4RV0A

Crystal structure of tn complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
159
Chain Sequence
b'GAMEPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase TER94
molecule tags Protein binding, transport protein
source organism Drosophila melanogaster
publication title Crystal structure of TN complex
rcsb
total genus 44
structure length 159
sequence length 167
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4rv0A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4rv0A02
1Y1VA 3GTGA 3GTMA 1PPYA 1DMSA 2Y0SA 1TWCA 2JV2A 5C1BA 2VUMA 3IR6A 2WAQA 1SFOA 5DYIA 4D7ZB 1PQFA 2JIPA 1KQGA 3IR7A 3QWZA 4GA6A 1TWFA 4KDIA 3GTKA 2PMZA 1Q16A 1FDIA 1QCSA 1UHEA 1E61A 1PT0A 1PYQA 2EEOB 3TM7B 4AOKB 1R27A 5DYGA 3CF2A 2V3VA 2JA5A 1TWAA 3HKZA 2V45A 1PQEA 4DMRA 1UHDA 3FKIA 1CZ5A 2YUJA 1CZ4A 1YLEA 3ML1A 3PLXB 1I50A 3GTLA 4CS0A 1E32A 1SIWA 5FTNA 5FTMA 4AYBA 1E18A 1IW7D 1TWHA 1OGYA 1TWGA 3HU2A 1H0HA 1WLFA 2KI8A 4KLNA 2E7ZA 3TIWA 1E5VA 1E60A 2VPXA 1PT1A 2PJHB 2WB1A 5GLFA 2JIMA 4AZDA 2VPYA 3QQ8A 5T5MD 4KDLA 2JIRA 1AA6A 3GTJA 1Y5IA 2R7ZA 2C45A 1ZC1A 1FDOA 1QDNA 2NYAA 3GTPA 2E2IA 3HU1A 3H0GA 5FTJA 5T5ID 1S3SA 3CQZA 3QQ7A 2NAPA 1KQFA 2R92A 2JIOA 2IV2X 4GA5A 1H5NA 1K83A 1R7RA 1DMRA 3IR5A 4CRYG 1G8KA 1Y1WA 4C2MA 2VPZA 2NVXA 1PYUB 1Y4ZA 2B63A 2JIQA 4KODA 5FTKA 3QC8A 5B6CA 2YU9A 1G8JA 4RV0A 3GTOA 3GTQA 1R9TA 4CRZA 4AAYA 4QIWA 2NVYA 2JA6A 4KO8A 2JA7A 1EU1A 3HU3A 1PQHA 1I3QA 3O5AA 1AW8B 5FTLA 2DMRA 2VPWA 5C18A 5EPPA 2E2HA 3DMRA 1CR5A 2R93A 4AONB 1TMOA 3OUGA 1WCMA 1VC3B
chains in the Genus database with same CATH superfamily
1Y1VA 3GTGA 3X2KA 3GTMA 2YVLA 1PPYA 1DMSA 3ZJVA 4NOHA 2Q18X 2Y0SA 1HD5A 1TWCA 4JJOA 2JV2A 5C1BA 2VUMA 3IR6A 5GM9A 2WAQA 1SFOA 5DYIA 2PJJA 2CW0D 4L48A 4D7ZB 2B25A 1PQFA 4FFTA 1BW3A 2JIPA 1KQGA 3IR7A 2PNWA 3QWZA 3X2IA 3X2HA 2PI8A 4GA6A 1TWFA 4KDIA 2Q1CX 3GTKA 3X2JA 2PMZA 3D30A 4JP6A 4FERA 1Q16A 1FDIA 1QCSA 1UHEA 1WC2A 1E61A 1PT0A 1PYQA 2EEOB 5H4UA 3SULA 3TM7B 2O5JD 4AVRA 5D6WA 3SUJA 4AQ7A 1L8FA 4AOKB 1R27A 2GAEA 3CF2A 2V3VA 5DYGA 4JCWA 1TWAA 2JA5A 2BE5D 3HKZA 1PQEA 2V45A 4DMRA 1UHDA 3ENGA 3FKIA 1I9GA 1CZ5A 2Q1AX 3FPUA 2YUJA 1CZ4A 4AS1A 2GF7A 1N10A 5ERGB 1YLEA 2A6ED 5CD1A 3ML1A 3PLXB 3FPRA 1I50A 3GTLA 4CS0A 2A69D 2MM0A 4UC4A 1E32A 1BW4A 1SIWA 2G5DA 5FTNA 3ZJUA 4CQNA 5FTMA 4AYBA 1E18A 1IW7D 2G6GA 1TWHA 1OGYA 1TWGA 1O54A 3HU2A 3X2OA 1H0HA 3CZBA 1WLFA 2KI8A 4KLNA 4ARIA 2PICA 4JP7A 2E7ZA 3TIWA 2A68D 3MB5A 5EQJB 1E5VA 1E60A 5GLXA 2HCZX 2VPXA 3X2NA 1PT1A 4FIBA 1YNND 2PJHB 2WB1A 5GLFA 2JIMA 4AZDA 4ZM7A 2VPYA 3QQ8A 5T5MD 4KDLA 2JIRA 1AA6A 3GTJA 1Y5IA 2XDPA 2R7ZA 2QQRA 2C45A 1ZC1A 1FDOA 1QDNA 2AE0X 2LW6A 2NYAA 2ENGA 3GTPA 2E2IA 3HU1A 3H0GA 5FTJA 5T5ID 1S3SA 3CQZA 3QQ7A 3X2PA 2NAPA 4JS7A 1KQFA 2R92A 2JIOA 3X2LA 3ZGZA 2IV2X 4GA5A 1H5NA 1K83A 1R7RA 2MM2A 5D6YA 1DMRA 3IR5A 4CRYG 1G8KA 2QQSA 1Y1WA 5D6XA 3SUKA 4C2MA 2VPZA 2NVXA 1ZYRD 1PYUB 5CCBA 1Y4ZA 2B63A 3LGAA 2JIQA 4FG2A 3M3GA 1OA9A 2Q1DX 4ARCA 2KY9A 4KODA 3LHDA 5CCXA 5FTKA 3QC8A 2KQAA 5B6CA 2YU9A 2BH0A 3FPTA 2Q19X 4ENGA 3SUMA 1G8JA 4RV0A 3GTOA 3GTQA 1R9TA 1OA7A 4CRZA 4AAYA 1SMYD 4QIWA 2NVYA 4FG4A 5GLYA 2JA6A 4KO8A 2JA7A 1EU1A 3X2MA 1YNJD 3HU3A 1PQHA 1I3QA 3O5AA 1AW8B 5FTLA 3ZJTA 2A6HD 2DMRA 3BQBA 2VPWA 5C18A 5EPPA 2E2HA 3DMRA 1CR5A 2R93A 3X2GA 2PWYA 4AONB 1TMOA 3OUGA 2GFAA 1WCMA 1VC3B
chains in the Genus database with same CATH topology
1Y1VA 3GTGA 3GTMA 2YVLA 1PPYA 1DMSA 3ZJVA 4NOHA 2Q18X 2Y0SA 1TWCA 2JV2A 5C1BA 2VUMA 3IR6A 2WAQA 1SFOA 5DYIA 2PJJA 2CW0D 4D7ZB 2B25A 1PQFA 2JIPA 1KQGA 3IR7A 2PNWA 3QWZA 2Q1CX 2PI8A 4GA6A 1TWFA 4KDIA 3GTKA 2PMZA 1Q16A 1FDIA 1QCSA 1UHEA 1E61A 1PT0A 1PYQA 2EEOB 2O5JD 5D6WA 3TM7B 4AQ7A 4AOKB 1R27A 2GAEA 3CF2A 2V3VA 5DYGA 2JA5A 1TWAA 2BE5D 3HKZA 2V45A 1PQEA 4DMRA 1UHDA 3FKIA 1I9GA 2Q1AX 1CZ5A 3FPUA 4AS1A 2YUJA 1CZ4A 2GF7A 5ERGB 1YLEA 2A6ED 5CD1A 3ML1A 3PLXB 3FPRA 1I50A 3GTLA 4CS0A 2A69D 2MM0A 4UC4A 1E32A 3ZJUA 1SIWA 2G5DA 5FTNA 4CQNA 5FTMA 4AYBA 1E18A 1IW7D 2G6GA 1TWHA 1OGYA 1TWGA 1O54A 3HU2A 1H0HA 3CZBA 1WLFA 2KI8A 4KLNA 4ARIA 2PICA 2E7ZA 3TIWA 2A68D 3MB5A 5EQJB 1E5VA 1E60A 2VPXA 1PT1A 4FIBA 1YNND 2PJHB 2WB1A 5GLFA 2JIMA 4AZDA 2VPYA 3QQ8A 5T5MD 4KDLA 2JIRA 1AA6A 3GTJA 1Y5IA 2XDPA 2R7ZA 2QQRA 2C45A 1ZC1A 1FDOA 1QDNA 2AE0X 2LW6A 2NYAA 3GTPA 2E2IA 3HU1A 3H0GA 5FTJA 5T5ID 1S3SA 3CQZA 3QQ7A 2NAPA 1KQFA 2R92A 2JIOA 3ZGZA 2IV2X 4GA5A 1H5NA 1K83A 1R7RA 2MM2A 5D6YA 1DMRA 3IR5A 4CRYG 1G8KA 2QQSA 1Y1WA 5D6XA 4C2MA 2VPZA 2NVXA 1ZYRD 1PYUB 5CCBA 1Y4ZA 2B63A 3LGAA 2JIQA 2Q1DX 4ARCA 2KY9A 4KODA 3LHDA 5CCXA 5FTKA 3QC8A 5B6CA 2YU9A 3FPTA 2Q19X 1G8JA 4RV0A 3GTOA 3GTQA 1R9TA 4CRZA 4AAYA 1SMYD 4QIWA 2NVYA 2JA6A 4KO8A 2JA7A 1EU1A 1YNJD 3HU3A 1PQHA 1I3QA 3O5AA 1AW8B 5FTLA 3ZJTA 2A6HD 2DMRA 3BQBA 2VPWA 5C18A 5EPPA 2E2HA 3DMRA 1CR5A 2R93A 2PWYA 4AONB 1TMOA 3OUGA 2GFAA 1WCMA 1VC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V A;  3GTG A;  3GTM A;  1PPY A;  1DMS A;  2Y0S A;  1TWC A;  2JV2 A;  5C1B A;  2VUM A;  3IR6 A;  2WAQ A;  1SFO A;  5DYI A;  4D7Z B;  1PQF A;  2JIP A;  1KQG A;  3IR7 A;  3QWZ A;  4GA6 A;  1TWF A;  4KDI A;  3GTK A;  2PMZ A;  1Q16 A;  1FDI A;  1QCS A;  1UHE A;  1E61 A;  1PT0 A;  1PYQ A;  2EEO B;  3TM7 B;  4AOK B;  1R27 A;  5DYG A;  3CF2 A;  2V3V A;  2JA5 A;  1TWA A;  3HKZ A;  2V45 A;  1PQE A;  4DMR A;  1UHD A;  3FKI A;  1CZ5 A;  2YUJ A;  1CZ4 A;  1YLE A;  3ML1 A;  3PLX B;  1I50 A;  3GTL A;  4CS0 A;  1E32 A;  1SIW A;  5FTN A;  5FTM A;  4AYB A;  1E18 A;  1IW7 D;  1TWH A;  1OGY A;  1TWG A;  3HU2 A;  1H0H A;  1WLF A;  2KI8 A;  4KLN A;  2E7Z A;  3TIW A;  1E5V A;  1E60 A;  2VPX A;  1PT1 A;  2PJH B;  2WB1 A;  5GLF A;  2JIM A;  4AZD A;  2VPY A;  3QQ8 A;  5T5M D;  4KDL A;  2JIR A;  1AA6 A;  3GTJ A;  1Y5I A;  2R7Z A;  2C45 A;  1ZC1 A;  1FDO A;  1QDN A;  2NYA A;  3GTP A;  2E2I A;  3HU1 A;  3H0G A;  5FTJ A;  5T5I D;  1S3S A;  3CQZ A;  3QQ7 A;  2NAP A;  1KQF A;  2R92 A;  2JIO A;  2IV2 X;  4GA5 A;  1H5N A;  1K83 A;  1R7R A;  1DMR A;  3IR5 A;  4CRY G;  1G8K A;  1Y1W A;  4C2M A;  2VPZ A;  2NVX A;  1PYU B;  1Y4Z A;  2B63 A;  2JIQ A;  4KOD A;  5FTK A;  3QC8 A;  5B6C A;  2YU9 A;  1G8J A;  4RV0 A;  3GTO A;  3GTQ A;  1R9T A;  4CRZ A;  4AAY A;  4QIW A;  2NVY A;  2JA6 A;  4KO8 A;  2JA7 A;  1EU1 A;  3HU3 A;  1PQH A;  1I3Q A;  3O5A A;  1AW8 B;  5FTL A;  2DMR A;  2VPW A;  5C18 A;  5EPP A;  2E2H A;  3DMR A;  1CR5 A;  2R93 A;  4AON B;  1TMO A;  3OUG A;  1WCM A;  1VC3 B; 
#chains in the Genus database with same CATH topology
 1Y1V A;  3GTG A;  3X2K A;  3GTM A;  2YVL A;  1PPY A;  1DMS A;  3ZJV A;  4NOH A;  2Q18 X;  2Y0S A;  1HD5 A;  1TWC A;  4JJO A;  2JV2 A;  5C1B A;  2VUM A;  3IR6 A;  5GM9 A;  2WAQ A;  1SFO A;  5DYI A;  2PJJ A;  2CW0 D;  4L48 A;  4D7Z B;  2B25 A;  1PQF A;  4FFT A;  1BW3 A;  2JIP A;  1KQG A;  3IR7 A;  2PNW A;  3QWZ A;  3X2I A;  3X2H A;  2PI8 A;  4GA6 A;  1TWF A;  4KDI A;  2Q1C X;  3GTK A;  3X2J A;  2PMZ A;  3D30 A;  4JP6 A;  4FER A;  1Q16 A;  1FDI A;  1QCS A;  1UHE A;  1WC2 A;  1E61 A;  1PT0 A;  1PYQ A;  2EEO B;  5H4U A;  3SUL A;  3TM7 B;  2O5J D;  4AVR A;  5D6W A;  3SUJ A;  4AQ7 A;  1L8F A;  4AOK B;  1R27 A;  2GAE A;  3CF2 A;  2V3V A;  5DYG A;  4JCW A;  1TWA A;  2JA5 A;  2BE5 D;  3HKZ A;  1PQE A;  2V45 A;  4DMR A;  1UHD A;  3ENG A;  3FKI A;  1I9G A;  1CZ5 A;  2Q1A X;  3FPU A;  2YUJ A;  1CZ4 A;  4AS1 A;  2GF7 A;  1N10 A;  5ERG B;  1YLE A;  2A6E D;  5CD1 A;  3ML1 A;  3PLX B;  3FPR A;  1I50 A;  3GTL A;  4CS0 A;  2A69 D;  2MM0 A;  4UC4 A;  1E32 A;  1BW4 A;  1SIW A;  2G5D A;  5FTN A;  3ZJU A;  4CQN A;  5FTM A;  4AYB A;  1E18 A;  1IW7 D;  2G6G A;  1TWH A;  1OGY A;  1TWG A;  1O54 A;  3HU2 A;  3X2O A;  1H0H A;  3CZB A;  1WLF A;  2KI8 A;  4KLN A;  4ARI A;  2PIC A;  4JP7 A;  2E7Z A;  3TIW A;  2A68 D;  3MB5 A;  5EQJ B;  1E5V A;  1E60 A;  5GLX A;  2HCZ X;  2VPX A;  3X2N A;  1PT1 A;  4FIB A;  1YNN D;  2PJH B;  2WB1 A;  5GLF A;  2JIM A;  4AZD A;  4ZM7 A;  2VPY A;  3QQ8 A;  5T5M D;  4KDL A;  2JIR A;  1AA6 A;  3GTJ A;  1Y5I A;  2XDP A;  2R7Z A;  2QQR A;  2C45 A;  1ZC1 A;  1FDO A;  1QDN A;  2AE0 X;  2LW6 A;  2NYA A;  2ENG A;  3GTP A;  2E2I A;  3HU1 A;  3H0G A;  5FTJ A;  5T5I D;  1S3S A;  3CQZ A;  3QQ7 A;  3X2P A;  2NAP A;  4JS7 A;  1KQF A;  2R92 A;  2JIO A;  3X2L A;  3ZGZ A;  2IV2 X;  4GA5 A;  1H5N A;  1K83 A;  1R7R A;  2MM2 A;  5D6Y A;  1DMR A;  3IR5 A;  4CRY G;  1G8K A;  2QQS A;  1Y1W A;  5D6X A;  3SUK A;  4C2M A;  2VPZ A;  2NVX A;  1ZYR D;  1PYU B;  5CCB A;  1Y4Z A;  2B63 A;  3LGA A;  2JIQ A;  4FG2 A;  3M3G A;  1OA9 A;  2Q1D X;  4ARC A;  2KY9 A;  4KOD A;  3LHD A;  5CCX A;  5FTK A;  3QC8 A;  2KQA A;  5B6C A;  2YU9 A;  2BH0 A;  3FPT A;  2Q19 X;  4ENG A;  3SUM A;  1G8J A;  4RV0 A;  3GTO A;  3GTQ A;  1R9T A;  1OA7 A;  4CRZ A;  4AAY A;  1SMY D;  4QIW A;  2NVY A;  4FG4 A;  5GLY A;  2JA6 A;  4KO8 A;  2JA7 A;  1EU1 A;  3X2M A;  1YNJ D;  3HU3 A;  1PQH A;  1I3Q A;  3O5A A;  1AW8 B;  5FTL A;  3ZJT A;  2A6H D;  2DMR A;  3BQB A;  2VPW A;  5C18 A;  5EPP A;  2E2H A;  3DMR A;  1CR5 A;  2R93 A;  3X2G A;  2PWY A;  4AON B;  1TMO A;  3OUG A;  2GFA A;  1WCM A;  1VC3 B; 
#chains in the Genus database with same CATH homology
 1Y1V A;  3GTG A;  3GTM A;  2YVL A;  1PPY A;  1DMS A;  3ZJV A;  4NOH A;  2Q18 X;  2Y0S A;  1TWC A;  2JV2 A;  5C1B A;  2VUM A;  3IR6 A;  2WAQ A;  1SFO A;  5DYI A;  2PJJ A;  2CW0 D;  4D7Z B;  2B25 A;  1PQF A;  2JIP A;  1KQG A;  3IR7 A;  2PNW A;  3QWZ A;  2Q1C X;  2PI8 A;  4GA6 A;  1TWF A;  4KDI A;  3GTK A;  2PMZ A;  1Q16 A;  1FDI A;  1QCS A;  1UHE A;  1E61 A;  1PT0 A;  1PYQ A;  2EEO B;  2O5J D;  5D6W A;  3TM7 B;  4AQ7 A;  4AOK B;  1R27 A;  2GAE A;  3CF2 A;  2V3V A;  5DYG A;  2JA5 A;  1TWA A;  2BE5 D;  3HKZ A;  2V45 A;  1PQE A;  4DMR A;  1UHD A;  3FKI A;  1I9G A;  2Q1A X;  1CZ5 A;  3FPU A;  4AS1 A;  2YUJ A;  1CZ4 A;  2GF7 A;  5ERG B;  1YLE A;  2A6E D;  5CD1 A;  3ML1 A;  3PLX B;  3FPR A;  1I50 A;  3GTL A;  4CS0 A;  2A69 D;  2MM0 A;  4UC4 A;  1E32 A;  3ZJU A;  1SIW A;  2G5D A;  5FTN A;  4CQN A;  5FTM A;  4AYB A;  1E18 A;  1IW7 D;  2G6G A;  1TWH A;  1OGY A;  1TWG A;  1O54 A;  3HU2 A;  1H0H A;  3CZB A;  1WLF A;  2KI8 A;  4KLN A;  4ARI A;  2PIC A;  2E7Z A;  3TIW A;  2A68 D;  3MB5 A;  5EQJ B;  1E5V A;  1E60 A;  2VPX A;  1PT1 A;  4FIB A;  1YNN D;  2PJH B;  2WB1 A;  5GLF A;  2JIM A;  4AZD A;  2VPY A;  3QQ8 A;  5T5M D;  4KDL A;  2JIR A;  1AA6 A;  3GTJ A;  1Y5I A;  2XDP A;  2R7Z A;  2QQR A;  2C45 A;  1ZC1 A;  1FDO A;  1QDN A;  2AE0 X;  2LW6 A;  2NYA A;  3GTP A;  2E2I A;  3HU1 A;  3H0G A;  5FTJ A;  5T5I D;  1S3S A;  3CQZ A;  3QQ7 A;  2NAP A;  1KQF A;  2R92 A;  2JIO A;  3ZGZ A;  2IV2 X;  4GA5 A;  1H5N A;  1K83 A;  1R7R A;  2MM2 A;  5D6Y A;  1DMR A;  3IR5 A;  4CRY G;  1G8K A;  2QQS A;  1Y1W A;  5D6X A;  4C2M A;  2VPZ A;  2NVX A;  1ZYR D;  1PYU B;  5CCB A;  1Y4Z A;  2B63 A;  3LGA A;  2JIQ A;  2Q1D X;  4ARC A;  2KY9 A;  4KOD A;  3LHD A;  5CCX A;  5FTK A;  3QC8 A;  5B6C A;  2YU9 A;  3FPT A;  2Q19 X;  1G8J A;  4RV0 A;  3GTO A;  3GTQ A;  1R9T A;  4CRZ A;  4AAY A;  1SMY D;  4QIW A;  2NVY A;  2JA6 A;  4KO8 A;  2JA7 A;  1EU1 A;  1YNJ D;  3HU3 A;  1PQH A;  1I3Q A;  3O5A A;  1AW8 B;  5FTL A;  3ZJT A;  2A6H D;  2DMR A;  3BQB A;  2VPW A;  5C18 A;  5EPP A;  2E2H A;  3DMR A;  1CR5 A;  2R93 A;  2PWY A;  4AON B;  1TMO A;  3OUG A;  2GFA A;  1WCM A;  1VC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...