4RUUA

Crystal structure of the q108k:k40l mutant of human cellular retinol binding proteinii in complex with all-trans-retinal after 24 hour incubation at 1.4 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
133
structure length
133
Chain Sequence
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTLVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKKWIEGDKLYLELTCGDQVCRQVFKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein 2
publication title Tuning the electronic absorption of protein-embedded all-trans-retinal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ruuA00
4CK4A 5FAZA 3CBSA 3STKA 4O9SA 4YCHA 2WEWA 1TOWA 2MO5A 2AMMX 4YGGA 4ZHCA 1AELA 1LIFA 5D45A 1E06A 5HAEA 1ACDA 5HZQA 1CBSA 3BDRA 3FA6A 1KZXA 1KT5A 1LIEA 2NNEA 4NNSA 5EEEA 1TW4A 3NPOA 1LPJA 1E5PA 4LKPA 1GM6A 1JYJA 3FW5A 2GTFX 1FENA 3B2HA 2OFRX 1ZNEA 1BWYA 1B4MA 5FFHA 1O8VA 2A2UA 2A13A 4GKCA 3TGAA 3BSZE 3CQNA 1LNMA 1ADLA 3WJBA 1G85A 1AQBA 5KHPA 2QO6A 1EXSA 4YKOA 3BRNA 1JYDA 4I9RA 2Q39A 4NNTA 1ERXA 1YWDA 2HYSA 2JU7A 4GRJA 3B2JA 1KT7A 5B29A 2WWPA 1BBPA 3ELXA 4IAWA 4QAEA 1ZNGA 4ZCBA 3Q6LA 4IAXA 3C77X 2CM4A 5H9LA 3ELZA 1YWCA 3F8AA 2W2FA 3B2IA 3RSWA 3U0DA 4OMWA 3WJFA 1BSOA 1MX7A 2LFOA 3KFFA 3NP1A 1DZKA 2LBAA 1YUPA 3VG3A 1T8VA 4IB6A 4Y0RA 3L4RA 1I04A 1NP4A 4DQ3A 1LIDA 5DG4A 2WUTA 4MVLA 4YBPA 4M7MA 5HTDA 4YFQA 3FR2A 3C76X 5BVSA 2K62A 1UREA 1O1VA 4A1YA 4ZHDA 2W2BA 5HA0A 4Y0QA 2QO4A 1LFOA 5LKEA 4YGHA 1FEMA 4NYQA 2L68A 4YFPA 5EDBA 3P6HA 1SXWA 1X8OA 2HLVA 1PBOA 2AT5X 4D6BA 1Z24A 3FENA 1EALA 1SY3A 1P6PA 1DF3A 2ACOA 4I3CA 2MJIA 1H91A 1OPAA 3JSQA 2WQAE 3HWDA 4YDAA 3HWGA 5D4AA 1QFTA 5F1EA 5IO7A 1GGLA 3D95A 4A1HA 3HWEA 3FLLA 1NP1A 4WFUA 2CZTA 1CBIA 1QFVA 4HPBA 3I0AA 1KT4A 1DV9A 4QZTA 2L9CA 3KQ0A 2ALLX 2HMBA 1JJXA 4ORSA 4IB7A 3UEWA 4ORXA 1AVGI 1GX8A 4AZOA 3FR5A 4AZRA 3NX1A 1KZWA 1GKAB 2G78A 1HMRA 2LB6A 4XMCA 1DZMA 4ZH6A 4QGXA 4QYPA 4TJZA 2FLJA 3APXA 3CMPA 3PPTA 1SA8A 3BLGA 4LKTA 3OJYC 2CZUA 4ZR2A 2P8GA 4LZVA 1O1UA 3BU1A 5JR8A 4GNWA 2A0AA 1GXAA 3APVA 3T1DA 3CQRA 1E00A 3FA7A 1CBRA 5HBSA 1QY0A 1RBPA 1SXYA 5D8JA 1GKAA 4ORUA 1GT4A 1ZNDA 1KT3A 4A8ZA 1B8EA 4ZHGA 3FMZA 4DQ4A 3TZSA 1BEBA 5HTEA 2FR2A 2X46A 3NQ9A 5LJEA 2ACPX 1LKEA 2WQ9A 3TF6A 3WJGA 1PMPA 3P6CA 3C78X 5F6ZA 5C0NA 4NLIA 4GH7A 1BRQA 1X8UA 1X8NA 5H9AA 4AZPA 3WJDA 3NR3A 3VG7A 3ZQ3A 1A2DA 1KQXA 2RQ0A 5H8TA 1OEKA 4TLJA 2FTBA 2L5PA 4GE1A 2FS6A 4M6SA 1VYGA 4R0BA 3KFIA 1T68X 1GX9A 1OPBA 4N7DA 1G5WA 2R74A 3I17A 3PH5A 5F6BA 4UU2A 1JBHA 2AT0X 1X89A 1AB0A 4D6AA 2IFBA 3O22A 4N7CA 4ALBA 5LJKA 4NYRA 1MUPA 4IMNA 1D2UA 1SY1A 1RLBE 1I4UA 3WBGA 4ZGUA 3BS2A 2LKKA 4ZH9A 3D96A 1LIBA 4OS0A 4XMFA 4WBKA 4YGZA 2X45A 1S2PA 1DZJA 1KT6A 5H9KA 1ICNA 2JN3A 4K19A 5BVTA 3KZAA 5FENA 3WJEA 5EDCA 4HPCA 3FR4A 5LJBA 5DPQA 1N0SA 5F58A 2FS7A 3P6FA 4YFRA 4TQ2A 3B2KA 4XMHA 1EW3A 1B56A 5EPQA 4XMGA 1EQDA 1ZRYA 4ZHFA 3U9PC 3DSZA 2FWVA 2KTDA 3EM0A 3P6EA 2RCQA 2NNDA 3VG6A 5D47A 2POAA 3EBKA 1OEJA 2LBVA 1D3SA 4OS3A 3VG5A 1YP6A 1ZNKA 1B0OA 4I9SA 5LJDA 4TKBA 4ORRA 5L8OA 4GETA 1IW2A 3P6DA 2KT4B 3TGCA 1EIOA 1QWDA 3IA8A 4QYNA 2OZQA 3PP6A 5HWZA 1HMTA 1QQSA 1GT1A 3CR6A 5LJHA 2PY1A 3HK1A 3MVFA 5L8IA 4ALOA 1A57A 2AT8X 1I05A 1VPRA 2JU8A 4BVMA 1DFVA 4YCEA 1CJ5A 3STNA 2ANSA 5IO6A 4AW8A 1DC9A 3EYCA 4OMXA 1QY1A 3EBWA 1JZUA 3DTQA 2ASNX 3VG4A 3WVMA 2G7BA 4UU3A 2HZRA 1I06A 3B2LA 2Q4NA 2Q9SA 3FELA 5HZ8A 4TKJA 2NNQA 5HZ5A 2QOSC 2AKQA 1TXLA 3GAQA 4YH0A 1SXUA 3NADA 1KXOA 3CWKA 1ZNHA 2AL0X 3PECA 4NP1A 3HWFA 2CM9A 1IKEA 1EIIA 5EEDA 1BRPA 2OVAA 2JU3A 2HNXA 3BX8A 4HPAA 2R56A 4RUUA 1HMSA 1FTPA 1MDCA 4WFVA 5HA1A 2WEXA 5D48A 5F7GA 4EFGA 2GJ5A 3O2YA 1LICA 1QABE 1OBPA 1HBQA 3APUA 4QZUA 2RD7C 1JV4A 1BSQA 4XMDA 4AZNA 2O62A 1BJ7A 1IFCA 5HCDC 2OVDA 1EUOA 4YMYA 3BY0A 4IB9A 2A2GA 4NLJA 3KFGA 2MM3A 3F9DA 1HN2A 2W2AA 1ML7A 4KIIA 1ALBA 2EU7X 3KFHA 2NP1A 1XKIA 3UEUA 1SXXA 1BSYA 3FIQA 1T0VA 2RCTA 2Q2PA 2JOZA 4ZHHA 3EMMA 2E4JA 1HQPA 4ZJ0A 5K06A 3UEXA 1QG5A 1YWBA 5LJCA 4ES7A 2AT3X 1YIVA 2G79A 3FW4A 5LJGA 1FELA 1TVQA 2AH7X 3UEVA 4MVKA 3BU9A 3O19A 4LZUA 4EDEA 5CE4A 3TGBA 1HBPA 4AZMA 1BLRA 3STMX 2F73A 3WJCA 4PSQA 1BM5A 2WSJA 1IFBA 4YKMA 1GT3A 2DM5A 1S7DA 1LF7A 1ZNLA 2XKLA 1VYFA 2XSTA 1XCAA 4TKHA 5HZ6A 1E02A 3K3LA 2CBSA 5B27A 1YP7A 1JJJA 2HZQA 4HFOA 4I3DA 5LKFA 1IKJA 1PM1X 1FE3A 1MVGA 1U17A 1G74A 3NQ3A 2L67A 1YWAA 1SY0A 2K23A 4ODDA 4ZFXA 2R73A 4GNYA 4ORYA 1UZ2X 2N93A 3P6GA 4IB8A 4OS8A 3RZYA 4BOEA 3APWA 2BLGA 2FT9A 1KQWA 3VG2A 3JS1A 1DZPA 4YDBA 2Q2MA 3U03A 1U18A 4Y0SA 5HZ9A 1EPAA 1FDQA 1G7NA 3IFBA 3NX2A 1X8PA 2WR6A 1TOUA 4YBUA 4AYHA 2A3FX 2YG2A 5AQ6A 4XMEA 2QM9A 2OVEA 1KOIA 1OBQA 1X71A 5L8NA 4EEJA 2FRSA 1EPBA 2CBRA 1QY2A 4TNNA 1IIUA 1SY2A 3BX7A 4AZQA 3PH6A 4QGVA 3QKGA 4IMOA 3WXQA 2QO5A 1PEEA 3D97A 4HPDA 4MVIA 1X8QA 1CRBA 3FEKA 1KGLA 1MX8A 4BQUA 3FEPA 4I3BA 2AT6X 1R0UA 5KIDA 3CBCA 3ZUIA 1A3YA 1GT5A 3MBTA 3AKNA 4Y0PA 1CBQA 1A18A 4QGWA 3AKMA 3FA8A 4EXZA 3ZUOA 3PEDA 4RUNA 4IBAA 5HCCC 2GC9A 2FR3A 4ORWA 5HCEC 2RA6A 2OFMX 4ARHA 5IO5A 1OBUA 3FA9A 1ICMA 1L6MA 3S26A 5H9NA 4A60A 5BVQA 1ERBA 1S44A 3G7XA 5KICA 3SAOA 5EZ2A 1NGLA 1OEEA 1U0XA
chains in the Genus database with same CATH superfamily
1N43A 4CK4A 5FAZA 3CBSA 3STKA 2IZIA 4O9SA 4YCHA 2WEWA 1TOWA 2MO5A 2AMMX 4O4UA 4YGGA 1SWCA 3SZIA 1SWAA 4ZHCA 1AELA 2IZLB 1LIFA 5D45A 4BX5B 1E06A 4GJVA 3F6ZB 2OL7A 5HAEA 1ACDA 5HZQA 1CBSA 3BDRA 3FA6A 1KZXA 1KT5A 1LIEA 2NNEA 4NNSA 5EEEA 1TW4A 3NPOA 1LPJA 2OY1O 4OEMA 1E5PA 2AF5A 1SMPI 4LKPA 3HOLA 1GM6A 1JYJA 3FW5A 5AJCA 5CSEA 2GTFX 3OBLA 3ZI8A 4BX6B 1FENA 2LA7A 3B2HA 4O3XB 2OFRX 1ZNEA 1BWYA 4Z2PA 1B4MA 5FFHA 1O8VA 1DF8A 1VWNB 2A2UA 2A13A 4GKCA 5IRWA 3SLJA 4CSBA 1VWPB 2RTNB 3TGAA 2M4LA 2BHVA 2IZFB 2OVSA 1LNMA 1ADLA 2FGSA 3BSZE 3CQNA 5JD2A 1G85A 1AQBA 3WJBA 5KHPA 2QO6A 1SWOA 1EXSA 1PBYA 4YKOA 3BRNA 1RXJA 1JYDA 3VU1A 4I9RA 2Q39A 4NNTA 1ERXA 1YWDA 2HYSA 2JMBA 2JU7A 4GRJA 2RTFB 1KT7A 3B2JA 3LHNA 2WWPA 1BBPA 3ELXA 4IAWA 4INNA 1I9HA 4QAEA 5FQ8E 1ZNGA 4ZCBA 3Q6LA 2RTJA 4IAXA 3C77X 4BX6A 2CM4A 3FDCA 5H9LA 1SREA 3ELZA 2ZSCA 1YWCA 1WUBA 3F8AA 2W2FA 3Q34A 3B2IA 3MG5A 3RSWA 3VHHA 2Y3EA 3VE2A 3U0DA 4OMWA 3WJFA 1BSOA 2CAMA 1MX7A 2LFOA 1VWMB 1RSUB 3KFFA 1W4TA 3NP1A 3VE1A 3EC5A 1DZKA 2LBAA 1YUPA 3VG3A 1T8VA 4IB6A 3P24A 4Y0RA 3L4RA 1I04A 1NP4A 2IZHB 2JW1A 4DQ3A 1LIDA 5DG4A 3CKGA 2HKDA 2RTLA 1SLFB 2WUTA 1SWDA 4MVLA 4YBPA 4M7MA 5HTDA 1SRIA 3CKFA 4YFQA 3FR2A 3C76X 1VWIB 5BVSA 1JJUA 2QOMA 2K62A 3RE6A 1UREA 1RXHA 4OELA 1O1VA 4A1YA 4ZHDA 4CPEA 1Y52X 2W2BA 3WZOA 5IRAA 5HA0A 4Y0QA 1LUQA 2QO4A 1LFOA 4GD9A 1NBXA 2F09A 2IZGB 1FEMA 4NYQA 2L68A 4QQ1A 4YGHA 3P6HA 4YFPA 1SXWA 1X8OA 2HLVA 2RTQB 1PBOA 2AT5X 4D6BA 1Z24A 3FENA 1EALA 1SY3A 1NQNA 2IZCB 1P6PA 1DF3A 2ACOA 4I3CA 4EKVA 2MJIA 1H91A 1OPAA 3JSQA 5FQ7E 2WQAE 3HWDA 4YDAA 3HWGA 5D4AA 1QFTA 3N91A 5F1EA 5IO7A 1GGLA 3D95A 4L1NA 2DJFA 1LELA 1MM9A 4LQZA 3SZHA 4A1HA 3HWEA 1LCWA 2JGSA 2OY5O 3FLLA 1NP1A 4WFUA 3WZNA 2CZTA 1CBIA 1QFVA 4HPBA 2OY7A 3I0AA 1KT4A 3VGWA 1DV9A 4QZTA 2L9CA 3KQ0A 3QQ2A 2A5BA 2ALLX 2RTBB 4JGLA 3RKGA 2I5ZO 2HMBA 2RTIB 4CDEA 1JJXA 4ORSA 4IB7A 1I78A 3UEWA 4C5PA 2Z4IA 4FBOA 3RWXA 4ORXA 4BGFA 1AVGI 1GX8A 5B2AO 4AZOA 3FR5A 4AZRA 2KD2A 1SWHA 3NX1A 1KZWA 1GKAB 2G78A 1SWPA 1HMRA 2RTGB 2LB6A 4XMCA 4CPHA 1DZMA 4ZH6A 4QGXA 5AJBA 2UYWA 4GGZA 2FHNX 1K3BA 1JMXA 4QYPA 4TJZA 2FLJA 3APXA 1UYNX 4GUZA 3CMPA 1IJ8A 1SWEA 2IZDB 1SA8A 3BLGA 3PPTA 4LKTA 2X8FA 4Y59A 3OJYC 2CZUA 4ZR2A 2P8GA 3LTWA 3PK2A 4LZVA 1O1UA 3BU1A 5JR8A 4GNWA 2A0AA 1GXAA 3APVA 4KCAA 3T1DA 2I5VO 1E00A 3CQRA 4B55A 4COTA 3FA7A 1CBRA 5HBSA 1QY0A 1RBPA 1SXYA 3T6FA 3ZZVA 1Y9TA 5D8JA 1GKAA 4ORUA 4FGIB 5B3MO 1GT4A 1ZNDA 4HWMA 1KT3A 4A8ZA 1B8EA 4ZHGA 1JQPA 2BT9A 3WOVA 3FMZA 4DQ4A 3TZSA 1BEBA 5HTEA 2FR2A 3VHIA 2X46A 1N7YA 3NQ9A 5LJEA 2ACPX 3ZW1B 1LKEA 2WQ9A 3TF6A 3WJGA 1VWRB 1PMPA 1OSPO 3P6CA 3C78X 2KW1A 5F6ZA 1GX3A 2QCBA 4NLIA 4GH7A 1BRQA 4CDFA 5B29A 1X8UA 1SWKA 1X8NA 3EW1A 3OD9A 5H9AA 4AZPA 4CDCA 2GH7A 1VWDB 3SLTA 3X00A 3WJDA 3E3CA 3NR3A 1STRB 4BX5A 3VG7A 3ZQ3A 1A2DA 1KQXA 2RQ0A 5H8TA 1OEKA 4TLJA 3WYPA 3PDFA 2FTBA 2L5PA 4GE1A 2FS6A 4M6SA 1VYGA 4R0BA 1VWFB 3KFIA 1T68X 1GX9A 1HXLA 3V8UA 1OPBA 4N7DA 1VWBB 1G5WA 3OE3A 3ZW1A 2R74A 2RTPB 2OFBA 3I17A 3PH5A 4IRWA 5F6BA 4UU2A 1JBHA 1VWGB 2AT0X 1KL5A 1X89A 1AB0A 4D6AA 4I95A 2IFBA 3O22A 4N7CA 4ALBA 5LJKA 4NYRA 1MUPA 1W5RA 1RSTB 4IMNA 1D2UA 1SY1A 1RLBE 5F2BA 2X4MA 1I4UA 3WBGA 1SWQA 4ZGUA 4ML7B 3BS2A 3HPEA 2LKKA 4ZH9A 3WZPA 2PI3O 3D96A 3T6LA 1LIBA 4OS0A 4XMFA 4YVBA 4OKAA 4CPFA 4WBKA 4YGZA 4Y5DA 2X45A 1S2PA 3AUMO 1DZJA 1KT6A 5H9KA 3RDSA 4BX7B 1AVDA 1ICNA 1UYOX 2JN3A 4K19A 4TKBA 3KZAA 5BVTA 5FENA 1SLEB 3WJEA 5EDCA 1SWNA 2RTKA 1MOYA 2Y3FA 4HPCA 3FR4A 5LJBA 4GU8A 1EI5A 2OFAA 5DPQA 3EW2A 3ZW0B 2VFBA 1N0SA 5F58A 2FS7A 3P6FA 4YFRA 4TQ2A 3B2KA 4XMHA 1EW3A 4O3WA 1B56A 5EPQA 4XMGA 1EQDA 1ZRYA 2OL8O 3U9PC 3DSZA 2FWVA 2KTDA 3EM0A 3NBXX 2X8TA 3P6EA 4O4OA 2RCQA 2NNDA 3VG6A 5D47A 2POAA 1Y53X 3FIDA 1WBIA 5IXGA 3EBKA 1OEJA 2RTCB 1VWJB 3HOEA 1Y0GA 2LBVA 1D3SA 4OS3A 4I6SA 3VG5A 4BX7A 1YP6A 1ZNKA 1B0OA 4I9SA 5LJDA 4BJ8A 2MHDA 4ORRA 2ZAGA 1NDJA 5L8OA 4GETA 2RTOB 1IW2A 3P6DA 4JHQA 5FQ6E 2VDFA 2KT4B 3RDUA 4Z2OA 5BYPA 2BS6A 4BCSA 4GJSA 4L3RA 3TGCA 1EIOA 1SLDB 3ZW0A 1QWDA 3IA8A 3SOTA 4QYNA 2OZQA 3PP6A 5HWZA 1HMTA 1QQSA 1STPA 1GT1A 3CR6A 3UAQA 5LJHA 3H3IA 2PY1A 5C0NA 4U8UO 3HK1A 4Z28A 3S60A 3MVFA 4O3ZA 2QMIA 5L8IA 4BBOA 4ALOA 2AVIA 4CPIA 1Y9LA 4O3YA 2VFCA 1A57A 2AT8X 3T2WA 1I05A 4FQBB 1VPRA 2JU8A 4GGTA 1DFVA 2RTEB 4YCEA 4BVMA 1CJ5A 2GTLO 3STNA 4GZVA 2ANSA 4KT5A 3RY2A 5IO6A 1LDOA 4AW8A 1DC9A 3EYCA 4U8UN 2OF9A 4OMXA 1HXZA 1QY1A 3EBWA 4EQAC 4NV8A 3DTQA 4O4XA 1JZUA 2ASNX 3VG4A 3WVMA 1KFFA 2G7BA 3RDMA 2ZAIA 1SRGA 4UU3A 3RY1A 2HZRA 1AVEA 1I06A 4U46A 3B2LA 1SWSA 2C1QA 2Q4NA 2Q9SA 2RTMA 3FELA 4MISA 4DNEA 5HZ8A 4TKJA 2NNQA 2GTLN 5HZ5A 3RDXA 2QOSC 2AKQA 5K68A 1TXLA 3GAQA 2BC3A 1VWHB 4YH0A 1SXUA 3NADA 5AEOA 4U8UM 2A8GA 1KXOA 4Z2VA 3CWKA 1ZNHA 1N4JA 2AL0X 3PECA 4NP1A 3HWFA 2CM9A 4CDDA 1IKEA 1EIIA 3P02A 5CHKA 1BRPA 5EEDA 1SRHA 4DCBA 2OVAA 2JU3A 2HNXA 3BX8A 4HPAA 2R56A 2G8CO 2GTLM 4RUUA 1HMSA 1K24A 1FTPA 1MDCA 2RTRB 4O49A 2FKJA 4WFVA 2FKGA 4MIRA 2WEXA 2X32A 1SRFA 5D48A 5F7GA 2GJ5A 5HA1A 4EFGA 3LV4A 1LICA 3O2YA 1VWCB 1QABE 4O4SA 2G5LA 1OBPA 1HBQA 3APUA 4QZUA 2RD7C 1JV4A 1BSQA 4XMDA 3T2XA 4AZNA 2IZJA 2O62A 2FHLA 2OL6O 3KVNA 4QNIA 1BJ7A 1LCVA 3MX7A 1IFCA 4Z27A 2OVDA 1EUOA 4YMYA 1NQMA 5HCDC 3BY0A 4IB9A 4JO6A 2A2GA 3PQSA 4NLJA 3KFGA 2MM3A 3F9DA 1HN2A 2OYBO 1HY2A 2IZEB 1ML7A 2W2AA 4KIIA 1ALBA 2EU7X 3KFHA 5B11O 3MM0A 2MF6A 2NP1A 2OF8A 1XKIA 2X56A 3UEUA 1SXXA 1BSYA 3FIQA 1T0VA 3WYQA 2X8SA 3RDQA 4ON1A 2UZ2A 2RCTA 2Q2PA 2JOZA 4ZHHA 4U3QA 3EMMA 2DJGA 2F01A 2E4JA 4NV7A 1HQPA 3RDOA 4ZJ0A 5K06A 1JMZA 3UEXA 4Z6JA 1QG5A 1YWBA 5K67A 5LJCA 4ES7A 2AT3X 1VWKB 1YIVA 2G79A 3FW4A 1FELA 1TVQA 4U9CA 5LJGA 4MVKA 3BU9A 3O19A 4LZUA 2AH7X 3UEVA 4EDEA 1LDQA 1HBPA 4AZMA 3TGBA 1VYOA 1BLRA 5L3YA 3STMX 2Z4HA 2F73A 3WJCA 2IZKA 4PSQA 1SRJA 1STSB 4I60A 2WSJA 1BM5A 3VPJE 1IFBA 1RXKA 4GK9A 4YKMA 2IZBA 1GT3A 2DM5A 1S7DA 1LF7A 1ZNLA 4FBVA 2XKLA 1VYFA 2XSTA 1JIWI 3S5VA 1XCAA 4TKHA 3AEHA 5HZ6A 1E02A 5CYBA 2C4IA 3K3LA 2CBSA 5B27A 1YP7A 3ZW2A 1JJJA 2IZAA 1Y55X 2HZQA 4HFOA 4I3DA 5LKFA 1IKJA 1PM1X 1FE3A 1MVGA 1SLGB 1U17A 1G74A 3NQ3A 2L67A 3S5XA 1NC9A 1SY0A 1YWAA 1W6FA 2K23A 1KL4A 2X55A 4ODDA 4ZFXA 4ZHFA 2R73A 2Y32A 3PQUA 5B5GA 3RBYA 4GNYA 4ORYA 1VWEB 2RTAA 5B5FA 1UZ2X 2X34A 2N93A 3P6GA 4GGRA 4IB8A 1SWBA 4OS8A 3RZYA 3SZJA 2KTSA 1KL3A 3VHMA 4BOEA 3APWA 1SWLA 2BLGA 1KQWA 2FT9A 3HTYA 4KC8A 2WPUA 3VG2A 3JS1A 1DZPA 3NQKA 4YDBA 2OY8A 1VWOB 2Q2MA 3U03A 1U18A 4Y0SA 5HZ9A 3FYFA 1EPAA 4ID2A 2MWHA 1FDQA 1G7NA 3GE2A 2RTDB 3IFBA 3JQOA 3RE5A 5LKEA 2RTHB 3NX2A 1X8PA 1E2TA 2WR6A 1HQQA 1SWRA 1TOUA 4YBUA 1SWJA 2A3FX 2BS5A 4MEEA 4AYHA 2YG2A 5AQ6A 1SWFA 2C1SA 4XMEA 2QM9A 5EDBA 2OVEA 1KOIA 1OBQA 1X71A 5L8NA 2RN4A 4EEJA 2FRSA 1EPBA 1MK5A 2CBRA 1QY2A 4TNNA 1IIUA 1SY2A 1VWLB 3BX7A 1MEPA 3PH6A 4AZQA 3QKGA 4QGVA 1LCZA 4IMOA 4CV7A 4PJ2A 3WXQA 4CPHB 2QO5A 1VWQB 1N9MA 1PEEA 3D97A 1FJ1E 4HPDA 4MVIA 3ZWEA 1X8QA 1CRBA 3FEKA 1SWTA 4KH8A 1KGLA 1MX8A 4BQUA 4GDAA 3FEPA 4I3BA 4ZGFA 1SWGA 2AT6X 4GDZA 3D4RA 3WZQA 1R0UA 2YMSA 5KIDA 3CBCA 3ZUIA 5IRUA 1VWAB 1A3YA 1GT5A 3MBTA 3AKNA 3SLOA 4Y0PA 4JNJA 4NW4A 1CBQA 1A18A 4QGWA 2BSZA 3AKMA 3FA8A 3ZUOA 4EXZA 3PEDA 4RUNA 4IBAA 4MVEA 1RAVA 5HCCC 5B10O 2GC9A 2FR3A 4ORWA 5HCEC 4FBRA 2RA6A 2OFMX 4ARHA 4QRLA 4KC7A 4WHIA 5IO5A 1OBUA 3FA9A 4IABA 1ICMA 3D9WA 1L6MA 3S26A 5H9NA 4A60A 5BVQA 1ERBA 2A5CA 1S44A 3G7XA 1SWUA 1N9YA 5KICA 3SAOA 1PTSA 5EZ2A 1NGLA 1OEEA 5CE4A 1U0XA
chains in the Genus database with same CATH topology
4CK4A 5FAZA 3CBSA 3STKA 4O9SA 4YCHA 2WEWA 1TOWA 2MO5A 2AMMX 4O4UA 4YGGA 4ZHCA 1AELA 1LIFA 5D45A 1E06A 3F6ZB 5HAEA 1ACDA 5HZQA 1CBSA 3BDRA 3FA6A 1KZXA 1KT5A 1LIEA 2NNEA 4NNSA 5EEEA 1TW4A 3NPOA 1LPJA 1E5PA 1SMPI 4LKPA 3HOLA 1GM6A 1JYJA 3FW5A 5AJCA 2GTFX 3OBLA 3ZI8A 1FENA 2LA7A 3B2HA 4O3XB 2OFRX 1ZNEA 1BWYA 1B4MA 5FFHA 1O8VA 2A2UA 2A13A 4GKCA 4CSBA 3TGAA 2M4LA 2OVSA 2BHVA 3BSZE 1LNMA 1ADLA 3CQNA 3WJBA 1G85A 1AQBA 5KHPA 2QO6A 1EXSA 4YKOA 3BRNA 1JYDA 3VU1A 4I9RA 2Q39A 4NNTA 1ERXA 1YWDA 2HYSA 2JMBA 2JU7A 4GRJA 3B2JA 1KT7A 3LHNA 5B29A 2WWPA 1BBPA 3ELXA 4IAWA 4INNA 4QAEA 5FQ8E 1ZNGA 4ZCBA 3Q6LA 4IAXA 3C77X 2CM4A 5H9LA 3ELZA 1YWCA 3F8AA 2W2FA 3B2IA 3RSWA 3VE2A 3U0DA 4OMWA 3WJFA 1BSOA 1MX7A 2LFOA 3KFFA 3NP1A 3VE1A 1DZKA 2LBAA 1YUPA 3VG3A 1T8VA 4IB6A 3P24A 4Y0RA 3L4RA 1I04A 1NP4A 2JW1A 4DQ3A 1LIDA 5DG4A 2WUTA 4MVLA 4YBPA 4M7MA 5HTDA 4YFQA 3FR2A 3C76X 5BVSA 2K62A 1UREA 1O1VA 4A1YA 4ZHDA 2W2BA 5HA0A 4Y0QA 2QO4A 1LFOA 5LKEA 2F09A 4YGHA 1FEMA 4NYQA 2L68A 4QQ1A 4YFPA 3P6HA 5EDBA 1SXWA 1X8OA 2HLVA 1PBOA 2AT5X 4D6BA 1Z24A 3FENA 1EALA 1SY3A 1P6PA 1DF3A 2ACOA 4I3CA 2MJIA 1H91A 1OPAA 3JSQA 5FQ7E 2WQAE 3HWDA 4YDAA 3HWGA 5D4AA 1QFTA 3N91A 5F1EA 5IO7A 1GGLA 3D95A 4L1NA 4LQZA 4A1HA 3HWEA 3FLLA 1NP1A 4WFUA 2CZTA 1CBIA 1QFVA 4HPBA 3I0AA 1KT4A 1DV9A 4QZTA 2L9CA 3KQ0A 2ALLX 4JGLA 3RKGA 2HMBA 1JJXA 4ORSA 4IB7A 3UEWA 2Z4IA 4FBOA 3RWXA 4ORXA 1AVGI 1GX8A 4AZOA 3FR5A 4AZRA 2KD2A 3NX1A 1KZWA 1GKAB 2G78A 1HMRA 2LB6A 4XMCA 1DZMA 4ZH6A 4QGXA 5AJBA 4QYPA 4TJZA 2FLJA 3APXA 3CMPA 3PPTA 1SA8A 3BLGA 4LKTA 2X8FA 3OJYC 2CZUA 4ZR2A 2P8GA 4LZVA 1O1UA 3BU1A 5JR8A 4GNWA 2A0AA 1GXAA 3APVA 4KCAA 3T1DA 3CQRA 1E00A 4COTA 3FA7A 1CBRA 5HBSA 1QY0A 1RBPA 1SXYA 1Y9TA 5D8JA 1GKAA 4ORUA 4FGIB 1GT4A 1ZNDA 4HWMA 1KT3A 4A8ZA 1B8EA 4ZHGA 3WOVA 2BT9A 3FMZA 4DQ4A 3TZSA 1BEBA 5HTEA 2FR2A 2X46A 3NQ9A 5LJEA 2ACPX 3ZW1B 1LKEA 2WQ9A 3TF6A 3WJGA 1PMPA 3P6CA 3C78X 2KW1A 5F6ZA 4NLIA 5C0NA 4GH7A 1BRQA 1X8UA 1X8NA 3OD9A 5H9AA 4AZPA 3WJDA 3E3CA 3NR3A 3VG7A 3ZQ3A 1A2DA 1KQXA 2RQ0A 5H8TA 1OEKA 4TLJA 2FTBA 2L5PA 4GE1A 2FS6A 4M6SA 1VYGA 4R0BA 3KFIA 1T68X 1GX9A 3V8UA 1OPBA 4N7DA 1G5WA 3OE3A 3ZW1A 2R74A 3I17A 3PH5A 5F6BA 4UU2A 1JBHA 2AT0X 1X89A 1AB0A 4D6AA 4I95A 2IFBA 3O22A 4N7CA 4ALBA 5LJKA 4NYRA 1MUPA 4IMNA 1D2UA 1SY1A 1RLBE 1I4UA 3WBGA 4ZGUA 4ML7B 3BS2A 2LKKA 4ZH9A 3D96A 1LIBA 4OS0A 4XMFA 4WBKA 4YGZA 2X45A 1S2PA 1DZJA 1KT6A 5H9KA 1ICNA 2JN3A 4K19A 5BVTA 3KZAA 5FENA 3WJEA 5EDCA 4HPCA 3FR4A 5LJBA 4GU8A 1EI5A 5DPQA 3ZW0B 1N0SA 5F58A 2FS7A 3P6FA 4YFRA 4TQ2A 3B2KA 4XMHA 1EW3A 4O3WA 1B56A 5EPQA 4XMGA 1EQDA 1ZRYA 4ZHFA 3U9PC 3DSZA 2FWVA 2KTDA 3EM0A 3NBXX 2X8TA 3P6EA 4O4OA 2RCQA 2NNDA 3VG6A 5D47A 2POAA 3EBKA 1OEJA 3HOEA 2LBVA 1D3SA 4OS3A 4I6SA 3VG5A 1YP6A 1ZNKA 1B0OA 4I9SA 5LJDA 4TKBA 2MHDA 4ORRA 2ZAGA 5L8OA 4GETA 1IW2A 3P6DA 5FQ6E 2KT4B 5BYPA 2BS6A 3TGCA 4L3RA 1EIOA 3ZW0A 1QWDA 3IA8A 3SOTA 4QYNA 2OZQA 3PP6A 5HWZA 1HMTA 1QQSA 1GT1A 3CR6A 3UAQA 5LJHA 3H3IA 2PY1A 4U8UO 3HK1A 3S60A 3MVFA 4O3ZA 2QMIA 5L8IA 4ALOA 1Y9LA 4O3YA 1A57A 2AT8X 1I05A 4FQBB 1VPRA 2JU8A 4BVMA 1DFVA 4YCEA 1CJ5A 2GTLO 3STNA 4GZVA 2ANSA 4KT5A 5IO6A 4AW8A 1DC9A 3EYCA 4U8UN 4OMXA 1QY1A 3EBWA 4EQAC 4O4XA 3DTQA 1JZUA 2ASNX 3VG4A 3WVMA 2G7BA 2ZAIA 4UU3A 2HZRA 1I06A 3B2LA 2Q4NA 2Q9SA 3FELA 4MISA 5HZ8A 4TKJA 2NNQA 2GTLN 5HZ5A 2QOSC 2AKQA 1TXLA 3GAQA 4YH0A 1SXUA 3NADA 5AEOA 4U8UM 1KXOA 3CWKA 1ZNHA 2AL0X 3PECA 4NP1A 3HWFA 2CM9A 1IKEA 1EIIA 3P02A 5EEDA 1BRPA 2OVAA 2JU3A 2HNXA 3BX8A 4HPAA 2R56A 4RUUA 2GTLM 1HMSA 1FTPA 1MDCA 4O49A 4WFVA 4MIRA 5HA1A 2WEXA 5D48A 5F7GA 4EFGA 2GJ5A 3LV4A 1LICA 3O2YA 1QABE 4O4SA 1OBPA 1HBQA 3APUA 4QZUA 2RD7C 1JV4A 1BSQA 4XMDA 4AZNA 2O62A 4QNIA 1BJ7A 3MX7A 1IFCA 5HCDC 2OVDA 1EUOA 4YMYA 3BY0A 4IB9A 2A2GA 3PQSA 4NLJA 3KFGA 2MM3A 3F9DA 1HN2A 2W2AA 1ML7A 4KIIA 1ALBA 2EU7X 3KFHA 2NP1A 1XKIA 3UEUA 1SXXA 1BSYA 3FIQA 1T0VA 2X8SA 4ON1A 2RCTA 2Q2PA 2JOZA 4ZHHA 4U3QA 3EMMA 2E4JA 1HQPA 4ZJ0A 5K06A 3UEXA 1QG5A 1YWBA 5LJCA 4ES7A 2AT3X 1YIVA 2G79A 3FW4A 4U9CA 1FELA 1TVQA 5LJGA 2AH7X 4MVKA 3BU9A 3O19A 4LZUA 3UEVA 3ZZVA 4EDEA 5CE4A 1HBPA 4AZMA 3TGBA 1BLRA 3STMX 2Z4HA 2F73A 3WJCA 4PSQA 1BM5A 2WSJA 3VPJE 1IFBA 4GK9A 4YKMA 1GT3A 2DM5A 1S7DA 1LF7A 1ZNLA 4FBVA 2XKLA 1VYFA 2XSTA 1JIWI 3S5VA 1XCAA 4TKHA 5HZ6A 1E02A 5CYBA 3K3LA 2CBSA 5B27A 1YP7A 3ZW2A 1JJJA 2HZQA 4HFOA 4I3DA 5LKFA 1IKJA 1PM1X 1FE3A 1MVGA 1U17A 1G74A 3NQ3A 2L67A 3S5XA 1YWAA 1SY0A 2K23A 4ODDA 4ZFXA 2R73A 3PQUA 3RBYA 4GNYA 4ORYA 1UZ2X 2N93A 3P6GA 4IB8A 4OS8A 3RZYA 2KTSA 4BOEA 3APWA 2BLGA 2FT9A 1KQWA 3HTYA 4KC8A 3VG2A 3JS1A 1DZPA 3NQKA 4YDBA 2Q2MA 3U03A 1U18A 4Y0SA 5HZ9A 3FYFA 1EPAA 4ID2A 2MWHA 1FDQA 1G7NA 3GE2A 3IFBA 3JQOA 3NX2A 1X8PA 2WR6A 1TOUA 4YBUA 4AYHA 2A3FX 2BS5A 2YG2A 5AQ6A 4XMEA 2QM9A 2OVEA 1KOIA 1OBQA 1X71A 5L8NA 2RN4A 4EEJA 2FRSA 1EPBA 2CBRA 1QY2A 4TNNA 1IIUA 1SY2A 3BX7A 4AZQA 3PH6A 4QGVA 3QKGA 4IMOA 4CV7A 4PJ2A 3WXQA 2QO5A 1PEEA 3D97A 4HPDA 4MVIA 3ZWEA 1X8QA 1CRBA 3FEKA 4KH8A 1KGLA 1MX8A 4BQUA 3FEPA 4I3BA 4ZGFA 2AT6X 4GDZA 3D4RA 1R0UA 2YMSA 5KIDA 3CBCA 3ZUIA 1A3YA 1GT5A 3MBTA 3AKNA 4Y0PA 4NW4A 1CBQA 1A18A 4QGWA 3AKMA 3FA8A 4EXZA 3ZUOA 3PEDA 4RUNA 4IBAA 4MVEA 5HCCC 2GC9A 2FR3A 4ORWA 5HCEC 4FBRA 2RA6A 2OFMX 4ARHA 4QRLA 4KC7A 4WHIA 5IO5A 1OBUA 3FA9A 4IABA 1ICMA 1L6MA 3S26A 5H9NA 4A60A 5BVQA 1ERBA 1S44A 3G7XA 5KICA 3SAOA 5EZ2A 1NGLA 1OEEA 1U0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CK4 A;  5FAZ A;  3CBS A;  3STK A;  4O9S A;  4YCH A;  2WEW A;  1TOW A;  2MO5 A;  2AMM X;  4YGG A;  4ZHC A;  1AEL A;  1LIF A;  5D45 A;  1E06 A;  5HAE A;  1ACD A;  5HZQ A;  1CBS A;  3BDR A;  3FA6 A;  1KZX A;  1KT5 A;  1LIE A;  2NNE A;  4NNS A;  5EEE A;  1TW4 A;  3NPO A;  1LPJ A;  1E5P A;  4LKP A;  1GM6 A;  1JYJ A;  3FW5 A;  2GTF X;  1FEN A;  3B2H A;  2OFR X;  1ZNE A;  1BWY A;  1B4M A;  5FFH A;  1O8V A;  2A2U A;  2A13 A;  4GKC A;  3TGA A;  3BSZ E;  3CQN A;  1LNM A;  1ADL A;  3WJB A;  1G85 A;  1AQB A;  5KHP A;  2QO6 A;  1EXS A;  4YKO A;  3BRN A;  1JYD A;  4I9R A;  2Q39 A;  4NNT A;  1ERX A;  1YWD A;  2HYS A;  2JU7 A;  4GRJ A;  3B2J A;  1KT7 A;  5B29 A;  2WWP A;  1BBP A;  3ELX A;  4IAW A;  4QAE A;  1ZNG A;  4ZCB A;  3Q6L A;  4IAX A;  3C77 X;  2CM4 A;  5H9L A;  3ELZ A;  1YWC A;  3F8A A;  2W2F A;  3B2I A;  3RSW A;  3U0D A;  4OMW A;  3WJF A;  1BSO A;  1MX7 A;  2LFO A;  3KFF A;  3NP1 A;  1DZK A;  2LBA A;  1YUP A;  3VG3 A;  1T8V A;  4IB6 A;  4Y0R A;  3L4R A;  1I04 A;  1NP4 A;  4DQ3 A;  1LID A;  5DG4 A;  2WUT A;  4MVL A;  4YBP A;  4M7M A;  5HTD A;  4YFQ A;  3FR2 A;  3C76 X;  5BVS A;  2K62 A;  1URE A;  1O1V A;  4A1Y A;  4ZHD A;  2W2B A;  5HA0 A;  4Y0Q A;  2QO4 A;  1LFO A;  5LKE A;  4YGH A;  1FEM A;  4NYQ A;  2L68 A;  4YFP A;  5EDB A;  3P6H A;  1SXW A;  1X8O A;  2HLV A;  1PBO A;  2AT5 X;  4D6B A;  1Z24 A;  3FEN A;  1EAL A;  1SY3 A;  1P6P A;  1DF3 A;  2ACO A;  4I3C A;  2MJI A;  1H91 A;  1OPA A;  3JSQ A;  2WQA E;  3HWD A;  4YDA A;  3HWG A;  5D4A A;  1QFT A;  5F1E A;  5IO7 A;  1GGL A;  3D95 A;  4A1H A;  3HWE A;  3FLL A;  1NP1 A;  4WFU A;  2CZT A;  1CBI A;  1QFV A;  4HPB A;  3I0A A;  1KT4 A;  1DV9 A;  4QZT A;  2L9C A;  3KQ0 A;  2ALL X;  2HMB A;  1JJX A;  4ORS A;  4IB7 A;  3UEW A;  4ORX A;  1AVG I;  1GX8 A;  4AZO A;  3FR5 A;  4AZR A;  3NX1 A;  1KZW A;  1GKA B;  2G78 A;  1HMR A;  2LB6 A;  4XMC A;  1DZM A;  4ZH6 A;  4QGX A;  4QYP A;  4TJZ A;  2FLJ A;  3APX A;  3CMP A;  3PPT A;  1SA8 A;  3BLG A;  4LKT A;  3OJY C;  2CZU A;  4ZR2 A;  2P8G A;  4LZV A;  1O1U A;  3BU1 A;  5JR8 A;  4GNW A;  2A0A A;  1GXA A;  3APV A;  3T1D A;  3CQR A;  1E00 A;  3FA7 A;  1CBR A;  5HBS A;  1QY0 A;  1RBP A;  1SXY A;  5D8J A;  1GKA A;  4ORU A;  1GT4 A;  1ZND A;  1KT3 A;  4A8Z A;  1B8E A;  4ZHG A;  3FMZ A;  4DQ4 A;  3TZS A;  1BEB A;  5HTE A;  2FR2 A;  2X46 A;  3NQ9 A;  5LJE A;  2ACP X;  1LKE A;  2WQ9 A;  3TF6 A;  3WJG A;  1PMP A;  3P6C A;  3C78 X;  5F6Z A;  5C0N A;  4NLI A;  4GH7 A;  1BRQ A;  1X8U A;  1X8N A;  5H9A A;  4AZP A;  3WJD A;  3NR3 A;  3VG7 A;  3ZQ3 A;  1A2D A;  1KQX A;  2RQ0 A;  5H8T A;  1OEK A;  4TLJ A;  2FTB A;  2L5P A;  4GE1 A;  2FS6 A;  4M6S A;  1VYG A;  4R0B A;  3KFI A;  1T68 X;  1GX9 A;  1OPB A;  4N7D A;  1G5W A;  2R74 A;  3I17 A;  3PH5 A;  5F6B A;  4UU2 A;  1JBH A;  2AT0 X;  1X89 A;  1AB0 A;  4D6A A;  2IFB A;  3O22 A;  4N7C A;  4ALB A;  5LJK A;  4NYR A;  1MUP A;  4IMN A;  1D2U A;  1SY1 A;  1RLB E;  1I4U A;  3WBG A;  4ZGU A;  3BS2 A;  2LKK A;  4ZH9 A;  3D96 A;  1LIB A;  4OS0 A;  4XMF A;  4WBK A;  4YGZ A;  2X45 A;  1S2P A;  1DZJ A;  1KT6 A;  5H9K A;  1ICN A;  2JN3 A;  4K19 A;  5BVT A;  3KZA A;  5FEN A;  3WJE A;  5EDC A;  4HPC A;  3FR4 A;  5LJB A;  5DPQ A;  1N0S A;  5F58 A;  2FS7 A;  3P6F A;  4YFR A;  4TQ2 A;  3B2K A;  4XMH A;  1EW3 A;  1B56 A;  5EPQ A;  4XMG A;  1EQD A;  1ZRY A;  4ZHF A;  3U9P C;  3DSZ A;  2FWV A;  2KTD A;  3EM0 A;  3P6E A;  2RCQ A;  2NND A;  3VG6 A;  5D47 A;  2POA A;  3EBK A;  1OEJ A;  2LBV A;  1D3S A;  4OS3 A;  3VG5 A;  1YP6 A;  1ZNK A;  1B0O A;  4I9S A;  5LJD A;  4TKB A;  4ORR A;  5L8O A;  4GET A;  1IW2 A;  3P6D A;  2KT4 B;  3TGC A;  1EIO A;  1QWD A;  3IA8 A;  4QYN A;  2OZQ A;  3PP6 A;  5HWZ A;  1HMT A;  1QQS A;  1GT1 A;  3CR6 A;  5LJH A;  2PY1 A;  3HK1 A;  3MVF A;  5L8I A;  4ALO A;  1A57 A;  2AT8 X;  1I05 A;  1VPR A;  2JU8 A;  4BVM A;  1DFV A;  4YCE A;  1CJ5 A;  3STN A;  2ANS A;  5IO6 A;  4AW8 A;  1DC9 A;  3EYC A;  4OMX A;  1QY1 A;  3EBW A;  1JZU A;  3DTQ A;  2ASN X;  3VG4 A;  3WVM A;  2G7B A;  4UU3 A;  2HZR A;  1I06 A;  3B2L A;  2Q4N A;  2Q9S A;  3FEL A;  5HZ8 A;  4TKJ A;  2NNQ A;  5HZ5 A;  2QOS C;  2AKQ A;  1TXL A;  3GAQ A;  4YH0 A;  1SXU A;  3NAD A;  1KXO A;  3CWK A;  1ZNH A;  2AL0 X;  3PEC A;  4NP1 A;  3HWF A;  2CM9 A;  1IKE A;  1EII A;  5EED A;  1BRP A;  2OVA A;  2JU3 A;  2HNX A;  3BX8 A;  4HPA A;  2R56 A;  4RUU A;  1HMS A;  1FTP A;  1MDC A;  4WFV A;  5HA1 A;  2WEX A;  5D48 A;  5F7G A;  4EFG A;  2GJ5 A;  3O2Y A;  1LIC A;  1QAB E;  1OBP A;  1HBQ A;  3APU A;  4QZU A;  2RD7 C;  1JV4 A;  1BSQ A;  4XMD A;  4AZN A;  2O62 A;  1BJ7 A;  1IFC A;  5HCD C;  2OVD A;  1EUO A;  4YMY A;  3BY0 A;  4IB9 A;  2A2G A;  4NLJ A;  3KFG A;  2MM3 A;  3F9D A;  1HN2 A;  2W2A A;  1ML7 A;  4KII A;  1ALB A;  2EU7 X;  3KFH A;  2NP1 A;  1XKI A;  3UEU A;  1SXX A;  1BSY A;  3FIQ A;  1T0V A;  2RCT A;  2Q2P A;  2JOZ A;  4ZHH A;  3EMM A;  2E4J A;  1HQP A;  4ZJ0 A;  5K06 A;  3UEX A;  1QG5 A;  1YWB A;  5LJC A;  4ES7 A;  2AT3 X;  1YIV A;  2G79 A;  3FW4 A;  5LJG A;  1FEL A;  1TVQ A;  2AH7 X;  3UEV A;  4MVK A;  3BU9 A;  3O19 A;  4LZU A;  4EDE A;  5CE4 A;  3TGB A;  1HBP A;  4AZM A;  1BLR A;  3STM X;  2F73 A;  3WJC A;  4PSQ A;  1BM5 A;  2WSJ A;  1IFB A;  4YKM A;  1GT3 A;  2DM5 A;  1S7D A;  1LF7 A;  1ZNL A;  2XKL A;  1VYF A;  2XST A;  1XCA A;  4TKH A;  5HZ6 A;  1E02 A;  3K3L A;  2CBS A;  5B27 A;  1YP7 A;  1JJJ A;  2HZQ A;  4HFO A;  4I3D A;  5LKF A;  1IKJ A;  1PM1 X;  1FE3 A;  1MVG A;  1U17 A;  1G74 A;  3NQ3 A;  2L67 A;  1YWA A;  1SY0 A;  2K23 A;  4ODD A;  4ZFX A;  2R73 A;  4GNY A;  4ORY A;  1UZ2 X;  2N93 A;  3P6G A;  4IB8 A;  4OS8 A;  3RZY A;  4BOE A;  3APW A;  2BLG A;  2FT9 A;  1KQW A;  3VG2 A;  3JS1 A;  1DZP A;  4YDB A;  2Q2M A;  3U03 A;  1U18 A;  4Y0S A;  5HZ9 A;  1EPA A;  1FDQ A;  1G7N A;  3IFB A;  3NX2 A;  1X8P A;  2WR6 A;  1TOU A;  4YBU A;  4AYH A;  2A3F X;  2YG2 A;  5AQ6 A;  4XME A;  2QM9 A;  2OVE A;  1KOI A;  1OBQ A;  1X71 A;  5L8N A;  4EEJ A;  2FRS A;  1EPB A;  2CBR A;  1QY2 A;  4TNN A;  1IIU A;  1SY2 A;  3BX7 A;  4AZQ A;  3PH6 A;  4QGV A;  3QKG A;  4IMO A;  3WXQ A;  2QO5 A;  1PEE A;  3D97 A;  4HPD A;  4MVI A;  1X8Q A;  1CRB A;  3FEK A;  1KGL A;  1MX8 A;  4BQU A;  3FEP A;  4I3B A;  2AT6 X;  1R0U A;  5KID A;  3CBC A;  3ZUI A;  1A3Y A;  1GT5 A;  3MBT A;  3AKN A;  4Y0P A;  1CBQ A;  1A18 A;  4QGW A;  3AKM A;  3FA8 A;  4EXZ A;  3ZUO A;  3PED A;  4RUN A;  4IBA A;  5HCC C;  2GC9 A;  2FR3 A;  4ORW A;  5HCE C;  2RA6 A;  2OFM X;  4ARH A;  5IO5 A;  1OBU A;  3FA9 A;  1ICM A;  1L6M A;  3S26 A;  5H9N A;  4A60 A;  5BVQ A;  1ERB A;  1S44 A;  3G7X A;  5KIC A;  3SAO A;  5EZ2 A;  1NGL A;  1OEE A;  1U0X A; 
#chains in the Genus database with same CATH topology
 1N43 A;  4CK4 A;  5FAZ A;  3CBS A;  3STK A;  2IZI A;  4O9S A;  4YCH A;  2WEW A;  1TOW A;  2MO5 A;  2AMM X;  4O4U A;  4YGG A;  1SWC A;  3SZI A;  1SWA A;  4ZHC A;  1AEL A;  2IZL B;  1LIF A;  5D45 A;  4BX5 B;  1E06 A;  4GJV A;  3F6Z B;  2OL7 A;  5HAE A;  1ACD A;  5HZQ A;  1CBS A;  3BDR A;  3FA6 A;  1KZX A;  1KT5 A;  1LIE A;  2NNE A;  4NNS A;  5EEE A;  1TW4 A;  3NPO A;  1LPJ A;  2OY1 O;  4OEM A;  1E5P A;  2AF5 A;  1SMP I;  4LKP A;  3HOL A;  1GM6 A;  1JYJ A;  3FW5 A;  5AJC A;  5CSE A;  2GTF X;  3OBL A;  3ZI8 A;  4BX6 B;  1FEN A;  2LA7 A;  3B2H A;  4O3X B;  2OFR X;  1ZNE A;  1BWY A;  4Z2P A;  1B4M A;  5FFH A;  1O8V A;  1DF8 A;  1VWN B;  2A2U A;  2A13 A;  4GKC A;  5IRW A;  3SLJ A;  4CSB A;  1VWP B;  2RTN B;  3TGA A;  2M4L A;  2BHV A;  2IZF B;  2OVS A;  1LNM A;  1ADL A;  2FGS A;  3BSZ E;  3CQN A;  5JD2 A;  1G85 A;  1AQB A;  3WJB A;  5KHP A;  2QO6 A;  1SWO A;  1EXS A;  1PBY A;  4YKO A;  3BRN A;  1RXJ A;  1JYD A;  3VU1 A;  4I9R A;  2Q39 A;  4NNT A;  1ERX A;  1YWD A;  2HYS A;  2JMB A;  2JU7 A;  4GRJ A;  2RTF B;  1KT7 A;  3B2J A;  3LHN A;  2WWP A;  1BBP A;  3ELX A;  4IAW A;  4INN A;  1I9H A;  4QAE A;  5FQ8 E;  1ZNG A;  4ZCB A;  3Q6L A;  2RTJ A;  4IAX A;  3C77 X;  4BX6 A;  2CM4 A;  3FDC A;  5H9L A;  1SRE A;  3ELZ A;  2ZSC A;  1YWC A;  1WUB A;  3F8A A;  2W2F A;  3Q34 A;  3B2I A;  3MG5 A;  3RSW A;  3VHH A;  2Y3E A;  3VE2 A;  3U0D A;  4OMW A;  3WJF A;  1BSO A;  2CAM A;  1MX7 A;  2LFO A;  1VWM B;  1RSU B;  3KFF A;  1W4T A;  3NP1 A;  3VE1 A;  3EC5 A;  1DZK A;  2LBA A;  1YUP A;  3VG3 A;  1T8V A;  4IB6 A;  3P24 A;  4Y0R A;  3L4R A;  1I04 A;  1NP4 A;  2IZH B;  2JW1 A;  4DQ3 A;  1LID A;  5DG4 A;  3CKG A;  2HKD A;  2RTL A;  1SLF B;  2WUT A;  1SWD A;  4MVL A;  4YBP A;  4M7M A;  5HTD A;  1SRI A;  3CKF A;  4YFQ A;  3FR2 A;  3C76 X;  1VWI B;  5BVS A;  1JJU A;  2QOM A;  2K62 A;  3RE6 A;  1URE A;  1RXH A;  4OEL A;  1O1V A;  4A1Y A;  4ZHD A;  4CPE A;  1Y52 X;  2W2B A;  3WZO A;  5IRA A;  5HA0 A;  4Y0Q A;  1LUQ A;  2QO4 A;  1LFO A;  4GD9 A;  1NBX A;  2F09 A;  2IZG B;  1FEM A;  4NYQ A;  2L68 A;  4QQ1 A;  4YGH A;  3P6H A;  4YFP A;  1SXW A;  1X8O A;  2HLV A;  2RTQ B;  1PBO A;  2AT5 X;  4D6B A;  1Z24 A;  3FEN A;  1EAL A;  1SY3 A;  1NQN A;  2IZC B;  1P6P A;  1DF3 A;  2ACO A;  4I3C A;  4EKV A;  2MJI A;  1H91 A;  1OPA A;  3JSQ A;  5FQ7 E;  2WQA E;  3HWD A;  4YDA A;  3HWG A;  5D4A A;  1QFT A;  3N91 A;  5F1E A;  5IO7 A;  1GGL A;  3D95 A;  4L1N A;  2DJF A;  1LEL A;  1MM9 A;  4LQZ A;  3SZH A;  4A1H A;  3HWE A;  1LCW A;  2JGS A;  2OY5 O;  3FLL A;  1NP1 A;  4WFU A;  3WZN A;  2CZT A;  1CBI A;  1QFV A;  4HPB A;  2OY7 A;  3I0A A;  1KT4 A;  3VGW A;  1DV9 A;  4QZT A;  2L9C A;  3KQ0 A;  3QQ2 A;  2A5B A;  2ALL X;  2RTB B;  4JGL A;  3RKG A;  2I5Z O;  2HMB A;  2RTI B;  4CDE A;  1JJX A;  4ORS A;  4IB7 A;  1I78 A;  3UEW A;  4C5P A;  2Z4I A;  4FBO A;  3RWX A;  4ORX A;  4BGF A;  1AVG I;  1GX8 A;  5B2A O;  4AZO A;  3FR5 A;  4AZR A;  2KD2 A;  1SWH A;  3NX1 A;  1KZW A;  1GKA B;  2G78 A;  1SWP A;  1HMR A;  2RTG B;  2LB6 A;  4XMC A;  4CPH A;  1DZM A;  4ZH6 A;  4QGX A;  5AJB A;  2UYW A;  4GGZ A;  2FHN X;  1K3B A;  1JMX A;  4QYP A;  4TJZ A;  2FLJ A;  3APX A;  1UYN X;  4GUZ A;  3CMP A;  1IJ8 A;  1SWE A;  2IZD B;  1SA8 A;  3BLG A;  3PPT A;  4LKT A;  2X8F A;  4Y59 A;  3OJY C;  2CZU A;  4ZR2 A;  2P8G A;  3LTW A;  3PK2 A;  4LZV A;  1O1U A;  3BU1 A;  5JR8 A;  4GNW A;  2A0A A;  1GXA A;  3APV A;  4KCA A;  3T1D A;  2I5V O;  1E00 A;  3CQR A;  4B55 A;  4COT A;  3FA7 A;  1CBR A;  5HBS A;  1QY0 A;  1RBP A;  1SXY A;  3T6F A;  3ZZV A;  1Y9T A;  5D8J A;  1GKA A;  4ORU A;  4FGI B;  5B3M O;  1GT4 A;  1ZND A;  4HWM A;  1KT3 A;  4A8Z A;  1B8E A;  4ZHG A;  1JQP A;  2BT9 A;  3WOV A;  3FMZ A;  4DQ4 A;  3TZS A;  1BEB A;  5HTE A;  2FR2 A;  3VHI A;  2X46 A;  1N7Y A;  3NQ9 A;  5LJE A;  2ACP X;  3ZW1 B;  1LKE A;  2WQ9 A;  3TF6 A;  3WJG A;  1VWR B;  1PMP A;  1OSP O;  3P6C A;  3C78 X;  2KW1 A;  5F6Z A;  1GX3 A;  2QCB A;  4NLI A;  4GH7 A;  1BRQ A;  4CDF A;  5B29 A;  1X8U A;  1SWK A;  1X8N A;  3EW1 A;  3OD9 A;  5H9A A;  4AZP A;  4CDC A;  2GH7 A;  1VWD B;  3SLT A;  3X00 A;  3WJD A;  3E3C A;  3NR3 A;  1STR B;  4BX5 A;  3VG7 A;  3ZQ3 A;  1A2D A;  1KQX A;  2RQ0 A;  5H8T A;  1OEK A;  4TLJ A;  3WYP A;  3PDF A;  2FTB A;  2L5P A;  4GE1 A;  2FS6 A;  4M6S A;  1VYG A;  4R0B A;  1VWF B;  3KFI A;  1T68 X;  1GX9 A;  1HXL A;  3V8U A;  1OPB A;  4N7D A;  1VWB B;  1G5W A;  3OE3 A;  3ZW1 A;  2R74 A;  2RTP B;  2OFB A;  3I17 A;  3PH5 A;  4IRW A;  5F6B A;  4UU2 A;  1JBH A;  1VWG B;  2AT0 X;  1KL5 A;  1X89 A;  1AB0 A;  4D6A A;  4I95 A;  2IFB A;  3O22 A;  4N7C A;  4ALB A;  5LJK A;  4NYR A;  1MUP A;  1W5R A;  1RST B;  4IMN A;  1D2U A;  1SY1 A;  1RLB E;  5F2B A;  2X4M A;  1I4U A;  3WBG A;  1SWQ A;  4ZGU A;  4ML7 B;  3BS2 A;  3HPE A;  2LKK A;  4ZH9 A;  3WZP A;  2PI3 O;  3D96 A;  3T6L A;  1LIB A;  4OS0 A;  4XMF A;  4YVB A;  4OKA A;  4CPF A;  4WBK A;  4YGZ A;  4Y5D A;  2X45 A;  1S2P A;  3AUM O;  1DZJ A;  1KT6 A;  5H9K A;  3RDS A;  4BX7 B;  1AVD A;  1ICN A;  1UYO X;  2JN3 A;  4K19 A;  4TKB A;  3KZA A;  5BVT A;  5FEN A;  1SLE B;  3WJE A;  5EDC A;  1SWN A;  2RTK A;  1MOY A;  2Y3F A;  4HPC A;  3FR4 A;  5LJB A;  4GU8 A;  1EI5 A;  2OFA A;  5DPQ A;  3EW2 A;  3ZW0 B;  2VFB A;  1N0S A;  5F58 A;  2FS7 A;  3P6F A;  4YFR A;  4TQ2 A;  3B2K A;  4XMH A;  1EW3 A;  4O3W A;  1B56 A;  5EPQ A;  4XMG A;  1EQD A;  1ZRY A;  2OL8 O;  3U9P C;  3DSZ A;  2FWV A;  2KTD A;  3EM0 A;  3NBX X;  2X8T A;  3P6E A;  4O4O A;  2RCQ A;  2NND A;  3VG6 A;  5D47 A;  2POA A;  1Y53 X;  3FID A;  1WBI A;  5IXG A;  3EBK A;  1OEJ A;  2RTC B;  1VWJ B;  3HOE A;  1Y0G A;  2LBV A;  1D3S A;  4OS3 A;  4I6S A;  3VG5 A;  4BX7 A;  1YP6 A;  1ZNK A;  1B0O A;  4I9S A;  5LJD A;  4BJ8 A;  2MHD A;  4ORR A;  2ZAG A;  1NDJ A;  5L8O A;  4GET A;  2RTO B;  1IW2 A;  3P6D A;  4JHQ A;  5FQ6 E;  2VDF A;  2KT4 B;  3RDU A;  4Z2O A;  5BYP A;  2BS6 A;  4BCS A;  4GJS A;  4L3R A;  3TGC A;  1EIO A;  1SLD B;  3ZW0 A;  1QWD A;  3IA8 A;  3SOT A;  4QYN A;  2OZQ A;  3PP6 A;  5HWZ A;  1HMT A;  1QQS A;  1STP A;  1GT1 A;  3CR6 A;  3UAQ A;  5LJH A;  3H3I A;  2PY1 A;  5C0N A;  4U8U O;  3HK1 A;  4Z28 A;  3S60 A;  3MVF A;  4O3Z A;  2QMI A;  5L8I A;  4BBO A;  4ALO A;  2AVI A;  4CPI A;  1Y9L A;  4O3Y A;  2VFC A;  1A57 A;  2AT8 X;  3T2W A;  1I05 A;  4FQB B;  1VPR A;  2JU8 A;  4GGT A;  1DFV A;  2RTE B;  4YCE A;  4BVM A;  1CJ5 A;  2GTL O;  3STN A;  4GZV A;  2ANS A;  4KT5 A;  3RY2 A;  5IO6 A;  1LDO A;  4AW8 A;  1DC9 A;  3EYC A;  4U8U N;  2OF9 A;  4OMX A;  1HXZ A;  1QY1 A;  3EBW A;  4EQA C;  4NV8 A;  3DTQ A;  4O4X A;  1JZU A;  2ASN X;  3VG4 A;  3WVM A;  1KFF A;  2G7B A;  3RDM A;  2ZAI A;  1SRG A;  4UU3 A;  3RY1 A;  2HZR A;  1AVE A;  1I06 A;  4U46 A;  3B2L A;  1SWS A;  2C1Q A;  2Q4N A;  2Q9S A;  2RTM A;  3FEL A;  4MIS A;  4DNE A;  5HZ8 A;  4TKJ A;  2NNQ A;  2GTL N;  5HZ5 A;  3RDX A;  2QOS C;  2AKQ A;  5K68 A;  1TXL A;  3GAQ A;  2BC3 A;  1VWH B;  4YH0 A;  1SXU A;  3NAD A;  5AEO A;  4U8U M;  2A8G A;  1KXO A;  4Z2V A;  3CWK A;  1ZNH A;  1N4J A;  2AL0 X;  3PEC A;  4NP1 A;  3HWF A;  2CM9 A;  4CDD A;  1IKE A;  1EII A;  3P02 A;  5CHK A;  1BRP A;  5EED A;  1SRH A;  4DCB A;  2OVA A;  2JU3 A;  2HNX A;  3BX8 A;  4HPA A;  2R56 A;  2G8C O;  2GTL M;  4RUU A;  1HMS A;  1K24 A;  1FTP A;  1MDC A;  2RTR B;  4O49 A;  2FKJ A;  4WFV A;  2FKG A;  4MIR A;  2WEX A;  2X32 A;  1SRF A;  5D48 A;  5F7G A;  2GJ5 A;  5HA1 A;  4EFG A;  3LV4 A;  1LIC A;  3O2Y A;  1VWC B;  1QAB E;  4O4S A;  2G5L A;  1OBP A;  1HBQ A;  3APU A;  4QZU A;  2RD7 C;  1JV4 A;  1BSQ A;  4XMD A;  3T2X A;  4AZN A;  2IZJ A;  2O62 A;  2FHL A;  2OL6 O;  3KVN A;  4QNI A;  1BJ7 A;  1LCV A;  3MX7 A;  1IFC A;  4Z27 A;  2OVD A;  1EUO A;  4YMY A;  1NQM A;  5HCD C;  3BY0 A;  4IB9 A;  4JO6 A;  2A2G A;  3PQS A;  4NLJ A;  3KFG A;  2MM3 A;  3F9D A;  1HN2 A;  2OYB O;  1HY2 A;  2IZE B;  1ML7 A;  2W2A A;  4KII A;  1ALB A;  2EU7 X;  3KFH A;  5B11 O;  3MM0 A;  2MF6 A;  2NP1 A;  2OF8 A;  1XKI A;  2X56 A;  3UEU A;  1SXX A;  1BSY A;  3FIQ A;  1T0V A;  3WYQ A;  2X8S A;  3RDQ A;  4ON1 A;  2UZ2 A;  2RCT A;  2Q2P A;  2JOZ A;  4ZHH A;  4U3Q A;  3EMM A;  2DJG A;  2F01 A;  2E4J A;  4NV7 A;  1HQP A;  3RDO A;  4ZJ0 A;  5K06 A;  1JMZ A;  3UEX A;  4Z6J A;  1QG5 A;  1YWB A;  5K67 A;  5LJC A;  4ES7 A;  2AT3 X;  1VWK B;  1YIV A;  2G79 A;  3FW4 A;  1FEL A;  1TVQ A;  4U9C A;  5LJG A;  4MVK A;  3BU9 A;  3O19 A;  4LZU A;  2AH7 X;  3UEV A;  4EDE A;  1LDQ A;  1HBP A;  4AZM A;  3TGB A;  1VYO A;  1BLR A;  5L3Y A;  3STM X;  2Z4H A;  2F73 A;  3WJC A;  2IZK A;  4PSQ A;  1SRJ A;  1STS B;  4I60 A;  2WSJ A;  1BM5 A;  3VPJ E;  1IFB A;  1RXK A;  4GK9 A;  4YKM A;  2IZB A;  1GT3 A;  2DM5 A;  1S7D A;  1LF7 A;  1ZNL A;  4FBV A;  2XKL A;  1VYF A;  2XST A;  1JIW I;  3S5V A;  1XCA A;  4TKH A;  3AEH A;  5HZ6 A;  1E02 A;  5CYB A;  2C4I A;  3K3L A;  2CBS A;  5B27 A;  1YP7 A;  3ZW2 A;  1JJJ A;  2IZA A;  1Y55 X;  2HZQ A;  4HFO A;  4I3D A;  5LKF A;  1IKJ A;  1PM1 X;  1FE3 A;  1MVG A;  1SLG B;  1U17 A;  1G74 A;  3NQ3 A;  2L67 A;  3S5X A;  1NC9 A;  1SY0 A;  1YWA A;  1W6F A;  2K23 A;  1KL4 A;  2X55 A;  4ODD A;  4ZFX A;  4ZHF A;  2R73 A;  2Y32 A;  3PQU A;  5B5G A;  3RBY A;  4GNY A;  4ORY A;  1VWE B;  2RTA A;  5B5F A;  1UZ2 X;  2X34 A;  2N93 A;  3P6G A;  4GGR A;  4IB8 A;  1SWB A;  4OS8 A;  3RZY A;  3SZJ A;  2KTS A;  1KL3 A;  3VHM A;  4BOE A;  3APW A;  1SWL A;  2BLG A;  1KQW A;  2FT9 A;  3HTY A;  4KC8 A;  2WPU A;  3VG2 A;  3JS1 A;  1DZP A;  3NQK A;  4YDB A;  2OY8 A;  1VWO B;  2Q2M A;  3U03 A;  1U18 A;  4Y0S A;  5HZ9 A;  3FYF A;  1EPA A;  4ID2 A;  2MWH A;  1FDQ A;  1G7N A;  3GE2 A;  2RTD B;  3IFB A;  3JQO A;  3RE5 A;  5LKE A;  2RTH B;  3NX2 A;  1X8P A;  1E2T A;  2WR6 A;  1HQQ A;  1SWR A;  1TOU A;  4YBU A;  1SWJ A;  2A3F X;  2BS5 A;  4MEE A;  4AYH A;  2YG2 A;  5AQ6 A;  1SWF A;  2C1S A;  4XME A;  2QM9 A;  5EDB A;  2OVE A;  1KOI A;  1OBQ A;  1X71 A;  5L8N A;  2RN4 A;  4EEJ A;  2FRS A;  1EPB A;  1MK5 A;  2CBR A;  1QY2 A;  4TNN A;  1IIU A;  1SY2 A;  1VWL B;  3BX7 A;  1MEP A;  3PH6 A;  4AZQ A;  3QKG A;  4QGV A;  1LCZ A;  4IMO A;  4CV7 A;  4PJ2 A;  3WXQ A;  4CPH B;  2QO5 A;  1VWQ B;  1N9M A;  1PEE A;  3D97 A;  1FJ1 E;  4HPD A;  4MVI A;  3ZWE A;  1X8Q A;  1CRB A;  3FEK A;  1SWT A;  4KH8 A;  1KGL A;  1MX8 A;  4BQU A;  4GDA A;  3FEP A;  4I3B A;  4ZGF A;  1SWG A;  2AT6 X;  4GDZ A;  3D4R A;  3WZQ A;  1R0U A;  2YMS A;  5KID A;  3CBC A;  3ZUI A;  5IRU A;  1VWA B;  1A3Y A;  1GT5 A;  3MBT A;  3AKN A;  3SLO A;  4Y0P A;  4JNJ A;  4NW4 A;  1CBQ A;  1A18 A;  4QGW A;  2BSZ A;  3AKM A;  3FA8 A;  3ZUO A;  4EXZ A;  3PED A;  4RUN A;  4IBA A;  4MVE A;  1RAV A;  5HCC C;  5B10 O;  2GC9 A;  2FR3 A;  4ORW A;  5HCE C;  4FBR A;  2RA6 A;  2OFM X;  4ARH A;  4QRL A;  4KC7 A;  4WHI A;  5IO5 A;  1OBU A;  3FA9 A;  4IAB A;  1ICM A;  3D9W A;  1L6M A;  3S26 A;  5H9N A;  4A60 A;  5BVQ A;  1ERB A;  2A5C A;  1S44 A;  3G7X A;  1SWU A;  1N9Y A;  5KIC A;  3SAO A;  1PTS A;  5EZ2 A;  1NGL A;  1OEE A;  5CE4 A;  1U0X A; 
#chains in the Genus database with same CATH homology
 4CK4 A;  5FAZ A;  3CBS A;  3STK A;  4O9S A;  4YCH A;  2WEW A;  1TOW A;  2MO5 A;  2AMM X;  4O4U A;  4YGG A;  4ZHC A;  1AEL A;  1LIF A;  5D45 A;  1E06 A;  3F6Z B;  5HAE A;  1ACD A;  5HZQ A;  1CBS A;  3BDR A;  3FA6 A;  1KZX A;  1KT5 A;  1LIE A;  2NNE A;  4NNS A;  5EEE A;  1TW4 A;  3NPO A;  1LPJ A;  1E5P A;  1SMP I;  4LKP A;  3HOL A;  1GM6 A;  1JYJ A;  3FW5 A;  5AJC A;  2GTF X;  3OBL A;  3ZI8 A;  1FEN A;  2LA7 A;  3B2H A;  4O3X B;  2OFR X;  1ZNE A;  1BWY A;  1B4M A;  5FFH A;  1O8V A;  2A2U A;  2A13 A;  4GKC A;  4CSB A;  3TGA A;  2M4L A;  2OVS A;  2BHV A;  3BSZ E;  1LNM A;  1ADL A;  3CQN A;  3WJB A;  1G85 A;  1AQB A;  5KHP A;  2QO6 A;  1EXS A;  4YKO A;  3BRN A;  1JYD A;  3VU1 A;  4I9R A;  2Q39 A;  4NNT A;  1ERX A;  1YWD A;  2HYS A;  2JMB A;  2JU7 A;  4GRJ A;  3B2J A;  1KT7 A;  3LHN A;  5B29 A;  2WWP A;  1BBP A;  3ELX A;  4IAW A;  4INN A;  4QAE A;  5FQ8 E;  1ZNG A;  4ZCB A;  3Q6L A;  4IAX A;  3C77 X;  2CM4 A;  5H9L A;  3ELZ A;  1YWC A;  3F8A A;  2W2F A;  3B2I A;  3RSW A;  3VE2 A;  3U0D A;  4OMW A;  3WJF A;  1BSO A;  1MX7 A;  2LFO A;  3KFF A;  3NP1 A;  3VE1 A;  1DZK A;  2LBA A;  1YUP A;  3VG3 A;  1T8V A;  4IB6 A;  3P24 A;  4Y0R A;  3L4R A;  1I04 A;  1NP4 A;  2JW1 A;  4DQ3 A;  1LID A;  5DG4 A;  2WUT A;  4MVL A;  4YBP A;  4M7M A;  5HTD A;  4YFQ A;  3FR2 A;  3C76 X;  5BVS A;  2K62 A;  1URE A;  1O1V A;  4A1Y A;  4ZHD A;  2W2B A;  5HA0 A;  4Y0Q A;  2QO4 A;  1LFO A;  5LKE A;  2F09 A;  4YGH A;  1FEM A;  4NYQ A;  2L68 A;  4QQ1 A;  4YFP A;  3P6H A;  5EDB A;  1SXW A;  1X8O A;  2HLV A;  1PBO A;  2AT5 X;  4D6B A;  1Z24 A;  3FEN A;  1EAL A;  1SY3 A;  1P6P A;  1DF3 A;  2ACO A;  4I3C A;  2MJI A;  1H91 A;  1OPA A;  3JSQ A;  5FQ7 E;  2WQA E;  3HWD A;  4YDA A;  3HWG A;  5D4A A;  1QFT A;  3N91 A;  5F1E A;  5IO7 A;  1GGL A;  3D95 A;  4L1N A;  4LQZ A;  4A1H A;  3HWE A;  3FLL A;  1NP1 A;  4WFU A;  2CZT A;  1CBI A;  1QFV A;  4HPB A;  3I0A A;  1KT4 A;  1DV9 A;  4QZT A;  2L9C A;  3KQ0 A;  2ALL X;  4JGL A;  3RKG A;  2HMB A;  1JJX A;  4ORS A;  4IB7 A;  3UEW A;  2Z4I A;  4FBO A;  3RWX A;  4ORX A;  1AVG I;  1GX8 A;  4AZO A;  3FR5 A;  4AZR A;  2KD2 A;  3NX1 A;  1KZW A;  1GKA B;  2G78 A;  1HMR A;  2LB6 A;  4XMC A;  1DZM A;  4ZH6 A;  4QGX A;  5AJB A;  4QYP A;  4TJZ A;  2FLJ A;  3APX A;  3CMP A;  3PPT A;  1SA8 A;  3BLG A;  4LKT A;  2X8F A;  3OJY C;  2CZU A;  4ZR2 A;  2P8G A;  4LZV A;  1O1U A;  3BU1 A;  5JR8 A;  4GNW A;  2A0A A;  1GXA A;  3APV A;  4KCA A;  3T1D A;  3CQR A;  1E00 A;  4COT A;  3FA7 A;  1CBR A;  5HBS A;  1QY0 A;  1RBP A;  1SXY A;  1Y9T A;  5D8J A;  1GKA A;  4ORU A;  4FGI B;  1GT4 A;  1ZND A;  4HWM A;  1KT3 A;  4A8Z A;  1B8E A;  4ZHG A;  3WOV A;  2BT9 A;  3FMZ A;  4DQ4 A;  3TZS A;  1BEB A;  5HTE A;  2FR2 A;  2X46 A;  3NQ9 A;  5LJE A;  2ACP X;  3ZW1 B;  1LKE A;  2WQ9 A;  3TF6 A;  3WJG A;  1PMP A;  3P6C A;  3C78 X;  2KW1 A;  5F6Z A;  4NLI A;  5C0N A;  4GH7 A;  1BRQ A;  1X8U A;  1X8N A;  3OD9 A;  5H9A A;  4AZP A;  3WJD A;  3E3C A;  3NR3 A;  3VG7 A;  3ZQ3 A;  1A2D A;  1KQX A;  2RQ0 A;  5H8T A;  1OEK A;  4TLJ A;  2FTB A;  2L5P A;  4GE1 A;  2FS6 A;  4M6S A;  1VYG A;  4R0B A;  3KFI A;  1T68 X;  1GX9 A;  3V8U A;  1OPB A;  4N7D A;  1G5W A;  3OE3 A;  3ZW1 A;  2R74 A;  3I17 A;  3PH5 A;  5F6B A;  4UU2 A;  1JBH A;  2AT0 X;  1X89 A;  1AB0 A;  4D6A A;  4I95 A;  2IFB A;  3O22 A;  4N7C A;  4ALB A;  5LJK A;  4NYR A;  1MUP A;  4IMN A;  1D2U A;  1SY1 A;  1RLB E;  1I4U A;  3WBG A;  4ZGU A;  4ML7 B;  3BS2 A;  2LKK A;  4ZH9 A;  3D96 A;  1LIB A;  4OS0 A;  4XMF A;  4WBK A;  4YGZ A;  2X45 A;  1S2P A;  1DZJ A;  1KT6 A;  5H9K A;  1ICN A;  2JN3 A;  4K19 A;  5BVT A;  3KZA A;  5FEN A;  3WJE A;  5EDC A;  4HPC A;  3FR4 A;  5LJB A;  4GU8 A;  1EI5 A;  5DPQ A;  3ZW0 B;  1N0S A;  5F58 A;  2FS7 A;  3P6F A;  4YFR A;  4TQ2 A;  3B2K A;  4XMH A;  1EW3 A;  4O3W A;  1B56 A;  5EPQ A;  4XMG A;  1EQD A;  1ZRY A;  4ZHF A;  3U9P C;  3DSZ A;  2FWV A;  2KTD A;  3EM0 A;  3NBX X;  2X8T A;  3P6E A;  4O4O A;  2RCQ A;  2NND A;  3VG6 A;  5D47 A;  2POA A;  3EBK A;  1OEJ A;  3HOE A;  2LBV A;  1D3S A;  4OS3 A;  4I6S A;  3VG5 A;  1YP6 A;  1ZNK A;  1B0O A;  4I9S A;  5LJD A;  4TKB A;  2MHD A;  4ORR A;  2ZAG A;  5L8O A;  4GET A;  1IW2 A;  3P6D A;  5FQ6 E;  2KT4 B;  5BYP A;  2BS6 A;  3TGC A;  4L3R A;  1EIO A;  3ZW0 A;  1QWD A;  3IA8 A;  3SOT A;  4QYN A;  2OZQ A;  3PP6 A;  5HWZ A;  1HMT A;  1QQS A;  1GT1 A;  3CR6 A;  3UAQ A;  5LJH A;  3H3I A;  2PY1 A;  4U8U O;  3HK1 A;  3S60 A;  3MVF A;  4O3Z A;  2QMI A;  5L8I A;  4ALO A;  1Y9L A;  4O3Y A;  1A57 A;  2AT8 X;  1I05 A;  4FQB B;  1VPR A;  2JU8 A;  4BVM A;  1DFV A;  4YCE A;  1CJ5 A;  2GTL O;  3STN A;  4GZV A;  2ANS A;  4KT5 A;  5IO6 A;  4AW8 A;  1DC9 A;  3EYC A;  4U8U N;  4OMX A;  1QY1 A;  3EBW A;  4EQA C;  4O4X A;  3DTQ A;  1JZU A;  2ASN X;  3VG4 A;  3WVM A;  2G7B A;  2ZAI A;  4UU3 A;  2HZR A;  1I06 A;  3B2L A;  2Q4N A;  2Q9S A;  3FEL A;  4MIS A;  5HZ8 A;  4TKJ A;  2NNQ A;  2GTL N;  5HZ5 A;  2QOS C;  2AKQ A;  1TXL A;  3GAQ A;  4YH0 A;  1SXU A;  3NAD A;  5AEO A;  4U8U M;  1KXO A;  3CWK A;  1ZNH A;  2AL0 X;  3PEC A;  4NP1 A;  3HWF A;  2CM9 A;  1IKE A;  1EII A;  3P02 A;  5EED A;  1BRP A;  2OVA A;  2JU3 A;  2HNX A;  3BX8 A;  4HPA A;  2R56 A;  4RUU A;  2GTL M;  1HMS A;  1FTP A;  1MDC A;  4O49 A;  4WFV A;  4MIR A;  5HA1 A;  2WEX A;  5D48 A;  5F7G A;  4EFG A;  2GJ5 A;  3LV4 A;  1LIC A;  3O2Y A;  1QAB E;  4O4S A;  1OBP A;  1HBQ A;  3APU A;  4QZU A;  2RD7 C;  1JV4 A;  1BSQ A;  4XMD A;  4AZN A;  2O62 A;  4QNI A;  1BJ7 A;  3MX7 A;  1IFC A;  5HCD C;  2OVD A;  1EUO A;  4YMY A;  3BY0 A;  4IB9 A;  2A2G A;  3PQS A;  4NLJ A;  3KFG A;  2MM3 A;  3F9D A;  1HN2 A;  2W2A A;  1ML7 A;  4KII A;  1ALB A;  2EU7 X;  3KFH A;  2NP1 A;  1XKI A;  3UEU A;  1SXX A;  1BSY A;  3FIQ A;  1T0V A;  2X8S A;  4ON1 A;  2RCT A;  2Q2P A;  2JOZ A;  4ZHH A;  4U3Q A;  3EMM A;  2E4J A;  1HQP A;  4ZJ0 A;  5K06 A;  3UEX A;  1QG5 A;  1YWB A;  5LJC A;  4ES7 A;  2AT3 X;  1YIV A;  2G79 A;  3FW4 A;  4U9C A;  1FEL A;  1TVQ A;  5LJG A;  2AH7 X;  4MVK A;  3BU9 A;  3O19 A;  4LZU A;  3UEV A;  3ZZV A;  4EDE A;  5CE4 A;  1HBP A;  4AZM A;  3TGB A;  1BLR A;  3STM X;  2Z4H A;  2F73 A;  3WJC A;  4PSQ A;  1BM5 A;  2WSJ A;  3VPJ E;  1IFB A;  4GK9 A;  4YKM A;  1GT3 A;  2DM5 A;  1S7D A;  1LF7 A;  1ZNL A;  4FBV A;  2XKL A;  1VYF A;  2XST A;  1JIW I;  3S5V A;  1XCA A;  4TKH A;  5HZ6 A;  1E02 A;  5CYB A;  3K3L A;  2CBS A;  5B27 A;  1YP7 A;  3ZW2 A;  1JJJ A;  2HZQ A;  4HFO A;  4I3D A;  5LKF A;  1IKJ A;  1PM1 X;  1FE3 A;  1MVG A;  1U17 A;  1G74 A;  3NQ3 A;  2L67 A;  3S5X A;  1YWA A;  1SY0 A;  2K23 A;  4ODD A;  4ZFX A;  2R73 A;  3PQU A;  3RBY A;  4GNY A;  4ORY A;  1UZ2 X;  2N93 A;  3P6G A;  4IB8 A;  4OS8 A;  3RZY A;  2KTS A;  4BOE A;  3APW A;  2BLG A;  2FT9 A;  1KQW A;  3HTY A;  4KC8 A;  3VG2 A;  3JS1 A;  1DZP A;  3NQK A;  4YDB A;  2Q2M A;  3U03 A;  1U18 A;  4Y0S A;  5HZ9 A;  3FYF A;  1EPA A;  4ID2 A;  2MWH A;  1FDQ A;  1G7N A;  3GE2 A;  3IFB A;  3JQO A;  3NX2 A;  1X8P A;  2WR6 A;  1TOU A;  4YBU A;  4AYH A;  2A3F X;  2BS5 A;  2YG2 A;  5AQ6 A;  4XME A;  2QM9 A;  2OVE A;  1KOI A;  1OBQ A;  1X71 A;  5L8N A;  2RN4 A;  4EEJ A;  2FRS A;  1EPB A;  2CBR A;  1QY2 A;  4TNN A;  1IIU A;  1SY2 A;  3BX7 A;  4AZQ A;  3PH6 A;  4QGV A;  3QKG A;  4IMO A;  4CV7 A;  4PJ2 A;  3WXQ A;  2QO5 A;  1PEE A;  3D97 A;  4HPD A;  4MVI A;  3ZWE A;  1X8Q A;  1CRB A;  3FEK A;  4KH8 A;  1KGL A;  1MX8 A;  4BQU A;  3FEP A;  4I3B A;  4ZGF A;  2AT6 X;  4GDZ A;  3D4R A;  1R0U A;  2YMS A;  5KID A;  3CBC A;  3ZUI A;  1A3Y A;  1GT5 A;  3MBT A;  3AKN A;  4Y0P A;  4NW4 A;  1CBQ A;  1A18 A;  4QGW A;  3AKM A;  3FA8 A;  4EXZ A;  3ZUO A;  3PED A;  4RUN A;  4IBA A;  4MVE A;  5HCC C;  2GC9 A;  2FR3 A;  4ORW A;  5HCE C;  4FBR A;  2RA6 A;  2OFM X;  4ARH A;  4QRL A;  4KC7 A;  4WHI A;  5IO5 A;  1OBU A;  3FA9 A;  4IAB A;  1ICM A;  1L6M A;  3S26 A;  5H9N A;  4A60 A;  5BVQ A;  1ERB A;  1S44 A;  3G7X A;  5KIC A;  3SAO A;  5EZ2 A;  1NGL A;  1OEE A;  1U0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...