4RV0A

Crystal structure of tn complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
159
Chain Sequence
GAMEPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TN complex
rcsb
source organism Drosophila melanogaster
molecule tags Protein binding, transport protein
molecule keywords Transitional endoplasmic reticulum ATPase TER94
total genus 44
structure length 159
sequence length 167
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4rv0A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4rv0A02
5GLFA 2V3VA 3IR5A 3CF2A 4GA6A 1QCSA 1WLFA 1I3QA 3QQ8A 4KO8A 1E61A 3GTQA 1Q16A 3CQZA 3HU1A 4KLNA 1PYUB 4RV0A 1H0HA 1KQFA 1E18A 3HKZA 3FKIA 2EEOB 5FTJA 1PQFA 1E32A 2E7ZA 4AOKB 2NVXA 1CZ5A 4D7ZB 5T5MD 2B63A 3HU3A 3QQ7A 1K83A 2VPXA 1KQGA 2JA5A 5C1BA 4KODA 1SFOA 2VPYA 1Y1VA 5FTMA 1TWFA 1DMRA 1DMSA 5FTNA 2PJHB 4DMRA 4CRYG 1TWCA 5EPPA 1PQHA 1IW7D 4CRZA 5DYIA 3O5AA 2C45A 1Y4ZA 5T5ID 2VUMA 2YUJA 3GTGA 2JIOA 1EU1A 5C18A 1G8JA 4AAYA 1WCMA 4AZDA 3GTKA 1ZC1A 2R93A 2DMRA 2JIRA 1VC3B 1E5VA 2NYAA 1TWGA 2V45A 1AA6A 3GTPA 1SIWA 2JIPA 3TIWA 1H5NA 2JV2A 1YLEA 3GTMA 1Y1WA 1CZ4A 1TMOA 2YU9A 2JIMA 4GA5A 4AONB 4C2MA 2VPWA 1UHDA 4CS0A 1QDNA 2R92A 3OUGA 2JA7A 2JA6A 2VPZA 3DMRA 1PYQA 1CR5A 1PT1A 2E2HA 4QIWA 1PT0A 1E60A 3GTOA 1AW8B 3PLXB 1PQEA 1I50A 5FTLA 1FDOA 5FTKA 1FDIA 1R9TA 2E2IA 2NVYA 3IR7A 2Y0SA 2PMZA 2KI8A 2R7ZA 3IR6A 3GTLA 3HU2A 1Y5IA 5DYGA 3GTJA 1PPYA 1R27A 3H0GA 4AYBA 1S3SA 4KDLA 5B6CA 1UHEA 3QWZA 1TWHA 2JIQA 1TWAA 2IV2X 3ML1A 2WB1A 4KDIA 1G8KA 1R7RA 3QC8A 2WAQA 3TM7B 1OGYA 2NAPA
chains in the Genus database with same CATH superfamily
5GLFA 2V3VA 3IR5A 3X2KA 3BQBA 3CF2A 4GA6A 5D6WA 1QCSA 1WLFA 2HCZX 3QQ8A 1I3QA 3FPRA 2CW0D 4KO8A 1E61A 3X2LA 1Q16A 3GTQA 2PWYA 3CQZA 3HU1A 4FIBA 4KLNA 1PYUB 4RV0A 1H0HA 1KQFA 1E18A 3HKZA 3FKIA 2EEOB 2LW6A 5FTJA 4ARIA 1PQFA 1E32A 1N10A 2E7ZA 4AOKB 3SUKA 3ZJUA 2PJJA 2NVXA 1CZ5A 4D7ZB 3X2JA 5T5MD 2B63A 3HU3A 3QQ7A 4JP7A 5GLXA 2VPXA 1K83A 2A69D 3MB5A 5CD1A 1KQGA 2JA5A 2BH0A 5C1BA 3ZJTA 4KODA 1SFOA 1BW3A 3D30A 2VPYA 1Y1VA 1L8FA 2PI8A 3CZBA 5FTMA 5EQJB 1TWFA 1DMRA 1DMSA 5FTNA 2KY9A 1O54A 2AE0X 2PJHB 4DMRA 4CRYG 1TWCA 5EPPA 2G6GA 1PQHA 1IW7D 4CRZA 1YNND 5DYIA 5H4UA 3O5AA 2C45A 4FFTA 1Y4ZA 5T5ID 2VUMA 3X2MA 2XDPA 2YUJA 4UC4A 3GTGA 2QQSA 5CCBA 3LGAA 2B25A 2JIOA 2G5DA 3X2PA 4FERA 4NOHA 4FG2A 4FG4A 5D6YA 1EU1A 3ZGZA 4JS7A 5C18A 1G8JA 4AAYA 1WCMA 4AZDA 3GTKA 3M3GA 1ZC1A 2R93A 2DMRA 3LHDA 2JIRA 1VC3B 1E5VA 2NYAA 1TWGA 1YNJD 1WC2A 2V45A 1AA6A 2KQAA 3GTPA 2Q1AX 5ERGB 2GAEA 3X2GA 2MM2A 1SIWA 2JIPA 4ARCA 3TIWA 3ENGA 1H5NA 2JV2A 1YLEA 3GTMA 1Y1WA 1CZ4A 2Q1DX 1TMOA 2YU9A 2QQRA 4AQ7A 5D6XA 2BE5D 2JIMA 1HD5A 4GA5A 4AVRA 4AONB 4CQNA 4C2MA 2VPWA 3SUMA 1UHDA 4ENGA 4CS0A 1BW4A 1OA9A 1QDNA 4JP6A 3OUGA 2R92A 2ENGA 3X2NA 2A68D 2JA7A 3FPUA 2JA6A 2VPZA 2YVLA 2O5JD 1I9GA 1OA7A 1PYQA 1CR5A 2A6ED 1PT1A 3DMRA 3SUJA 2E2HA 4QIWA 1PT0A 1E60A 4JCWA 1AW8B 3X2HA 3GTOA 2GF7A 2Q18X 2A6HD 1PQEA 2PNWA 3PLXB 4L48A 1I50A 5FTLA 5GM9A 1FDOA 5FTKA 1FDIA 1R9TA 2E2IA 2NVYA 1ZYRD 3IR7A 2Y0SA 2PMZA 2KI8A 3X2IA 3IR6A 3GTLA 2R7ZA 3HU2A 1Y5IA 5DYGA 3GTJA 5GLYA 2Q19X 3ZJVA 1PPYA 1R27A 4ZM7A 4JJOA 3FPTA 3H0GA 4AYBA 1S3SA 4KDLA 2GFAA 3SULA 5B6CA 3X2OA 4AS1A 1UHEA 3QWZA 1TWHA 2JIQA 1TWAA 2IV2X 3ML1A 2WB1A 4KDIA 2PICA 1G8KA 1R7RA 3QC8A 1SMYD 2WAQA 3TM7B 2MM0A 1OGYA 5CCXA 2NAPA 2Q1CX
chains in the Genus database with same CATH topology
5GLFA 2V3VA 3IR5A 3BQBA 3CF2A 4GA6A 5D6WA 1QCSA 1WLFA 1I3QA 3QQ8A 3FPRA 2CW0D 4KO8A 1E61A 3GTQA 1Q16A 2PWYA 4FIBA 3CQZA 3HU1A 4KLNA 1PYUB 4RV0A 1H0HA 1KQFA 1E18A 3HKZA 3FKIA 2EEOB 2LW6A 5FTJA 4ARIA 1PQFA 1E32A 2E7ZA 4AOKB 3ZJUA 2PJJA 2NVXA 1CZ5A 4D7ZB 5T5MD 2B63A 3HU3A 3QQ7A 1K83A 3MB5A 2VPXA 2A69D 1KQGA 2JA5A 5C1BA 3ZJTA 4KODA 1SFOA 2VPYA 1Y1VA 3CZBA 2PI8A 5FTMA 5EQJB 1TWFA 1DMRA 1DMSA 5FTNA 2KY9A 1O54A 2AE0X 2PJHB 4DMRA 4CRYG 1TWCA 5EPPA 2G6GA 1PQHA 1IW7D 4CRZA 1YNND 5DYIA 3O5AA 2C45A 1Y4ZA 5T5ID 2VUMA 2XDPA 2YUJA 3GTGA 2QQSA 5CCBA 3LGAA 2B25A 2JIOA 2G5DA 4NOHA 5D6YA 1EU1A 3ZGZA 5C18A 1G8JA 4AAYA 1WCMA 4AZDA 3GTKA 1ZC1A 2R93A 2DMRA 2JIRA 1VC3B 1E5VA 2V45A 1TWGA 1YNJD 2NYAA 1AA6A 5ERGB 5CD1A 3GTPA 2Q1AX 2GAEA 2MM2A 1SIWA 2JIPA 4ARCA 3TIWA 1H5NA 2JV2A 1YLEA 3GTMA 1Y1WA 1CZ4A 2Q1DX 1TMOA 2YU9A 2QQRA 4AQ7A 5D6XA 2BE5D 2JIMA 4GA5A 4AONB 4CQNA 4C2MA 2VPWA 1UHDA 4CS0A 1QDNA 2R92A 3OUGA 2A68D 2JA7A 3FPUA 2JA6A 2VPZA 2YVLA 2O5JD 1I9GA 3DMRA 1PYQA 1CR5A 2A6ED 1PT1A 2E2HA 3LHDA 2Q18X 4QIWA 1PT0A 1E60A 3GTOA 1AW8B 4UC4A 2GF7A 2A6HD 1PQEA 2PNWA 3PLXB 1I50A 5FTLA 1FDOA 5FTKA 1FDIA 1R9TA 2E2IA 2NVYA 1ZYRD 3IR7A 2Y0SA 2PMZA 2KI8A 2R7ZA 3IR6A 3GTLA 2Q19X 3HU2A 1Y5IA 5DYGA 3GTJA 3ZJVA 1PPYA 1R27A 3FPTA 3H0GA 4AYBA 1S3SA 4KDLA 2GFAA 5B6CA 4AS1A 1UHEA 3QWZA 1TWHA 2JIQA 1TWAA 2IV2X 3ML1A 2WB1A 4KDIA 2PICA 1G8KA 1R7RA 3QC8A 1SMYD 2WAQA 3TM7B 2MM0A 1OGYA 5CCXA 2NAPA 2Q1CX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLF A;  2V3V A;  3IR5 A;  3CF2 A;  4GA6 A;  1QCS A;  1WLF A;  1I3Q A;  3QQ8 A;  4KO8 A;  1E61 A;  3GTQ A;  1Q16 A;  3CQZ A;  3HU1 A;  4KLN A;  1PYU B;  4RV0 A;  1H0H A;  1KQF A;  1E18 A;  3HKZ A;  3FKI A;  2EEO B;  5FTJ A;  1PQF A;  1E32 A;  2E7Z A;  4AOK B;  2NVX A;  1CZ5 A;  4D7Z B;  5T5M D;  2B63 A;  3HU3 A;  3QQ7 A;  1K83 A;  2VPX A;  1KQG A;  2JA5 A;  5C1B A;  4KOD A;  1SFO A;  2VPY A;  1Y1V A;  5FTM A;  1TWF A;  1DMR A;  1DMS A;  5FTN A;  2PJH B;  4DMR A;  4CRY G;  1TWC A;  5EPP A;  1PQH A;  1IW7 D;  4CRZ A;  5DYI A;  3O5A A;  2C45 A;  1Y4Z A;  5T5I D;  2VUM A;  2YUJ A;  3GTG A;  2JIO A;  1EU1 A;  5C18 A;  1G8J A;  4AAY A;  1WCM A;  4AZD A;  3GTK A;  1ZC1 A;  2R93 A;  2DMR A;  2JIR A;  1VC3 B;  1E5V A;  2NYA A;  1TWG A;  2V45 A;  1AA6 A;  3GTP A;  1SIW A;  2JIP A;  3TIW A;  1H5N A;  2JV2 A;  1YLE A;  3GTM A;  1Y1W A;  1CZ4 A;  1TMO A;  2YU9 A;  2JIM A;  4GA5 A;  4AON B;  4C2M A;  2VPW A;  1UHD A;  4CS0 A;  1QDN A;  2R92 A;  3OUG A;  2JA7 A;  2JA6 A;  2VPZ A;  3DMR A;  1PYQ A;  1CR5 A;  1PT1 A;  2E2H A;  4QIW A;  1PT0 A;  1E60 A;  3GTO A;  1AW8 B;  3PLX B;  1PQE A;  1I50 A;  5FTL A;  1FDO A;  5FTK A;  1FDI A;  1R9T A;  2E2I A;  2NVY A;  3IR7 A;  2Y0S A;  2PMZ A;  2KI8 A;  2R7Z A;  3IR6 A;  3GTL A;  3HU2 A;  1Y5I A;  5DYG A;  3GTJ A;  1PPY A;  1R27 A;  3H0G A;  4AYB A;  1S3S A;  4KDL A;  5B6C A;  1UHE A;  3QWZ A;  1TWH A;  2JIQ A;  1TWA A;  2IV2 X;  3ML1 A;  2WB1 A;  4KDI A;  1G8K A;  1R7R A;  3QC8 A;  2WAQ A;  3TM7 B;  1OGY A;  2NAP A; 
#chains in the Genus database with same CATH topology
 5GLF A;  2V3V A;  3IR5 A;  3X2K A;  3BQB A;  3CF2 A;  4GA6 A;  5D6W A;  1QCS A;  1WLF A;  2HCZ X;  3QQ8 A;  1I3Q A;  3FPR A;  2CW0 D;  4KO8 A;  1E61 A;  3X2L A;  1Q16 A;  3GTQ A;  2PWY A;  3CQZ A;  3HU1 A;  4FIB A;  4KLN A;  1PYU B;  4RV0 A;  1H0H A;  1KQF A;  1E18 A;  3HKZ A;  3FKI A;  2EEO B;  2LW6 A;  5FTJ A;  4ARI A;  1PQF A;  1E32 A;  1N10 A;  2E7Z A;  4AOK B;  3SUK A;  3ZJU A;  2PJJ A;  2NVX A;  1CZ5 A;  4D7Z B;  3X2J A;  5T5M D;  2B63 A;  3HU3 A;  3QQ7 A;  4JP7 A;  5GLX A;  2VPX A;  1K83 A;  2A69 D;  3MB5 A;  5CD1 A;  1KQG A;  2JA5 A;  2BH0 A;  5C1B A;  3ZJT A;  4KOD A;  1SFO A;  1BW3 A;  3D30 A;  2VPY A;  1Y1V A;  1L8F A;  2PI8 A;  3CZB A;  5FTM A;  5EQJ B;  1TWF A;  1DMR A;  1DMS A;  5FTN A;  2KY9 A;  1O54 A;  2AE0 X;  2PJH B;  4DMR A;  4CRY G;  1TWC A;  5EPP A;  2G6G A;  1PQH A;  1IW7 D;  4CRZ A;  1YNN D;  5DYI A;  5H4U A;  3O5A A;  2C45 A;  4FFT A;  1Y4Z A;  5T5I D;  2VUM A;  3X2M A;  2XDP A;  2YUJ A;  4UC4 A;  3GTG A;  2QQS A;  5CCB A;  3LGA A;  2B25 A;  2JIO A;  2G5D A;  3X2P A;  4FER A;  4NOH A;  4FG2 A;  4FG4 A;  5D6Y A;  1EU1 A;  3ZGZ A;  4JS7 A;  5C18 A;  1G8J A;  4AAY A;  1WCM A;  4AZD A;  3GTK A;  3M3G A;  1ZC1 A;  2R93 A;  2DMR A;  3LHD A;  2JIR A;  1VC3 B;  1E5V A;  2NYA A;  1TWG A;  1YNJ D;  1WC2 A;  2V45 A;  1AA6 A;  2KQA A;  3GTP A;  2Q1A X;  5ERG B;  2GAE A;  3X2G A;  2MM2 A;  1SIW A;  2JIP A;  4ARC A;  3TIW A;  3ENG A;  1H5N A;  2JV2 A;  1YLE A;  3GTM A;  1Y1W A;  1CZ4 A;  2Q1D X;  1TMO A;  2YU9 A;  2QQR A;  4AQ7 A;  5D6X A;  2BE5 D;  2JIM A;  1HD5 A;  4GA5 A;  4AVR A;  4AON B;  4CQN A;  4C2M A;  2VPW A;  3SUM A;  1UHD A;  4ENG A;  4CS0 A;  1BW4 A;  1OA9 A;  1QDN A;  4JP6 A;  3OUG A;  2R92 A;  2ENG A;  3X2N A;  2A68 D;  2JA7 A;  3FPU A;  2JA6 A;  2VPZ A;  2YVL A;  2O5J D;  1I9G A;  1OA7 A;  1PYQ A;  1CR5 A;  2A6E D;  1PT1 A;  3DMR A;  3SUJ A;  2E2H A;  4QIW A;  1PT0 A;  1E60 A;  4JCW A;  1AW8 B;  3X2H A;  3GTO A;  2GF7 A;  2Q18 X;  2A6H D;  1PQE A;  2PNW A;  3PLX B;  4L48 A;  1I50 A;  5FTL A;  5GM9 A;  1FDO A;  5FTK A;  1FDI A;  1R9T A;  2E2I A;  2NVY A;  1ZYR D;  3IR7 A;  2Y0S A;  2PMZ A;  2KI8 A;  3X2I A;  3IR6 A;  3GTL A;  2R7Z A;  3HU2 A;  1Y5I A;  5DYG A;  3GTJ A;  5GLY A;  2Q19 X;  3ZJV A;  1PPY A;  1R27 A;  4ZM7 A;  4JJO A;  3FPT A;  3H0G A;  4AYB A;  1S3S A;  4KDL A;  2GFA A;  3SUL A;  5B6C A;  3X2O A;  4AS1 A;  1UHE A;  3QWZ A;  1TWH A;  2JIQ A;  1TWA A;  2IV2 X;  3ML1 A;  2WB1 A;  4KDI A;  2PIC A;  1G8K A;  1R7R A;  3QC8 A;  1SMY D;  2WAQ A;  3TM7 B;  2MM0 A;  1OGY A;  5CCX A;  2NAP A;  2Q1C X; 
#chains in the Genus database with same CATH homology
 5GLF A;  2V3V A;  3IR5 A;  3BQB A;  3CF2 A;  4GA6 A;  5D6W A;  1QCS A;  1WLF A;  1I3Q A;  3QQ8 A;  3FPR A;  2CW0 D;  4KO8 A;  1E61 A;  3GTQ A;  1Q16 A;  2PWY A;  4FIB A;  3CQZ A;  3HU1 A;  4KLN A;  1PYU B;  4RV0 A;  1H0H A;  1KQF A;  1E18 A;  3HKZ A;  3FKI A;  2EEO B;  2LW6 A;  5FTJ A;  4ARI A;  1PQF A;  1E32 A;  2E7Z A;  4AOK B;  3ZJU A;  2PJJ A;  2NVX A;  1CZ5 A;  4D7Z B;  5T5M D;  2B63 A;  3HU3 A;  3QQ7 A;  1K83 A;  3MB5 A;  2VPX A;  2A69 D;  1KQG A;  2JA5 A;  5C1B A;  3ZJT A;  4KOD A;  1SFO A;  2VPY A;  1Y1V A;  3CZB A;  2PI8 A;  5FTM A;  5EQJ B;  1TWF A;  1DMR A;  1DMS A;  5FTN A;  2KY9 A;  1O54 A;  2AE0 X;  2PJH B;  4DMR A;  4CRY G;  1TWC A;  5EPP A;  2G6G A;  1PQH A;  1IW7 D;  4CRZ A;  1YNN D;  5DYI A;  3O5A A;  2C45 A;  1Y4Z A;  5T5I D;  2VUM A;  2XDP A;  2YUJ A;  3GTG A;  2QQS A;  5CCB A;  3LGA A;  2B25 A;  2JIO A;  2G5D A;  4NOH A;  5D6Y A;  1EU1 A;  3ZGZ A;  5C18 A;  1G8J A;  4AAY A;  1WCM A;  4AZD A;  3GTK A;  1ZC1 A;  2R93 A;  2DMR A;  2JIR A;  1VC3 B;  1E5V A;  2V45 A;  1TWG A;  1YNJ D;  2NYA A;  1AA6 A;  5ERG B;  5CD1 A;  3GTP A;  2Q1A X;  2GAE A;  2MM2 A;  1SIW A;  2JIP A;  4ARC A;  3TIW A;  1H5N A;  2JV2 A;  1YLE A;  3GTM A;  1Y1W A;  1CZ4 A;  2Q1D X;  1TMO A;  2YU9 A;  2QQR A;  4AQ7 A;  5D6X A;  2BE5 D;  2JIM A;  4GA5 A;  4AON B;  4CQN A;  4C2M A;  2VPW A;  1UHD A;  4CS0 A;  1QDN A;  2R92 A;  3OUG A;  2A68 D;  2JA7 A;  3FPU A;  2JA6 A;  2VPZ A;  2YVL A;  2O5J D;  1I9G A;  3DMR A;  1PYQ A;  1CR5 A;  2A6E D;  1PT1 A;  2E2H A;  3LHD A;  2Q18 X;  4QIW A;  1PT0 A;  1E60 A;  3GTO A;  1AW8 B;  4UC4 A;  2GF7 A;  2A6H D;  1PQE A;  2PNW A;  3PLX B;  1I50 A;  5FTL A;  1FDO A;  5FTK A;  1FDI A;  1R9T A;  2E2I A;  2NVY A;  1ZYR D;  3IR7 A;  2Y0S A;  2PMZ A;  2KI8 A;  2R7Z A;  3IR6 A;  3GTL A;  2Q19 X;  3HU2 A;  1Y5I A;  5DYG A;  3GTJ A;  3ZJV A;  1PPY A;  1R27 A;  3FPT A;  3H0G A;  4AYB A;  1S3S A;  4KDL A;  2GFA A;  5B6C A;  4AS1 A;  1UHE A;  3QWZ A;  1TWH A;  2JIQ A;  1TWA A;  2IV2 X;  3ML1 A;  2WB1 A;  4KDI A;  2PIC A;  1G8K A;  1R7R A;  3QC8 A;  1SMY D;  2WAQ A;  3TM7 B;  2MM0 A;  1OGY A;  5CCX A;  2NAP A;  2Q1C X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...