4RV0A

Crystal structure of tn complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
159
Chain Sequence
b'GAMEPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase TER94
publication title Crystal structure of TN complex
rcsb
source organism Drosophila melanogaster
molecule tags Protein binding, transport protein
total genus 44
structure length 159
sequence length 167
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 4rv0A01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4rv0A02
3OUGA 2VPWA 1FDOA 1Y1VA 3IR6A 1WLFA 3PLXB 2E2HA 2IV2X 1UHEA 3QQ8A 1R9TA 2YUJA 1PT1A 1G8KA 5FTJA 1YLEA 1PT0A 1TWHA 3GTQA 1PQEA 4GA6A 2NVXA 5EPPA 1EU1A 2JIRA 3DMRA 3HKZA 3GTPA 1E5VA 1PQFA 2V3VA 3HU2A 3HU1A 1AW8B 2EEOB 3IR5A 4DMRA 4KDIA 1TWFA 4C2MA 3TIWA 3GTGA 1Y4ZA 1Y5IA 2VPZA 1I50A 1TWCA 2NVYA 3IR7A 1PPYA 2VUMA 3GTOA 1PYQA 2JIMA 4KDLA 5FTKA 4CRZA 2JIPA 1QCSA 1CR5A 1PQHA 3CQZA 1TWAA 1CZ4A 4KLNA 5DYIA 2R93A 3ML1A 1E32A 3O5AA 1SIWA 3TM7B 1TMOA 2PJHB 4RV0A 1I3QA 1R27A 5FTLA 2R7ZA 2E7ZA 1TWGA 1UHDA 2YU9A 1OGYA 5FTNA 4CRYG 2JIOA 5GLFA 2PMZA 3GTKA 2E2IA 1E18A 3QQ7A 1FDIA 1CZ5A 2DMRA 2V45A 1E60A 1PYUB 2WB1A 5FTMA 1G8JA 2NAPA 3QC8A 2R92A 1AA6A 2JA5A 1Y1WA 4QIWA 1ZC1A 1DMSA 1H0HA 1SFOA 2JA7A 1K83A 3FKIA 2JV2A 1E61A 2WAQA 1WCMA 3GTLA 1Q16A 2JIQA 3HU3A 4AZDA 4AAYA 3GTJA 1DMRA 1R7RA 4CS0A 2NYAA 1KQGA 5T5ID 5DYGA 5T5MD 4GA5A 4D7ZB 5B6CA 3GTMA 2VPXA 4AYBA 2JA6A 4KODA 5C18A 1S3SA 4AONB 3QWZA 3CF2A 1VC3B 4KO8A 2VPYA 3H0GA 4AOKB 1H5NA 2Y0SA 1QDNA 2B63A 2KI8A 2C45A 1KQFA 1IW7D 5C1BA
chains in the Genus database with same CATH superfamily
2BE5D 2VPWA 3OUGA 4AVRA 3ZJTA 1FDOA 1Y1VA 2A68D 3X2MA 3SUJA 1N10A 3IR6A 1WLFA 3PLXB 2E2HA 2IV2X 1UHEA 2BH0A 3QQ8A 2A6HD 4FG4A 4JP7A 3X2JA 1R9TA 5CCXA 2YUJA 1I9GA 1PT1A 1G8KA 5FTJA 2Q1AX 1YLEA 2ENGA 3ZGZA 2PWYA 1PT0A 1TWHA 2G5DA 1PQEA 4GA6A 3GTQA 5EPPA 2NVXA 1EU1A 2JIRA 3DMRA 3HKZA 5H4UA 3GTPA 1E5VA 2GF7A 1YNND 1PQFA 1WC2A 2A6ED 2V3VA 5CD1A 3HU2A 3HU1A 1OA7A 1AW8B 2EEOB 3IR5A 4DMRA 4KDIA 2AE0X 3MB5A 1TWFA 4C2MA 3TIWA 3GTGA 2PI8A 2Q18X 2CW0D 2YVLA 2O5JD 1Y4ZA 1Y5IA 2VPZA 1I50A 1TWCA 2A69D 4FERA 2NVYA 2MM2A 2MM0A 3IR7A 1PPYA 1YNJD 2B25A 2HCZX 1OA9A 3X2LA 2VUMA 1SMYD 1BW4A 4FG2A 4ARCA 5D6XA 3GTOA 1L8FA 1PYQA 2JIMA 4KDLA 4NOHA 5FTKA 4CRZA 2JIPA 1O54A 1QCSA 3ZJVA 1CR5A 1PQHA 3D30A 3CQZA 1TWAA 2QQRA 1CZ4A 4KLNA 5DYIA 2R93A 3ML1A 1E32A 3O5AA 1SIWA 4JJOA 3TM7B 4AS1A 1TMOA 2PJHB 4RV0A 1I3QA 1R27A 5FTLA 3X2GA 2R7ZA 2E7ZA 1TWGA 1UHDA 2XDPA 2YU9A 5D6YA 1OGYA 5FTNA 4CRYG 2JIOA 5GLFA 3ZJUA 2PMZA 3GTKA 1HD5A 2Q1CX 3SUMA 2E2IA 1E18A 3QQ7A 2PNWA 3X2NA 1FDIA 5GLYA 1CZ5A 2GFAA 2DMRA 3SUKA 4L48A 2V45A 1E60A 1PYUB 3X2OA 2G6GA 2WB1A 5FTMA 3FPRA 1G8JA 2NAPA 3SULA 4ZM7A 3QC8A 4CQNA 2R92A 2KQAA 1ZYRD 1AA6A 2JA5A 3ENGA 1Y1WA 5CCBA 4QIWA 1ZC1A 2Q19X 1DMSA 1H0HA 4JCWA 1SFOA 2JA7A 1K83A 3FKIA 2JV2A 4JP6A 4FIBA 1E61A 4UC4A 2WAQA 5ERGB 1WCMA 3GTLA 3X2KA 2LW6A 1Q16A 2JIQA 4ARIA 4ENGA 2PICA 3HU3A 4AZDA 4AAYA 3GTJA 3FPTA 1DMRA 3LGAA 1BW3A 1R7RA 5GM9A 3BQBA 4CS0A 2NYAA 1KQGA 5T5ID 5DYGA 5T5MD 4GA5A 5D6WA 4AQ7A 4D7ZB 4FFTA 5B6CA 3GTMA 2VPXA 4AYBA 5GLXA 2KY9A 2JA6A 4KODA 5C18A 1S3SA 2QQSA 2PJJA 2GAEA 3FPUA 4JS7A 4AONB 3QWZA 3X2HA 3CF2A 3X2IA 1VC3B 4KO8A 2VPYA 3H0GA 4AOKB 1H5NA 2Y0SA 3X2PA 5EQJB 1QDNA 3M3GA 2KI8A 2B63A 3LHDA 2Q1DX 3CZBA 2C45A 1KQFA 1IW7D 5C1BA
chains in the Genus database with same CATH topology
2BE5D 2VPWA 3OUGA 3ZJTA 1FDOA 1Y1VA 2A68D 3IR6A 1WLFA 3PLXB 2E2HA 2IV2X 1UHEA 3QQ8A 2A6HD 1R9TA 5CCXA 2YUJA 1I9GA 1PT1A 1G8KA 5FTJA 2Q1AX 1YLEA 3ZGZA 2PWYA 1PT0A 1TWHA 2G5DA 1PQEA 4GA6A 3GTQA 5EPPA 2NVXA 1EU1A 2JIRA 3DMRA 3HKZA 3GTPA 2GF7A 1E5VA 1YNND 1PQFA 2A6ED 2V3VA 5CD1A 3HU2A 3HU1A 1AW8B 2EEOB 3IR5A 4DMRA 4KDIA 2AE0X 3MB5A 1TWFA 4C2MA 3TIWA 3GTGA 2PI8A 2Q18X 2CW0D 2YVLA 2O5JD 1Y4ZA 1Y5IA 2VPZA 1I50A 1TWCA 2A69D 2NVYA 2MM2A 2MM0A 3IR7A 1PPYA 1YNJD 2B25A 2VUMA 1SMYD 4ARCA 5D6XA 3GTOA 1PYQA 2JIMA 4KDLA 4NOHA 5FTKA 4CRZA 2JIPA 1O54A 1QCSA 3ZJVA 1CR5A 1PQHA 3CQZA 1TWAA 2QQRA 1CZ4A 4KLNA 5DYIA 2R93A 3ML1A 1E32A 3O5AA 1SIWA 3TM7B 4AS1A 1TMOA 2PJHB 4RV0A 1I3QA 1R27A 5FTLA 2R7ZA 2E7ZA 1TWGA 1UHDA 2XDPA 2YU9A 5D6YA 1OGYA 5FTNA 4CRYG 2JIOA 5GLFA 3ZJUA 2PMZA 3GTKA 2Q1CX 2E2IA 1E18A 3QQ7A 2PNWA 1FDIA 1CZ5A 2GFAA 2DMRA 2V45A 1E60A 1PYUB 2G6GA 2WB1A 5FTMA 3FPRA 1G8JA 2NAPA 3QC8A 4CQNA 2R92A 1ZYRD 1AA6A 2JA5A 5CCBA 1Y1WA 4QIWA 1ZC1A 2Q19X 1DMSA 1H0HA 1SFOA 2JA7A 1K83A 3FKIA 2JV2A 4FIBA 4UC4A 1E61A 2WAQA 5ERGB 1WCMA 3GTLA 2LW6A 1Q16A 2JIQA 4ARIA 2PICA 3HU3A 4AZDA 4AAYA 3GTJA 3FPTA 1DMRA 3LGAA 3BQBA 1R7RA 4CS0A 2NYAA 1KQGA 5T5ID 5DYGA 5T5MD 4GA5A 5D6WA 4AQ7A 4D7ZB 5B6CA 3GTMA 2VPXA 4AYBA 2KY9A 2JA6A 4KODA 5C18A 1S3SA 2QQSA 2PJJA 2GAEA 3FPUA 4AONB 3QWZA 3CF2A 1VC3B 4KO8A 2VPYA 3H0GA 4AOKB 1H5NA 2Y0SA 5EQJB 1QDNA 2B63A 2KI8A 3LHDA 2Q1DX 3CZBA 2C45A 1KQFA 1IW7D 5C1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUG A;  2VPW A;  1FDO A;  1Y1V A;  3IR6 A;  1WLF A;  3PLX B;  2E2H A;  2IV2 X;  1UHE A;  3QQ8 A;  1R9T A;  2YUJ A;  1PT1 A;  1G8K A;  5FTJ A;  1YLE A;  1PT0 A;  1TWH A;  3GTQ A;  1PQE A;  4GA6 A;  2NVX A;  5EPP A;  1EU1 A;  2JIR A;  3DMR A;  3HKZ A;  3GTP A;  1E5V A;  1PQF A;  2V3V A;  3HU2 A;  3HU1 A;  1AW8 B;  2EEO B;  3IR5 A;  4DMR A;  4KDI A;  1TWF A;  4C2M A;  3TIW A;  3GTG A;  1Y4Z A;  1Y5I A;  2VPZ A;  1I50 A;  1TWC A;  2NVY A;  3IR7 A;  1PPY A;  2VUM A;  3GTO A;  1PYQ A;  2JIM A;  4KDL A;  5FTK A;  4CRZ A;  2JIP A;  1QCS A;  1CR5 A;  1PQH A;  3CQZ A;  1TWA A;  1CZ4 A;  4KLN A;  5DYI A;  2R93 A;  3ML1 A;  1E32 A;  3O5A A;  1SIW A;  3TM7 B;  1TMO A;  2PJH B;  4RV0 A;  1I3Q A;  1R27 A;  5FTL A;  2R7Z A;  2E7Z A;  1TWG A;  1UHD A;  2YU9 A;  1OGY A;  5FTN A;  4CRY G;  2JIO A;  5GLF A;  2PMZ A;  3GTK A;  2E2I A;  1E18 A;  3QQ7 A;  1FDI A;  1CZ5 A;  2DMR A;  2V45 A;  1E60 A;  1PYU B;  2WB1 A;  5FTM A;  1G8J A;  2NAP A;  3QC8 A;  2R92 A;  1AA6 A;  2JA5 A;  1Y1W A;  4QIW A;  1ZC1 A;  1DMS A;  1H0H A;  1SFO A;  2JA7 A;  1K83 A;  3FKI A;  2JV2 A;  1E61 A;  2WAQ A;  1WCM A;  3GTL A;  1Q16 A;  2JIQ A;  3HU3 A;  4AZD A;  4AAY A;  3GTJ A;  1DMR A;  1R7R A;  4CS0 A;  2NYA A;  1KQG A;  5T5I D;  5DYG A;  5T5M D;  4GA5 A;  4D7Z B;  5B6C A;  3GTM A;  2VPX A;  4AYB A;  2JA6 A;  4KOD A;  5C18 A;  1S3S A;  4AON B;  3QWZ A;  3CF2 A;  1VC3 B;  4KO8 A;  2VPY A;  3H0G A;  4AOK B;  1H5N A;  2Y0S A;  1QDN A;  2B63 A;  2KI8 A;  2C45 A;  1KQF A;  1IW7 D;  5C1B A; 
#chains in the Genus database with same CATH topology
 2BE5 D;  2VPW A;  3OUG A;  4AVR A;  3ZJT A;  1FDO A;  1Y1V A;  2A68 D;  3X2M A;  3SUJ A;  1N10 A;  3IR6 A;  1WLF A;  3PLX B;  2E2H A;  2IV2 X;  1UHE A;  2BH0 A;  3QQ8 A;  2A6H D;  4FG4 A;  4JP7 A;  3X2J A;  1R9T A;  5CCX A;  2YUJ A;  1I9G A;  1PT1 A;  1G8K A;  5FTJ A;  2Q1A X;  1YLE A;  2ENG A;  3ZGZ A;  2PWY A;  1PT0 A;  1TWH A;  2G5D A;  1PQE A;  4GA6 A;  3GTQ A;  5EPP A;  2NVX A;  1EU1 A;  2JIR A;  3DMR A;  3HKZ A;  5H4U A;  3GTP A;  1E5V A;  2GF7 A;  1YNN D;  1PQF A;  1WC2 A;  2A6E D;  2V3V A;  5CD1 A;  3HU2 A;  3HU1 A;  1OA7 A;  1AW8 B;  2EEO B;  3IR5 A;  4DMR A;  4KDI A;  2AE0 X;  3MB5 A;  1TWF A;  4C2M A;  3TIW A;  3GTG A;  2PI8 A;  2Q18 X;  2CW0 D;  2YVL A;  2O5J D;  1Y4Z A;  1Y5I A;  2VPZ A;  1I50 A;  1TWC A;  2A69 D;  4FER A;  2NVY A;  2MM2 A;  2MM0 A;  3IR7 A;  1PPY A;  1YNJ D;  2B25 A;  2HCZ X;  1OA9 A;  3X2L A;  2VUM A;  1SMY D;  1BW4 A;  4FG2 A;  4ARC A;  5D6X A;  3GTO A;  1L8F A;  1PYQ A;  2JIM A;  4KDL A;  4NOH A;  5FTK A;  4CRZ A;  2JIP A;  1O54 A;  1QCS A;  3ZJV A;  1CR5 A;  1PQH A;  3D30 A;  3CQZ A;  1TWA A;  2QQR A;  1CZ4 A;  4KLN A;  5DYI A;  2R93 A;  3ML1 A;  1E32 A;  3O5A A;  1SIW A;  4JJO A;  3TM7 B;  4AS1 A;  1TMO A;  2PJH B;  4RV0 A;  1I3Q A;  1R27 A;  5FTL A;  3X2G A;  2R7Z A;  2E7Z A;  1TWG A;  1UHD A;  2XDP A;  2YU9 A;  5D6Y A;  1OGY A;  5FTN A;  4CRY G;  2JIO A;  5GLF A;  3ZJU A;  2PMZ A;  3GTK A;  1HD5 A;  2Q1C X;  3SUM A;  2E2I A;  1E18 A;  3QQ7 A;  2PNW A;  3X2N A;  1FDI A;  5GLY A;  1CZ5 A;  2GFA A;  2DMR A;  3SUK A;  4L48 A;  2V45 A;  1E60 A;  1PYU B;  3X2O A;  2G6G A;  2WB1 A;  5FTM A;  3FPR A;  1G8J A;  2NAP A;  3SUL A;  4ZM7 A;  3QC8 A;  4CQN A;  2R92 A;  2KQA A;  1ZYR D;  1AA6 A;  2JA5 A;  3ENG A;  1Y1W A;  5CCB A;  4QIW A;  1ZC1 A;  2Q19 X;  1DMS A;  1H0H A;  4JCW A;  1SFO A;  2JA7 A;  1K83 A;  3FKI A;  2JV2 A;  4JP6 A;  4FIB A;  1E61 A;  4UC4 A;  2WAQ A;  5ERG B;  1WCM A;  3GTL A;  3X2K A;  2LW6 A;  1Q16 A;  2JIQ A;  4ARI A;  4ENG A;  2PIC A;  3HU3 A;  4AZD A;  4AAY A;  3GTJ A;  3FPT A;  1DMR A;  3LGA A;  1BW3 A;  1R7R A;  5GM9 A;  3BQB A;  4CS0 A;  2NYA A;  1KQG A;  5T5I D;  5DYG A;  5T5M D;  4GA5 A;  5D6W A;  4AQ7 A;  4D7Z B;  4FFT A;  5B6C A;  3GTM A;  2VPX A;  4AYB A;  5GLX A;  2KY9 A;  2JA6 A;  4KOD A;  5C18 A;  1S3S A;  2QQS A;  2PJJ A;  2GAE A;  3FPU A;  4JS7 A;  4AON B;  3QWZ A;  3X2H A;  3CF2 A;  3X2I A;  1VC3 B;  4KO8 A;  2VPY A;  3H0G A;  4AOK B;  1H5N A;  2Y0S A;  3X2P A;  5EQJ B;  1QDN A;  3M3G A;  2KI8 A;  2B63 A;  3LHD A;  2Q1D X;  3CZB A;  2C45 A;  1KQF A;  1IW7 D;  5C1B A; 
#chains in the Genus database with same CATH homology
 2BE5 D;  2VPW A;  3OUG A;  3ZJT A;  1FDO A;  1Y1V A;  2A68 D;  3IR6 A;  1WLF A;  3PLX B;  2E2H A;  2IV2 X;  1UHE A;  3QQ8 A;  2A6H D;  1R9T A;  5CCX A;  2YUJ A;  1I9G A;  1PT1 A;  1G8K A;  5FTJ A;  2Q1A X;  1YLE A;  3ZGZ A;  2PWY A;  1PT0 A;  1TWH A;  2G5D A;  1PQE A;  4GA6 A;  3GTQ A;  5EPP A;  2NVX A;  1EU1 A;  2JIR A;  3DMR A;  3HKZ A;  3GTP A;  2GF7 A;  1E5V A;  1YNN D;  1PQF A;  2A6E D;  2V3V A;  5CD1 A;  3HU2 A;  3HU1 A;  1AW8 B;  2EEO B;  3IR5 A;  4DMR A;  4KDI A;  2AE0 X;  3MB5 A;  1TWF A;  4C2M A;  3TIW A;  3GTG A;  2PI8 A;  2Q18 X;  2CW0 D;  2YVL A;  2O5J D;  1Y4Z A;  1Y5I A;  2VPZ A;  1I50 A;  1TWC A;  2A69 D;  2NVY A;  2MM2 A;  2MM0 A;  3IR7 A;  1PPY A;  1YNJ D;  2B25 A;  2VUM A;  1SMY D;  4ARC A;  5D6X A;  3GTO A;  1PYQ A;  2JIM A;  4KDL A;  4NOH A;  5FTK A;  4CRZ A;  2JIP A;  1O54 A;  1QCS A;  3ZJV A;  1CR5 A;  1PQH A;  3CQZ A;  1TWA A;  2QQR A;  1CZ4 A;  4KLN A;  5DYI A;  2R93 A;  3ML1 A;  1E32 A;  3O5A A;  1SIW A;  3TM7 B;  4AS1 A;  1TMO A;  2PJH B;  4RV0 A;  1I3Q A;  1R27 A;  5FTL A;  2R7Z A;  2E7Z A;  1TWG A;  1UHD A;  2XDP A;  2YU9 A;  5D6Y A;  1OGY A;  5FTN A;  4CRY G;  2JIO A;  5GLF A;  3ZJU A;  2PMZ A;  3GTK A;  2Q1C X;  2E2I A;  1E18 A;  3QQ7 A;  2PNW A;  1FDI A;  1CZ5 A;  2GFA A;  2DMR A;  2V45 A;  1E60 A;  1PYU B;  2G6G A;  2WB1 A;  5FTM A;  3FPR A;  1G8J A;  2NAP A;  3QC8 A;  4CQN A;  2R92 A;  1ZYR D;  1AA6 A;  2JA5 A;  5CCB A;  1Y1W A;  4QIW A;  1ZC1 A;  2Q19 X;  1DMS A;  1H0H A;  1SFO A;  2JA7 A;  1K83 A;  3FKI A;  2JV2 A;  4FIB A;  4UC4 A;  1E61 A;  2WAQ A;  5ERG B;  1WCM A;  3GTL A;  2LW6 A;  1Q16 A;  2JIQ A;  4ARI A;  2PIC A;  3HU3 A;  4AZD A;  4AAY A;  3GTJ A;  3FPT A;  1DMR A;  3LGA A;  3BQB A;  1R7R A;  4CS0 A;  2NYA A;  1KQG A;  5T5I D;  5DYG A;  5T5M D;  4GA5 A;  5D6W A;  4AQ7 A;  4D7Z B;  5B6C A;  3GTM A;  2VPX A;  4AYB A;  2KY9 A;  2JA6 A;  4KOD A;  5C18 A;  1S3S A;  2QQS A;  2PJJ A;  2GAE A;  3FPU A;  4AON B;  3QWZ A;  3CF2 A;  1VC3 B;  4KO8 A;  2VPY A;  3H0G A;  4AOK B;  1H5N A;  2Y0S A;  5EQJ B;  1QDN A;  2B63 A;  2KI8 A;  3LHD A;  2Q1D X;  3CZB A;  2C45 A;  1KQF A;  1IW7 D;  5C1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...