4RV0A

Crystal structure of tn complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
159
Chain Sequence
GAMEPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase TER94
publication title Crystal structure of TN complex
rcsb
source organism Drosophila melanogaster
molecule tags Protein binding, transport protein
total genus 44
structure length 159
sequence length 167
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4rv0A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4rv0A02
5FTLA 5FTKA 1KQGA 5T5ID 4RV0A 3GTJA 2V45A 1CZ4A 1UHDA 3DMRA 2WAQA 3GTLA 1CZ5A 3HKZA 5DYGA 1PQFA 1Y4ZA 4DMRA 1E60A 4QIWA 1PQEA 1QCSA 1WLFA 2JA7A 5FTJA 2NVXA 1DMSA 1WCMA 3HU2A 4KODA 4AONB 3QWZA 3GTGA 5B6CA 1ZC1A 5GLFA 3QQ8A 1PT0A 2R93A 1PYQA 3CF2A 3QC8A 2VUMA 2JIOA 3HU3A 1YLEA 2JIPA 4CS0A 1H5NA 2EEOB 1CR5A 3H0GA 1TWHA 4CRYG 4C2MA 1FDOA 4CRZA 3O5AA 1PPYA 2JA6A 1TWAA 1SFOA 1PQHA 3TM7B 1Y5IA 3GTPA 2R92A 1EU1A 5C1BA 4D7ZB 4AZDA 1E32A 1PYUB 1G8JA 3IR5A 5C18A 1S3SA 2C45A 2VPZA 2B63A 1G8KA 1AW8B 2JA5A 1E61A 2NVYA 1I50A 2VPYA 2NAPA 3GTOA 1TMOA 2KI8A 1Q16A 3GTQA 5DYIA 1TWGA 2R7ZA 4GA5A 2JIMA 1H0HA 4GA6A 1E18A 1R27A 2JIRA 1R7RA 3GTKA 1TWFA 1AA6A 1KQFA 1OGYA 3HU1A 1TWCA 2Y0SA 2VPWA 1Y1VA 3ML1A 2V3VA 4KO8A 1UHEA 3IR7A 2JV2A 3FKIA 1IW7D 3TIWA 2JIQA 5FTNA 1E5VA 2E2IA 1FDIA 1K83A 2VPXA 2NYAA 5FTMA 1I3QA 3OUGA 4AYBA 2E2HA 2PJHB 1PT1A 3IR6A 2PMZA 2WB1A 2YUJA 4AAYA 3CQZA 2DMRA 4KDLA 2IV2X 3GTMA 1Y1WA 5T5MD 1DMRA 1R9TA 2E7ZA 4KLNA 4AOKB 4KDIA 1VC3B 5EPPA 3PLXB 1SIWA 3QQ7A 1QDNA 2YU9A
chains in the Genus database with same CATH superfamily
3X2KA 5FTKA 5FTLA 3SULA 1KQGA 4FG2A 4RV0A 5T5ID 3X2JA 3GTJA 2V45A 1CZ4A 1UHDA 2A68D 2WAQA 3DMRA 4L48A 3GTLA 3HKZA 5DYGA 1CZ5A 2Q1CX 1PQFA 1Y4ZA 3X2MA 4DMRA 1E60A 4QIWA 1PQEA 1QCSA 1WLFA 2JA7A 5FTJA 2NVXA 3FPUA 1YNND 1DMSA 1WCMA 3HU2A 4KODA 4AONB 3QWZA 3GTGA 5B6CA 2Q1AX 1WC2A 1ZC1A 3ZJVA 5GLFA 3QQ8A 4AS1A 2PWYA 1PT0A 2R93A 3LGAA 1PYQA 3CF2A 3QC8A 2VUMA 2JIOA 3HU3A 1YLEA 2JIPA 4NOHA 4CS0A 1ZYRD 4ARIA 3BQBA 5D6YA 1H5NA 2EEOB 1CR5A 3H0GA 1TWHA 3ZGZA 3X2GA 2PNWA 3CZBA 4CRYG 4JP7A 4C2MA 2MM2A 2Q19X 1FDOA 4CRZA 1SMYD 3O5AA 3SUJA 2BH0A 1PPYA 2JA6A 3ZJUA 1TWAA 3LHDA 3MB5A 3X2PA 1SFOA 1PQHA 3TM7B 2KY9A 4FG4A 1N10A 1Y5IA 2HCZX 3GTPA 2R92A 1EU1A 2PI8A 4JS7A 5H4UA 5C1BA 4ARCA 4D7ZB 4AVRA 4AZDA 1E32A 1BW3A 1PYUB 2GF7A 1G8JA 2O5JD 3IR5A 2A6ED 5C18A 1S3SA 2C45A 2VPZA 2B63A 4FFTA 2QQSA 1BW4A 1G8KA 1AW8B 2JA5A 2XDPA 1E61A 3SUMA 1O54A 4AQ7A 2NVYA 1I50A 2CW0D 2NAPA 2VPYA 3GTOA 1TMOA 2KI8A 5D6WA 1Q16A 5CD1A 5ERGB 5GLXA 3GTQA 5DYIA 1TWGA 3ENGA 1YNJD 2R7ZA 2MM0A 3FPTA 4GA5A 5CCBA 3ZJTA 2JIMA 3X2IA 1H0HA 2G5DA 4CQNA 3SUKA 5D6XA 4GA6A 2Q1DX 1E18A 1R27A 2JIRA 1R7RA 1OA7A 3GTKA 1TWFA 1AA6A 1KQFA 1OGYA 4ENGA 3HU1A 2YU9A 2QQRA 3X2HA 1TWCA 2Y0SA 3M3GA 2YVLA 1OA9A 2VPWA 4FIBA 4FERA 1Y1VA 3ML1A 2Q18X 2V3VA 4KO8A 1UHEA 4UC4A 4JJOA 3D30A 3IR7A 2JV2A 2A6HD 5GM9A 2LW6A 2BE5D 3FKIA 3X2OA 5GLYA 2PICA 1IW7D 4JCWA 3TIWA 2JIQA 5FTNA 1E5VA 2E2IA 5EQJB 2ENGA 1FDIA 1K83A 4JP6A 2GFAA 2VPXA 2NYAA 5FTMA 1I3QA 3OUGA 4AYBA 2GAEA 2E2HA 2PJHB 1PT1A 3IR6A 3X2LA 2PMZA 2PJJA 2WB1A 2B25A 3X2NA 3FPRA 2YUJA 4AAYA 3CQZA 2DMRA 4KDLA 2IV2X 3GTMA 1Y1WA 1I9GA 1L8FA 5T5MD 5CCXA 2G6GA 1DMRA 1R9TA 2E7ZA 2AE0X 4KLNA 2KQAA 4KDIA 2A69D 1VC3B 4AOKB 5EPPA 3PLXB 1SIWA 3QQ7A 4ZM7A 1QDNA 1HD5A
chains in the Genus database with same CATH topology
5FTLA 5FTKA 1KQGA 5T5ID 4RV0A 3GTJA 2V45A 1CZ4A 1UHDA 2A68D 2WAQA 3DMRA 3GTLA 1CZ5A 3HKZA 5DYGA 2Q1CX 1PQFA 1Y4ZA 4DMRA 1E60A 4QIWA 1PQEA 1QCSA 1WLFA 2JA7A 5FTJA 2NVXA 3FPUA 1YNND 1DMSA 1WCMA 3HU2A 4KODA 4AONB 3QWZA 3GTGA 5B6CA 2Q1AX 1ZC1A 3ZJVA 5GLFA 3QQ8A 4AS1A 2PWYA 1PT0A 2R93A 3LGAA 1PYQA 3CF2A 3QC8A 2VUMA 2JIOA 3HU3A 1YLEA 2JIPA 4NOHA 4CS0A 1ZYRD 4ARIA 3BQBA 5D6YA 1H5NA 2EEOB 1CR5A 3H0GA 1TWHA 3ZGZA 2PNWA 3CZBA 4CRYG 2Q19X 4C2MA 2MM2A 1FDOA 4CRZA 1SMYD 3O5AA 1PPYA 2JA6A 3ZJUA 1TWAA 3LHDA 3MB5A 2KY9A 1SFOA 1PQHA 3TM7B 1Y5IA 3GTPA 2R92A 1EU1A 2PI8A 5C1BA 4ARCA 4D7ZB 4AZDA 1E32A 2GF7A 1PYUB 1G8JA 2O5JD 3IR5A 2A6ED 5C18A 1S3SA 2C45A 2VPZA 2B63A 2QQSA 1G8KA 1AW8B 2JA5A 2XDPA 1E61A 4AQ7A 1O54A 2NVYA 1I50A 2CW0D 2NAPA 2VPYA 3GTOA 1TMOA 2KI8A 5D6WA 1Q16A 5CD1A 5ERGB 3GTQA 5DYIA 1TWGA 3FPTA 1YNJD 2R7ZA 2MM0A 4GA5A 5CCBA 3ZJTA 2JIMA 1H0HA 2G5DA 4CQNA 5D6XA 4GA6A 2Q1DX 1E18A 1R27A 2JIRA 1R7RA 3GTKA 1TWFA 1AA6A 1KQFA 1OGYA 3HU1A 2QQRA 1TWCA 2Y0SA 2YVLA 2VPWA 4FIBA 1Y1VA 3ML1A 2Q18X 2V3VA 4KO8A 1UHEA 4UC4A 3IR7A 2JV2A 2A6HD 2LW6A 2BE5D 3FKIA 2PICA 1IW7D 3TIWA 2JIQA 5FTNA 1E5VA 2E2IA 5EQJB 1FDIA 1K83A 2GFAA 2VPXA 2NYAA 5FTMA 1I3QA 3OUGA 4AYBA 2GAEA 2E2HA 2PJHB 1PT1A 3IR6A 2PMZA 2PJJA 2WB1A 2B25A 3FPRA 2YUJA 4AAYA 3CQZA 2DMRA 4KDLA 2IV2X 3GTMA 1Y1WA 1I9GA 5T5MD 5CCXA 2G6GA 1DMRA 1R9TA 2E7ZA 2AE0X 4KLNA 4AOKB 4KDIA 2A69D 1VC3B 5EPPA 3PLXB 1SIWA 3QQ7A 1QDNA 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTL A;  5FTK A;  1KQG A;  5T5I D;  4RV0 A;  3GTJ A;  2V45 A;  1CZ4 A;  1UHD A;  3DMR A;  2WAQ A;  3GTL A;  1CZ5 A;  3HKZ A;  5DYG A;  1PQF A;  1Y4Z A;  4DMR A;  1E60 A;  4QIW A;  1PQE A;  1QCS A;  1WLF A;  2JA7 A;  5FTJ A;  2NVX A;  1DMS A;  1WCM A;  3HU2 A;  4KOD A;  4AON B;  3QWZ A;  3GTG A;  5B6C A;  1ZC1 A;  5GLF A;  3QQ8 A;  1PT0 A;  2R93 A;  1PYQ A;  3CF2 A;  3QC8 A;  2VUM A;  2JIO A;  3HU3 A;  1YLE A;  2JIP A;  4CS0 A;  1H5N A;  2EEO B;  1CR5 A;  3H0G A;  1TWH A;  4CRY G;  4C2M A;  1FDO A;  4CRZ A;  3O5A A;  1PPY A;  2JA6 A;  1TWA A;  1SFO A;  1PQH A;  3TM7 B;  1Y5I A;  3GTP A;  2R92 A;  1EU1 A;  5C1B A;  4D7Z B;  4AZD A;  1E32 A;  1PYU B;  1G8J A;  3IR5 A;  5C18 A;  1S3S A;  2C45 A;  2VPZ A;  2B63 A;  1G8K A;  1AW8 B;  2JA5 A;  1E61 A;  2NVY A;  1I50 A;  2VPY A;  2NAP A;  3GTO A;  1TMO A;  2KI8 A;  1Q16 A;  3GTQ A;  5DYI A;  1TWG A;  2R7Z A;  4GA5 A;  2JIM A;  1H0H A;  4GA6 A;  1E18 A;  1R27 A;  2JIR A;  1R7R A;  3GTK A;  1TWF A;  1AA6 A;  1KQF A;  1OGY A;  3HU1 A;  1TWC A;  2Y0S A;  2VPW A;  1Y1V A;  3ML1 A;  2V3V A;  4KO8 A;  1UHE A;  3IR7 A;  2JV2 A;  3FKI A;  1IW7 D;  3TIW A;  2JIQ A;  5FTN A;  1E5V A;  2E2I A;  1FDI A;  1K83 A;  2VPX A;  2NYA A;  5FTM A;  1I3Q A;  3OUG A;  4AYB A;  2E2H A;  2PJH B;  1PT1 A;  3IR6 A;  2PMZ A;  2WB1 A;  2YUJ A;  4AAY A;  3CQZ A;  2DMR A;  4KDL A;  2IV2 X;  3GTM A;  1Y1W A;  5T5M D;  1DMR A;  1R9T A;  2E7Z A;  4KLN A;  4AOK B;  4KDI A;  1VC3 B;  5EPP A;  3PLX B;  1SIW A;  3QQ7 A;  1QDN A;  2YU9 A; 
#chains in the Genus database with same CATH topology
 3X2K A;  5FTK A;  5FTL A;  3SUL A;  1KQG A;  4FG2 A;  4RV0 A;  5T5I D;  3X2J A;  3GTJ A;  2V45 A;  1CZ4 A;  1UHD A;  2A68 D;  2WAQ A;  3DMR A;  4L48 A;  3GTL A;  3HKZ A;  5DYG A;  1CZ5 A;  2Q1C X;  1PQF A;  1Y4Z A;  3X2M A;  4DMR A;  1E60 A;  4QIW A;  1PQE A;  1QCS A;  1WLF A;  2JA7 A;  5FTJ A;  2NVX A;  3FPU A;  1YNN D;  1DMS A;  1WCM A;  3HU2 A;  4KOD A;  4AON B;  3QWZ A;  3GTG A;  5B6C A;  2Q1A X;  1WC2 A;  1ZC1 A;  3ZJV A;  5GLF A;  3QQ8 A;  4AS1 A;  2PWY A;  1PT0 A;  2R93 A;  3LGA A;  1PYQ A;  3CF2 A;  3QC8 A;  2VUM A;  2JIO A;  3HU3 A;  1YLE A;  2JIP A;  4NOH A;  4CS0 A;  1ZYR D;  4ARI A;  3BQB A;  5D6Y A;  1H5N A;  2EEO B;  1CR5 A;  3H0G A;  1TWH A;  3ZGZ A;  3X2G A;  2PNW A;  3CZB A;  4CRY G;  4JP7 A;  4C2M A;  2MM2 A;  2Q19 X;  1FDO A;  4CRZ A;  1SMY D;  3O5A A;  3SUJ A;  2BH0 A;  1PPY A;  2JA6 A;  3ZJU A;  1TWA A;  3LHD A;  3MB5 A;  3X2P A;  1SFO A;  1PQH A;  3TM7 B;  2KY9 A;  4FG4 A;  1N10 A;  1Y5I A;  2HCZ X;  3GTP A;  2R92 A;  1EU1 A;  2PI8 A;  4JS7 A;  5H4U A;  5C1B A;  4ARC A;  4D7Z B;  4AVR A;  4AZD A;  1E32 A;  1BW3 A;  1PYU B;  2GF7 A;  1G8J A;  2O5J D;  3IR5 A;  2A6E D;  5C18 A;  1S3S A;  2C45 A;  2VPZ A;  2B63 A;  4FFT A;  2QQS A;  1BW4 A;  1G8K A;  1AW8 B;  2JA5 A;  2XDP A;  1E61 A;  3SUM A;  1O54 A;  4AQ7 A;  2NVY A;  1I50 A;  2CW0 D;  2NAP A;  2VPY A;  3GTO A;  1TMO A;  2KI8 A;  5D6W A;  1Q16 A;  5CD1 A;  5ERG B;  5GLX A;  3GTQ A;  5DYI A;  1TWG A;  3ENG A;  1YNJ D;  2R7Z A;  2MM0 A;  3FPT A;  4GA5 A;  5CCB A;  3ZJT A;  2JIM A;  3X2I A;  1H0H A;  2G5D A;  4CQN A;  3SUK A;  5D6X A;  4GA6 A;  2Q1D X;  1E18 A;  1R27 A;  2JIR A;  1R7R A;  1OA7 A;  3GTK A;  1TWF A;  1AA6 A;  1KQF A;  1OGY A;  4ENG A;  3HU1 A;  2YU9 A;  2QQR A;  3X2H A;  1TWC A;  2Y0S A;  3M3G A;  2YVL A;  1OA9 A;  2VPW A;  4FIB A;  4FER A;  1Y1V A;  3ML1 A;  2Q18 X;  2V3V A;  4KO8 A;  1UHE A;  4UC4 A;  4JJO A;  3D30 A;  3IR7 A;  2JV2 A;  2A6H D;  5GM9 A;  2LW6 A;  2BE5 D;  3FKI A;  3X2O A;  5GLY A;  2PIC A;  1IW7 D;  4JCW A;  3TIW A;  2JIQ A;  5FTN A;  1E5V A;  2E2I A;  5EQJ B;  2ENG A;  1FDI A;  1K83 A;  4JP6 A;  2GFA A;  2VPX A;  2NYA A;  5FTM A;  1I3Q A;  3OUG A;  4AYB A;  2GAE A;  2E2H A;  2PJH B;  1PT1 A;  3IR6 A;  3X2L A;  2PMZ A;  2PJJ A;  2WB1 A;  2B25 A;  3X2N A;  3FPR A;  2YUJ A;  4AAY A;  3CQZ A;  2DMR A;  4KDL A;  2IV2 X;  3GTM A;  1Y1W A;  1I9G A;  1L8F A;  5T5M D;  5CCX A;  2G6G A;  1DMR A;  1R9T A;  2E7Z A;  2AE0 X;  4KLN A;  2KQA A;  4KDI A;  2A69 D;  1VC3 B;  4AOK B;  5EPP A;  3PLX B;  1SIW A;  3QQ7 A;  4ZM7 A;  1QDN A;  1HD5 A; 
#chains in the Genus database with same CATH homology
 5FTL A;  5FTK A;  1KQG A;  5T5I D;  4RV0 A;  3GTJ A;  2V45 A;  1CZ4 A;  1UHD A;  2A68 D;  2WAQ A;  3DMR A;  3GTL A;  1CZ5 A;  3HKZ A;  5DYG A;  2Q1C X;  1PQF A;  1Y4Z A;  4DMR A;  1E60 A;  4QIW A;  1PQE A;  1QCS A;  1WLF A;  2JA7 A;  5FTJ A;  2NVX A;  3FPU A;  1YNN D;  1DMS A;  1WCM A;  3HU2 A;  4KOD A;  4AON B;  3QWZ A;  3GTG A;  5B6C A;  2Q1A X;  1ZC1 A;  3ZJV A;  5GLF A;  3QQ8 A;  4AS1 A;  2PWY A;  1PT0 A;  2R93 A;  3LGA A;  1PYQ A;  3CF2 A;  3QC8 A;  2VUM A;  2JIO A;  3HU3 A;  1YLE A;  2JIP A;  4NOH A;  4CS0 A;  1ZYR D;  4ARI A;  3BQB A;  5D6Y A;  1H5N A;  2EEO B;  1CR5 A;  3H0G A;  1TWH A;  3ZGZ A;  2PNW A;  3CZB A;  4CRY G;  2Q19 X;  4C2M A;  2MM2 A;  1FDO A;  4CRZ A;  1SMY D;  3O5A A;  1PPY A;  2JA6 A;  3ZJU A;  1TWA A;  3LHD A;  3MB5 A;  2KY9 A;  1SFO A;  1PQH A;  3TM7 B;  1Y5I A;  3GTP A;  2R92 A;  1EU1 A;  2PI8 A;  5C1B A;  4ARC A;  4D7Z B;  4AZD A;  1E32 A;  2GF7 A;  1PYU B;  1G8J A;  2O5J D;  3IR5 A;  2A6E D;  5C18 A;  1S3S A;  2C45 A;  2VPZ A;  2B63 A;  2QQS A;  1G8K A;  1AW8 B;  2JA5 A;  2XDP A;  1E61 A;  4AQ7 A;  1O54 A;  2NVY A;  1I50 A;  2CW0 D;  2NAP A;  2VPY A;  3GTO A;  1TMO A;  2KI8 A;  5D6W A;  1Q16 A;  5CD1 A;  5ERG B;  3GTQ A;  5DYI A;  1TWG A;  3FPT A;  1YNJ D;  2R7Z A;  2MM0 A;  4GA5 A;  5CCB A;  3ZJT A;  2JIM A;  1H0H A;  2G5D A;  4CQN A;  5D6X A;  4GA6 A;  2Q1D X;  1E18 A;  1R27 A;  2JIR A;  1R7R A;  3GTK A;  1TWF A;  1AA6 A;  1KQF A;  1OGY A;  3HU1 A;  2QQR A;  1TWC A;  2Y0S A;  2YVL A;  2VPW A;  4FIB A;  1Y1V A;  3ML1 A;  2Q18 X;  2V3V A;  4KO8 A;  1UHE A;  4UC4 A;  3IR7 A;  2JV2 A;  2A6H D;  2LW6 A;  2BE5 D;  3FKI A;  2PIC A;  1IW7 D;  3TIW A;  2JIQ A;  5FTN A;  1E5V A;  2E2I A;  5EQJ B;  1FDI A;  1K83 A;  2GFA A;  2VPX A;  2NYA A;  5FTM A;  1I3Q A;  3OUG A;  4AYB A;  2GAE A;  2E2H A;  2PJH B;  1PT1 A;  3IR6 A;  2PMZ A;  2PJJ A;  2WB1 A;  2B25 A;  3FPR A;  2YUJ A;  4AAY A;  3CQZ A;  2DMR A;  4KDL A;  2IV2 X;  3GTM A;  1Y1W A;  1I9G A;  5T5M D;  5CCX A;  2G6G A;  1DMR A;  1R9T A;  2E7Z A;  2AE0 X;  4KLN A;  4AOK B;  4KDI A;  2A69 D;  1VC3 B;  5EPP A;  3PLX B;  1SIW A;  3QQ7 A;  1QDN A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...