4RVAA

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for deacylation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAAMATTLRKLLTGELLTPASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rvaA00
1PI4A 3O86A 4S2OA 5M1AA 2ZM2A 1Q2PA 1SKFA 5CGWA 5M19A 1LI0A 4N9KA 5HAIA 4LCMA 3NCKA 4HBUA 3EQVA 2Y2KA 2ZD8A 2XD1A 1ES2A 3M6BA 1ZC2A 1PWDA 3A3EA 4FSFA 4B4ZA 4IEDA 3ZG9B 3HVFA 1GA9A 1K57C 2IWBA 4OQ0A 5CHMA 1ALQA 4FD8A 4X68A 2VGJA 4LCLA 3LEZA 1WYCA 4DXCA 3DTMA 1XX2A 2ZC4B 3BECA 1FR6A 3ZVWA 5EECA 1MBLA 5KMWA 3IXDA 1L0GA 3N6IA 1PIOA 2XF3A 1KDSA 1K54C 3MBZA 4JXSA 3VMAA 4X69A 3AGFA 2BLSA 3VSKA 4EUZA 3ZG5A 1IEMA 5HAQA 2PU2A 1CEGA 1K55C 3ZNTA 4RYEA 1XKZA 1YMXA 2Z2LB 5U47A 2WKEA 2P9VB 4WBGA 2HDRA 4BQMA 5FAOA 4S2NC 4P6BA 3IHBA 3IF6C 3IWOA 1XGJA 3HLCA 5E2GA 4ZJ2A 1YMSA 4P85A 4LV3A 3IWQA 3UDXA 2B5RA 1FOFA 1YQSA 4DDSA 4H8RA 2DRWA 3HLGA 4WEJA 1BLCA 2G2WA 1IYQA 5EPHA 4X53A 3ZG7B 4E3OA 3PTEA 3ZDJA 3C7UA 1MPLA 2Y2PA 3IXHA 4R4RA 3IWIA 3MZDA 4KG2A 2G2UA 2ZQ8A 2VGKA 4E3KA 3S22A 2HP6A 1IYOA 1QMFA 2ZQDA 4JXWA 4M3KA 3V50A 2J7VA 4MLLA 2EXAA 3ISGA 5EOOA 5CHUA 3Q7ZA 3D4FA 5FATA 3UY6A 4R4SA 1PWGA 1N4OA 4S2IA 4Q8IA 4OVDA 3HLFA 2Y2GA 3VP1A 5GL9A 4PM9A 1NZOA 4DF6A 3RXWA 1QMEA 2V1ZA 3M2JA 5L2FA 1HD8A 3UPPA 5A90A 3SS5A 1ONHA 4C3QA 3CJMA 1YLJA 2P74A 2XK1A 3W4QA 4DKIA 3PBNA 4C6YA 5JYPA 1BLSA 1BTLA 4UA6A 4D2OA 1W8YA 1XP4A 3ITBA 3VOYA 4PMAA 3Q07A 4EBPA 1BULA 1I2WA 2H10A 2XR0A 3QHYA 5J8XA 2C5WB 5CEDA 4HEFA 5FSRA 3VP2A 1W5DA 1MWTA 2FFFB 3A3IA 1BSGA 3BEBA 5FQQA 2XH9A 5HW3A 5JYOA 4RX3A 3Q81A 3PBQA 4QD4A 5FQJA 1PZOA 2ZQCA 1TDGA 5CECA 2EX8A 4K0WA 5EVIB 3ZCZA 3ZG8B 4BD0A 4R1GA 5DTKA 4RVAA 2Y2HA 3HLEA 3Q7VA 2WAFA 4OPYA 1FSWA 2Y4AA 4FH4A 1NY0A 3DW0A 4GKUA 5DTSA 1E3UD 1NZUA 4GOGA 4KQRA 1FSYA 2WGWA 3ZVTA 1JTDA 2WAEA 3C5AA 3OPPA 5GLAA 1PYYA 1BUEA 1M6KA 3G32A 1DY6A 4BL3A 2Y2QA 2HP9A 4PPRA 5EOEA 5GLCA 3AGDA 1NJ4A 3GRJA 2Y55A 3G31A 3NDEA 1E3UA 5FAPA 3Q1FA 2PBYA 1XXMA 3PAEA 1LL9A 4XXRA 2XD5A 2ZM8A 4UA9A 1ONGA 3FWLA 1NXYA 1O07A 1SDEA 4ZAMA 4BL2A 3O88A 3W4PA 2XFTA 1Q2QA 1J9MA 4JLFA 4WZ5A 1K56D 4QY6A 2R9XA 4UA7A 4YINA 5F1FA 3OPRA 1XPBA 2C6WB 3WRZA 1TDLA 1KVLA 5M18A 3M2KA 1U60A 3BFCA 3S1YA 3FYZA 3PBTA 4CPKA 5D3OA 4KQQA 3G2YA 2IWCA 4DRTA 4KG5A 1XGIA 1MY8A 1PWCA 3FKWA 1JTGA 4ZBEA 4N1HA 3G34A 3QNBA 4OLDA 2Y2OA 2J8YA 2Y2MA 4OH0A 1ES5A 5FI2A 1KE0A 3NI9A 1PZPA 4JF4A 1SCWA 4U0TA 2QZ6A 3LY4A 4P87A 3TG9A 4DXBA 4NK3A 1IYSA 4WZ4A 5HARA 3IXBA 3BM6A 4S2LA 3VP3A 4O7DA 1ERQA 2WKIA 1JWZA 2EFUA 4ZJ1A 1H8ZA 2WZZA 4OQHA 2XLNA 2JE5A 3ZNYA 3BFFA 3GQZA 3SH7A 5FQ9A 3UN7A 4UHUA 3FKVA 3RJUA 2WADA 2Y59A 5CTMA 1LL5A 4GD8A 5E43A 4OOYA 4L0LA 4WYYA 3NC8A 1MWRA 1YLYA 4PM5A 3NBLA 1CI9A 2Q9NA 3IF6B 3PBSA 1G6AA 5AQ9A 5TFQA 3Q82A 2H0YA 3MKFA 3BLMA 2Y91A 1MXOA 2DNSA 3C4OA 3HUNA 1DJBA 1FR1A 1IYPA 1RGZA 2WUQA 3BFDA 3N8SA 4MNRA 4NETA 3W4OA 3ZHHA 3FZCA 3GSGA 5E2FA 1MKIA 2V2FF 1Z6FA 4R23A 5DF9A 3RXXA 1FQGA 4WMCD 3OZHA 2QPNA 2JBFA 3GTCA 3HUMA 4EBLA 3CG5A 3E2KA 4OOLA 2I72A 5E2EA 5CEBA 1IKGA 3IH9A 4OP5A 1G68A 2EX6A 1CK3A 1IKIA 3V39A 4EV4A 1TVFA 1EI5A 4OKPA 1FCMA 4JXGA 3VSLA 3SH8A 1K38A 2HPBA 1K4FA 4KZ7A 4X6TA 5CRFA 1RP5A 4KZ5A 5CTNA 2J9PA 2P9VA 3IXGA 4Z9QA 3V3RA 3LY3A 1TEMA 1AXBA 4WELA 4U3TA 3UO9A 3EQUA 4GDNA 4OQIA 4ZJ3A 4FCFA 1KGEA 3HL9A 1ESUA 5HAPA 3UE3A 4PM6A 1I2SA 4CJNA 3MXSA 1W79A 3HBRA 2ZC3B 1KDWA 4GDBA 4E3IA 1YM1A 3OPHA 4PM7A 3UDIA 3IT9A 1ES4A 4KENB 4OONA 3SS3A 3ZG0A 4DDYA 2WGWB 1GHIA 3A3FA 3BLSA 4K0XA 1KE3A 5CGXA 4S2JA 5GHZA 1NRFA 3IH8A 3ITAA 1HZOA 1DJAA 3MZEA 1NYYA 3QNCA 3WWXA 2A49A 4JF5A 4DE1A 2GDNA 3PBOA 3MZFA 4WZ5C 1XA1A 5F82A 3HLWA 4MBKA 4OOMA 2Q9MA 5F83A 3LCEA 3NY4A 3WRTA 2V20A 3BFGA 1ES3A 1HTZA 3P09A 2HP5A 2UWXA 4GZBA 1KGFA 2EX9A 2BG1A 1GHPA 2WGIA 2QMIA 1NYMA 4OP8A 4RX2A 3G30A 2Y2NA 3BYDA 1DJCA 2IWDA 4EBNA 5GLDA 2ZC7A 3B3XA 3UNWA 1BT5A 1BZAA 1ERMA 4KZ3A 3O87A 1CI8A 1N9BA 1RCJA 4JPMA 4B88A 2WGVA 2XFSA 5EVID 2X71A 4RA7A 2RCXA 5FI6A 3FV7A 3C7VA 5EE8A 2Z2MB 2DCFA 1LLBA 4ID4A 4K91A 4LENA 4MBHA 4XUXA 3OPLA 5TGFA 2EXBA 4KZAA 4KG6A 4A5RA 1EWZA 1YLPA 5TR7A 3HLDA 2XDMA 5GHXA 3JYIA 4Y0UA 1I5QA 1W7FA 4U0XA 3DWKA 5KSCA 4E6XA 4E3NA 5EVIA 3MXRA 1EROA 2PU4A 2RL3A 4IBRA 4OQGA 1BLPA 1L2SA 1K56A 1PW8A 4QY5A 4QHCA 2OV5A 4S2KA 4IVIA 5HFOA 4JKTA 3VP0A 1OMEA 4N1XA 5DTTA 1WE4A 3CMZA 4HESA 4Y7PA 4ZTKA 5CERA 4Y0TA 3WS5A 1S6RA 3G35A 4GNUA 2ZLYA 3I7JA 3MKEA 4HBTA 3W8KA 4DE2A 4KZBA 5DF7A 2ZQAA 3PAGA 3NDGA 1YLZA 3WS1A 1VQQA 1ZKJA 1WYBA 1JVJA 5AQAA 4GD6A 5FDHA 4GB7A 3UE0A 2WZXA 2ZC5B 2WYXA 4WM9A 5GLBA 5E2HA 3DWZA 3WS0A 2A3UA 4JXVA 1L0FA 4EQIA 5AQ7A 3NIAA 2ZMAA 4LV1A 2WK0A 3UPNA 5EVLA 1C3BA 5IHVA 3WS2A 4BENA 3IF5A 5HL1A 4ZDXA 4E3JA 1YT4A 3A3DA 5F1GA 3VOZA 3SOIA 1KE4A 1FCNA 4WEKA 3OCLA 2OSUA 3ZGAB 3MFDA 1XA7A 4PM8A 3BRMA 3GMWA 4R3BA 3A3JA 1K57A 3LO7A 3PBRA 1K6RA 1O7EA 4OPRA 3V5MA 4KZ4A 1E4DA 3G2ZA 4Y0OA 5FA7A 1S0WA 1M40A 4R3JA 2FFYA 2EX2A 4OPQA 3C4PA 2E8IA 5A93A 3M6HA 1PI5A 1K54A 1ZG4A 3UPOA 4MBFA 3HREA 4BJPA 4EWFA 3O3VA 3WS4A 2XEPA 3TSGA 4DE3A 2Y2LA 3GVBA 4LV0A 4WMCA 2JCHA 1ZG6A 1H5XA 4OPZA 3VFFA 3N8LA 4C75A 4DE0A 3ZFZA 1CEFA 2R9WA 3P98A 4QB8A 5KSHA 4YFMA 5FAQA 3VP4A 5CXWA 3S4XA 3UDFA 1K55A 1K25A 1GA0A 1JWVA 1KGGA 3N4IA 1SDNA 5FASA 4N92A 3Q7VB 3V3SA 4S2MA 3N7WA 1LI9A 5CHJA 4S2NA 2H0TA 2EFXA 2XGNA 3IF6A 4N9LA 5G18A 2HDUA 2Y2IA 3GV9A 3BFEA 3GR2A 1LHYA 5KZHA 5BOHA 4LV2A 4E3LA 2ZC6B 3SH9A 2JC7A 4IBXA 4P0MA 4F94A 3SS4A 2OLVA 3UE1A 2HDSA 1PW1A 4FH2A 4KZ6A 1GCEA 4E3MA 1JWPA 3OC2A 4UAAA 3HUOA 5GHYA 4JF6A 1KVMA 2WKHA 2Y2JA 2H5SA 2OLUA 4IVKA 1ESIA 5AQBA 3TOIA 4JBFA 5EVIC 4OLGA 5FQMA 1IELA 4BLMA 2ZQ9A 5EUAA 4XUZA 1HVBA 1L0DA 1W8QA 4X55A 2J9OA 4E6WA 4GN2A 4KZ9A 1VM1A 3E2LA 4BD1A 3VFHA 3HLBA 1BLHA 4QJGA 1MWSA 3OCNA 2CC1A 5DF8A 1SHVA 4KQOA 4MEZA 1FCOA 1L0EA 1Y54A 4S2PA 2ZJ9A 1K6SA 1GHMA 1H8YA 2HDQA 2ZQ7A 5DVAA 5CGSA 1YLWA 5HX9A 1MWUA 5FQIA 2X02A 4X56A 4B4XA 5A91A 5I94A 2XQZA 3N8RA 2X01A 2ZM0A 3AGEA 3G4PA 1E25A 3IHAA 4R0QA 1YLTA 4KZ8A 5FI7A 3CZDA 5FQKA 1K4EA 1RGYA 4QU3A 5A92A 3IQAA
chains in the Genus database with same CATH superfamily
3O86A 1SKFA 5CGWA 2O99A 1PNEA 2W3DA 3QP1A 4CQHA 3NCKA 3IX8A 1ES2A 1T1BA 5IU1A 4IEDA 1K57C 3F1OA 4O01A 3E98A 4R6LA 4X68A 2QHKA 3LEZA 2Z6CA 3DTMA 5EECA 1MBLA 3IXDA 2XF3A 2J80A 4JXSA 1K54C 4B93A 3AGFA 3R4KA 4EUZA 5HAQA 5U47A 4AFIA 2IA2A 5DFYA 5FAOA 3HLCA 4LV3A 2B5RA 2DRWA 2G2WA 4CLCE 4X53A 1P97A 1MPLA 3IWIA 4KG2A 3UMEA 4EU0A 2EWWA 2ZQ8A 3O5YA 3S22A 4L9GA 1IYOA 4M3KA 5EM1A 2EXAA 1CJFA 5EOOA 5A8BA 5CHUA 5FATA 3UY6A 4PM9A 3B47A 3GECA 1VHMA 1D1JA 5L2FA 3M2JA 2GX5A 4BBVA 5A90A 1XJ3A 3VV4A 2P74A 3LIBA 4O8GA 3W4QA 4C6YA 5G4YA 1BLSA 1BTLA 4UA6A 3TJZC 1XP4A 4PMAA 2XR0A 3QHYA 3VP2A 1MWTA 2FFFB 1WA9A 4Y13A 5FQJA 3T1RA 1PZOA 3SW1A 2Y79A 2EX8A 4K0WA 5EVIB 2VK3A 4BD0A 3MJQA 3Q7VA 1FSWA 2Y4AA 4GKUA 5DKKA 3T50A 1T1AA 3C5AA 3OPPA 3A0VA 5GLAA 1PYYA 1M6KA 3G32A 2Y2QA 2W3EA 4PPRA 3AGDA 1AWIA 3NECA 2J3WA 1NJ4A 1W63M 3G31A 3NDEA 5FAPA 3KSFA 3Q1FA 2PBYA 1XXMA 3EWKA 3FWLA 4ZAMA 3W4PA 1NWZA 4YINA 2C6WB 1TDLA 1KVLA 5M18A 5EVEA 3R7WA 3FYZA 2D01A 4ZBEA 4OLDA 4PKYG 2Y2OA 1G6OA 1GSWA 4JF4A 2MJ6A 3LY4A 2R78A 5HWVA 1OTBA 2PDRA 4WZ4A 3E0YA 3IXBA 1JWZA 2PBDP 2EFUA 3UB9A 4OQHA 3H7WB 1XJ4A 4Z1WA 3ZNYA 1NLZA 2Y59A 1LL5A 5E43A 4WN5A 2Q9NA 3IX4A 3MKFA 2DNSA 4JGOA 1RGZA 3C2WA 1MKIA 1Z6FA 3RXXA 3KSHA 2JBFA 4HIAA 4OOLA 5CEBA 3IH9A 4OP5A 1G68A 1CK3A 4OKPA 3H9WA 4JXGA 3VSLA 2A24B 1K38A 1K4FA 4KZ5A 3V3RA 2J9PA 2P9VA 4Z9QA 1TEMA 5K5BA 4U3TA 5HAPA 3UE3A 3T4SA 4CJNA 2W1TB 1YM1A 4I39A 4PM7A 3KYZA 2WGWB 1OTEA 1NYYA 2A49A 4DE1A 5HWWA 1XA1A 4GJ4A 4OOMA 2YKFA 3LCEA 3DTIA 4DN0A 3CPTA 3H82A 1KGFA 3EGXC 2KX6A 4EERA 4OP8A 4EBNA 1DJCA 4CLCA 5GLDA 3B3XA 3F1OB 4KZ3A 2QJ5A 1N9BA 1RCJA 3LGOA 1S4SA 2WKPA 2XA7S 2RCXA 1VEUA 2DCFA 1A0KA 4ID4A 5EFWA 5TR7A 3B42A 2NUTC 3HLDA 1DP8A 5GHXA 1W7FA 3DTEA 3DWKA 1EROA 4OQGA 3S7PA 1PW8A 5EV0A 5HFOA 4N1XA 5DTTA 3QP4A 3WS5A 1S6RA 4GNUA 4ZRRA 3IS2A 4WF0A 2ZQAA 3WS1A 1ZKJA 3BY8A 1WYBA 5AQAA 4GB7A 3UE0A 4WM9A 1MKMA 3WS0A 3TE8A 5AQ7A 3NIAA 2PD7A 4UQIS 4YWZA 4ZDXA 1ZHHB 1YT4A 3A3DA 4WEKA 1FCNA 2OSUA 3MFDA 1XA7A 3BRMA 3GMWA 4R3BA 4ETXA 1PFLA 5EM0A 2EX2A 4OPQA 2E8IA 3M6HA 4DMZA 1PI5A 4R38A 3UPOA 4EWFA 2L1MA 1XFNA 3WS4A 2HGVA 5F5YA 1H5XA 4C75A 3N8LA 1OT6A 5FASA 4N92A 3Q7VB 1K0KA 1LI9A 2H0TA 3BJNA 3IF6A 3C8CA 2HDUA 3T4KA 2VZWA 3BFEA 5BOHA 2ZC6B 3SH9A 4WL9A 3P01A 3FG8A 4F94A 3UB6A 3UE1A 4KZ6A 1GCEA 3OC2A 1MC0A 2P08A 3LIFA 4IUHA 5EVIC 4KUOA 1IELA 3R7WB 4E6WA 4GN2A 4Y15A 2XRNA 3OCNA 1L0EA 2ZJ9A 1H8YA 2ZQ7A 5FL3A 2X02A 4B4XA 2XQZA 3N8RA 4IHQA 3G4PA 2BTFP 4GCZA 4A5RA 4S2OA 1Q2PA 2Y2KA 2ZD8A 4LGWA 4FOFA 2JHEA 1ALQA 1FR6A 3JVUA 5HDSA 1L0GA 3N6IA 1PIOA 1OTDA 1KDSA 3MBZA 4X69A 2VGLM 3VSKA 1UWPX 4I3JA 4YNRA 1F98A 4UQIM 1K55C 1XKZA 1YMXA 2V1BA 3PXPA 2P9VB 2HDRA 3SZTA 4P6BA 1F9IA 5E2GA 2E8JA 4P85A 3UDXA 3CHWP 1FOFA 1YQSA 4BBUA 3ZG7B 2ZOHA 4E3OA 3TRCA 4YOFA 4BBTA 3GDIA 1QMFA 2ZQDA 2J7VA 4MLLA 3ISGA 3Q7ZA 4R4SA 1PWGA 4OVDA 2Y2GA 4WLAA 3VP1A 1N9NA 3H82B 4DF6A 4HH3A 1JNUA 5F6AA 4CLCB 3MF0A 4DKIA 1G5UA 4EEUA 5JYPA 3KSIA 4ME4A 2H10A 4Y17A 5DKLA 1XJ6A 2C5WB 2W3FA 1VEUB 5CEDA 3VOLA 3A3IA 4K08A 1Z09A 5HW3A 2XH9A 5JYOA 2A24A 4RX3A 3Q81A 4QD4A 4I3IA 3DAVA 2J3TD 3NOTC 5DTKA 4X1MA 2Y2HA 4OPYA 5C5KA 5DTSA 1L3LA 1E3UD 3NJAA 4HH2A 4GOGA 4KQRA 2WGWA 3ZVTA 1JTDA 4MN5A 3EOIA 1DY6A 4BL3A 1MZUA 3IS2B 2W27A 2Y55A 3PAEA 2CMNA 2OWHA 2XD5A 2ZM8A 3T4QA 4BL2A 3O88A 4F3LA 1Q2QA 5AVEA 2HZ5A 3OPRA 3WRZA 1XJ2A 3PBTA 1S67L 2VEAA 3G34A 4B9OA 1KE0A 3NI9A 4U0TA 1SCWA 2QZ6A 3T1QB 2Y8HA 5AJGA 3QP8A 1IYSA 4R3AA 3OBFA 5HARA 1ERQA 3EGDC 1H8ZA 2WZZA 3BFFA 3T1SA 2ZMVA 3NC8A 1MWRA 3QP2A 3KSGA 4PM5A 1D06A 2YKHA 1CI9A 2V8CA 3IF6B 3PBSA 5TFQA 3BLMA 2Y91A 1MXOA 1FR1A 4MNRA 3ZHHA 3CWFA 5J4EA 1FQGA 3HUMA 1RGYA 3E2KA 1P0ZA 1IKIA 2GJ3A 1TVFA 1EI5A 5DFXA 1FCMA 3LICA 4EQ1A 5HWTA 4X6TA 1RP5A 5CTNA 3IXGA 4WELA 4GDNA 4OQIA 3HL9A 3DTKA 3MXSA 1W79A 3HBRA 1J3WA 2ZC3B 4E3IA 1LL8A 2HJ9C 3W2ZA 1D7EA 4KENB 4K0XA 4S2JA 3IH8A 3QNCA 3PBOA 3QP6A 1TD5A 2B02A 3WRTA 2V20A 4BMWA 3S7QA 2UWXA 4GZBA 2PHYA 5IS1A 2WKQA 3E4PA 4RX2A 2IWDA 1BZAA 3L7HA 2INWA 4JGRA 2JN7A 2HV1A 2X71A 4RA7A 5HL6A 3C7VA 5EE8A 2Z2MB 5HPFA 4MBHA 2EXBA 4KZAA 4KG6A 2K7SA 1GSXA 2PAVP 4U0XA 5KSCA 1TS7A 3MXRA 2JKRI 4QPRA 1K56A 3NOPC 4S2KA 4JKTA 1OMEA 2VKSA 1WE4A 3NULA 1ODVA 1SZVA 3RTYA 4NXGA 3W8KA 4DE2A 3TW8A 4KZBA 4LRXC 2W0NA 3T4LA 3HJIA 5DJTA 1JVJA 4GD6A 5GLBA 4P6ZM 4I3AA 2A3UA 2ZMAA 3RH8B 3NOUC 5HD5A 3VOZA 3ZGAB 3OCLA 4PM8A 2JKTI 3A3JA 2Z6DA 3MQOA 3EEHA 1E4DA 4Y0OA 1S0WA 4R3JA 3FPWA 3C4PA 5A93A 3MR0A 2D02A 3VE4A 2EA9A 4MBFA 4E04A 4WMCA 4DE0A 3VFFA 5TJJA 1K25A 1SDNA 4NXBA 1N9OA 3V3SA 3N7WA 4Y5FA 5CHJA 4S2NA 4CLCC 1OPXA 3GV9A 2Y2IA 3GR2A 1LHYA 2M7VA 5KZHA 2JC7A 1X0OA 2OLVA 4I5SA 1PW1A 4FH2A 4E3MA 1JWPA 3HUOA 4F3LB 1KVMA 2WKHA 4G3KA 4IVKA 4KUKA 2KLIA 3LIAA 2AVXA 4X55A 4KZ9A 1VM1A 3VFHA 5DF8A 1SHVA 4MEZA 1K6SA 5DVAA 3ULFA 3T4OA 4X56A 1CQAA 3AGEA 3IHAA 4KZ8A 4HP4A 1K4EA 3IQAA 5M1AA 2ZM2A 1GSVA 4FTXA 5HAIA 3ZQ5A 3EEAA 3EQVA 2XD1A 3M6BA 1PWDA 3A3EA 4FSFA 5G4ZA 2GNXA 4HNBA 2IWBA 4OQ0A 4FD8A 1TF1A 2VGLS 2ZC4B 4I38A 3VMAA 5L09A 2BLSA 1IEMA 3F1NA 1Y4OA 3HJKA 1CEGA 2Z2LB 2VA0A 4WBGA 4BQMA 4KQDA 2V9AA 3IF6C 3IWOA 1XGJA 1OTIA 4ZJ2A 1YMSA 2OAP1 3LFVA 3T4JA 4DDSA 1YKDA 3HLGA 2VV7A 2W1RA 4G3VA 1BLCA 1OT9A 4WEJA 1IYQA 5EPHA 4EXOA 3ZDJA 3C7UA 3IXHA 3MZDA 2I9VA 4JXWA 5KIZA 4EUVA 2OWJA 2W3HA 2O9BA 5TBMA 4LRYC 4S2IA 4Q8IA 3E4OA 3HLFA 4MDZA 5FEGA 1NZOA 3RXWA 1QMEA 2V1ZA 1YLJA 1H0MA 2JKRM 3PBNA 4D2OA 4EBPA 3Q07A 5J8XA 4HEFA 5FSRA 3QP5A 3BEBA 2FH5A 3PBQA 2ZQCA 1TDGA 5CECA 3PHYA 1ZTUA 3BQAA 4R1GA 4RVAA 3HLEA 2WAFA 4XT2A 5AVFA 3A0SA 1NZUA 1FSYA 2NUPC 4G3WA 2WAEA 4RQ9A 3F1PA 1S1YA 5EOEA 5GLCA 3OLOA 3LR0A 1E3UA 4PHTA 2JKTM 1TS0A 4XXRA 1LL9A 1HLUP 3L9KA 1NXYA 1SDEA 2JKGA 1J9MA 4WZ5A 4QY6A 2R9XA 3LIEA 5F1FA 1XPBA 3LEQA 1LSXA 1FILA 2QJ7A 3S1YA 3ZYTA 5D3OA 3G2YA 2IWCA 1XGIA 1MY8A 2XSSA 1PWCA 4N1HA 1YAXA 2J8YA 1PZPA 3TG9A 2DMWA 1LSWA 2LB5A 3LYXA 1T1CA 3PR6A 3BM6A 2WKIA 2G7UA 4ZJ1A 5L10A 4DJ2A 5DJUA 3OOVA 3GQZA 3SH7A 3FKVA 3RJUA 2WADA 5CTMA 4GD8A 1T19A 3K2NA 4L0LA 1XFQA 1H3QA 2ZL1A 1G6AA 5AQ9A 1VETA 2H0YA 3LR5A 3C4OA 3HUNA 1DJBA 3CI6A 3BFDA 3N8SA 3FZCA 4R23A 2JKFA 3OZHA 2QPNA 1FIKA 3CG5A 3C30A 2I72A 5E2EA 1IKGA 2EX6A 3MQQA 4EV4A 1UGUA 3SH8A 4KZ7A 5CRFA 3LY3A 4X1LA 3KYEA 5HSQA 4NEED 1DRMA 4ZJ3A 1ESUA 5FDSA 5HDDA 2O0YA 1S1ZA 2Q0OA 4GDBA 3UDIA 3IT9A 3S7NA 3RFBA 3ZG0A 4DDYA 1OJ5A 1GHIA 3A3FA 3BLSA 3U2AA 1KE3A 5CGXA 1DJAA 3MZEA 4WUJA 3MZFA 4FUWA 1V9YA 3UE6A 4MBKA 2Q9MA 1CF0A 2M7UA 2HF6A 2KOIA 3BFGA 1HTZA 2HP5A 3IX3A 2H28A 2WGIA 2QMIA 1NYMA 3G30A 2Y2NA 3BYDA 2ZC7A 3UNWA 4GW9A 1EW0A 1ERMA 3O87A 3A0RA 4B88A 4JPMA 2WGVA 2XFSA 5EVID 1OJGA 1LLBA 4K91A 1YPRA 4LENA 5TGFA 1YSPA 2PR5A 3F1NB 3KO6A 1DP9A 4E3NA 2ZMFA 4IBRA 1L2SA 4QY5A 3UB7A 4IVIA 2ZOIA 3VP0A 4HESA 4Y7PA 4Y0TA 4HQAA 3G35A 3I7JA 4NXEA 4O0PA 5MC7A 4HBTA 4HJ6A 1N9LA 2QYBA 3PAGA 4NXFA 2VV6A 4P6ZS 5J3WA 1S66L 5FDHA 3D72A 2BASA 5LBRA 1L0FA 5TBMB 1C3BA 5IHVA 4BENA 2WKRA 3IF5A 2VJWA 4Q0JA 5HL1A 4H6JB 2PD8A 1PRQA 2V8FA 5F1GA 3SOIA 1KE4A 1K57A 3PBRA 1K6RA 2OAQ1 4KZ4A 3G2ZA 4IJGA 1M40A 2FFYA 4ESPA 2PT7A 1K54A 3BQ8A 2XEPA 3TSGA 1OTAA 3GVBA 4LV0A 2JCHA 1ZG6A 4OPZA 3ZFZA 4QB8A 5KSHA 2M1CA 2QKPA 3UDFA 3S4XA 3N4IA 1JWVA 1TS8A 4S2MA 4XT2B 3K3DA 4GLQA 4MN7A 5FEFA 2OOLA 4E3LA 3F1PB 5HPIA 4HHDA 3K3CA 4P0MA 3SS4A 2HDSA 2B95A 4L9EA 5F69A 4JF6A 2Y2JA 2H5SA 2XROA 1ESIA 5AQBA 4JBFA 3UMDA 3G6OA 4OLGA 5FQMA 4BLMA 2ZQ9A 1P9RA 2V0WA 4XUZA 1L0DA 1W8QA 3E2LA 3HLBA 4MCWA 2CC1A 3MSHA 4KQOA 1Y54A 4HY8A 4S2PA 1Y28A 3VE3A 5HDCA 4IUKA 5CGSA 1YLWA 5HX9A 5FQIA 5A91A 5I94A 4DJ3A 2ZM0A 5L07A 4GHIA 5FQKA 2PRFA 3ZG5A 4QU3A 5A92A 1PI4A 2PR6A 5M19A 1LI0A 1STZA 4N9KA 3LUQA 4LCMA 4HBUA 2EWVA 1ZC2A 2ZL1B 4JGPA 1V9ZA 4B4ZA 3ZG9B 3HVFA 1VETB 1GA9A 5CHMA 2VGJA 4LCLA 1WYCA 4DXCA 1XX2A 3BECA 4HJ3A 3ZVWA 5KMWA 4Q0HA 4GS9A 3MS6A 1SKOA 4EETB 1IOUA 2PU2A 3ZNTA 4RYEA 4JGQA 2WKEA 3CLOA 4S2NC 3IHBA 3IWQA 4H8RA 1S4RA 3PTEA 2Y2PA 4R4RA 2G2UA 3B33A 2VGKA 4E3KA 2HP6A 4HI4A 3FPVA 2K2NA 1H8MA 3V50A 2P04A 3IBJA 3D4FA 1N4OA 5GL9A 3LR3A 1HD8A 3JVVA 3UPPA 3SS5A 1ONHA 4C3QA 3CJMA 2VV8A 2XK1A 3BY9A 3D3OA 1W8YA 3ITBA 3VOYA 1BULA 1I2WA 1UWNX 1W5DA 3ICYA 1BSGA 5FQQA 3C38A 2PYRA 3ZCZA 3ZG8B 4HJ4A 2B18A 4FH4A 1NY0A 3DW0A 5J7EA 1VB6A 2L0WA 1F2KA 3CAXA 3LIDA 4MN6A 2VLGA 1BUEA 2HP9A 3CITA 3GRJA 1W63Q 2ACGA 4UA9A 5CX7A 3BWLA 1ONGA 1T18A 1O07A 3LR4A 2XFTA 4JLFA 1K56D 1BYWA 4UA7A 3HCYA 3M2KA 1U60A 3BFCA 4D60A 4CPKA 4KQQA 1ACFA 4BWIA 4NKPA 4DRTA 4KG5A 3FKWA 1JTGA 3FC7A 3QNBA 4HP9A 3IBRA 2Y2MA 4OH0A 1ES5A 5FI2A 2L4RA 1IFQA 2GZAA 4P87A 3V67A 4ARZA 4DXBA 1NRJA 4NK3A 2ZBBA 3DBAA 3VP3A 4S2LA 4O7DA 3MFXA 2XLNA 2JE5A 3KYQA 5FQ9A 3UN7A 4UHUA 4EW7A 1LSVA 4OOYA 4WYYA 1YLYA 1YSQA 5HZHA 3NBLA 3Q82A 2KDKA 1IYPA 2WUQA 3W4OA 4NETA 3GSGA 5E2FA 2V2FF 2UV0E 5DF9A 4WMCD 3PYPA 3GTCA 4EBLA 2VX8A 1F5MA 3V39A 4H6JA 2HPBA 3UO9A 3T1XA 1AXBA 3EQUA 4FCFA 1KGEA 1KOUA 3MMHA 4PM6A 4M4XA 1I2SA 2V0UA 4PAUA 1KDWA 3MXQA 3OPHA 4Y3IA 3T12B 1ES4A 2J3TC 4OONA 3SS3A 1TS6A 5GHZA 1NRFA 4LPZA 3ITAA 1HZOA 3WWXA 4ETZA 2W3GA 4JF5A 2GDNA 4CLCD 4WZ5C 4GHIB 3KX0X 5F82A 3HLWA 4NG2A 5F83A 3NY4A 1ES3A 3CUEC 3P09A 2EX9A 2BG1A 1GHPA 2LB9A 2P7JA 2V1AA 3MQ0A 1BT5A 1LT0A 1CI8A 3T4TA 4PKYA 5FI6A 3FV7A 4XUXA 2A2LA 4EESA 3OPLA 2XA7M 1EWZA 4GS9B 1YLPA 5HD3A 1SKOB 3CUEA 2XDMA 3JYIA 4Y0UA 3U4LP 1I5QA 4E6XA 5EVIA 2PU4A 2RL3A 4II7A 4Y2FA 3UB5P 1BLPA 2OV5A 4QHCA 3CMZA 4UEYA 4ZTKA 5CERA 2PYPA 2ZLYA 3MKEA 5DF7A 3UB8A 3E4QA 3NDGA 1YLZA 1VQQA 4LRZE 2WZXA 2ZC5B 2WYXA 5E2HA 3DWZA 4X25A 4EQIA 4JXVA 4LV1A 2WK0A 3P7NA 3UPNA 4Q0IA 5EVLA 2QWSA 3WS2A 1DP6A 4E3JA 5L8MA 3LO7A 4LFUA 1O7EA 4OPRA 3V5MA 2HJEA 5FA7A 2O9CA 1ZG4A 3HREA 4BJPA 3O3VA 3NHQA 4DE3A 2Y2LA 3H7WA 1CEFA 2R9WA 3P98A 4L9FA 1P9WA 4YFMA 5FAQA 3VP4A 5CXWA 1K55A 2O9AA 1GA0A 1KGGA 4EEPA 3LI8A 4N9LA 2EFXA 2XGNA 3CPTB 5G18A 5F68A 4LV2A 4HOIA 4IBXA 3JPUA 4LLOB 5IT5A 2K31A 1G28A 4UAAA 5GHYA 2OLUA 3TOIA 3BW6A 5EUAA 1NLYA 1HVBA 2J9OA 4QWOA 4BD1A 2W1TA 1BLHA 4QJGA 1MWSA 1FCOA 1GHMA 2HDQA 3D9YA 1MWUA 4ARZB 3S7OA 2X01A 4MMNA 4R70A 1E25A 4R0QA 1YLTA 3LI9A 5FI7A 3CZDA 5I5LA 2FZ0A
chains in the Genus database with same CATH topology
1PI4A 3O86A 4S2OA 5M1AA 2ZM2A 1Q2PA 1SKFA 5CGWA 5M19A 1LI0A 4N9KA 5HAIA 4LCMA 3NCKA 4HBUA 3EQVA 2Y2KA 2ZD8A 2XD1A 1ES2A 3M6BA 1ZC2A 1PWDA 3A3EA 4FSFA 4B4ZA 4IEDA 3ZG9B 3HVFA 1GA9A 1K57C 2IWBA 4OQ0A 5CHMA 1ALQA 4FD8A 4X68A 2VGJA 4LCLA 3LEZA 1WYCA 4DXCA 3DTMA 1XX2A 2ZC4B 3BECA 1FR6A 3ZVWA 5EECA 1MBLA 5KMWA 3IXDA 1L0GA 3N6IA 1PIOA 2XF3A 1KDSA 1K54C 3MBZA 4JXSA 3VMAA 4X69A 3AGFA 2BLSA 3VSKA 4EUZA 3ZG5A 1IEMA 5HAQA 2PU2A 1CEGA 1K55C 3ZNTA 4RYEA 1XKZA 1YMXA 2Z2LB 5U47A 2WKEA 2P9VB 4WBGA 2HDRA 4BQMA 5FAOA 4S2NC 4P6BA 3IHBA 3IF6C 3IWOA 1XGJA 3HLCA 5E2GA 4ZJ2A 1YMSA 4P85A 4LV3A 3IWQA 3UDXA 2B5RA 1FOFA 1YQSA 4DDSA 4H8RA 2DRWA 3HLGA 4WEJA 1BLCA 2G2WA 1IYQA 5EPHA 4X53A 3ZG7B 4E3OA 3PTEA 3ZDJA 3C7UA 1MPLA 2Y2PA 3IXHA 4R4RA 3IWIA 3MZDA 4KG2A 2G2UA 2ZQ8A 2VGKA 4E3KA 3S22A 2HP6A 1IYOA 1QMFA 2ZQDA 4JXWA 4M3KA 3V50A 2J7VA 4MLLA 2EXAA 3ISGA 5EOOA 5CHUA 3Q7ZA 3D4FA 5FATA 3UY6A 4R4SA 1PWGA 1N4OA 4S2IA 4Q8IA 4OVDA 3HLFA 2Y2GA 3VP1A 5GL9A 4PM9A 1NZOA 4DF6A 3RXWA 1QMEA 2V1ZA 3M2JA 5L2FA 1HD8A 3UPPA 5A90A 3SS5A 1ONHA 4C3QA 3CJMA 1YLJA 2P74A 2XK1A 3W4QA 4DKIA 3PBNA 4C6YA 5JYPA 1BLSA 1BTLA 4UA6A 4D2OA 1W8YA 1XP4A 3ITBA 3VOYA 4PMAA 3Q07A 4EBPA 1BULA 1I2WA 2H10A 2XR0A 3QHYA 5J8XA 2C5WB 5CEDA 4HEFA 5FSRA 3VP2A 1W5DA 1MWTA 2FFFB 3A3IA 1BSGA 3BEBA 5FQQA 2XH9A 5HW3A 5JYOA 4RX3A 3Q81A 3PBQA 4QD4A 5FQJA 1PZOA 2ZQCA 1TDGA 5CECA 2EX8A 4K0WA 5EVIB 3ZCZA 3ZG8B 4BD0A 4R1GA 5DTKA 4RVAA 2Y2HA 3HLEA 3Q7VA 2WAFA 4OPYA 1FSWA 2Y4AA 4FH4A 1NY0A 3DW0A 4GKUA 5DTSA 1E3UD 1NZUA 4GOGA 4KQRA 1FSYA 2WGWA 3ZVTA 1JTDA 2WAEA 3C5AA 3OPPA 5GLAA 1PYYA 1BUEA 1M6KA 3G32A 1DY6A 4BL3A 2Y2QA 2HP9A 4PPRA 5EOEA 5GLCA 3AGDA 1NJ4A 3GRJA 2Y55A 3G31A 3NDEA 1E3UA 5FAPA 3Q1FA 2PBYA 1XXMA 3PAEA 1LL9A 4XXRA 2XD5A 2ZM8A 4UA9A 1ONGA 3FWLA 1NXYA 1O07A 1SDEA 4ZAMA 4BL2A 3O88A 3W4PA 2XFTA 1Q2QA 1J9MA 4JLFA 4WZ5A 1K56D 4QY6A 2R9XA 4UA7A 4YINA 5F1FA 3OPRA 1XPBA 2C6WB 3WRZA 1TDLA 1KVLA 5M18A 3M2KA 1U60A 3BFCA 3S1YA 3FYZA 3PBTA 4CPKA 5D3OA 4KQQA 3G2YA 2IWCA 4DRTA 4KG5A 1XGIA 1MY8A 1PWCA 3FKWA 1JTGA 4ZBEA 4N1HA 3G34A 3QNBA 4OLDA 2Y2OA 2J8YA 2Y2MA 4OH0A 1ES5A 5FI2A 1KE0A 3NI9A 1PZPA 4JF4A 1SCWA 4U0TA 2QZ6A 3LY4A 4P87A 3TG9A 4DXBA 4NK3A 1IYSA 4WZ4A 5HARA 3IXBA 3BM6A 4S2LA 3VP3A 4O7DA 1ERQA 2WKIA 1JWZA 2EFUA 4ZJ1A 1H8ZA 2WZZA 4OQHA 2XLNA 2JE5A 3ZNYA 3BFFA 3GQZA 3SH7A 5FQ9A 3UN7A 4UHUA 3FKVA 3RJUA 2WADA 2Y59A 5CTMA 1LL5A 4GD8A 5E43A 4OOYA 4L0LA 4WYYA 3NC8A 1MWRA 1YLYA 4PM5A 3NBLA 1CI9A 2Q9NA 3IF6B 3PBSA 1G6AA 5AQ9A 5TFQA 3Q82A 2H0YA 3MKFA 3BLMA 2Y91A 1MXOA 2DNSA 3C4OA 3HUNA 1DJBA 1FR1A 1IYPA 1RGZA 2WUQA 3BFDA 3N8SA 4MNRA 4NETA 3W4OA 3ZHHA 3FZCA 3GSGA 5E2FA 1MKIA 2V2FF 1Z6FA 4R23A 5DF9A 3RXXA 1FQGA 4WMCD 3OZHA 2QPNA 2JBFA 3GTCA 3HUMA 4EBLA 3CG5A 3E2KA 4OOLA 2I72A 5E2EA 5CEBA 1IKGA 3IH9A 4OP5A 1G68A 2EX6A 1CK3A 1IKIA 3V39A 4EV4A 1TVFA 1EI5A 4OKPA 1FCMA 4JXGA 3VSLA 3SH8A 1K38A 2HPBA 1K4FA 4KZ7A 4X6TA 5CRFA 1RP5A 4KZ5A 5CTNA 2J9PA 2P9VA 3IXGA 4Z9QA 3V3RA 3LY3A 1TEMA 1AXBA 4WELA 4U3TA 3UO9A 3EQUA 4GDNA 4OQIA 4ZJ3A 4FCFA 1KGEA 3HL9A 1ESUA 5HAPA 3UE3A 4PM6A 1I2SA 4CJNA 3MXSA 1W79A 3HBRA 2ZC3B 1KDWA 4GDBA 4E3IA 1YM1A 3OPHA 4PM7A 3UDIA 3IT9A 1ES4A 4KENB 4OONA 3SS3A 3ZG0A 4DDYA 2WGWB 1GHIA 3A3FA 3BLSA 4K0XA 1KE3A 5CGXA 4S2JA 5GHZA 1NRFA 3IH8A 3ITAA 1HZOA 1DJAA 3MZEA 1NYYA 3QNCA 3WWXA 2A49A 4JF5A 4DE1A 2GDNA 3PBOA 3MZFA 4WZ5C 1XA1A 5F82A 3HLWA 4MBKA 4OOMA 2Q9MA 5F83A 3LCEA 3NY4A 3WRTA 2V20A 3BFGA 1ES3A 1HTZA 3P09A 2HP5A 2UWXA 4GZBA 1KGFA 2EX9A 2BG1A 1GHPA 2WGIA 2QMIA 1NYMA 4OP8A 4RX2A 3G30A 2Y2NA 3BYDA 1DJCA 2IWDA 4EBNA 5GLDA 2ZC7A 3B3XA 3UNWA 1BT5A 1BZAA 1ERMA 4KZ3A 3O87A 1CI8A 1N9BA 1RCJA 4JPMA 4B88A 2WGVA 2XFSA 5EVID 2X71A 4RA7A 2RCXA 5FI6A 3FV7A 3C7VA 5EE8A 2Z2MB 2DCFA 1LLBA 4ID4A 4K91A 4LENA 4MBHA 4XUXA 3OPLA 5TGFA 2EXBA 4KZAA 4KG6A 4A5RA 1EWZA 1YLPA 5TR7A 3HLDA 2XDMA 5GHXA 3JYIA 4Y0UA 1I5QA 1W7FA 4U0XA 3DWKA 5KSCA 4E6XA 4E3NA 5EVIA 3MXRA 1EROA 2PU4A 2RL3A 4IBRA 4OQGA 1BLPA 1L2SA 1K56A 1PW8A 4QY5A 4QHCA 2OV5A 4S2KA 4IVIA 5HFOA 4JKTA 3VP0A 1OMEA 4N1XA 5DTTA 1WE4A 3CMZA 4HESA 4Y7PA 4ZTKA 5CERA 4Y0TA 3WS5A 1S6RA 3G35A 4GNUA 2ZLYA 3I7JA 3MKEA 4HBTA 3W8KA 4DE2A 4KZBA 5DF7A 2ZQAA 3PAGA 3NDGA 1YLZA 3WS1A 1VQQA 1ZKJA 1WYBA 1JVJA 5AQAA 4GD6A 5FDHA 4GB7A 3UE0A 2WZXA 2ZC5B 2WYXA 4WM9A 5GLBA 5E2HA 3DWZA 3WS0A 2A3UA 4JXVA 1L0FA 4EQIA 5AQ7A 3NIAA 2ZMAA 4LV1A 2WK0A 3UPNA 5EVLA 1C3BA 5IHVA 3WS2A 4BENA 3IF5A 5HL1A 4ZDXA 4E3JA 1YT4A 3A3DA 5F1GA 3VOZA 3SOIA 1KE4A 1FCNA 4WEKA 3OCLA 2OSUA 3ZGAB 3MFDA 1XA7A 4PM8A 3BRMA 3GMWA 4R3BA 3A3JA 1K57A 3LO7A 3PBRA 1K6RA 1O7EA 4OPRA 3V5MA 4KZ4A 1E4DA 3G2ZA 4Y0OA 5FA7A 1S0WA 1M40A 4R3JA 2FFYA 2EX2A 4OPQA 3C4PA 2E8IA 5A93A 3M6HA 1PI5A 1K54A 1ZG4A 3UPOA 4MBFA 3HREA 4BJPA 4EWFA 3O3VA 3WS4A 2XEPA 3TSGA 4DE3A 2Y2LA 3GVBA 4LV0A 4WMCA 2JCHA 1ZG6A 1H5XA 4OPZA 3VFFA 3N8LA 4C75A 4DE0A 3ZFZA 1CEFA 2R9WA 3P98A 4QB8A 5KSHA 4YFMA 5FAQA 3VP4A 5CXWA 3S4XA 3UDFA 1K55A 1K25A 1GA0A 1JWVA 1KGGA 3N4IA 1SDNA 5FASA 4N92A 3Q7VB 3V3SA 4S2MA 3N7WA 1LI9A 5CHJA 4S2NA 2H0TA 2EFXA 2XGNA 3IF6A 4N9LA 5G18A 2HDUA 2Y2IA 3GV9A 3BFEA 3GR2A 1LHYA 5KZHA 5BOHA 4LV2A 4E3LA 2ZC6B 3SH9A 2JC7A 4IBXA 4P0MA 4F94A 3SS4A 2OLVA 3UE1A 2HDSA 1PW1A 4FH2A 4KZ6A 1GCEA 4E3MA 1JWPA 3OC2A 4UAAA 3HUOA 5GHYA 4JF6A 1KVMA 2WKHA 2Y2JA 2H5SA 2OLUA 4IVKA 1ESIA 5AQBA 3TOIA 4JBFA 5EVIC 4OLGA 5FQMA 1IELA 4BLMA 2ZQ9A 5EUAA 4XUZA 1HVBA 1L0DA 1W8QA 4X55A 2J9OA 4E6WA 4GN2A 4KZ9A 1VM1A 3E2LA 4BD1A 3VFHA 3HLBA 1BLHA 4QJGA 1MWSA 3OCNA 2CC1A 5DF8A 1SHVA 4KQOA 4MEZA 1FCOA 1L0EA 1Y54A 4S2PA 2ZJ9A 1K6SA 1GHMA 1H8YA 2HDQA 2ZQ7A 5DVAA 5CGSA 1YLWA 5HX9A 1MWUA 5FQIA 2X02A 4X56A 4B4XA 5A91A 5I94A 2XQZA 3N8RA 2X01A 2ZM0A 3AGEA 3G4PA 1E25A 3IHAA 4R0QA 1YLTA 4KZ8A 5FI7A 3CZDA 5FQKA 1K4EA 1RGYA 4QU3A 5A92A 3IQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI4 A;  3O86 A;  4S2O A;  5M1A A;  2ZM2 A;  1Q2P A;  1SKF A;  5CGW A;  5M19 A;  1LI0 A;  4N9K A;  5HAI A;  4LCM A;  3NCK A;  4HBU A;  3EQV A;  2Y2K A;  2ZD8 A;  2XD1 A;  1ES2 A;  3M6B A;  1ZC2 A;  1PWD A;  3A3E A;  4FSF A;  4B4Z A;  4IED A;  3ZG9 B;  3HVF A;  1GA9 A;  1K57 C;  2IWB A;  4OQ0 A;  5CHM A;  1ALQ A;  4FD8 A;  4X68 A;  2VGJ A;  4LCL A;  3LEZ A;  1WYC A;  4DXC A;  3DTM A;  1XX2 A;  2ZC4 B;  3BEC A;  1FR6 A;  3ZVW A;  5EEC A;  1MBL A;  5KMW A;  3IXD A;  1L0G A;  3N6I A;  1PIO A;  2XF3 A;  1KDS A;  1K54 C;  3MBZ A;  4JXS A;  3VMA A;  4X69 A;  3AGF A;  2BLS A;  3VSK A;  4EUZ A;  3ZG5 A;  1IEM A;  5HAQ A;  2PU2 A;  1CEG A;  1K55 C;  3ZNT A;  4RYE A;  1XKZ A;  1YMX A;  2Z2L B;  5U47 A;  2WKE A;  2P9V B;  4WBG A;  2HDR A;  4BQM A;  5FAO A;  4S2N C;  4P6B A;  3IHB A;  3IF6 C;  3IWO A;  1XGJ A;  3HLC A;  5E2G A;  4ZJ2 A;  1YMS A;  4P85 A;  4LV3 A;  3IWQ A;  3UDX A;  2B5R A;  1FOF A;  1YQS A;  4DDS A;  4H8R A;  2DRW A;  3HLG A;  4WEJ A;  1BLC A;  2G2W A;  1IYQ A;  5EPH A;  4X53 A;  3ZG7 B;  4E3O A;  3PTE A;  3ZDJ A;  3C7U A;  1MPL A;  2Y2P A;  3IXH A;  4R4R A;  3IWI A;  3MZD A;  4KG2 A;  2G2U A;  2ZQ8 A;  2VGK A;  4E3K A;  3S22 A;  2HP6 A;  1IYO A;  1QMF A;  2ZQD A;  4JXW A;  4M3K A;  3V50 A;  2J7V A;  4MLL A;  2EXA A;  3ISG A;  5EOO A;  5CHU A;  3Q7Z A;  3D4F A;  5FAT A;  3UY6 A;  4R4S A;  1PWG A;  1N4O A;  4S2I A;  4Q8I A;  4OVD A;  3HLF A;  2Y2G A;  3VP1 A;  5GL9 A;  4PM9 A;  1NZO A;  4DF6 A;  3RXW A;  1QME A;  2V1Z A;  3M2J A;  5L2F A;  1HD8 A;  3UPP A;  5A90 A;  3SS5 A;  1ONH A;  4C3Q A;  3CJM A;  1YLJ A;  2P74 A;  2XK1 A;  3W4Q A;  4DKI A;  3PBN A;  4C6Y A;  5JYP A;  1BLS A;  1BTL A;  4UA6 A;  4D2O A;  1W8Y A;  1XP4 A;  3ITB A;  3VOY A;  4PMA A;  3Q07 A;  4EBP A;  1BUL A;  1I2W A;  2H10 A;  2XR0 A;  3QHY A;  5J8X A;  2C5W B;  5CED A;  4HEF A;  5FSR A;  3VP2 A;  1W5D A;  1MWT A;  2FFF B;  3A3I A;  1BSG A;  3BEB A;  5FQQ A;  2XH9 A;  5HW3 A;  5JYO A;  4RX3 A;  3Q81 A;  3PBQ A;  4QD4 A;  5FQJ A;  1PZO A;  2ZQC A;  1TDG A;  5CEC A;  2EX8 A;  4K0W A;  5EVI B;  3ZCZ A;  3ZG8 B;  4BD0 A;  4R1G A;  5DTK A;  4RVA A;  2Y2H A;  3HLE A;  3Q7V A;  2WAF A;  4OPY A;  1FSW A;  2Y4A A;  4FH4 A;  1NY0 A;  3DW0 A;  4GKU A;  5DTS A;  1E3U D;  1NZU A;  4GOG A;  4KQR A;  1FSY A;  2WGW A;  3ZVT A;  1JTD A;  2WAE A;  3C5A A;  3OPP A;  5GLA A;  1PYY A;  1BUE A;  1M6K A;  3G32 A;  1DY6 A;  4BL3 A;  2Y2Q A;  2HP9 A;  4PPR A;  5EOE A;  5GLC A;  3AGD A;  1NJ4 A;  3GRJ A;  2Y55 A;  3G31 A;  3NDE A;  1E3U A;  5FAP A;  3Q1F A;  2PBY A;  1XXM A;  3PAE A;  1LL9 A;  4XXR A;  2XD5 A;  2ZM8 A;  4UA9 A;  1ONG A;  3FWL A;  1NXY A;  1O07 A;  1SDE A;  4ZAM A;  4BL2 A;  3O88 A;  3W4P A;  2XFT A;  1Q2Q A;  1J9M A;  4JLF A;  4WZ5 A;  1K56 D;  4QY6 A;  2R9X A;  4UA7 A;  4YIN A;  5F1F A;  3OPR A;  1XPB A;  2C6W B;  3WRZ A;  1TDL A;  1KVL A;  5M18 A;  3M2K A;  1U60 A;  3BFC A;  3S1Y A;  3FYZ A;  3PBT A;  4CPK A;  5D3O A;  4KQQ A;  3G2Y A;  2IWC A;  4DRT A;  4KG5 A;  1XGI A;  1MY8 A;  1PWC A;  3FKW A;  1JTG A;  4ZBE A;  4N1H A;  3G34 A;  3QNB A;  4OLD A;  2Y2O A;  2J8Y A;  2Y2M A;  4OH0 A;  1ES5 A;  5FI2 A;  1KE0 A;  3NI9 A;  1PZP A;  4JF4 A;  1SCW A;  4U0T A;  2QZ6 A;  3LY4 A;  4P87 A;  3TG9 A;  4DXB A;  4NK3 A;  1IYS A;  4WZ4 A;  5HAR A;  3IXB A;  3BM6 A;  4S2L A;  3VP3 A;  4O7D A;  1ERQ A;  2WKI A;  1JWZ A;  2EFU A;  4ZJ1 A;  1H8Z A;  2WZZ A;  4OQH A;  2XLN A;  2JE5 A;  3ZNY A;  3BFF A;  3GQZ A;  3SH7 A;  5FQ9 A;  3UN7 A;  4UHU A;  3FKV A;  3RJU A;  2WAD A;  2Y59 A;  5CTM A;  1LL5 A;  4GD8 A;  5E43 A;  4OOY A;  4L0L A;  4WYY A;  3NC8 A;  1MWR A;  1YLY A;  4PM5 A;  3NBL A;  1CI9 A;  2Q9N A;  3IF6 B;  3PBS A;  1G6A A;  5AQ9 A;  5TFQ A;  3Q82 A;  2H0Y A;  3MKF A;  3BLM A;  2Y91 A;  1MXO A;  2DNS A;  3C4O A;  3HUN A;  1DJB A;  1FR1 A;  1IYP A;  1RGZ A;  2WUQ A;  3BFD A;  3N8S A;  4MNR A;  4NET A;  3W4O A;  3ZHH A;  3FZC A;  3GSG A;  5E2F A;  1MKI A;  2V2F F;  1Z6F A;  4R23 A;  5DF9 A;  3RXX A;  1FQG A;  4WMC D;  3OZH A;  2QPN A;  2JBF A;  3GTC A;  3HUM A;  4EBL A;  3CG5 A;  3E2K A;  4OOL A;  2I72 A;  5E2E A;  5CEB A;  1IKG A;  3IH9 A;  4OP5 A;  1G68 A;  2EX6 A;  1CK3 A;  1IKI A;  3V39 A;  4EV4 A;  1TVF A;  1EI5 A;  4OKP A;  1FCM A;  4JXG A;  3VSL A;  3SH8 A;  1K38 A;  2HPB A;  1K4F A;  4KZ7 A;  4X6T A;  5CRF A;  1RP5 A;  4KZ5 A;  5CTN A;  2J9P A;  2P9V A;  3IXG A;  4Z9Q A;  3V3R A;  3LY3 A;  1TEM A;  1AXB A;  4WEL A;  4U3T A;  3UO9 A;  3EQU A;  4GDN A;  4OQI A;  4ZJ3 A;  4FCF A;  1KGE A;  3HL9 A;  1ESU A;  5HAP A;  3UE3 A;  4PM6 A;  1I2S A;  4CJN A;  3MXS A;  1W79 A;  3HBR A;  2ZC3 B;  1KDW A;  4GDB A;  4E3I A;  1YM1 A;  3OPH A;  4PM7 A;  3UDI A;  3IT9 A;  1ES4 A;  4KEN B;  4OON A;  3SS3 A;  3ZG0 A;  4DDY A;  2WGW B;  1GHI A;  3A3F A;  3BLS A;  4K0X A;  1KE3 A;  5CGX A;  4S2J A;  5GHZ A;  1NRF A;  3IH8 A;  3ITA A;  1HZO A;  1DJA A;  3MZE A;  1NYY A;  3QNC A;  3WWX A;  2A49 A;  4JF5 A;  4DE1 A;  2GDN A;  3PBO A;  3MZF A;  4WZ5 C;  1XA1 A;  5F82 A;  3HLW A;  4MBK A;  4OOM A;  2Q9M A;  5F83 A;  3LCE A;  3NY4 A;  3WRT A;  2V20 A;  3BFG A;  1ES3 A;  1HTZ A;  3P09 A;  2HP5 A;  2UWX A;  4GZB A;  1KGF A;  2EX9 A;  2BG1 A;  1GHP A;  2WGI A;  2QMI A;  1NYM A;  4OP8 A;  4RX2 A;  3G30 A;  2Y2N A;  3BYD A;  1DJC A;  2IWD A;  4EBN A;  5GLD A;  2ZC7 A;  3B3X A;  3UNW A;  1BT5 A;  1BZA A;  1ERM A;  4KZ3 A;  3O87 A;  1CI8 A;  1N9B A;  1RCJ A;  4JPM A;  4B88 A;  2WGV A;  2XFS A;  5EVI D;  2X71 A;  4RA7 A;  2RCX A;  5FI6 A;  3FV7 A;  3C7V A;  5EE8 A;  2Z2M B;  2DCF A;  1LLB A;  4ID4 A;  4K91 A;  4LEN A;  4MBH A;  4XUX A;  3OPL A;  5TGF A;  2EXB A;  4KZA A;  4KG6 A;  4A5R A;  1EWZ A;  1YLP A;  5TR7 A;  3HLD A;  2XDM A;  5GHX A;  3JYI A;  4Y0U A;  1I5Q A;  1W7F A;  4U0X A;  3DWK A;  5KSC A;  4E6X A;  4E3N A;  5EVI A;  3MXR A;  1ERO A;  2PU4 A;  2RL3 A;  4IBR A;  4OQG A;  1BLP A;  1L2S A;  1K56 A;  1PW8 A;  4QY5 A;  4QHC A;  2OV5 A;  4S2K A;  4IVI A;  5HFO A;  4JKT A;  3VP0 A;  1OME A;  4N1X A;  5DTT A;  1WE4 A;  3CMZ A;  4HES A;  4Y7P A;  4ZTK A;  5CER A;  4Y0T A;  3WS5 A;  1S6R A;  3G35 A;  4GNU A;  2ZLY A;  3I7J A;  3MKE A;  4HBT A;  3W8K A;  4DE2 A;  4KZB A;  5DF7 A;  2ZQA A;  3PAG A;  3NDG A;  1YLZ A;  3WS1 A;  1VQQ A;  1ZKJ A;  1WYB A;  1JVJ A;  5AQA A;  4GD6 A;  5FDH A;  4GB7 A;  3UE0 A;  2WZX A;  2ZC5 B;  2WYX A;  4WM9 A;  5GLB A;  5E2H A;  3DWZ A;  3WS0 A;  2A3U A;  4JXV A;  1L0F A;  4EQI A;  5AQ7 A;  3NIA A;  2ZMA A;  4LV1 A;  2WK0 A;  3UPN A;  5EVL A;  1C3B A;  5IHV A;  3WS2 A;  4BEN A;  3IF5 A;  5HL1 A;  4ZDX A;  4E3J A;  1YT4 A;  3A3D A;  5F1G A;  3VOZ A;  3SOI A;  1KE4 A;  1FCN A;  4WEK A;  3OCL A;  2OSU A;  3ZGA B;  3MFD A;  1XA7 A;  4PM8 A;  3BRM A;  3GMW A;  4R3B A;  3A3J A;  1K57 A;  3LO7 A;  3PBR A;  1K6R A;  1O7E A;  4OPR A;  3V5M A;  4KZ4 A;  1E4D A;  3G2Z A;  4Y0O A;  5FA7 A;  1S0W A;  1M40 A;  4R3J A;  2FFY A;  2EX2 A;  4OPQ A;  3C4P A;  2E8I A;  5A93 A;  3M6H A;  1PI5 A;  1K54 A;  1ZG4 A;  3UPO A;  4MBF A;  3HRE A;  4BJP A;  4EWF A;  3O3V A;  3WS4 A;  2XEP A;  3TSG A;  4DE3 A;  2Y2L A;  3GVB A;  4LV0 A;  4WMC A;  2JCH A;  1ZG6 A;  1H5X A;  4OPZ A;  3VFF A;  3N8L A;  4C75 A;  4DE0 A;  3ZFZ A;  1CEF A;  2R9W A;  3P98 A;  4QB8 A;  5KSH A;  4YFM A;  5FAQ A;  3VP4 A;  5CXW A;  3S4X A;  3UDF A;  1K55 A;  1K25 A;  1GA0 A;  1JWV A;  1KGG A;  3N4I A;  1SDN A;  5FAS A;  4N92 A;  3Q7V B;  3V3S A;  4S2M A;  3N7W A;  1LI9 A;  5CHJ A;  4S2N A;  2H0T A;  2EFX A;  2XGN A;  3IF6 A;  4N9L A;  5G18 A;  2HDU A;  2Y2I A;  3GV9 A;  3BFE A;  3GR2 A;  1LHY A;  5KZH A;  5BOH A;  4LV2 A;  4E3L A;  2ZC6 B;  3SH9 A;  2JC7 A;  4IBX A;  4P0M A;  4F94 A;  3SS4 A;  2OLV A;  3UE1 A;  2HDS A;  1PW1 A;  4FH2 A;  4KZ6 A;  1GCE A;  4E3M A;  1JWP A;  3OC2 A;  4UAA A;  3HUO A;  5GHY A;  4JF6 A;  1KVM A;  2WKH A;  2Y2J A;  2H5S A;  2OLU A;  4IVK A;  1ESI A;  5AQB A;  3TOI A;  4JBF A;  5EVI C;  4OLG A;  5FQM A;  1IEL A;  4BLM A;  2ZQ9 A;  5EUA A;  4XUZ A;  1HVB A;  1L0D A;  1W8Q A;  4X55 A;  2J9O A;  4E6W A;  4GN2 A;  4KZ9 A;  1VM1 A;  3E2L A;  4BD1 A;  3VFH A;  3HLB A;  1BLH A;  4QJG A;  1MWS A;  3OCN A;  2CC1 A;  5DF8 A;  1SHV A;  4KQO A;  4MEZ A;  1FCO A;  1L0E A;  1Y54 A;  4S2P A;  2ZJ9 A;  1K6S A;  1GHM A;  1H8Y A;  2HDQ A;  2ZQ7 A;  5DVA A;  5CGS A;  1YLW A;  5HX9 A;  1MWU A;  5FQI A;  2X02 A;  4X56 A;  4B4X A;  5A91 A;  5I94 A;  2XQZ A;  3N8R A;  2X01 A;  2ZM0 A;  3AGE A;  3G4P A;  1E25 A;  3IHA A;  4R0Q A;  1YLT A;  4KZ8 A;  5FI7 A;  3CZD A;  5FQK A;  1K4E A;  1RGY A;  4QU3 A;  5A92 A;  3IQA A; 
#chains in the Genus database with same CATH topology
 3O86 A;  1SKF A;  5CGW A;  2O99 A;  1PNE A;  2W3D A;  3QP1 A;  4CQH A;  3NCK A;  3IX8 A;  1ES2 A;  1T1B A;  5IU1 A;  4IED A;  1K57 C;  3F1O A;  4O01 A;  3E98 A;  4R6L A;  4X68 A;  2QHK A;  3LEZ A;  2Z6C A;  3DTM A;  5EEC A;  1MBL A;  3IXD A;  2XF3 A;  2J80 A;  4JXS A;  1K54 C;  4B93 A;  3AGF A;  3R4K A;  4EUZ A;  5HAQ A;  5U47 A;  4AFI A;  2IA2 A;  5DFY A;  5FAO A;  3HLC A;  4LV3 A;  2B5R A;  2DRW A;  2G2W A;  4CLC E;  4X53 A;  1P97 A;  1MPL A;  3IWI A;  4KG2 A;  3UME A;  4EU0 A;  2EWW A;  2ZQ8 A;  3O5Y A;  3S22 A;  4L9G A;  1IYO A;  4M3K A;  5EM1 A;  2EXA A;  1CJF A;  5EOO A;  5A8B A;  5CHU A;  5FAT A;  3UY6 A;  4PM9 A;  3B47 A;  3GEC A;  1VHM A;  1D1J A;  5L2F A;  3M2J A;  2GX5 A;  4BBV A;  5A90 A;  1XJ3 A;  3VV4 A;  2P74 A;  3LIB A;  4O8G A;  3W4Q A;  4C6Y A;  5G4Y A;  1BLS A;  1BTL A;  4UA6 A;  3TJZ C;  1XP4 A;  4PMA A;  2XR0 A;  3QHY A;  3VP2 A;  1MWT A;  2FFF B;  1WA9 A;  4Y13 A;  5FQJ A;  3T1R A;  1PZO A;  3SW1 A;  2Y79 A;  2EX8 A;  4K0W A;  5EVI B;  2VK3 A;  4BD0 A;  3MJQ A;  3Q7V A;  1FSW A;  2Y4A A;  4GKU A;  5DKK A;  3T50 A;  1T1A A;  3C5A A;  3OPP A;  3A0V A;  5GLA A;  1PYY A;  1M6K A;  3G32 A;  2Y2Q A;  2W3E A;  4PPR A;  3AGD A;  1AWI A;  3NEC A;  2J3W A;  1NJ4 A;  1W63 M;  3G31 A;  3NDE A;  5FAP A;  3KSF A;  3Q1F A;  2PBY A;  1XXM A;  3EWK A;  3FWL A;  4ZAM A;  3W4P A;  1NWZ A;  4YIN A;  2C6W B;  1TDL A;  1KVL A;  5M18 A;  5EVE A;  3R7W A;  3FYZ A;  2D01 A;  4ZBE A;  4OLD A;  4PKY G;  2Y2O A;  1G6O A;  1GSW A;  4JF4 A;  2MJ6 A;  3LY4 A;  2R78 A;  5HWV A;  1OTB A;  2PDR A;  4WZ4 A;  3E0Y A;  3IXB A;  1JWZ A;  2PBD P;  2EFU A;  3UB9 A;  4OQH A;  3H7W B;  1XJ4 A;  4Z1W A;  3ZNY A;  1NLZ A;  2Y59 A;  1LL5 A;  5E43 A;  4WN5 A;  2Q9N A;  3IX4 A;  3MKF A;  2DNS A;  4JGO A;  1RGZ A;  3C2W A;  1MKI A;  1Z6F A;  3RXX A;  3KSH A;  2JBF A;  4HIA A;  4OOL A;  5CEB A;  3IH9 A;  4OP5 A;  1G68 A;  1CK3 A;  4OKP A;  3H9W A;  4JXG A;  3VSL A;  2A24 B;  1K38 A;  1K4F A;  4KZ5 A;  3V3R A;  2J9P A;  2P9V A;  4Z9Q A;  1TEM A;  5K5B A;  4U3T A;  5HAP A;  3UE3 A;  3T4S A;  4CJN A;  2W1T B;  1YM1 A;  4I39 A;  4PM7 A;  3KYZ A;  2WGW B;  1OTE A;  1NYY A;  2A49 A;  4DE1 A;  5HWW A;  1XA1 A;  4GJ4 A;  4OOM A;  2YKF A;  3LCE A;  3DTI A;  4DN0 A;  3CPT A;  3H82 A;  1KGF A;  3EGX C;  2KX6 A;  4EER A;  4OP8 A;  4EBN A;  1DJC A;  4CLC A;  5GLD A;  3B3X A;  3F1O B;  4KZ3 A;  2QJ5 A;  1N9B A;  1RCJ A;  3LGO A;  1S4S A;  2WKP A;  2XA7 S;  2RCX A;  1VEU A;  2DCF A;  1A0K A;  4ID4 A;  5EFW A;  5TR7 A;  3B42 A;  2NUT C;  3HLD A;  1DP8 A;  5GHX A;  1W7F A;  3DTE A;  3DWK A;  1ERO A;  4OQG A;  3S7P A;  1PW8 A;  5EV0 A;  5HFO A;  4N1X A;  5DTT A;  3QP4 A;  3WS5 A;  1S6R A;  4GNU A;  4ZRR A;  3IS2 A;  4WF0 A;  2ZQA A;  3WS1 A;  1ZKJ A;  3BY8 A;  1WYB A;  5AQA A;  4GB7 A;  3UE0 A;  4WM9 A;  1MKM A;  3WS0 A;  3TE8 A;  5AQ7 A;  3NIA A;  2PD7 A;  4UQI S;  4YWZ A;  4ZDX A;  1ZHH B;  1YT4 A;  3A3D A;  4WEK A;  1FCN A;  2OSU A;  3MFD A;  1XA7 A;  3BRM A;  3GMW A;  4R3B A;  4ETX A;  1PFL A;  5EM0 A;  2EX2 A;  4OPQ A;  2E8I A;  3M6H A;  4DMZ A;  1PI5 A;  4R38 A;  3UPO A;  4EWF A;  2L1M A;  1XFN A;  3WS4 A;  2HGV A;  5F5Y A;  1H5X A;  4C75 A;  3N8L A;  1OT6 A;  5FAS A;  4N92 A;  3Q7V B;  1K0K A;  1LI9 A;  2H0T A;  3BJN A;  3IF6 A;  3C8C A;  2HDU A;  3T4K A;  2VZW A;  3BFE A;  5BOH A;  2ZC6 B;  3SH9 A;  4WL9 A;  3P01 A;  3FG8 A;  4F94 A;  3UB6 A;  3UE1 A;  4KZ6 A;  1GCE A;  3OC2 A;  1MC0 A;  2P08 A;  3LIF A;  4IUH A;  5EVI C;  4KUO A;  1IEL A;  3R7W B;  4E6W A;  4GN2 A;  4Y15 A;  2XRN A;  3OCN A;  1L0E A;  2ZJ9 A;  1H8Y A;  2ZQ7 A;  5FL3 A;  2X02 A;  4B4X A;  2XQZ A;  3N8R A;  4IHQ A;  3G4P A;  2BTF P;  4GCZ A;  4A5R A;  4S2O A;  1Q2P A;  2Y2K A;  2ZD8 A;  4LGW A;  4FOF A;  2JHE A;  1ALQ A;  1FR6 A;  3JVU A;  5HDS A;  1L0G A;  3N6I A;  1PIO A;  1OTD A;  1KDS A;  3MBZ A;  4X69 A;  2VGL M;  3VSK A;  1UWP X;  4I3J A;  4YNR A;  1F98 A;  4UQI M;  1K55 C;  1XKZ A;  1YMX A;  2V1B A;  3PXP A;  2P9V B;  2HDR A;  3SZT A;  4P6B A;  1F9I A;  5E2G A;  2E8J A;  4P85 A;  3UDX A;  3CHW P;  1FOF A;  1YQS A;  4BBU A;  3ZG7 B;  2ZOH A;  4E3O A;  3TRC A;  4YOF A;  4BBT A;  3GDI A;  1QMF A;  2ZQD A;  2J7V A;  4MLL A;  3ISG A;  3Q7Z A;  4R4S A;  1PWG A;  4OVD A;  2Y2G A;  4WLA A;  3VP1 A;  1N9N A;  3H82 B;  4DF6 A;  4HH3 A;  1JNU A;  5F6A A;  4CLC B;  3MF0 A;  4DKI A;  1G5U A;  4EEU A;  5JYP A;  3KSI A;  4ME4 A;  2H10 A;  4Y17 A;  5DKL A;  1XJ6 A;  2C5W B;  2W3F A;  1VEU B;  5CED A;  3VOL A;  3A3I A;  4K08 A;  1Z09 A;  5HW3 A;  2XH9 A;  5JYO A;  2A24 A;  4RX3 A;  3Q81 A;  4QD4 A;  4I3I A;  3DAV A;  2J3T D;  3NOT C;  5DTK A;  4X1M A;  2Y2H A;  4OPY A;  5C5K A;  5DTS A;  1L3L A;  1E3U D;  3NJA A;  4HH2 A;  4GOG A;  4KQR A;  2WGW A;  3ZVT A;  1JTD A;  4MN5 A;  3EOI A;  1DY6 A;  4BL3 A;  1MZU A;  3IS2 B;  2W27 A;  2Y55 A;  3PAE A;  2CMN A;  2OWH A;  2XD5 A;  2ZM8 A;  3T4Q A;  4BL2 A;  3O88 A;  4F3L A;  1Q2Q A;  5AVE A;  2HZ5 A;  3OPR A;  3WRZ A;  1XJ2 A;  3PBT A;  1S67 L;  2VEA A;  3G34 A;  4B9O A;  1KE0 A;  3NI9 A;  4U0T A;  1SCW A;  2QZ6 A;  3T1Q B;  2Y8H A;  5AJG A;  3QP8 A;  1IYS A;  4R3A A;  3OBF A;  5HAR A;  1ERQ A;  3EGD C;  1H8Z A;  2WZZ A;  3BFF A;  3T1S A;  2ZMV A;  3NC8 A;  1MWR A;  3QP2 A;  3KSG A;  4PM5 A;  1D06 A;  2YKH A;  1CI9 A;  2V8C A;  3IF6 B;  3PBS A;  5TFQ A;  3BLM A;  2Y91 A;  1MXO A;  1FR1 A;  4MNR A;  3ZHH A;  3CWF A;  5J4E A;  1FQG A;  3HUM A;  1RGY A;  3E2K A;  1P0Z A;  1IKI A;  2GJ3 A;  1TVF A;  1EI5 A;  5DFX A;  1FCM A;  3LIC A;  4EQ1 A;  5HWT A;  4X6T A;  1RP5 A;  5CTN A;  3IXG A;  4WEL A;  4GDN A;  4OQI A;  3HL9 A;  3DTK A;  3MXS A;  1W79 A;  3HBR A;  1J3W A;  2ZC3 B;  4E3I A;  1LL8 A;  2HJ9 C;  3W2Z A;  1D7E A;  4KEN B;  4K0X A;  4S2J A;  3IH8 A;  3QNC A;  3PBO A;  3QP6 A;  1TD5 A;  2B02 A;  3WRT A;  2V20 A;  4BMW A;  3S7Q A;  2UWX A;  4GZB A;  2PHY A;  5IS1 A;  2WKQ A;  3E4P A;  4RX2 A;  2IWD A;  1BZA A;  3L7H A;  2INW A;  4JGR A;  2JN7 A;  2HV1 A;  2X71 A;  4RA7 A;  5HL6 A;  3C7V A;  5EE8 A;  2Z2M B;  5HPF A;  4MBH A;  2EXB A;  4KZA A;  4KG6 A;  2K7S A;  1GSX A;  2PAV P;  4U0X A;  5KSC A;  1TS7 A;  3MXR A;  2JKR I;  4QPR A;  1K56 A;  3NOP C;  4S2K A;  4JKT A;  1OME A;  2VKS A;  1WE4 A;  3NUL A;  1ODV A;  1SZV A;  3RTY A;  4NXG A;  3W8K A;  4DE2 A;  3TW8 A;  4KZB A;  4LRX C;  2W0N A;  3T4L A;  3HJI A;  5DJT A;  1JVJ A;  4GD6 A;  5GLB A;  4P6Z M;  4I3A A;  2A3U A;  2ZMA A;  3RH8 B;  3NOU C;  5HD5 A;  3VOZ A;  3ZGA B;  3OCL A;  4PM8 A;  2JKT I;  3A3J A;  2Z6D A;  3MQO A;  3EEH A;  1E4D A;  4Y0O A;  1S0W A;  4R3J A;  3FPW A;  3C4P A;  5A93 A;  3MR0 A;  2D02 A;  3VE4 A;  2EA9 A;  4MBF A;  4E04 A;  4WMC A;  4DE0 A;  3VFF A;  5TJJ A;  1K25 A;  1SDN A;  4NXB A;  1N9O A;  3V3S A;  3N7W A;  4Y5F A;  5CHJ A;  4S2N A;  4CLC C;  1OPX A;  3GV9 A;  2Y2I A;  3GR2 A;  1LHY A;  2M7V A;  5KZH A;  2JC7 A;  1X0O A;  2OLV A;  4I5S A;  1PW1 A;  4FH2 A;  4E3M A;  1JWP A;  3HUO A;  4F3L B;  1KVM A;  2WKH A;  4G3K A;  4IVK A;  4KUK A;  2KLI A;  3LIA A;  2AVX A;  4X55 A;  4KZ9 A;  1VM1 A;  3VFH A;  5DF8 A;  1SHV A;  4MEZ A;  1K6S A;  5DVA A;  3ULF A;  3T4O A;  4X56 A;  1CQA A;  3AGE A;  3IHA A;  4KZ8 A;  4HP4 A;  1K4E A;  3IQA A;  5M1A A;  2ZM2 A;  1GSV A;  4FTX A;  5HAI A;  3ZQ5 A;  3EEA A;  3EQV A;  2XD1 A;  3M6B A;  1PWD A;  3A3E A;  4FSF A;  5G4Z A;  2GNX A;  4HNB A;  2IWB A;  4OQ0 A;  4FD8 A;  1TF1 A;  2VGL S;  2ZC4 B;  4I38 A;  3VMA A;  5L09 A;  2BLS A;  1IEM A;  3F1N A;  1Y4O A;  3HJK A;  1CEG A;  2Z2L B;  2VA0 A;  4WBG A;  4BQM A;  4KQD A;  2V9A A;  3IF6 C;  3IWO A;  1XGJ A;  1OTI A;  4ZJ2 A;  1YMS A;  2OAP 1;  3LFV A;  3T4J A;  4DDS A;  1YKD A;  3HLG A;  2VV7 A;  2W1R A;  4G3V A;  1BLC A;  1OT9 A;  4WEJ A;  1IYQ A;  5EPH A;  4EXO A;  3ZDJ A;  3C7U A;  3IXH A;  3MZD A;  2I9V A;  4JXW A;  5KIZ A;  4EUV A;  2OWJ A;  2W3H A;  2O9B A;  5TBM A;  4LRY C;  4S2I A;  4Q8I A;  3E4O A;  3HLF A;  4MDZ A;  5FEG A;  1NZO A;  3RXW A;  1QME A;  2V1Z A;  1YLJ A;  1H0M A;  2JKR M;  3PBN A;  4D2O A;  4EBP A;  3Q07 A;  5J8X A;  4HEF A;  5FSR A;  3QP5 A;  3BEB A;  2FH5 A;  3PBQ A;  2ZQC A;  1TDG A;  5CEC A;  3PHY A;  1ZTU A;  3BQA A;  4R1G A;  4RVA A;  3HLE A;  2WAF A;  4XT2 A;  5AVF A;  3A0S A;  1NZU A;  1FSY A;  2NUP C;  4G3W A;  2WAE A;  4RQ9 A;  3F1P A;  1S1Y A;  5EOE A;  5GLC A;  3OLO A;  3LR0 A;  1E3U A;  4PHT A;  2JKT M;  1TS0 A;  4XXR A;  1LL9 A;  1HLU P;  3L9K A;  1NXY A;  1SDE A;  2JKG A;  1J9M A;  4WZ5 A;  4QY6 A;  2R9X A;  3LIE A;  5F1F A;  1XPB A;  3LEQ A;  1LSX A;  1FIL A;  2QJ7 A;  3S1Y A;  3ZYT A;  5D3O A;  3G2Y A;  2IWC A;  1XGI A;  1MY8 A;  2XSS A;  1PWC A;  4N1H A;  1YAX A;  2J8Y A;  1PZP A;  3TG9 A;  2DMW A;  1LSW A;  2LB5 A;  3LYX A;  1T1C A;  3PR6 A;  3BM6 A;  2WKI A;  2G7U A;  4ZJ1 A;  5L10 A;  4DJ2 A;  5DJU A;  3OOV A;  3GQZ A;  3SH7 A;  3FKV A;  3RJU A;  2WAD A;  5CTM A;  4GD8 A;  1T19 A;  3K2N A;  4L0L A;  1XFQ A;  1H3Q A;  2ZL1 A;  1G6A A;  5AQ9 A;  1VET A;  2H0Y A;  3LR5 A;  3C4O A;  3HUN A;  1DJB A;  3CI6 A;  3BFD A;  3N8S A;  3FZC A;  4R23 A;  2JKF A;  3OZH A;  2QPN A;  1FIK A;  3CG5 A;  3C30 A;  2I72 A;  5E2E A;  1IKG A;  2EX6 A;  3MQQ A;  4EV4 A;  1UGU A;  3SH8 A;  4KZ7 A;  5CRF A;  3LY3 A;  4X1L A;  3KYE A;  5HSQ A;  4NEE D;  1DRM A;  4ZJ3 A;  1ESU A;  5FDS A;  5HDD A;  2O0Y A;  1S1Z A;  2Q0O A;  4GDB A;  3UDI A;  3IT9 A;  3S7N A;  3RFB A;  3ZG0 A;  4DDY A;  1OJ5 A;  1GHI A;  3A3F A;  3BLS A;  3U2A A;  1KE3 A;  5CGX A;  1DJA A;  3MZE A;  4WUJ A;  3MZF A;  4FUW A;  1V9Y A;  3UE6 A;  4MBK A;  2Q9M A;  1CF0 A;  2M7U A;  2HF6 A;  2KOI A;  3BFG A;  1HTZ A;  2HP5 A;  3IX3 A;  2H28 A;  2WGI A;  2QMI A;  1NYM A;  3G30 A;  2Y2N A;  3BYD A;  2ZC7 A;  3UNW A;  4GW9 A;  1EW0 A;  1ERM A;  3O87 A;  3A0R A;  4B88 A;  4JPM A;  2WGV A;  2XFS A;  5EVI D;  1OJG A;  1LLB A;  4K91 A;  1YPR A;  4LEN A;  5TGF A;  1YSP A;  2PR5 A;  3F1N B;  3KO6 A;  1DP9 A;  4E3N A;  2ZMF A;  4IBR A;  1L2S A;  4QY5 A;  3UB7 A;  4IVI A;  2ZOI A;  3VP0 A;  4HES A;  4Y7P A;  4Y0T A;  4HQA A;  3G35 A;  3I7J A;  4NXE A;  4O0P A;  5MC7 A;  4HBT A;  4HJ6 A;  1N9L A;  2QYB A;  3PAG A;  4NXF A;  2VV6 A;  4P6Z S;  5J3W A;  1S66 L;  5FDH A;  3D72 A;  2BAS A;  5LBR A;  1L0F A;  5TBM B;  1C3B A;  5IHV A;  4BEN A;  2WKR A;  3IF5 A;  2VJW A;  4Q0J A;  5HL1 A;  4H6J B;  2PD8 A;  1PRQ A;  2V8F A;  5F1G A;  3SOI A;  1KE4 A;  1K57 A;  3PBR A;  1K6R A;  2OAQ 1;  4KZ4 A;  3G2Z A;  4IJG A;  1M40 A;  2FFY A;  4ESP A;  2PT7 A;  1K54 A;  3BQ8 A;  2XEP A;  3TSG A;  1OTA A;  3GVB A;  4LV0 A;  2JCH A;  1ZG6 A;  4OPZ A;  3ZFZ A;  4QB8 A;  5KSH A;  2M1C A;  2QKP A;  3UDF A;  3S4X A;  3N4I A;  1JWV A;  1TS8 A;  4S2M A;  4XT2 B;  3K3D A;  4GLQ A;  4MN7 A;  5FEF A;  2OOL A;  4E3L A;  3F1P B;  5HPI A;  4HHD A;  3K3C A;  4P0M A;  3SS4 A;  2HDS A;  2B95 A;  4L9E A;  5F69 A;  4JF6 A;  2Y2J A;  2H5S A;  2XRO A;  1ESI A;  5AQB A;  4JBF A;  3UMD A;  3G6O A;  4OLG A;  5FQM A;  4BLM A;  2ZQ9 A;  1P9R A;  2V0W A;  4XUZ A;  1L0D A;  1W8Q A;  3E2L A;  3HLB A;  4MCW A;  2CC1 A;  3MSH A;  4KQO A;  1Y54 A;  4HY8 A;  4S2P A;  1Y28 A;  3VE3 A;  5HDC A;  4IUK A;  5CGS A;  1YLW A;  5HX9 A;  5FQI A;  5A91 A;  5I94 A;  4DJ3 A;  2ZM0 A;  5L07 A;  4GHI A;  5FQK A;  2PRF A;  3ZG5 A;  4QU3 A;  5A92 A;  1PI4 A;  2PR6 A;  5M19 A;  1LI0 A;  1STZ A;  4N9K A;  3LUQ A;  4LCM A;  4HBU A;  2EWV A;  1ZC2 A;  2ZL1 B;  4JGP A;  1V9Z A;  4B4Z A;  3ZG9 B;  3HVF A;  1VET B;  1GA9 A;  5CHM A;  2VGJ A;  4LCL A;  1WYC A;  4DXC A;  1XX2 A;  3BEC A;  4HJ3 A;  3ZVW A;  5KMW A;  4Q0H A;  4GS9 A;  3MS6 A;  1SKO A;  4EET B;  1IOU A;  2PU2 A;  3ZNT A;  4RYE A;  4JGQ A;  2WKE A;  3CLO A;  4S2N C;  3IHB A;  3IWQ A;  4H8R A;  1S4R A;  3PTE A;  2Y2P A;  4R4R A;  2G2U A;  3B33 A;  2VGK A;  4E3K A;  2HP6 A;  4HI4 A;  3FPV A;  2K2N A;  1H8M A;  3V50 A;  2P04 A;  3IBJ A;  3D4F A;  1N4O A;  5GL9 A;  3LR3 A;  1HD8 A;  3JVV A;  3UPP A;  3SS5 A;  1ONH A;  4C3Q A;  3CJM A;  2VV8 A;  2XK1 A;  3BY9 A;  3D3O A;  1W8Y A;  3ITB A;  3VOY A;  1BUL A;  1I2W A;  1UWN X;  1W5D A;  3ICY A;  1BSG A;  5FQQ A;  3C38 A;  2PYR A;  3ZCZ A;  3ZG8 B;  4HJ4 A;  2B18 A;  4FH4 A;  1NY0 A;  3DW0 A;  5J7E A;  1VB6 A;  2L0W A;  1F2K A;  3CAX A;  3LID A;  4MN6 A;  2VLG A;  1BUE A;  2HP9 A;  3CIT A;  3GRJ A;  1W63 Q;  2ACG A;  4UA9 A;  5CX7 A;  3BWL A;  1ONG A;  1T18 A;  1O07 A;  3LR4 A;  2XFT A;  4JLF A;  1K56 D;  1BYW A;  4UA7 A;  3HCY A;  3M2K A;  1U60 A;  3BFC A;  4D60 A;  4CPK A;  4KQQ A;  1ACF A;  4BWI A;  4NKP A;  4DRT A;  4KG5 A;  3FKW A;  1JTG A;  3FC7 A;  3QNB A;  4HP9 A;  3IBR A;  2Y2M A;  4OH0 A;  1ES5 A;  5FI2 A;  2L4R A;  1IFQ A;  2GZA A;  4P87 A;  3V67 A;  4ARZ A;  4DXB A;  1NRJ A;  4NK3 A;  2ZBB A;  3DBA A;  3VP3 A;  4S2L A;  4O7D A;  3MFX A;  2XLN A;  2JE5 A;  3KYQ A;  5FQ9 A;  3UN7 A;  4UHU A;  4EW7 A;  1LSV A;  4OOY A;  4WYY A;  1YLY A;  1YSQ A;  5HZH A;  3NBL A;  3Q82 A;  2KDK A;  1IYP A;  2WUQ A;  3W4O A;  4NET A;  3GSG A;  5E2F A;  2V2F F;  2UV0 E;  5DF9 A;  4WMC D;  3PYP A;  3GTC A;  4EBL A;  2VX8 A;  1F5M A;  3V39 A;  4H6J A;  2HPB A;  3UO9 A;  3T1X A;  1AXB A;  3EQU A;  4FCF A;  1KGE A;  1KOU A;  3MMH A;  4PM6 A;  4M4X A;  1I2S A;  2V0U A;  4PAU A;  1KDW A;  3MXQ A;  3OPH A;  4Y3I A;  3T12 B;  1ES4 A;  2J3T C;  4OON A;  3SS3 A;  1TS6 A;  5GHZ A;  1NRF A;  4LPZ A;  3ITA A;  1HZO A;  3WWX A;  4ETZ A;  2W3G A;  4JF5 A;  2GDN A;  4CLC D;  4WZ5 C;  4GHI B;  3KX0 X;  5F82 A;  3HLW A;  4NG2 A;  5F83 A;  3NY4 A;  1ES3 A;  3CUE C;  3P09 A;  2EX9 A;  2BG1 A;  1GHP A;  2LB9 A;  2P7J A;  2V1A A;  3MQ0 A;  1BT5 A;  1LT0 A;  1CI8 A;  3T4T A;  4PKY A;  5FI6 A;  3FV7 A;  4XUX A;  2A2L A;  4EES A;  3OPL A;  2XA7 M;  1EWZ A;  4GS9 B;  1YLP A;  5HD3 A;  1SKO B;  3CUE A;  2XDM A;  3JYI A;  4Y0U A;  3U4L P;  1I5Q A;  4E6X A;  5EVI A;  2PU4 A;  2RL3 A;  4II7 A;  4Y2F A;  3UB5 P;  1BLP A;  2OV5 A;  4QHC A;  3CMZ A;  4UEY A;  4ZTK A;  5CER A;  2PYP A;  2ZLY A;  3MKE A;  5DF7 A;  3UB8 A;  3E4Q A;  3NDG A;  1YLZ A;  1VQQ A;  4LRZ E;  2WZX A;  2ZC5 B;  2WYX A;  5E2H A;  3DWZ A;  4X25 A;  4EQI A;  4JXV A;  4LV1 A;  2WK0 A;  3P7N A;  3UPN A;  4Q0I A;  5EVL A;  2QWS A;  3WS2 A;  1DP6 A;  4E3J A;  5L8M A;  3LO7 A;  4LFU A;  1O7E A;  4OPR A;  3V5M A;  2HJE A;  5FA7 A;  2O9C A;  1ZG4 A;  3HRE A;  4BJP A;  3O3V A;  3NHQ A;  4DE3 A;  2Y2L A;  3H7W A;  1CEF A;  2R9W A;  3P98 A;  4L9F A;  1P9W A;  4YFM A;  5FAQ A;  3VP4 A;  5CXW A;  1K55 A;  2O9A A;  1GA0 A;  1KGG A;  4EEP A;  3LI8 A;  4N9L A;  2EFX A;  2XGN A;  3CPT B;  5G18 A;  5F68 A;  4LV2 A;  4HOI A;  4IBX A;  3JPU A;  4LLO B;  5IT5 A;  2K31 A;  1G28 A;  4UAA A;  5GHY A;  2OLU A;  3TOI A;  3BW6 A;  5EUA A;  1NLY A;  1HVB A;  2J9O A;  4QWO A;  4BD1 A;  2W1T A;  1BLH A;  4QJG A;  1MWS A;  1FCO A;  1GHM A;  2HDQ A;  3D9Y A;  1MWU A;  4ARZ B;  3S7O A;  2X01 A;  4MMN A;  4R70 A;  1E25 A;  4R0Q A;  1YLT A;  3LI9 A;  5FI7 A;  3CZD A;  5I5L A;  2FZ0 A; 
#chains in the Genus database with same CATH homology
 1PI4 A;  3O86 A;  4S2O A;  5M1A A;  2ZM2 A;  1Q2P A;  1SKF A;  5CGW A;  5M19 A;  1LI0 A;  4N9K A;  5HAI A;  4LCM A;  3NCK A;  4HBU A;  3EQV A;  2Y2K A;  2ZD8 A;  2XD1 A;  1ES2 A;  3M6B A;  1ZC2 A;  1PWD A;  3A3E A;  4FSF A;  4B4Z A;  4IED A;  3ZG9 B;  3HVF A;  1GA9 A;  1K57 C;  2IWB A;  4OQ0 A;  5CHM A;  1ALQ A;  4FD8 A;  4X68 A;  2VGJ A;  4LCL A;  3LEZ A;  1WYC A;  4DXC A;  3DTM A;  1XX2 A;  2ZC4 B;  3BEC A;  1FR6 A;  3ZVW A;  5EEC A;  1MBL A;  5KMW A;  3IXD A;  1L0G A;  3N6I A;  1PIO A;  2XF3 A;  1KDS A;  1K54 C;  3MBZ A;  4JXS A;  3VMA A;  4X69 A;  3AGF A;  2BLS A;  3VSK A;  4EUZ A;  3ZG5 A;  1IEM A;  5HAQ A;  2PU2 A;  1CEG A;  1K55 C;  3ZNT A;  4RYE A;  1XKZ A;  1YMX A;  2Z2L B;  5U47 A;  2WKE A;  2P9V B;  4WBG A;  2HDR A;  4BQM A;  5FAO A;  4S2N C;  4P6B A;  3IHB A;  3IF6 C;  3IWO A;  1XGJ A;  3HLC A;  5E2G A;  4ZJ2 A;  1YMS A;  4P85 A;  4LV3 A;  3IWQ A;  3UDX A;  2B5R A;  1FOF A;  1YQS A;  4DDS A;  4H8R A;  2DRW A;  3HLG A;  4WEJ A;  1BLC A;  2G2W A;  1IYQ A;  5EPH A;  4X53 A;  3ZG7 B;  4E3O A;  3PTE A;  3ZDJ A;  3C7U A;  1MPL A;  2Y2P A;  3IXH A;  4R4R A;  3IWI A;  3MZD A;  4KG2 A;  2G2U A;  2ZQ8 A;  2VGK A;  4E3K A;  3S22 A;  2HP6 A;  1IYO A;  1QMF A;  2ZQD A;  4JXW A;  4M3K A;  3V50 A;  2J7V A;  4MLL A;  2EXA A;  3ISG A;  5EOO A;  5CHU A;  3Q7Z A;  3D4F A;  5FAT A;  3UY6 A;  4R4S A;  1PWG A;  1N4O A;  4S2I A;  4Q8I A;  4OVD A;  3HLF A;  2Y2G A;  3VP1 A;  5GL9 A;  4PM9 A;  1NZO A;  4DF6 A;  3RXW A;  1QME A;  2V1Z A;  3M2J A;  5L2F A;  1HD8 A;  3UPP A;  5A90 A;  3SS5 A;  1ONH A;  4C3Q A;  3CJM A;  1YLJ A;  2P74 A;  2XK1 A;  3W4Q A;  4DKI A;  3PBN A;  4C6Y A;  5JYP A;  1BLS A;  1BTL A;  4UA6 A;  4D2O A;  1W8Y A;  1XP4 A;  3ITB A;  3VOY A;  4PMA A;  3Q07 A;  4EBP A;  1BUL A;  1I2W A;  2H10 A;  2XR0 A;  3QHY A;  5J8X A;  2C5W B;  5CED A;  4HEF A;  5FSR A;  3VP2 A;  1W5D A;  1MWT A;  2FFF B;  3A3I A;  1BSG A;  3BEB A;  5FQQ A;  2XH9 A;  5HW3 A;  5JYO A;  4RX3 A;  3Q81 A;  3PBQ A;  4QD4 A;  5FQJ A;  1PZO A;  2ZQC A;  1TDG A;  5CEC A;  2EX8 A;  4K0W A;  5EVI B;  3ZCZ A;  3ZG8 B;  4BD0 A;  4R1G A;  5DTK A;  4RVA A;  2Y2H A;  3HLE A;  3Q7V A;  2WAF A;  4OPY A;  1FSW A;  2Y4A A;  4FH4 A;  1NY0 A;  3DW0 A;  4GKU A;  5DTS A;  1E3U D;  1NZU A;  4GOG A;  4KQR A;  1FSY A;  2WGW A;  3ZVT A;  1JTD A;  2WAE A;  3C5A A;  3OPP A;  5GLA A;  1PYY A;  1BUE A;  1M6K A;  3G32 A;  1DY6 A;  4BL3 A;  2Y2Q A;  2HP9 A;  4PPR A;  5EOE A;  5GLC A;  3AGD A;  1NJ4 A;  3GRJ A;  2Y55 A;  3G31 A;  3NDE A;  1E3U A;  5FAP A;  3Q1F A;  2PBY A;  1XXM A;  3PAE A;  1LL9 A;  4XXR A;  2XD5 A;  2ZM8 A;  4UA9 A;  1ONG A;  3FWL A;  1NXY A;  1O07 A;  1SDE A;  4ZAM A;  4BL2 A;  3O88 A;  3W4P A;  2XFT A;  1Q2Q A;  1J9M A;  4JLF A;  4WZ5 A;  1K56 D;  4QY6 A;  2R9X A;  4UA7 A;  4YIN A;  5F1F A;  3OPR A;  1XPB A;  2C6W B;  3WRZ A;  1TDL A;  1KVL A;  5M18 A;  3M2K A;  1U60 A;  3BFC A;  3S1Y A;  3FYZ A;  3PBT A;  4CPK A;  5D3O A;  4KQQ A;  3G2Y A;  2IWC A;  4DRT A;  4KG5 A;  1XGI A;  1MY8 A;  1PWC A;  3FKW A;  1JTG A;  4ZBE A;  4N1H A;  3G34 A;  3QNB A;  4OLD A;  2Y2O A;  2J8Y A;  2Y2M A;  4OH0 A;  1ES5 A;  5FI2 A;  1KE0 A;  3NI9 A;  1PZP A;  4JF4 A;  1SCW A;  4U0T A;  2QZ6 A;  3LY4 A;  4P87 A;  3TG9 A;  4DXB A;  4NK3 A;  1IYS A;  4WZ4 A;  5HAR A;  3IXB A;  3BM6 A;  4S2L A;  3VP3 A;  4O7D A;  1ERQ A;  2WKI A;  1JWZ A;  2EFU A;  4ZJ1 A;  1H8Z A;  2WZZ A;  4OQH A;  2XLN A;  2JE5 A;  3ZNY A;  3BFF A;  3GQZ A;  3SH7 A;  5FQ9 A;  3UN7 A;  4UHU A;  3FKV A;  3RJU A;  2WAD A;  2Y59 A;  5CTM A;  1LL5 A;  4GD8 A;  5E43 A;  4OOY A;  4L0L A;  4WYY A;  3NC8 A;  1MWR A;  1YLY A;  4PM5 A;  3NBL A;  1CI9 A;  2Q9N A;  3IF6 B;  3PBS A;  1G6A A;  5AQ9 A;  5TFQ A;  3Q82 A;  2H0Y A;  3MKF A;  3BLM A;  2Y91 A;  1MXO A;  2DNS A;  3C4O A;  3HUN A;  1DJB A;  1FR1 A;  1IYP A;  1RGZ A;  2WUQ A;  3BFD A;  3N8S A;  4MNR A;  4NET A;  3W4O A;  3ZHH A;  3FZC A;  3GSG A;  5E2F A;  1MKI A;  2V2F F;  1Z6F A;  4R23 A;  5DF9 A;  3RXX A;  1FQG A;  4WMC D;  3OZH A;  2QPN A;  2JBF A;  3GTC A;  3HUM A;  4EBL A;  3CG5 A;  3E2K A;  4OOL A;  2I72 A;  5E2E A;  5CEB A;  1IKG A;  3IH9 A;  4OP5 A;  1G68 A;  2EX6 A;  1CK3 A;  1IKI A;  3V39 A;  4EV4 A;  1TVF A;  1EI5 A;  4OKP A;  1FCM A;  4JXG A;  3VSL A;  3SH8 A;  1K38 A;  2HPB A;  1K4F A;  4KZ7 A;  4X6T A;  5CRF A;  1RP5 A;  4KZ5 A;  5CTN A;  2J9P A;  2P9V A;  3IXG A;  4Z9Q A;  3V3R A;  3LY3 A;  1TEM A;  1AXB A;  4WEL A;  4U3T A;  3UO9 A;  3EQU A;  4GDN A;  4OQI A;  4ZJ3 A;  4FCF A;  1KGE A;  3HL9 A;  1ESU A;  5HAP A;  3UE3 A;  4PM6 A;  1I2S A;  4CJN A;  3MXS A;  1W79 A;  3HBR A;  2ZC3 B;  1KDW A;  4GDB A;  4E3I A;  1YM1 A;  3OPH A;  4PM7 A;  3UDI A;  3IT9 A;  1ES4 A;  4KEN B;  4OON A;  3SS3 A;  3ZG0 A;  4DDY A;  2WGW B;  1GHI A;  3A3F A;  3BLS A;  4K0X A;  1KE3 A;  5CGX A;  4S2J A;  5GHZ A;  1NRF A;  3IH8 A;  3ITA A;  1HZO A;  1DJA A;  3MZE A;  1NYY A;  3QNC A;  3WWX A;  2A49 A;  4JF5 A;  4DE1 A;  2GDN A;  3PBO A;  3MZF A;  4WZ5 C;  1XA1 A;  5F82 A;  3HLW A;  4MBK A;  4OOM A;  2Q9M A;  5F83 A;  3LCE A;  3NY4 A;  3WRT A;  2V20 A;  3BFG A;  1ES3 A;  1HTZ A;  3P09 A;  2HP5 A;  2UWX A;  4GZB A;  1KGF A;  2EX9 A;  2BG1 A;  1GHP A;  2WGI A;  2QMI A;  1NYM A;  4OP8 A;  4RX2 A;  3G30 A;  2Y2N A;  3BYD A;  1DJC A;  2IWD A;  4EBN A;  5GLD A;  2ZC7 A;  3B3X A;  3UNW A;  1BT5 A;  1BZA A;  1ERM A;  4KZ3 A;  3O87 A;  1CI8 A;  1N9B A;  1RCJ A;  4JPM A;  4B88 A;  2WGV A;  2XFS A;  5EVI D;  2X71 A;  4RA7 A;  2RCX A;  5FI6 A;  3FV7 A;  3C7V A;  5EE8 A;  2Z2M B;  2DCF A;  1LLB A;  4ID4 A;  4K91 A;  4LEN A;  4MBH A;  4XUX A;  3OPL A;  5TGF A;  2EXB A;  4KZA A;  4KG6 A;  4A5R A;  1EWZ A;  1YLP A;  5TR7 A;  3HLD A;  2XDM A;  5GHX A;  3JYI A;  4Y0U A;  1I5Q A;  1W7F A;  4U0X A;  3DWK A;  5KSC A;  4E6X A;  4E3N A;  5EVI A;  3MXR A;  1ERO A;  2PU4 A;  2RL3 A;  4IBR A;  4OQG A;  1BLP A;  1L2S A;  1K56 A;  1PW8 A;  4QY5 A;  4QHC A;  2OV5 A;  4S2K A;  4IVI A;  5HFO A;  4JKT A;  3VP0 A;  1OME A;  4N1X A;  5DTT A;  1WE4 A;  3CMZ A;  4HES A;  4Y7P A;  4ZTK A;  5CER A;  4Y0T A;  3WS5 A;  1S6R A;  3G35 A;  4GNU A;  2ZLY A;  3I7J A;  3MKE A;  4HBT A;  3W8K A;  4DE2 A;  4KZB A;  5DF7 A;  2ZQA A;  3PAG A;  3NDG A;  1YLZ A;  3WS1 A;  1VQQ A;  1ZKJ A;  1WYB A;  1JVJ A;  5AQA A;  4GD6 A;  5FDH A;  4GB7 A;  3UE0 A;  2WZX A;  2ZC5 B;  2WYX A;  4WM9 A;  5GLB A;  5E2H A;  3DWZ A;  3WS0 A;  2A3U A;  4JXV A;  1L0F A;  4EQI A;  5AQ7 A;  3NIA A;  2ZMA A;  4LV1 A;  2WK0 A;  3UPN A;  5EVL A;  1C3B A;  5IHV A;  3WS2 A;  4BEN A;  3IF5 A;  5HL1 A;  4ZDX A;  4E3J A;  1YT4 A;  3A3D A;  5F1G A;  3VOZ A;  3SOI A;  1KE4 A;  1FCN A;  4WEK A;  3OCL A;  2OSU A;  3ZGA B;  3MFD A;  1XA7 A;  4PM8 A;  3BRM A;  3GMW A;  4R3B A;  3A3J A;  1K57 A;  3LO7 A;  3PBR A;  1K6R A;  1O7E A;  4OPR A;  3V5M A;  4KZ4 A;  1E4D A;  3G2Z A;  4Y0O A;  5FA7 A;  1S0W A;  1M40 A;  4R3J A;  2FFY A;  2EX2 A;  4OPQ A;  3C4P A;  2E8I A;  5A93 A;  3M6H A;  1PI5 A;  1K54 A;  1ZG4 A;  3UPO A;  4MBF A;  3HRE A;  4BJP A;  4EWF A;  3O3V A;  3WS4 A;  2XEP A;  3TSG A;  4DE3 A;  2Y2L A;  3GVB A;  4LV0 A;  4WMC A;  2JCH A;  1ZG6 A;  1H5X A;  4OPZ A;  3VFF A;  3N8L A;  4C75 A;  4DE0 A;  3ZFZ A;  1CEF A;  2R9W A;  3P98 A;  4QB8 A;  5KSH A;  4YFM A;  5FAQ A;  3VP4 A;  5CXW A;  3S4X A;  3UDF A;  1K55 A;  1K25 A;  1GA0 A;  1JWV A;  1KGG A;  3N4I A;  1SDN A;  5FAS A;  4N92 A;  3Q7V B;  3V3S A;  4S2M A;  3N7W A;  1LI9 A;  5CHJ A;  4S2N A;  2H0T A;  2EFX A;  2XGN A;  3IF6 A;  4N9L A;  5G18 A;  2HDU A;  2Y2I A;  3GV9 A;  3BFE A;  3GR2 A;  1LHY A;  5KZH A;  5BOH A;  4LV2 A;  4E3L A;  2ZC6 B;  3SH9 A;  2JC7 A;  4IBX A;  4P0M A;  4F94 A;  3SS4 A;  2OLV A;  3UE1 A;  2HDS A;  1PW1 A;  4FH2 A;  4KZ6 A;  1GCE A;  4E3M A;  1JWP A;  3OC2 A;  4UAA A;  3HUO A;  5GHY A;  4JF6 A;  1KVM A;  2WKH A;  2Y2J A;  2H5S A;  2OLU A;  4IVK A;  1ESI A;  5AQB A;  3TOI A;  4JBF A;  5EVI C;  4OLG A;  5FQM A;  1IEL A;  4BLM A;  2ZQ9 A;  5EUA A;  4XUZ A;  1HVB A;  1L0D A;  1W8Q A;  4X55 A;  2J9O A;  4E6W A;  4GN2 A;  4KZ9 A;  1VM1 A;  3E2L A;  4BD1 A;  3VFH A;  3HLB A;  1BLH A;  4QJG A;  1MWS A;  3OCN A;  2CC1 A;  5DF8 A;  1SHV A;  4KQO A;  4MEZ A;  1FCO A;  1L0E A;  1Y54 A;  4S2P A;  2ZJ9 A;  1K6S A;  1GHM A;  1H8Y A;  2HDQ A;  2ZQ7 A;  5DVA A;  5CGS A;  1YLW A;  5HX9 A;  1MWU A;  5FQI A;  2X02 A;  4X56 A;  4B4X A;  5A91 A;  5I94 A;  2XQZ A;  3N8R A;  2X01 A;  2ZM0 A;  3AGE A;  3G4P A;  1E25 A;  3IHA A;  4R0Q A;  1YLT A;  4KZ8 A;  5FI7 A;  3CZD A;  5FQK A;  1K4E A;  1RGY A;  4QU3 A;  5A92 A;  3IQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...