;  1VQ4 A;  1Q82 R;  1RI0 A;  1GFC A;  1M27 C;  4HVU A;  3QZ5 B;  3ER0 A;  1E7O A;  4F14 A;  5GAN e;  1YJW A;  2SEM A;  4C8Q C;  3CCE T;  4PJO F;  2NUT B;  2X4J A;  2EJF A;  1Q95 G;  3CD6 A;  1KG1 A;  2NUP B;  2HBW A;  1CSK A;  1BI0 A;  2R5M A;  1PKT A;  2B8A A;  2VUB A;  4Z02 A;  4RTT A;  2WSF E;  1D1B A;  1ACM B;  2LX7 A;  4FT4 A;  3QBY A;  2O4X B;  4E2F B;  1WQW A;  1FMV A;  4C0Z A;  4A4K A;  4F7U A;  1ZSZ A;  1QVF S;  1X2Q A;  1CKB A;  3CCS Q;  4HA8 A;  1N8R C;  1HK9 A;  4BD3 A;  4II1 A;  3SEM A;  1VQ8 T;  2DZC A;  1TS9 A;  2DTH A;  1G3T A;  4JS5 A;  4OF1 A;  1WHJ A;  2D0N A;  2DET A;  2AIR B;  1WJS A;  1M4Z A;  3V7C A;  5EG2 A;  1W2B P;  1VQM Q;  5IT9 E;  1PHT A;  2DXC A;  3MHX A;  3QYG B;  2L3P A;  4AG1 C;  2CUD A;  3PMI A;  1I5O B;  4C0G A;  2Y90 A;  1M90 C;  5HCK A;  4C8Q B;  2M02 A;  1QW1 A;  2JMA A;  4RG8 A;  1D0Y A;  1UHC A;  1U1S A;  3X25 B;  2V1Q A;  2XKO C;  1G3W A;  2ABL A;  4M75 G;  3BY7 A;  1UHF A;  2DBM A;  1R0B G;  4C5G A;  5GAN 6;  4J9C A;  2MI6 A;  2RJD A;  3P8B B;  3VKI A;  4M78 F;  4JLI A;  4XQ3 A;  3RKY A;  5GAN 4;  5CIU A;  3HSB A;  3S6W A;  1Q86 R;  1UE9 A;  1V1C A;  1AVZ C;  4D6W A;  2DKG A;  3I5S A;  3RER A;  3CC4 Q;  1Q86 C;  2GF7 A;  5GAN 2;  2AZV A;  2QK0 A;  3QDR B;  1ZSZ C;  3HL8 A;  1Q81 C;  3G71 T;  2GTO A;  2RHY A;  2FZK B;  1S72 A;  2GNC A;  3DLL A;  2DK3 A;  5I21 A;  2KAF A;  1MV3 A;  4J9I A;  1YJN T;  1ABQ A;  2HKQ B;  4IUT A;  4PFZ A;  3NTH A;  4RCC A;  2BE7 D;  1JBM A;  2EBP A;  3EH2 A;  4B9W A;  3CPW P;  1FWZ A;  3OMG A;  4N4G A;  4RUG A;  1UEC A;  3TEE A;  2DYB A;  4NL2 A;  3R6O A;  4J6Y A;  4OGE A;  4QQ6 A;  2P4R A;  2HEQ A;  1NYG A;  1M9S A;  3RDV A;  1WXT A;  2HSE B;  3R6N A;  1ZBJ A;  1WHK A;  2XID A;  1WNL A;  2KRN A;  3DB3 A;  4OMN A;  2BZX A;  2RO0 A;  4C5H A;  2EWN A;  3NMZ C;  4XTW A;  1RUW A;  1KSW A;  1BBZ A;  1MGQ A;  1ZSZ B;  3MEW A;  4PL6 A;  3RES A;  4Z89 A;  4M7D G;  2DVE A;  1FMK A;  1K73 R;  3MET A;  2E64 A;  4AFS C;  1S72 T;  4MZM A;  1K73 C;  5GAN d;  4X1V A;  1KC8 C;  1NJI U;  5M9O A;  2F2X A;  3M58 A;  2CRE A;  2DRM A;  3VUZ A;  1YJW Q;  1YHQ A;  1KC8 U;  4DBH A;  2RQW A;  1VQ6 A;  5D6W A;  1FXX A;  1MMD A;  5GAM j;  3E1S A;  2GTJ A;  3A98 A;  5KYN A;  2QYZ A;  2RI2 A;  3OYK A;  3JB9 D;  2CZ7 B;  3C12 A;  1U1T A;  1ARK A;  1MNE A;  2KEA A;  2ROT A;  3OBY A;  2FPE A;  2VWF A;  3UAT A;  4E7Z A;  1O9S A;  4FT2 A;  4M75 A;  1MMG A;  3CMA A;  3OSS C;  1AOJ A;  1BI3 A;  4CRI A;  2HAX A;  2RH2 A;  2DER A;  5KYX B;  4CC7 A;  2ZPB B;  5J3B A;  5GAM g;  1QWF A;  4A53 A;  2AT1 B;  2ED1 A;  1VQ5 Q;  4C0F A;  2DEQ A;  3FC3 A;  4OML A;  5GMK l;  4FSX A;  1M1G A;  2RHX A;  4ANJ A;  4KGV B;  4LN2 A;  4E7K A;  2W0Z A;  3UF4 A;  4C92 D;  3CCJ A;  3CCL A;  3HTR A;  3CCV Q;  3BDL A;  1ZX6 A;  1AEY A;  2KXD A;  3VV0 A;  4C92 E;  1VQ6 T;  3EG9 B;  3RIR A;  5D6Y A;  2ZAE A;  2DAQ A;  5IH2 A;  5FRM A;  4A4H A;  1KQS S;  3EHQ A;  2LNV A;  2O31 A;  4LUD A;  3M59 A;  3CQT A;  3CXC P;  1VOM A;  3P8D A;  2LJ1 A;  1JQQ A;  1KD1 C;  2HDA A;  5GAM h;  1TUC A;  4M75 C;  4AMC A;  2ZPG B;  3HFO A;  3NTK A;  1KD1 U;  2DRK A;  1T0H A;  3AT1 B;  3RKW A;  1IGQ A;  4IUP A;  3BDU A;  2EQM A;  3J7A F;  3G4S A;  1VUB A;  1HSQ A;  3PE0 A;  3M56 A;  1OEB A;  3U23 A;  2OJ2 A;  3FIF A;  1B7T A;  2RPN A;  1LJO A;  3RKX A;  5I11 A;  4AT1 B;  1YWO A;  1VYU A;  3CCJ T;  2HMA A;  4IIO A;  2HKN A;  1IRX A;  1M1K C;  3CBM A;  3OYN A;  1XQH A;  5FWB A;  1JO8 A;  2QI2 A;  1OOT A;  1JB0 E;  2AKK A;  2PVD B;  5C6S A;  2E10 A;  2ZPF B;  4ELZ C;  4BI4 A;  1T3L A;  2RJE A;  3JCM J;  3OMC A;  4LDY A;  2PTK A;  4FYX B;  2MF2 A;  5I2S A;  4J83 A;  3OS2 A;  1N9S A;  1UFF A;  4EMG A;  1M30 A;  4M75 B;  3OW2 A;  2DL4 A;  3M0P A;  2F69 A;  1JJ2 S;  4AG2 C;  1FMW A;  3CCQ A;  3MCA B;  2JVV A;  3PNW C;  4J7I A;  1AWW A;  5FWC A;  2OTJ Q;  2QG9 B;  1NZ9 A;  1K9M R;  1VQ7 A;  3G4S T;  2K3Y A;  5GMK j;  3H6Z A;  2AK5 A;  1YHQ Q;  4PKC C;  4M77 D;  5KE2 A;  3RMQ A;  3V8K A;  1UDL A;  5L8R E;  2KRM A;  4EDU A;  4DBF A;  2CP2 A;  3MEU A;  2LCS A;  2A7Y A;  4M4Z A;  1OZ3 A;  4M77 E;  4TVR A;  4LUE A;  4X9D A;  3LLR A;  5L23 A;  4OB3 B;  2D9T A;  2JNG A;  5DLO A;  4OB0 B;  2QQ9 A;  2E5Q A;  1VQK A;  1PRL C;  4K11 A;  4J9D A;  2EGE A;  2QA4 A;  3EG3 A;  2H3E B;  2C0T A;  5GAM f;  3CMA Q;  1NEG A;  4M7D D;  1PD0 A;  3A1P A;  2OTL Q;  2KY9 A;  1VQN A;  4X9C A;  1VQ9 A;  2YHT A;  4QVZ A;  1LOJ A;  2LQ8 A;  2QDY B;  4MDW A;  4DEX A;  4HKE A;  5FLX E;  3PIP A;  3A8G B;  2LDM A;  2G3R A;  4QW2 A;  1M8V A;  3I35 A;  3NHN A;  4XU3 A;  3MP8 A;  2F5K A;  2X51 A;  2DM1 A;  3CME Q;  4XAX B;  1SSH A;  2XI9 A;  3C0C A;  5GJV B;  2DTO A;  1VQ7 T;  2CDT A;  1QKX A;  3CCL Q;  3OYL A;  2QTV A;  1U3O A;  1ZA2 B;  2DJZ A;  1NBE B;  4L5G A;  5DLQ E;  1D09 B;  1W2B A;  3BFM A;  3NPF A;  2EAY A;  5KH6 A;  2RD1 A;  4EMK A;  4A4E A;  2RI5 A;  4P5N A;  2DD5 A;  2DL5 A;  5FU7 C;  1ZUY A;  5GMK h;  3TSZ A;  3HRT A;  5KE3 A;  4DBR A;  4JZ4 A;  1QMC A;  3HFN A;  2CT3 A;  3RUX A;  3CCR T;  3QDF A;  1JJ2 P;  2KMT A;  2BE9 B;  1FX7 A;  5GAN j;  5GMK e;  2PZ1 A;  1VQN T;  1E6G A;  3H41 A;  2BZ8 A;  1WA7 A;  3REB B;  4ZN3 A;  3S3N A;  4E6R A;  1X6B A;  1RAF B;  2PVG B;  2E3I A;  2KT1 A;  1K0X A;  4QVD A;  1VQO A;  3KFV A;  1QVG S;  2YUO A;  5GAN g;  4XK8 E;  2Y4X A;  2L89 A;  5ECA A;  1Q7Y U;  2CT4 A;  3WVD B;  2EYW A;  2VC8 A;  2ZPH B;  3GNF B;  3M54 A;  2RJF A;  1OX9 A;  3CCE A;  5FU7 B;  3CPW A;  4GBQ A;  3GP8 A;  2PVO B;  3M57 A;  5GAN 7;  3CC7 Q;  4EMK C;  1TOV A;  2CSI A;  3JCM Q;  1VQL Q;  3A5Z B;  1HYO A;  5HK0 A;  2KBT A;  1VYV A;  5LL6 S;  2A0F B;  2EYQ A;  4BI3 A;  1WHG A;  2YUP A;  1Z9Z A;  3CCQ Q;  2KK4 A;  3WXM B;  3LX7 A;  3JB9 G;  5CAI A;  3I56 A;  2HBP A;  4E7S A;  5KYY A;  3ASK A;  1ZBX A;  2DZ9 A;  3RR6 A;  1SPK A;  1D1C A;  2LX9 A;  3QJY A;  4PJL A;  1X69 A;  1BIA A;  4KUD K;  4O6J A;  2HQX A;  2J6K A;  5GAN h;  3QHS A;  1YIJ T;  2FPD A;  4QKU A;  2IPO B;  2ZCF B;  1MV0 B;  4BE2 A;  1VQO T;  3INZ A;  2RQT A;  4KUI A;  2L0A A;  4LDX A;  2QEX Q;  1VQP Q;  1TUD A;  2J6O A;  4M7A D;  1F1B B;  5CKE A;  3CC4 T;  2LNH B;  1Q82 C;  2KE9 A;  1MND A;  2LCL A;  1RAE B;  3M4G A;  2PUO B;  2HL5 C;  1VQK Q;  4M7A E;  3HRS A;  3DKM A;  4PLI A;  4EMK B;  5CR2 A;  5KCH A;  4C92 G;  2HD0 A;  2RK2 A;  3SB2 A;  1WZO A;  2X4Y A;  1PC0 A;  1TG0 A;  4C8Q F;  1RAH B;  1W6X A;  2FL7 A;  3MEA A;  3VS7 A;  4LE9 A;  3LW5 E;  4IKF A;  3CCU A;  1M3B A;  1RAI B;  3I56 T;  3G71 A;  4DEY A;  2IIM A;  1SHG A;  1UB4 A;  3MJX A;  2Y4Y A;  3VS3 A;  2O88 A;  4Q5W A;  1MHN A;  3QII A;  1IB8 A;  1YJN A;  4WF2 A;  1N8R U;  4PJO D;  4MZP A;  3PMT A;  2LJ0 A;  2RB6 A;  5IXB A;  2DJQ A;  4ZGJ B;  3VS2 A;  4DQ2 A;  5J39 A;  1YCY A;  4IUU A;  2QGF B;  2YUQ A;  4PJO E;  2KR3 A;  2MMP A;  1LVK A;  1WPY A;  3GIB A;  2GBQ A;  5FW9 A;  2RN8 A;  5GAN 5;  3OS1 A;  4C8Q E;  2OAW A;  2XD0 A;  4FYY B;  1C1A A;  3I55 A;  1M90 U;  4E7J A;  3JCM V;  2YUN A;  2K5I A;  3I5R A;  1RAG B; 
#chains in the Genus database with same CATH homology
 1ZUK A;  2A36 A;  1AOJ A;  3RNJ A;  4RTX A;  4CC7 A;  2EVR A;  4RTY A;  1M3C A;  2MIO A;  2YT6 A;  2L2P A;  1QWF A;  2J05 A;  1UG1 A;  1UJY A;  1YNZ A;  2ED1 A;  1ZLM A;  2RNA A;  4WCI A;  2CH4 W;  4J9B A;  2G6F X;  1QLY A;  1IO6 A;  2K79 A;  2VVK A;  2M51 A;  1WDX A;  4OML A;  3UA6 A;  1OPK A;  1YWP A;  1GFD A;  1N5Z A;  1OPL A;  4LN2 A;  1SHF A;  5GJW B;  3ULR B;  2W0Z A;  4LNP A;  3UF4 A;  2L3Q A;  1UJ0 A;  2F2V A;  3RBB B;  2L3S A;  5I22 A;  4JJC A;  4RTU A;  1ZX6 A;  1AEY A;  2JW4 A;  3PVQ A;  4JJD A;  1ZSG A;  2JM9 A;  2KXD A;  4EIK A;  2DBK A;  1PRM C;  3QWX X;  2CSQ A;  2RQV A;  1X43 A;  5IH2 A;  3GBQ A;  3VS1 A;  4JZ3 A;  1GRI A;  3EHQ A;  1EFN A;  2E5K A;  4KRT A;  2O31 A;  2RQU A;  4LUD A;  5IHI A;  1WXB A;  1VYT A;  3CQT A;  4RTW A;  2V1R A;  2GQI A;  2CUB A;  3ZL7 C;  2LJ1 A;  1JQQ A;  1FYN A;  1WI7 A;  1WFW A;  2D8H A;  2HDA A;  4Z8A A;  1H92 A;  5IHN A;  1TUC A;  4J9H A;  1LCK A;  2ENM A;  2CH4 A;  2QDL A;  2DRK A;  1T0H A;  1JXO A;  2VKN A;  1ZUU A;  1HSQ A;  3PE0 A;  1M8M A;  1OEB A;  3U23 A;  2OJ2 A;  4HCK A;  2A28 A;  3REA B;  2RPN A;  3H0I A;  5EC7 A;  5I11 A;  1AZE A;  3EG2 A;  1YWO A;  1VYU A;  1K9A A;  2YDL A;  4J9E A;  4IIO A;  1X2K A;  2PNI A;  1YP5 A;  5FWB A;  3VS0 A;  1JO8 A;  1WYX A;  4ZNX A;  1OOT A;  1AWJ A;  2AKK A;  4J9F A;  1AZG B;  2AZS A;  3TVT A;  1NM7 A;  3EG1 A;  1T3L A;  1Y0M A;  1KIK A;  1WXU A;  1XOV A;  2ED0 A;  4QT7 A;  4Y92 A;  4OMO A;  3LH5 A;  2EYZ A;  2DF6 A;  1B3Q A;  1PKS A;  2PTK A;  3I9Q A;  1W1F A;  2OI3 A;  1G83 A;  4D8D A;  1UFF A;  2FRW A;  1M30 A;  2J6F A;  2LP5 A;  2DL4 A;  3M0P A;  2F2W A;  4J9G A;  2FO0 A;  1JU5 C;  2FPF A;  4AG2 C;  1RI9 A;  3EG0 A;  2FEI A;  2XMF A;  1MUZ A;  1UGV A;  2H8H A;  3VRY A;  1AWW A;  5FWC A;  1E6H A;  2JM8 A;  3UA7 A;  4OMM A;  2GGR A;  2DIL A;  3PVL A;  2EW3 A;  2B86 A;  2DX1 A;  2AK5 A;  2ECZ A;  2X3X D;  1ABO A;  2HCK A;  4AFQ C;  2KT8 A;  1UDL A;  1H3H A;  2LQW A;  2KRM A;  2JS0 A;  4IIM A;  2LCS A;  3VS6 A;  4M4Z A;  2DMO A;  4LUE A;  4ORZ A;  3SHW A;  4CC2 A;  5L23 A;  1K0S A;  1A0N B;  2KNB B;  1X6G A;  1HJD A;  1U06 A;  3VRZ A;  1PRL C;  1GCP A;  4K11 A;  2KRS A;  4J9D A;  1BB9 A;  2D1X A;  2EGE A;  3EG3 A;  2KYB A;  2A08 A;  2JTE A;  1WX6 A;  1JXM A;  1Z9Q A;  2YSQ A;  4Z88 A;  2C0T A;  3O5Z A;  1NEG A;  2W10 A;  1I1J A;  1Y57 A;  2O9S A;  3EGU A;  3M0S A;  1KJW A;  4F17 A;  1HD3 A;  1SEM A;  1QCF A;  1UUE A;  3M0R A;  1RLQ C;  2EYX A;  2K2M A;  3JV3 A;  2KRO A;  4DEX A;  3M0U A;  4F16 A;  2RF0 A;  3I35 A;  2EGA A;  3NHN A;  1YCS B;  1X27 A;  1I07 A;  2DM1 A;  1GFC A;  1M27 C;  4HVU A;  1SSH A;  3C0C A;  5GJV B;  2CDT A;  2O2O A;  1QKX A;  1E7O A;  4F14 A;  1B07 A;  1AWO A;  2SEM A;  4D8K A;  1GBQ A;  1U3O A;  1W70 A;  2M0Y A;  1K1Z A;  3NPF A;  2HBW A;  1CSK A;  1S1N A;  1PKT A;  2DL5 A;  4RTT A;  1ZUY A;  2DNU A;  2DL8 A;  3TSZ A;  2LX7 A;  4JZ4 A;  1X2Q A;  1CKB A;  2CT3 A;  1PWT A;  4RTV A;  3SEM A;  2AKL A;  4A63 B;  2PZ1 A;  4CC4 B;  1E6G A;  1NG2 A;  2C0O A;  3H41 A;  2DL7 A;  2BZ8 A;  2D0N A;  1T0J A;  1WA7 A;  3REB B;  4ESR A;  1KFZ A;  5IHK A;  4RTZ A;  2MCN A;  2DE0 X;  4CC3 A;  4E6R A;  1X6B A;  1PHT A;  2NWM A;  1OV3 A;  2KT1 A;  1K0X A;  1T3S A;  1K4U S;  1AWX A;  3M0T A;  2L3P A;  1NLP C;  3VS5 A;  4AG1 C;  2CUD A;  3KFV A;  2EQI A;  2YUO A;  5HCK A;  2DVJ A;  4HVV A;  5ECA A;  1RLP C;  2RMO A;  2CT4 A;  2EYW A;  1J3T A;  2JMA A;  2LMJ A;  1UHC A;  2C0I A;  1GCQ A;  1NEB A;  2V1Q A;  2BZY A;  2ABL A;  1NLO C;  1U5S A;  2K3B A;  1UHF A;  2DBM A;  4GBQ A;  2EGC A;  4J9C A;  1G2B A;  2KGT A;  1AD5 A;  4GLM A;  2EPD A;  1NYF A;  2ROL A;  2CSI A;  2O9V A;  1UE9 A;  1VA7 A;  1V1C A;  1AVZ C;  4OMP A;  1QKW A;  2KBT A;  3I5S A;  1VYV A;  1QWE A;  2EYY A;  5IXF A;  3H0F A;  2BTT A;  2YUP A;  4AFU C;  2AZV A;  1Z9Z A;  1YN8 A;  2GTO A;  3M0Q A;  2GNC A;  1UTI A;  1H8K A;  1MV3 A;  2D8J A;  4J9I A;  1ABQ A;  4R0K A;  1SPK A;  4OMQ A;  2K9G A;  2EBP A;  2MOX A;  1JEG A;  1I0C A;  1X69 A;  2J6K A;  2A37 A;  2FPD A;  4HXJ A;  4JPB W;  1MV0 B;  4RUG A;  3NGP A;  2DA9 A;  1UEC A;  1SRM A;  2RQT A;  2DYB A;  1BU1 A;  2J7I A;  2L0A A;  2I0N A;  1TUD A;  2J6O A;  4FSS A;  2P4R A;  2LNH B;  2DLP A;  2HEQ A;  1NYG A;  3VS4 A;  2KE9 A;  1WXT A;  3R6N A;  1ZBJ A;  2EKH A;  1M3A A;  2KRN A;  1GCQ C;  4OMN A;  3H0H A;  2BZX A;  4AFZ C;  1SRL A;  2J06 A;  3QWY A;  2DL3 A;  1K76 A;  1TG0 A;  3NMZ C;  1RUW A;  1GL5 A;  2JXB A;  1KSW A;  1W6X A;  3EHR A;  1BBZ A;  3VS7 A;  4LE9 A;  2NUZ A;  4JJB A;  4Z89 A;  1FMK A;  2LQN A;  1M3B A;  4AFS C;  1PNJ A;  2ESW A;  2KYM A;  2LZ6 B;  2RQR A;  4DEY A;  2IIM A;  2FRY A;  2LJ3 A;  1SHG A;  4X1V A;  2FG0 A;  3VS3 A;  2O88 A;  2X3W D;  1GBR A;  2LJ0 A;  2F2X A;  2CRE A;  2HSP A;  2DRM A;  1BK2 A;  5IXB A;  2DJQ A;  1WIE A;  3VS2 A;  2KXC A;  2YUQ A;  2K6D A;  2KR3 A;  4HVW A;  2RQW A;  3IQL A;  2SRC A;  2GBQ A;  3FJ5 A;  5FW9 A;  2JMC A;  2RN8 A;  2GTJ A;  3A98 A;  1WLP B;  2OAW A;  2JT4 A;  1CKA A;  3THK A;  1ARK A;  2JS2 A;  2KEA A;  2ROT A;  2YUN A;  2FPE A;  2VWF A;  3UAT A;  3I5R A;  2K7A A;  3TSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...