4RW0A

Crystal structure of a member of the lipolytic protein g-d-s-l family from veillonella parvula dsm 2008
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
184
structure length
184
Chain Sequence
NAMEIICFGDSITRGYDVPYGRGWVEICDASIENVNFTNYGEDGCSVQGMIYNIENWAVTAVSDPTRHIFLMCGTNDILQGRDSTYVYKTLVKAIELASTKGMVIIGLETQIDSDMDGLDLVVREVNEQLKAYAAEHNIKVIDFYTTLFEADQIGQIVFAGEVHPNERGYRLMAYKALEVFTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a member of the lipolytic protein G-D-S-L family from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula dsm 2008
molecule tags Hydrolase
molecule keywords Lipolytic protein G-D-S-L family
total genus 66
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4rw0A00
2HSJA 3DT8A 4K9SA 1ESEA 5JD3A 4IYJA 1DEXA 4XVHA 1Z8HA 1JRLA 2WAOA 4PPYA 4JJ4A 3DT9A 2WABA 4OAPA 3W7VA 1YZFA 4NRDA 1VJGA 4DEVA 1K7CA 4LHSA 4HYQA 5A4AA 3P94A 2WAAA 1PP4A 1ESCA 4RW0A 4K3UA 4I8IA 2O14A 4HF7A 4TX1A 2APJA 3KVNA 3BZWA 4Q9AA 3U37A 1FXWF 3C1UA 1J00A 4H08A 2VPTA 1BWQA 5B5SA 2Q0QA 1DEOA 1ZMBA 1ES9A 3HP4A 1FXWA 3RJTA 3DCIA 4RSHA 2Q0SA 4JGGA 1ESDA 1BWPA 1BWRA 4JHLA 3SLRA 1U8UA 3MILA 4K7JA 1VYHA 4OAOA 3SKVA 4Q7QA 4JJ6A 5HOEA 4M8KA 3PT5A 3DC7A 4S1PA 1IVNA 1WABA 2W9XA 5BN1A 4K40A 4JKOA 3DT6A 5CD9A 1V2GA
chains in the Genus database with same CATH superfamily
3LBFA 4KGDA 1ZMOA 2ZYVX 4COKA 2D2XA 1KI9A 2MMGA 2R48A 4JL6A 3VNRA 5IBQA 1N5RA 1X80B 3AUUA 3IVCA 1UPUA 1UKVY 2JD1A 1K7YA 2W2KB 4A7PA 1NA5A 3V8EA 2WSSD 1ZN7A 3T4XA 4QGHA 4DZZA 2BY4A 3KSUA 1WZNA 1W2WB 4Y6GB 4I5GA 1D2MA 1H0KA 1QCDA 1Z17A 1PG2A 2ZIXB 3IP3A 4RJLA 1TOAA 5ECDA 3GEIA 5IHPA 1GTJ1 3BUSA 4LVUA 4XX0A 4ZZ0A 3JASB 6REQB 1Y8CA 4MVYA 4QQKA 4XPZA 5D6OA 3QKRA 1XIVA 4EHKA 2IZZA 2HCJB 5CT8A 2IU3A 1W0CA 3O1LA 4R6WA 1QHHB 1B1AA 3LNTA 3WNQA 4W9NC 1RBYA 4LEIA 4ZEMA 3WLSA 2HF8A 1FTWA 2CVPA 2YWDA 1C0EA 5ALMA 5DW0A 3RS0A 3K70D 1YMUA 3BWMA 1XZ8A 3IDOA 5CEFA 3DHYA 4EO9A 2QTTA 4CMEA 4Y2HA 3ED5A 1QHGA 1Z2DA 2HK9A 3GRYA 3L43A 5K3BA 3VPGA 1W1WA 5B1EA 3IEMA 2DHEA 3C15C 3CT4A 3LY9A 4OG2A 4AIIA 5TS3A 4BAGA 4WNCA 1QYVA 4PNZA 3DV0B 3SC3A 1N33B 5AHWA 1R0SA 4NEHB 4OBXA 4Q4AA 4FWTA 1XYYA 1A72A 1JT9A 3TOVA 3LSTA 3TR6A 5AW9A 4IIJA 5JHHB 3ELBA 3V8RA 3DLTA 1AUXA 2VNHA 3MYRA 4R1NA 4V2UA 1UDBA 4D8UA 2GXAA 1NBOA 1U8XX 2A0YA 2X0RA 1Y1PA 4XQ0A 2JLYA 1UBEA 1I4OA 3AJ8A 2ZJ3A 3BWYA 4H08A 4MS1A 2Z58A 2X23A 1JL3A 5C31A 5KOYA 1TCUA 2QQFA 3SX0A 1GL9B 5LOVA 2H2DA 2JLBA 5BR7A 1U2RA 2X3UA 3D8RA 2FNAA 2F3SA 2I3GA 2ID8A 4EATA 4N6GA 3OIVA 1NMEA 4Z8YA 4J0FA 1YWGO 4NP6A 4KE6A 4OHBA 1YV9A 5ALIA 4LDAA 5THQA 4AROA 1E7WA 2YOGA 1IG0A 3ZHQA 5LQDA 5D5QA 2R85A 3NIDB 1AMNA 1D03A 2I80A 1E9EA 3QPCA 4GIBA 4MPJA 1N6PA 3F78A 1H0HA 2R8RA 3P96A 4HDNB 4R01A 5CTAA 3UN1A 5COBA 3WBBA 2HY7A 1NFQA 3SQDA 2VAXA 4EWLA 2K7FA 3FHJA 1YS1X 1Z6PA 2PZJA 4CLEA 1WV1A 2H8KA 4KXWA 3O2QB 4M7PA 4OK6A 5G4KB 2TECE 1MA3A 1QGAA 1A71A 3CISA 1OB5A 2X58A 3A1DA 2IDMA 4CWAA 4YVFA 3VVBA 4D9CA 1IWPB 3WIDA 1BDMA 2PCLA 1D1PA 4KWIA 5EQTA 1Y8QB 3UMJA 4V0RA 3GFBA 1FLDA 4IIHA 5K4HA 3KOUA 1V35A 1J2TA 4TKMA 1T26A 4TLAA 1G16A 4BNHA 5E3JA 3U7GA 4M86A 1C0PA 4B4UA 2GAAA 4JEIA 4EUHA 3IKMB 2X8JA 1GLVA 4FMDF 1Z6ZA 5CB4A 2ZSUA 4ZJPA 5CT5A 1QONA 2FYTA 2IUEA 4EI9A 1LKZA 1BN6A 1TU0A 2QTBA 1UFQA 2ATXA 3EGDB 3HA2A 4X7BA 3EC1A 1Y6FA 3CWZA 3T5DA 3NOVA 1JAHA 2CWWA 3OZFA 4GUDA 2G63A 5DM2A 5JW6A 4GPZA 3MOSA 1Z6XA 3E0XA 3U80A 4DCGA 2BISA 3MCWA 2MYTA 5H02A 4F38A 1QAMA 4LJRA 1CQJA 4NAVA 2H2WA 3QY9A 1TA9A 3R3XA 4LYJA 2ODEA 3TEJA 3GRZA 4BKMA 3OLVA 4MV3A 1IXSB 1EINA 4K9LA 4LZZA 4PC3A 1GADO 2ZR8A 4OAQA 5FKJA 1MFPA 3SIRA 4YRGA 3H5TA 4LF4B 3UJNA 4MYRA 1E2BA 4EY8A 3KYBA 2NO4A 4R1UA 1YGPA 5A4FS 3ZX5A 4DUYB 3VR0A 2B5WA 1Z6GA 3ZEIA 2Y1EA 4MJXA 1O3YA 2H59A 1XQ6A 4XD2A 2P40A 4D0RA 3E61A 3IA7A 1T2UA 1YI8A 4MCHA 3DZ8A 4Q3OA 2WT4A 1QZXA 2HBQA 1PEDA 2HHJA 2HLDD 2IEBA 1ZXBA 2DUNA 2NO0A 2PGNA 1IZZA 2IHYA 3D0RA 3H5OA 4WWHA 5ALVA 4AY6A 1YU9A 1C4WA 1T8PA 1BFUA 3DNPA 5JG7A 3Q3EA 1I1OA 5ALOA 4EPTA 4NXNB 2JHAA 3COSA 3SSOA 3MRTA 2LKCA 5HJEA 4FDMA 5IYZF 2NV2B 4BWFB 2RBEA 1Q0LA 4BB6A 1S2IA 1E2MA 1QGOA 1QH1B 3T52A 1BC5A 1Y9EA 3ZXYA 1VIDA 1K8ZB 2D13A 3I12A 1L8QA 3MTDA 4A03A 1WXEA 1X8XA 1R9JA 4CF7A 4KR2A 1ZRSA 5HMLA 4MUXA 4IEEA 1RU3A 3TBHA 3ZGVA 5M04A 2Y0BA 2BFCA 3PGVA 3F3YA 1XI2A 4HDKA 1UC8A 1WKCA 4BDSA 3IAS6 2WIFA 5CNMA 2B3TA 2PFKA 3QTLA 4IFIA 3BZWA 3DR3A 4N6OA 4E09A 3TKLA 2Y27A 5M34A 4II3A 2R6ZA 1BXKA 1LDGA 4NOJA 4AJPA 5A4IS 4ZCRA 1UT6A 1N7JA 2XBLA 3IQIX 1WVIA 3R1IA 1GHTA 1GA1A 1E99A 2D1FA 1GKYA 8OHMA 3SJUA 3JAKB 4EI8A 1Y7IA 2QL5A 5A3SA 4MQUA 5EXXA 3DKVA 3T5MA 4AJ9A 2EBHX 1BH2A 4FUQA 1GPYA 4YHHB 4V3BA 1Q17A 5HA5A 5DNUA 4ZQFA 2BEKA 2FMIA 1IY8A 1CB0A 1KZ1A 1L7OA 1PTJC 4B79A 4HAUA 2GKSA 1M74A 1JTFA 2QAJA 1WTCA 3UV6A 1I6WA 3VVMA 3L0YA 2XXAA 4PN7A 5FT9A 3KU1A 3RADC 4WT7A 4HQLA 2ROQA 2HLPA 3DO5A 1OI2A 1R4MA 2MOKA 1IBRA 2X13A 3BBPA 5EJFA 3EZXA 2XTAA 4KN8A 4AUMA 4DM4A 1V25A 1JEJA 4JLPA 1L1QA 5FTJA 3WLIA 4BYGA 2AN9A 2J4FA 2MHCA 3OVMA 1EP3B 3FMVA 2LD4A 2VOJA 4YGXB 5BQXA 4R51A 2NPFA 2D8MA 3IDZA 3LVFO 1WF6A 4KBFA 4IW3B 4CV0A 4QM6A 3MS2A 4GI3A 3A6PC 4JBGA 5FFNA 1WP4A 1QVZA 1WX1A 1AKWA 1X6VA 1XTPA 2IX9A 2K87A 3JY6A 3A4NA 1MO4A 3C14C 3RQIA 3KNZA 4B3IA 3F74A 3K9NA 1RIIA 5DHRA 3WDKA 1LRLA 4FFBB 2OD9A 3HCFA 1V4NA 4HMQA 4BKRA 1L5VA 1CEYA 2Q49A 2WYHA 3TE6A 1QC5B 4FOLA 3AC0A 1NKTA 4IZOA 3NDRA 3ZWOA 4L74A 3U19A 1V95A 3L8FA 2EG9A 4Z99A 5KU1A 1BSVA 3O8LA 2OOSA 2HCFA 3NIBA 4IP0A 4DJTA 4UPEA 2AFIB 4LBWA 5LJLA 1RPZA 5K0CA 4DJAA 4B3CA 4ABYA 1KBQA 5ER6A 2HSJA 4KTTE 3VH1A 5HILA 2VTVA 3QBVA 4DB2A 4RQTA 4MWCA 3NIFB 4XYBA 1S3SA 5DIZA 4CTOA 3QLUA 4NESA 2X2PA 4V02A 4DT1B 1XAHA 2O6HA 4LWPA 1Q1NA 1R4AA 2FPLA 5KX5B 2ZVDA 5HQTA 4LMBA 5IFLA 1W9HA 1G7RA 5FA6A 4P9NA 3ASZA 1DVRA 2BGNA 1QHNA 1RC1A 2I8LA 4WASA 1Q0UA 2P9CA 1YTLA 2FZ5A 4X45A 4UU0A 3UG7A 2WFAA 1SQSA 3ACDA 4Q9NA 4HWRA 3AWDA 3K0KA 3MUFA 3VYTB 1VJ1A 1GQ2A 2AOXA 1TF2A 1IJBA 2Q41A 2XCRB 3GLVA 4LUCA 4CLRA 1E3JA 3LX8A 3ZY5A 2H2IA 1JKJA 3G5MA 3RAEC 4ZOQI 1WP9A 2BEVB 3S3TA 4DA0A 3ESAA 4ID3A 3E05A 2J48A 1SVMA 2YVAA 3AJRA 4OQMA 4J6FA 4R1PA 5EHXA 3VPHA 5KVQA 2B4YA 5LQRA 2PQ6A 3TJMA 5TQ2B 2VDOB 1MW9X 3OX1A 4GMDA 1KEKA 4JKIA 2RB5A 4P31A 3SMQA 1C9YA 2VBFA 1O57A 3A9WA 1I32A 3H8VA 3BMNA 2MTBA 4YRLA 1SC1A 5EZ6B 3T8YA 4BQQA 3M4XA 3IQGX 1UEXC 4EKDA 1JXQA 3R41A 2AFVA 3RVMA 2OFPA 3ELDA 3LUBA 4LV8B 5HDQA 1F12A 2QYTA 5LP6F 3A10A 4ARSA 5EIFA 4MHTA 4F91B 4HQ6A 1V8BA 3IVGA 4RFVA 3T4EA 3VI3B 4XWKA 4RL4A 4REQA 4QG7A 4QRDA 3O7WA 3RS8A 4WESB 4YN3A 3C3KA 4J4HA 5AVVA 4N8DA 1G38A 2Q1SA 4DIDA 1EWTA 4G4JA 1A7KA 1MEJA 4HQRA 3W8DA 3RC8A 4ARAA 2IE0A 3I8OA 3IOYA 3VR5H 5JDIA 3O8CA 5E2BA 1OVMA 1JHPA 4P1ZA 4KYUA 5H3HA 1MTZA 1Y7PA 2OBBA 1B23P 1YRAA 3CYFA 4Z7NB 1QORA 2LBPA 1PJ3A 1XK6A 4IS2A 2ZWVA 5F3DA 3SN6A 3UAGA 2PUDA 5E8JA 4H77A 1FP2A 5LC1A 4ZI5A 1VL1A 4BTEA 5CB0A 2D3TA 4F4DA 3QLJA 1XQXA 2QTLA 2WM3A 4ROTA 3PWTA 3LTEA 2ZREA 3LO8A 2ZFUA 3GC6A 3S44A 2GPWA 4BNJA 5JXHA 2CK3D 3KYCA 1E20A 3L79A 1RJ9B 2CHQA 2AN1A 3R4VA 4MZXA 4YCCA 4ZVOA 1LVUA 4J3FA 1IAVA 3MUOA 5AVQA 4OLAA 3KOOA 1TT5A 2HTEA 2WJVA 3E4CA 3E9RA 3FLAA 1H0SA 2XI4A 5BOSB 3PKJA 5F52A 4E94A 3DBHA 3GYGA 1TYCA 2NXWA 3MWYW 1C4KA 4LBVA 1U4OA 4R0VA 3EYWA 4UE6A 3TOSA 2WUWE 4ZQEA 2QE6A 1DIOB 2J6BA 3DTTA 4GQAA 1DIHA 3JTEA 5KVAA 2IUYA 5IBRA 4B31A 2RGWA 1HDRA 4M7WA 1K27A 3HKEB 3DZCA 2VAMA 2VA9A 4Z5XA 1INLA 3CUSA 1ZCFA 3HYRA 1H2FA 4ARIA 4M0CA 5FUBA 2FMFA 1LK7A 2IPXA 3DW3X 3P9SA 4OJQA 4XIIA 3R5XA 1BXRB 1ADBA 3H2YA 3JATA 3M6LA 3FFBA 4RY2A 3T6KA 1XJCA 3CVOA 1KZGB 3NTOA 5GONF 4JXKA 1OXBB 4EB6A 1B26A 1NVBA 4HRYA 4MQMA 2GBPA 3C24A 3OZVA 1WAMA 3IR5A 3WZLA 1Q7CA 5G4LA 3L0SA 3PNMA 3BH0A 2ASVA 3ZNQA 1E2JA 3HN6A 2DPGA 3WKDA 2PJRA 1KKMA 2VQDA 4WK0B 5CVEA 1EESA 1U7HA 3ZYZA 1N2SA 3MJHA 3CZCA 1CJBA 1QF9A 1UPBA 3MTEA 1AU9A 3PYXA 3Q3VA 1TUIA 4TL7A 3RKSA 4OI4A 4B6PA 1WXXA 4QUBA 3SBOA 1V11A 5GV8A 1N7IA 4UEOA 2ZDQA 1US8B 3NNDA 2QV7A 4G4IA 2H4ZA 1PRYA 3HVUA 4LJ6A 1IQRA 1V11B 3IGFA 2WB4A 2A30A 4PR0A 1QQAA 5KSPA 1BQEA 3TLXA 3OF3A 4K26A 3AHDA 2EJTA 1JG2A 1R88A 1QIFA 2QYHA 3EMDA 3ONVA 3FTDA 3H83A 5TR9A 3TBFA 2VSXA 3O7MA 1CC1S 3EPKA 3BSYA 4WBSA 1PSZA 1WWKA 1YA6A 2FKAA 4IIFA 4XA8A 3PFNA 1YBFA 4PQGA 4DUGD 1HYHA 1OZ0A 1T43A 4HVCA 4X90A 4MJ7A 4DY4A 3R09A 4JI2B 1ADJA 1JIJA 4O4JB 4OUDA 4ZT7A 1XZNA 1O5TA 3EGOA 1UPAA 5T4FA 4DEYA 5CEEA 1P4SA 1V39A 3Q3IA 3AV3A 3WL5A 3KKNA 1B15A 2YZMA 2CHEA 3NV7A 4KG7A 1I6KA 3QJYA 1E1RD 3RIYA 1PR2A 3EGIA 2VF8A 4N82A 1VM6A 1XU9A 5GJVC 3WVNA 5B5SA 1JU4A 5E7IA 5DCWA 3K9FC 1GQOA 4DDUA 1M1NB 1ODCA 3F1LA 4Z7OB 4RZHA 4HVAA 3P9IA 3S5JA 3WK4A 3OICA 5EHQA 2JGDA 2R4TA 3AR3A 2Q6LA 2KBFA 2QP4A 4WACA 2C9OA 4Y2JA 2PHZA 1O77A 1F5NA 4DILA 1PJAA 2PK3A 3FNBA 1FK8A 3EA0A 1WBDA 3TD6A 4C89A 2J59A 1P7CA 3ILHA 2WHYA 2Q3JA 3I0ZA 4QDZA 3WYFA 4YV7A 4L3WA 1RMQA 4AF8A 2NZ2A 1ORHA 5AM0A 4YR7A 1PJ4A 1QK3A 1S01A 3P0JA 3HUDA 4RM2A 2QN3A 4MCJA 4ZTZB 3EWAA 3WB2A 4UQOA 3ZXSA 4Q1EA 3T7CA 3ADOA 4TTJA 3TMKA 2EAUA 2B1QA 3FPEA 2VTBA 1N5OX 1DDOA 1FDWA 2BD0A 5HQ3A 2C5LA 4BNUA 1Z33A 3CXUA 3HXKA 4CEHA 1H6BA 3PWZA 3Q5DA 3JZFA 4Q9IA 2RSLA 2O8DB 3B1XA 3PPVA 2GZRA 1IVNA 1G2PA 1XQWA 1U65A 3I2HA 4KO3S 1XZMA 1CB7A 2CBXA 4O4HF 5COQA 2OPBA 3RBZA 5CFOA 5AJYA 3AX6A 4C4TA 4XVQA 4DARA 2ACWA 2PFSA 4JQCA 2C5BA 1VLMA 4CT5A 3DYIA 3NUZA 1ECPA 3KB1A 4MCIA 3QU2A 1G20E 4BVBA 4CG0A 1HDZA 1LDMA 2ZT5A 1G60A 3G7UA 3SNHA 4IJUA 3CZAA 1VA5A 2CSXA 3WLHA 5FB3A 3LSYA 4FOOA 2CLEB 2DQ4A 3G0DA 3SOPA 4GMFA 4C4XA 3WLFA 4HS4A 1T4GA 3GLRA 4IJMA 1PT9A 3EIUA 4OFWA 1OX4A 5EE1A 3LC2O 2BEUA 2BLLA 4FS3A 4OQEA 4PCUA 3C4JA 4K86A 3S27A 4JJFA 1YZFA 2A4KA 3Q3JB 1DRUA 3P45A 1Z7BA 4XGKA 4JJIA 3OM0A 5G53C 2A5LA 3BF7A 3UY4A 1QDUA 3QF4B 1KU0A 3SYMA 1BEZA 1XZBA 5DRYA 4HWSA 3L0OA 5A9SB 1XB2A 3G0GA 1HE1C 3KHKA 3QEMB 3ZWXA 1F1BA 4BEWA 3WOVA 3G85A 4BV2A 3PEYA 5I01A 2F48A 2JAQA 2JJ8A 4M83A 1KQPA 2CNOA 1OLSA 2FK8A 4GM4A 2ZYGA 4K6GA 5M3BA 5DO9A 5A9RA 4AS1A 1NJ2A 5JS8A 5AXBA 3KAPA 3T38A 4QUEA 3R76A 3H2SA 1EM6A 3R3JA 1FMLA 2RI1A 4B6EA 1XVTA 2EFGA 2G17A 1QHEA 2M6LA 2O7SA 2HU2A 1Y7HA 1FP7A 2QVBA 3EXG1 3DZFA 1U2EA 4A16A 4TZTA 4CFYA 1NPTO 3UC5A 2ALJA 3CS3A 3R5HA 2WT8A 5EWMA 5EIBD 3DJFA 4RULA 1G8FA 1ZMBA 3B5IA 4D02A 2V59A 1RWQA 1U28A 2EL7A 4J1SA 1T1EA 3MCAA 2XZPA 1NM5A 4M21A 1KNXA 2H2HA 4CF4A 4EGCB 2EKDA 5J4YA 1AIPA 2B6HA 4E5DA 5SYMA 2XV1A 3G23A 4YMGA 5DTJA 1UM8A 3GPBA 6PFKA 4OJMX 2QGFA 1CIPA 3DHEA 4Y2YA 1SBIA 2IDKA 5L3RA 1NF2A 4RD4A 4JEHA 3HKCA 1W4BA 7REQA 1YDEA 3G68A 1DC8A 2DWPA 3B7PA 3IEXA 4RVCA 3EASA 4ZYXA 2J0QA 1FUYB 3QOYA 3IR6A 2XX3A 4LY0A 2LCQA 1H4SA 2GPSA 4YCAA 1VL6A 4MKFA 5FI5A 3JWEA 2FN8A 3O21A 2I5PO 3K0AB 4OREX 4OBEA 5KKNB 4AZWA 1DC5A 2WIBA 1YL6A 2XHZA 3C8UA 4PYQA 1CQWA 3T3MB 1UP6A 1GV0A 2XITA 1J56A 2J07A 4ADSG 10MHA 2QN9A 3W06A 4PICA 3TNDA 1XLVA 1FYVA 1NQUA 2R1TB 4X61A 3DVRX 3HSKA 3SDZA 2REXB 3Q3HA 5DMXA 3VR6H 1LTHR 4MAFA 4HNSA 1WMDA 3OFJA 3M34A 4Q3CA 5I7WA 4XJXA 4EJ0A 4RU1A 2Q5JA 4QYTA 3CLHA 2ZE6A 3D7SA 3MJDA 2AR0A 3OPXA 4FDUA 4BFZA 4FZ5A 1TTHA 2BMDA 3RVLA 5MF6A 3X1WA 2W2KA 3AVUA 3DUFB 1A96A 2C61A 1LSJA 1K3UB 3OPYB 4L0MA 3W8RA 5JRJA 4L2IA 3T3OA 5LQUA 5LU9A 1X86B 2A58A 1E18A 1L7MA 3IMEA 5EL0A 3HE3A 3ZZ1A 4EQ6B 5AFSA 2O05A 1J2JA 1Z38A 5FFMA 3A9VA 3AZPA 5YASA 4JLJA 5G41A 1NAIA 5BQ5A 4DBLE 2MINB 2Z98A 4IDNA 1EBFA 3VYRB 121PA 2AF4C 5B1YA 1DBIA 4IIUA 4UM7A 4X44A 3BCRA 5DYIA 4GI7A 5FLKA 4ENWA 1DEAA 3TDNA 1E63A 2J3JA 3ABOB 2P3LA 3I62A 1W36D 1RQNA 2IV7A 2MT9A 4H18A 4JOSA 1BMDA 1GCGA 2ZUTA 5AW4A 3EOBI 2DQKA 1VZ3A 3EIOA 4I9GA 5A3QA 3EUEA 2RJOA 4F3KA 5GZ1A 1ZCAA 4HN9A 2Z6AA 3Q6NA 3IQZA 4TXHA 3VKWA 1QMGA 4F45A 4ZOBA 4BRUA 2XOKA 4CQMD 1C1XB 4HATA 5KINB 3CLRD 1CUFA 5CUQA 3ZQUA 3Q9LA 2QRNA 3R0XA 521PA 4QQNA 3GJSA 2P6OA 2AOVA 3HKBB 3C87A 3IEIA 5K2OA 2DFTA 1ZN2A 2X1MA 2YXLA 4EW2A 1YCDA 1LPOA 3OT4A 4E70A 1U8AA 5BNTA 3N86A 1QZ3A 3L1JA 4XM1A 2PTHA 3FY4A 3HACA 4EPYA 5CDHA 1RYBA 4LKRA 4FILA 2JD0A 4TX1A 1USIA 2II6A 3OO0A 2WEKA 4JBXA 4Y8VA 3NHMA 4MV0A 2VYNA 1KAGA 1RXIA 3AP2A 4HQNA 2WJGA 4WK4B 4ZMBA 3R2JA 4YYZA 3EEFA 5HIMA 5IF9A 3TZEA 3Q3CA 4MVCA 4U3JA 4CQNA 1TU4A 2OXEA 4WXMA 3FBGA 4PS1A 1E8NA 4DY6A 1U7WA 2Q0QA 4R2HA 1I10A 5FWXB 3OQ1A 1TM7E 4W99A 5KX5A 1OYWA 2ZJBA 4WL0A 5E9JA 4HAVA 3PC4A 1PVVA 3G02A 3TL6A 2XE6A 2BEWA 3RJTA 3WK5A 3ZCVA 3T7AA 4M49A 1UBNA 1FRQA 3AB3A 4DC9A 3GLHA 2WKSA 3LD9A 1I94B 3IBFA 1A2QA 4K6KA 2PYDA 1NSYA 3CGWA 4DM7A 3F3KA 2OHJA 5ALKA 1KY5A 1LH0A 2WHQA 4XW2A 4YAOA 3VH2A 4UZEA 3P4XA 1IN7A 2IODA 4OMUA 2QVLA 3WXMA 4CKZA 1UJCA 3CBQA 3P2EA 2YIDA 1MA0A 1P4RA 2E0IA 3GJ4A 1SCBA 1HQKA 3IBSA 4WLEA 1SZJG 5FTNA 4NECA 1JWAB 1ATZA 4BX9A 2PGLA 1DAHA 2Y1GA 3M7IA 5F5NA 3ZUPA 4WKGA 5A7GA 5ES4B 2CD9A 4HDOB 4XWOA 3RRXA 1AMOA 2WFZA 3SC2A 2H3HA 1LBEA 3NFYA 1Q1BA 4KV9A 5KZMB 1LD3A 4QTZA 2JEOA 2B7CA 4MKXA 4BPBA 5BQ3A 5IT4A 4DKJA 2JK0A 2NYUA 2A5FA 3FZYA 3OX3A 3HWSA 3N8GA 3AG6A 1ABFA 1K7EB 1PT7A 1ZHHA 3BMOB 4EVSA 3P27A 2CLOB 1LDYA 4N1AA 4F93B 2ZTUA 3PF9A 4K40A 4C20A 2HNKA 2O57A 1KJQA 4G09A 4AKHA 3HU3A 1TYZA 3ZCUA 2HCTA 2HR1A 1XMQB 2P8SA 3W5DA 3QM1A 3RYCB 2G0AA 2WIKA 2YXBA 3DT8A 3VX4A 4OTZA 5CLQA 1CR4A 4RZ2A 2B69A 1TZBA 4RHYA 5C5IA 1HF3A 1OHHD 3ORYA 1JILA 1RQXA 2PBZA 1PS9A 3TSAA 1ORVA 4UATA 5CH5A 3KFXA 4KMMA 4IVRA 2FQQA 2YWBA 3PXDA 1XJWA 3SM3A 3LUJA 4FKMA 3T1TA 2BC9A 3AY7A 3O93A 2VL7A 2DKFA 4M8LA 5F2OA 4ZGBA 4A5OA 2HJ9A 1M6NA 5CK4A 1E1KA 3JAKA 4YRZA 3D4OA 5BOSA 1J07A 4WY2A 1BDHA 4M55A 2DPLA 1KQNA 2X4GA 4GRDA 4DLSA 1N9ZA 2VHXA 3OUUA 3A37A 3ZWYA 1RJ9A 4LK3A 4DL9A 3LBIA 2I3DA 4IKEA 4FFMA 1GSOA 3KOYA 2WM2A 3QXGA 1H93A 3R7BA 1L4KA 2B82A 2GD0A 1P1IA 2XB9A 1BOOA 3RPEA 5J2TA 3DLBA 2Q2VA 2Z9DA 4YRCA 2P91A 2QLFA 2PJDA 3KT0A 3V6LA 4KZPA 2IBMA 3G6KA 1NE2A 2XQKA 4KFSA 3V1KA 2NO7A 1YVDA 4KH1A 3QE0A 1OA1A 1T0HB 1ZH2A 4QJBA 3ZV6A 1IWOA 2FW6A 3MWFA 3KXDA 1KYWA 2QPOA 4G56A 3AR8A 4RNDB 1YU6A 4A0RA 1QTIA 1OFTA 3KQTA 5HW0A 3H7IA 5HZGA 1J0BA 2N42A 1Z08A 3L18A 4CDGA 3N8NA 4XWAA 1BWSA 2GO1A 3NBQA 5B1HA 5KIAA 2A9VA 1Z35A 1EAMA 1MB0A 2W8BB 3JQ9A 2OBXA 5EPEA 4LC1A 1DEOA 2D3WA 3T7TA 4RIGA 2YRXA 1D6JA 5IHXA 2WA2A 3QQPA 3QBEA 2IBTA 1PGJA 2WLTA 3I04M 4N3CA 1OZFA 3VGJA 2EV9A 2HO5A 3EW9A 4O1HA 3J81A 1HFKA 2RHHA 3DM5A 1EVJA 1QB7A 1TMKA 1V6SA 3L04A 3ZV4A 5KNBD 3H5NA 3V7FA 3AVXA 3U60B 3VDQA 1YFZA 3UMCA 3RLFA 1QVAA 2CVQA 5E1DA 1Y9AA 1D7AA 4OK5A 1MC4A 5E7QA 5HE9A 4LHXA 1R5JA 2GYUA 2F6RA 2LWIA 5EXSA 2D2FA 2QRGA 4L5JA 1FYWA 4IOJA 1QM5A 3MF4A 2NXJA 1H4TA 3U7IA 5LXTA 3ETGA 5A06A 3WGIA 2EATA 3QOWA 4JJ6A 1NUQA 5KNCH 2PRYA 4IGEA 2ZSDA 3UJ8A 2VT7A 4BBJA 2Y1CA 2B1GA 1KDRA 1HTTA 1O6BA 4F8YA 1O96B 3KJEA 4HZGA 5JMPA 1JG6A 4F5ZA 3OOHA 2NZUG 3FA2A 1QTRA 3WA6A 2AEFA 2WSSA 1RJEA 3OURA 4MRSA 1GGHA 1WKBA 1Z68A 5DPMA 3WFIA 4IHAA 1VKOA 1DKQA 5EIXA 3B48A 2KLBA 5SZHB 1XL0A 1KDPA 3DHVA 3RC2A 4NENB 4YPVA 5TRTA 1JJFA 1FVFA 2VDPB 3IDSA 4B4OA 2XEXA 1RAIA 3GZ4A 4AECA 4J1QA 1V2GA 3L8EA 2J3HA 3EEBA 3QHAA 4P53A 3CR8A 1DWQA 2AK2A 5DBIA 3EA5A 4DLNA 1W48A 3PQ2A 2ECQA 3SJBA 4KHPB 3BXXA 2QLBA 3A7EA 3GZTB 4ZODA 2VDMB 3VSDA 4RD0A 1UMKA 3LQKA 2W70A 2PL9A 1KOFA 4O4IF 4DYHA 1WOMA 4Q12A 5ALLA 5F4ZA 2PUEA 4GWKA 3O8BA 5L9AA 3OQHA 1Q20A 4CR7A 3A31A 3R9XA 1C7EA 2CUNA 3NM4A 1H3NA 1W36C 3CUTA 1QH1A 1WV0A 4CIAA 4CODB 1HTBA 4Z2AA 4QD3A 1IXRC 4PGGA 1YQTA 3FUWA 3CKLA 3JZAA 3RS9A 1NYQA 5KNBH 4G4GA 3K35A 4BNZA 4EKNB 4ZAFA 1DKNA 3DO8A 3GCWA 3HVIA 6NULA 1ISJA 5THXA 4B0PA 3I1IA 2F8SA 3A05A 5EGNA 4OP1A 3SYTA 3AVTA 3OEEA 1YXMA 1P1JA 3AKDA 3IODA 3RAGA 5EJ8A 1ATIA 4N5MA 4X71A 5BYBA 4MWZA 4MYTA 2J6IA 2P75A 4GYJA 3WL4A 1DC6A 1R6TA 3BHIA 5KQLA 2ZG6A 4P0QB 1JJVA 1DHRA 1Z4MA 3TQCA 1Z6YA 1W25A 4Z8XA 4C0WA 4C7VA 1SOAA 2EBFX 2BFFA 3K9WA 4YRKA 5A3RA 4KIFA 1B8NA 2PZ8A 3CB4A 3DMFA 4FOPA 4ENPA 1JHOA 2PXCA 3CKKA 5DCLA 1XEXB 2ONYA 4I1VA 2EKBA 2HMVA 3IMCA 1ZJ6A 3U37A 1L4GA 4RHXA 3IB6A 3QXSA 3OLYA 1GNLA 4MVJA 4UCFA 1G8KA 2B9VA 5HDBB 1S2MA 2NUAA 2OFFA 1UOOA 2ADFA 1OIVA 2P9YA 4N12A 5F78A 3SZLA 2VQ6A 1Y5IA 4BX0A 4CQJA 3WMXA 4DWJA 3K70C 2Q1TA 3CSDA 3ZXIA 1W44A 1TTQB 1BDJA 4OXKA 5I9LA 5IF3A 3PG5A 2O8NA 4EB0A 1U0TA 4BVEA 2AS0A 1HI9A 2YWFA 4MR8A 4FVTA 2XXBA 5KKCA 3N1UA 4INZA 1MFZA 3OEWA 3EHDA 4O4LB 5DBHX 1NP7A 3NBXX 1DWUA 1NU8A 2HCRA 1ZYUA 4FNAA 4EX6A 4REOA 2GARA 4MPPA 1UODA 4TTVA 3GD7A 4CG2A 2HU7A 1GUDA 3FCCA 1VZ2A 3H4MA 1D2NA 4RFSA 4L72A 4KQXA 3SKYA 1E9CA 1ESDA 2JFXA 1NN3A 2WNIA 1IQUA 5ALFA 1O2DA 4Z54A 2DTDA 2PZGA 4EDHA 2V6JA 1W5AA 1KL7A 3OD5A 3QELA 1RP7A 1YKFA 1A82A 2R7AA 3A1SA 3F3SA 3WWPA 3ZNPA 4OMFG 1MT0A 1KBOA 4RWEA 2NUBA 1KZ9A 5I7AA 3DV2A 5CK5A 4D8TA 5C34B 1QQBA 3Q7EA 4KJZA 5EKSA 3ED1A 4YGYA 4WOBA 3ZGOA 5TLSA 5F23A 1ZI9A 4M8KA 3JD2A 1W85B 2GOYA 3PF8A 3RT9A 3VOSA 1CJUC 3RROA 7GPBA 1I3NA 2YYYA 4MICA 4RPGA 4ZCIA 1R6DA 1PYDA 1ISPA 3TVYA 5CM9C 1WD5A 2J5KA 2OHFA 3CO5A 3EZ2A 1SURA 2XCSB 3BXGA 2JVKA 5IX8A 2IOHA 2J9GA 1CK4A 4WBXC 3WQHA 1UAAA 3R0ZA 3SBXA 3K6RA 3E03A 4HADA 2A9QA 2NSDA 3AUSA 3IBYA 2GM5A 3U2QA 1VMIA 5CX4A 1E9AA 3BHMA 1W93A 2B2XA 2ZJ0A 3OCUA 3REGA 4D26A 1T8YA 1N5MA 1O6GA 1X77A 3DLAA 4JB0A 4ZEWA 5KSOA 1TCBA 4Z0PA 2NO5A 3WSTA 2AMYA 2GPJA 3FRIA 2BTQB 2VF2A 3TSCA 5BSEA 3L1KA 4XLLA 1P6UA 1M6VA 1OILA 3KXIA 2WYWA 3HKCB 1D8TA 1YR8A 1T25A 3AI3A 3HCEA 3QEKA 4ZVKA 1HO3A 3N2LA 1DQSA 4ZRNA 3ADPA 2Q3DA 4TT3A 4UMEA 1JIUA 1YVUA 4RV5A 1TTTA 4KLRA 3IPRA 1V45E 5FI3A 2V58A 1CTQA 4ZEVA 2P3SA 3RUEA 2A5DA 1DX6A 2BGKA 2IJGX 1ZGHA 3QI7A 4I08A 3PHCA 5K0SA 9ABPA 1F0PA 4HWTA 4L28A 5FTWA 1QK5A 2W71A 1N0UA 3P94A 5I8WA 2DQSA 2P2ZA 1WDWB 1G5FA 1L1EA 2PX2A 1C8LA 2IA5A 5BUQA 5HCIA 1NYRA 3GMSA 2QORA 4TOIA 5B3JC 5THKA 2PZAA 3RYTC 4H3KB 3DTVB 1T2CA 1KEZA 3EC2A 1SIWA 2HF9A 2L2QA 3FCXA 1ULUA 2XNJA 1GPAA 1NFFA 3ORQA 4CEHB 4TMWA 1GXSB 5HRCA 4MJLA 5HQ3B 2OEPA 1U28C 3NIGB 1GIAA 3SZGA 4AUKA 2OQIA 5K3AA 2DERA 1U1DA 2B98A 2H51A 3IDAA 2V96A 4L9RA 1XRLA 5BN4A 2A59A 3T95A 3HY3A 2OHHA 1JQLB 2GVZC 2BM1A 1D9ZA 4E1BA 3D8UA 3EXHA 1ES9A 1M7GA 2LE0A 4JL8A 4QDTA 2PUTA 4FHEA 4AL4A 4AMBA 3CBGA 1KJNA 5CDFE 1K9VF 3CNQS 2WQ7A 2XYGA 1Z4JA 1MJGA 1CR1A 4TV8A 3OCCA 3P9YA 3HR7A 2AUNA 4HI0E 4EO4A 2MIIA 4RYDA 1LTQA 1MMFB 2GNOA 2VHZA 5M29A 1R0BA 1OLXA 5AJWA 4ZVMA 1YVRA 2HJSA 3TTTA 4B71A 3ZJTA 3M0EA 2PSHA 4LMPA 3R74A 3D0QA 2FG7C 4B48A 4MLDA 5BSTA 2J4DA 5ENZA 3I6YA 4FGJA 4E1AA 3GPLA 1VKRA 1G3IA 4RAQA 4ZO9A 4A82A 4Q9JA 2FZKA 4LOIA 3RARA 4JR2A 3ZXXA 3VYUB 1USUA 2PH1A 1GU7A 3KCNA 1ZC4A 4MI9A 2VPPA 4QBKA 5FPYA 3W3ZB 1LDEA 2PO5A 3CF6R 5IRCD 1BFKA 1LC3A 2I6TA 3KBOA 1GNRA 1JB9A 1IMOA 4M1KA 4PAOA 1XT6A 3V1TC 3HABA 2V7XA 2IFTA 3FLBA 3KLNA 5BN1A 4DLUA 3NT2A 2IY8A 2W8ZA 3E1GA 4LGYA 1T9HA 4RS4A 5ALQA 5CB8A 1RBQA 3H97A 1E3SA 3OPNA 4B09A 2CDNA 1DT3A 1N2ZA 1XOIA 4L15A 1T10A 2WKRA 4M9UA 4WTOA 3RTGA 3SZOA 1ZGJA 3W90A 3DTVA 4MA5A 1RAGA 4PO3X 3ZLUA 3ES9A 3KQVA 2QLTA 3E8SA 3HDHA 4X1YB 4KRYA 4ON9A 3NNSA 1XMXA 1GTL1 4JKYA 4RZ3A 2ATCA 1W19A 2OYSA 1NYTA 4NY1A 1JDSA 1I36A 2IEGA 4ZO4A 1JTEA 4B3TB 2WKPA 2PN1A 5BSWA 4BNDB 4BO9A 3H2IA 4RYLA 4BNKA 1NVVR 5K0EA 1SCQA 1WXDA 4G97A 2WSIA 4TM7A 4J1TA 1ZGAA 3K1AB 4LKOA 4KHZA 1A7JA 2UVQA 3DG9A 3F67A 3IQDB 2UVPB 2I55A 3OCVA 4BUJA 5BNWA 3KPYA 3VTKA 1E5VA 2ONJA 2Q6KA 4ITVA 4L27A 4C0QC 1OWLA 1USGA 1KR2A 2VP4A 2ILVA 2QVXX 3EK2A 4B1FA 3TLYA 1EVKA 1UWVA 1YNOA 2A1TR 3CN7A 5KJEA 3VBCA 3A4IA 3CXRA 4HNHA 4MQEB 1SD2A 3WC4A 3E1SA 3LC1O 2J85A 1NF9A 1MUUA 3R3WA 2FVYA 2V7EA 3AI2A 4MCAA 4NCXA 4ZI7A 1XQVA 1AY0A 4PX2A 3CEPB 1RRGA 2CT8A 2A0UA 1FFHA 3BWXA 5GONB 2BTEA 2XLBA 1TLFA 4F84A 3A25A 1TM4E 3AB7A 3O8OA 4BCDA 1H9BA 1PFGA 1NR1A 2BUAA 3IRVA 4DV7B 3MYYA 3RRNA 1QHSA 4DNQA 5BSHA 1RRVA 3BSFA 4YPFA 1Z6TA 3RGWS 1X42A 3WHLA 3IHWA 2NU9A 3KAKA 1RJWA 1D5CA 4YJDA 1A8HA 3UF0A 5AKJA 1O5OA 5LUBA 3FJOA 1TW3A 5C0OE 1NX9A 2O2GA 2KJQA 3C8MA 3CF2A 1DRJA 1VHTA 1L6IA 4KO8A 2GPNA 1GCUA 2BM9A 5AIAA 1QBGA 2XKBA 5BP7A 3NT5A 1V3VA 2VK2A 3UB2A 1LFDB 4C0HA 2HWUA 3CCBA 2AMVA 2DT5A 4HGOA 3QG1A 5CXXA 3FUCA 1AS3A 2REQA 3O8QB 1P7VA 3OZRA 3OPYI 5TY0A 2R47A 3P2KA 3BICA 2C9ZA 3U81A 3WGTA 5AXCA 4NFSA 5IZCC 2LUOA 1KP9A 4QOHA 1KXJA 3AKYA 4A1OA 5LNK6 1W73A 3RTAA 3GGJA 1Q1AA 4B5KA 5KJFA 2GS9A 4ZZ2A 2XWSA 2BF7A 4GKJB 4C4YA 1CQXA 1OYVA 1QQ6A 4X8OA 2O1WA 1Q0RA 4ZYLA 3EF1A 2J31A 3D0OA 4XIFA 3TI9A 4FHZA 1ZFNA 4AN4A 4D3DA 2PGIA 4EMUA 5JQGF 2AOUA 5K01A 2QW1A 4KQ6A 2RAUA 1P39A 3C3XA 4HLCA 1RI2A 3DS8A 2CCGA 3C45A 3MGGA 4F3CA 3FROA 1YJ8A 4Y9DA 3SHTA 1HKUA 4P98A 5IAOA 3E3MA 3KOZA 2Q6OA 5GVRA 3DBVO 2G9VA 1HX7A 4DXDA 2YC4C 3R20A 2E4UA 3P9KA 4AK9A 1E6CA 1CVLA 3FGOA 3AG5A 5H8WA 3GNLA 4UAUA 2A2ZA 1IBKB 1F2VA 2ZYIA 1CQZA 3COWA 5CFZA 4KXNA 3R5TA 1E66A 5E0OA 5FIUA 3A2MA 4PYLA 2BH9A 4LX0A 2Q1XA 3QI2A 2WUEA 4J0QA 4WX2B 5FYQA 1ZS9A 1EDBA 3UGJA 1YZVA 3LS2A 3CEJA 3I2FA 2BUCA 3NYIA 3UYLA 5FJIA 1CDOA 1VLVA 3OTWA 4QUIA 5CFPA 1EA5A 2X2EA 5D87A 3K53A 1HE4A 1G98A 2WY2D 4HDCA 3JD1A 5J3JA 1F2UB 4N03A 4Q02A 3W7BA 3RVJA 3WB0A 2A33A 3PXXA 4WNIA 4OQPA 4Q66C 4NOMA 1M6VB 3L40A 4M3NA 2IGBA 1G55A 3VJMA 2QTVB 4TQUS 4HDMB 3TCNA 3EFHA 3PIRA 5B7QA 2Z9CA 3NNNA 4H31A 4JI5B 4DEVA 3MK31 1PZEA 2AV6A 3AM4A 4AKGA 3ESZA 4L16A 1JIQA 1RM5A 1TC2A 5DLDA 1X87A 2B25A 3TWOA 1A1SA 4GL4A 2UV8A 2FSFA 1Y42X 3HY6A 4ZHQA 1ZX1A 1AK1A 2RHWA 3WKAA 3PJFA 2H4XA 1EUQA 3JQBC 4LTNA 1DUSA 1TIKA 4R7TA 1SB9A 3BRWD 4MUBA 2RAPA 1YSCA 3FZQA 1R5BA 3M33A 2UYGA 3ST7A 3F4KA 1SUCA 2VJNA 3THSA 5ALDA 3EVGA 4AY5A 4JELA 4PBSA 4ZCSA 1YJQA 2PKQO 4OHKA 4EK9A 2QD5A 4D9GA 2B4RO 2ZPTX 4XYMA 1PNQA 2PT7A 3FCEA 5EJ5A 4JT4A 2X22A 2IYZA 1MG5A 5D84A 4ZCPA 2ZZKA 3WYEA 3I01M 4UUQA 1QDEA 1C2TA 2GZSA 4DSAA 1VIMA 5EN4A 2BJWA 3AJDA 3I9V6 1N0WA 1Q1QA 3GRAA 1ZWLA 3ISJA 2PMFA 2FZ4A 2QAGA 4LSMA 2GK7A 4CL3A 1QIDA 1WDKA 2FDRA 3JQ6A 1ZW1A 3WMEA 3R5JA 3PQCA 4R4JA 3MSCA 5T4BA 5KYYA 2QTNA 1Q84A 2Q2WA 3IJPA 1VBNA 1XKLA 4MVJP 3KT3A 2ZAGA 3GHHA 1DXHA 1EP9A 1II9A 2WAMA 4FYXA 4OB7A 5JNUA 1ISMA 4KQWA 5EG5A 1FZQA 1YI0A 4IDOA 4MR8B 5H83A 2YUTA 1T4CB 3CFYA 3IVMA 1CPYA 3KKQA 5DK6A 5LA6A 3G2OA 4MSUA 4R98A 4R2WA 1KI2A 4TQ9A 1QZTA 2JBWA 4Z0HO 1UZUA 4Q7KA 5A5FA 5DSTA 4P0PB 3DZKA 3EH1A 5ISMA 5BSUA 2IZOA 3PR3A 1AXGA 2QJRA 2A5GA 3H1AA 4ND5A 5CVUA 1TKCA 3KQHA 1WEKA 1LNQA 2HX1A 1T1SA 4UM9B 4J4BA 4EPRA 3LFUA 3WTBA 3AVPA 1H85A 2IX3A 1GFZA 3CT6A 2Y76A 4OATA 1JBQA 3T61A 4IS3A 5DBEX 4Y6QA 2CC2A 2Q62A 3D64A 2GCOA 1T0JB 2BBSA 4Q3KA 2A9KA 3G7SA 1CS0A 3JYHA 3MXTA 1KDZA 5DW3A 2PSJA 3CNBA 5AI8A 3SVTA 4TYNA 4DV6B 4MDFA 4X93A 2FUCA 1FX0B 1VJCA 4DNPA 3B3AA 3EAGA 1LWOA 1YZQA 3B8HA 5KJ6A 1EA7A 2YXPX 4PZUA 1N6KA 5F2EA 3UQYS 3C6BA 1OYOA 4BJ5A 2FRXA 4MV4A 5DSXA 4B83A 2VDWA 1V47A 4GC5A 2IYYA 2A92A 5IXYA 3ER9A 1T5DX 1WO8A 2ZUSA 3RG2A 4MS3B 4LYAA 3PWKA 4KRXA 1LLFA 3TQIA 4PLFA 1GJRA 3QUSA 2C5FA 3CV3A 1E5TA 1EFHA 1L5MA 3AIIA 3A1WA 3WRXA 1TFUA 1U0EA 9GPBA 1C30A 1CZLA 1AQ6A 2ANCA 1PO7A 4ZRMA 2YRFA 5CT9A 5ILQA 4DIKA 3CNNA 2EBUA 2H5IA 4C3OB 3I53A 2J9FB 4AURA 4QTYA 3BAFA 2JHGA 2BSAA 4GR9A 3KO8A 4IM7A 2DBVO 3FPFA 3REQA 1E7MA 4EHNA 1PF7E 1D2HA 1T8WA 1PW5A 2R00C 2VHEA 3IXMA 4JAVC 1ZK2A 2ZQYA 1BYIA 4V0OA 2BF4A 3A6EA 2WQZA 1WDTA 3BZUA 4M6WB 4DLZA 3MMZA 5BNZA 4EHBA 5FHRA 3ACCA 5HBRA 2ECFA 3QU5A 2X8JB 5GGXA 3W0LB 2XDWA 4UJ5A 2W6OA 2C84A 4BN5A 2YBDA 7YASA 1B2LA 1M1YE 2ZULA 2JLWA 1NW6A 3AYXB 1WB9A 1BKSB 3QXXA 3V4SA 1NZDA 2P9HA 1N75A 5H0IA 2RHJA 1PT8A 3H4IA 3WQBA 1PL6A 5JATA 4C7OA 2HLNA 5T8KA 2KYRA 2OZLB 2B8WA 1I13A 2AI1A 3L02A 3TXAA 3V7YA 4ALKA 4BTVA 1ODIA 4L22A 1O95D 2HGSA 1GKLA 3GT4A 3QVGA 2AMLA 4Z4CA 4C6RA 2HPVA 3H2HA 1ZJZA 4EG0A 1X7WA 1XD8A 4UDXX 4QLAA 4ZVSA 4LF9B 2TRSB 4AJNA 3WISA 2VDVE 5IU6A 3I8SA 4X41A 1T1RA 2ZT7A 5AM4A 3YASA 1G18A 2AT1A 4J0HA 3K1AA 5KYWB 3LPCA 4OCZA 4GSKA 2GBFA 5G2OA 3S2UA 1C9MA 4DR1B 1PSWA 4L9WA 4BWGA 4AYWA 1XXHE 3TG2A 3E81A 1R66A 3R7LA 2QD1A 5F64A 3UV7A 1RRMA 4JHLA 2VK1A 1DIGA 4L08A 1DLIA 1M5UA 2VEOA 1N5LA 1JGTA 4JIGA 3HDVA 5REQB 2WZQA 1S6YA 4IDBA 1JI3A 2R7MA 5DM4A 1L5FA 4GH5A 4AIRA 1OAAA 1KVTA 4HG2A 4N7BA 4G63A 3ZWKA 2ZTHA 3QYAA 4EY3A 2VDKB 2KW5A 1XZJA 3HLYA 4GE0A 1JDBC 4IX1A 1GNTA 1LPBB 3GZNA 2BJVA 1M2WA 2FPIB 1VHLA 2LPMA 2PKXA 1OH8A 3WYAA 1NBMA 4K9PA 1DJLA 2IVFA 5JBQA 1GZVA 3A3PA 2IYQA 2P27A 3IUMA 3G0IA 3JQ7B 3LY7A 5JCZA 4TS3A 3SC4A 2E2WA 3WG9A 1TPYA 1V7PC 4MLPA 3CNLA 5ALPA 1JEEA 4PLVA 5HK8A 1XK7A 4TROA 2D5AA 3OZWA 5JHGB 2OB1A 5HKKD 3ZD8A 5DIFA 2XUHA 2Q1WA 5AM5A 1KYQA 2ZBUA 3DFUA 1O6ZA 2QD4A 3U39A 2FZWA 3H6KA 1NQXA 3QFHA 4RE6A 3DZGA 2QEQA 2XYVA 2PUGA 1EM8A 1LK5A 1E1QD 1V1RB 1COWD 2A9JA 1RHUA 1GQSA 1RDFA 2D1QA 4P86A 2VYND 1ECLA 4TUYF 2R8EA 2X8LA 4C06A 1PJTA 4AMGA 3TRDA 2XWBF 1OH5A 3RYHB 4CMJA 2G71A 3G6WA 1KZHA 3OLXA 3CH4B 1O6FA 1GCIA 4DDVA 4QBFA 2ES4A 3NASA 4BC0A 4L0DA 5A6SA 3DE7X 3NG1A 4EH1A 4BVFA 1OWNA 1LJ8A 2CWDA 3FR8A 1G5HA 3BSSA 4G5RA 4BWYA 5B6PA 5KBYA 1A04A 3M1IA 1L9XA 4C2BA 3IUPA 4TYPA 1M2VB 4O2AB 4D80A 1SOWA 2GHQA 3KZKA 3AB8A 3OF5A 4N40A 4RMHA 4XJSA 5ESWA 1Z37A 1WMBA 1XVVA 3AM3A 3BGDA 3KKMA 2VN8A 4G8DA 4L2IB 5D1HA 2O1SA 2AR7A 4AZSA 1TM3E 5IC6A 1MGPA 3MFQA 4TGLA 5FNZA 4KCGA 3MTGA 2UAGA 2EFJA 4BO6A 5LPNA 2G7ZA 2IXTA 4OH1A 3CLRC 3DOCA 1J0AA 1U2TA 4R1OA 4BO1A 2WVGA 4FC7A 2A1IA 4FK8A 1KSHA 5I4BA 1UJ6A 3DBLA 4NR0A 2G9ZA 2VATA 4PRLA 1G8YA 5DYYA 2GLXA 3AFGA 5G1NA 1PSDA 2XNCA 3GT0A 4JR1A 4NBRA 1KAEA 4B2IA 4NMLA 3EODA 3AF0A 4ZAWA 1JYFA 2C0PA 1QG0A 1E2GA 5K45A 4A6XA 3JSXA 2UVDA 4FBMA 4RORA 4MLZA 4B3RB 2RBKA 5AW2A 3UHOA 3NLLA 5J2UB 1R2QA 5JSZA 2PMCA 4UDYX 4FFRA 4YLGA 3ROQA 2IQ5A 3GJ6A 3WYNA 1WCYA 1ZITA 4GGMX 1W52X 4ARUA 4DMHA 5HXAA 1EEXB 2GXSA 4R05A 3PNYA 4JLAA 1KMCA 2PU7A 3UANA 4TSKA 1Q92A 4CV3A 4EGSA 5KMGA 4F11A 4W9RA 5IAJA 1N5DA 2R62A 3KEQA 3O8DA 1YQQA 2O3RA 3DEZA 3WIBA 3CU5A 1OWPA 4AJKA 4YT2A 4OQYA 1YQUA 2YQ4A 3GYBA 5GM1A 2BCEA 2PGXA 1NASA 4LYGA 4CGYA 1C9DB 4ROSA 1T35A 2RGNC 4U7TB 3IO5A 4MQBA 1DINA 3HHPA 1KHHA 1Z16A 3BJIC 4FGLA 2WPDA 3M5PA 3X3HA 1ZNXA 1G1MA 3ECAA 2JLXA 4RTNA 1D2CA 4ER3A 5KOJB 2ZZNA 5LQMA 1UDCA 2AWNA 1ECJA 1ENZA 2GZMA 3AL0C 1B2RA 4UM9D 2RHCA 3IEVA 1QB8A 1X19A 2VH2A 1SA0B 5D01A 1KOLA 4DDTA 5KSWB 4QX6A 4BNTA 3ISTA 2O20A 5L7YA 5KTRA 2QI9C 4DA8A 2W6PA 3LW7A 3CW9A 2BKXA 1KORA 4IXTA 1E2LA 4BZPA 4IO0A 2P90A 1BDBA 3NI2A 1OKKA 2QMUA 1WZIA 1RI5A 4JC0A 1G6KA 1SVUA 2TMYA 1UQUA 2HEGA 5ESXA 5ALYA 3B9PA 4X84A 1S2DA 2FZGA 2I87A 1B74A 3M1AA 4KSBA 1J0DA 3IDFA 4HSEA 1ZK3A 5DGHA 5A2QA 4WKBA 5EUQB 4A6DA 1G8AA 2JPDA 2Y6VA 4JD5A 3RHSA 4IIYA 2ISQA 4OXNA 1TKBA 2YJNA 5EESA 5GOZA 3W4IA 3R7SA 2WOOA 1Y9JA 5G0VA 2Z3WA 1PW7A 2CJWB 2CMHA 2TSYB 3EAQA 4KO2S 4NRDA 1T9DA 4MO9A 4RVSA 4Y1EA 1NVDA 1X3SA 1OT3A 3RTBA 5CCDA 3ZIAA 4YRSA 1G17A 1RAHA 3PIDA 4Q3BA 2O6LA 4L4XA 5HNKA 3ZY3A 3ET4A 5JZBA 1EGQA 4HNUA 1NI4A 1JQAA 4CN9A 1SXGA 1D7OA 4DFDA 1YB6A 1C41A 3I1FA 4I9HA 5KNDH 5IT9A 1UXHA 3ESRA 4XDYA 3WQRA 5CLLA 1GNSA 1UF9A 3KZVA 3PSAA 1LBQA 1M9NA 4LQ4A 2D8AA 1FFDA 3PHHA 4KVGA 4TMYA 1O1YA 2APJA 4OB8A 3DD1A 3H0KA 3HMKA 3E3OA 4ZEOA 2ZJ5A 5EKUA 5KTSA 1E2DA 3N87A 2PQ0A 4RTMA 4C5CA 2D4AA 3KQWA 2A9PA 1XD2A 3ER6A 1KA9H 4J0EA 5IWCA 3D6TB 2OM6A 4YJ3A 2W2LD 4L7VA 3IDQA 4D56A 1NQ5A 4HXGA 2ZM5A 3P97A 1P5JA 5JVDB 2VJCA 2C83A 4R8VA 3TQTA 2VHYA 5HFJA 4O5OA 3UXEA 1QZUA 2NVUA 5BORA 4PHCA 4QC2A 1N5KA 2CE2X 5KCMA 1SCJA 4AZ3A 721PA 1GKUB 1KVUA 5C5DA 1WZCA 2BHRA 1NRIA 1RFGE 5JPCA 1FVHA 3W05A 1ZOLA 1XMOB 2J32A 2B92A 2IXFA 2ONZA 4C3VA 4N9QA 1L7NA 4L8FA 3WMFA 4NC9A 1JX6A 4ETIA 2HRDA 2C5HA 3I4FA 2HWKA 4D9NA 1YACA 4F3TA 4DF3A 1M6EX 1FX1A 1I14A 1J5PA 1MOPA 2QNIA 2QR3A 3P9PA 4LE0A 1S02A 1VL5A 2X42A 4H7FA 4WXYB 4GYKA 2VRWA 3Q8WA 4C88A 2NT3A 3S68A 2CXXA 4B2PA 3NWPA 1FYXA 2RGCA 1M73E 1KPHA 5IKMA 3DPUA 3DF9A 2BHNA 3LI2A 2QOEA 3C16C 1MOQA 1N1EA 2E89A 4LYYA 4RKFA 5FUMA 2VRCA 1X1DA 3COVA 1DGQA 3LCUA 3O3NB 2WW8A 3KB2A 4RKWA 4AS3A 4Z4FA 3F5SA 4RZUA 2VPWA 4FNGA 1C5KA 3IR7A 4ZTBA 2ZSAA 4URZR 5JH7F 1YFLA 4OXQA 2BN4A 2RHGB 2XDQA 2HMUA 3HL0A 4P22A 3LWDA 2NU7B 4HLUA 1P73A 3NHPA 1B41A 3BGSA 3IBGA 4EPXA 5IDWA 1V4BA 4I50B 3T3NA 2P7IA 3THYA 1OU0A 3I9MA 4PCLA 2M6RA 1NE7A 3CA8A 3LV8A 5K8LA 4PWYA 4RJ2A 2AHRA 1KY2A 3T9FA 3ZK8A 2P5SA 2WK1A 3TRFA 4BVAA 4U7PB 4G41A 3NJ4A 3PTLA 1OXUA 3CUUA 1SQGA 3PI6A 4RQAA 3RIGA 3EOZA 4KQIA 3K92A 2WC1A 3SQMA 3AXSA 2ZROA 1CNEA 3NTVA 2IOFA 3KSAC 3O47A 5SY4A 1RQ2A 4OJKA 2Z2XA 4CUKA 4U6NA 2GYYA 3FFXA 2YIMA 1CV2A 3AJAA 4HJRA 2BW0A 3V4PB 2OENG 1B00A 3C1AA 2FEKA 3HB1A 4UPVA 4ACAA 4Z51A 1E62A 1W4RA 1Z22A 1VI2A 2NAPA 2M9MA 2Q6TA 3GPIA 3ICCA 4QPDA 1F6DA 2DUMA 4AP6A 2XB6A 2FFJA 1LQTA 3RABA 2Q28A 2W2PA 1D4FA 1UBMS 2O2JA 1Z34A 1J1IA 1M6YA 1QUFA 1LJUA 1VPLA 1BCSA 3KYJB 3N58A 4JY7A 3RW9A 4ZDJA 4O2BA 4Q3EA 3C7AA 1NR7A 2PEYA 1YFJA 1ILEA 2OXIA 4MHSA 1CIJA 2COEA 1ZOIA 3PUYA 2CHFA 1FSPA 3MB8A 3HGQA 4WEQA 5ALSA 4YWHA 3BWDD 4LZJA 3DLPX 5KC9A 2ZDHA 3IO3A 3RF7A 4RJIA 1PL8A 2VZ8A 4M99A 4R8RA 1BA2A 1QRTA 1QG6A 1Y4SA 2PPVA 4RJTA 4JH0A 1UC9A 3D7NA 3SX4A 3H8JA 3PNPA 5HHTA 5EJGA 3BA1A 4BC1A 3FX2A 1H4VB 4LJ5A 4W5QA 2ZLBA 3BJZA 2RJ3A 3BKXA 3LUKA 3FZNA 3H86A 1NVXQ 2ZE5A 3QBJA 3C7CB 3KQOA 3RUHA 3UGTA 3W79A 4X66B 1JHMA 2IHNA 4PIPA 3HWWA 4BB9A 1JDNA 2BWJA 2P3OA 4Q4LA 3RIEA 3N2EA 5JFOA 4OI2A 3FETA 4GYYA 1U2DA 1XC7A 2FFBA 4WZZA 1WA5A 4FDTA 4C03A 4IWXA 3FFAA 3VC2A 3R3SA 2ZAOA 4GD3Q 2PAFA 4XDHA 2VHVA 1JKFA 2EFEB 2ZJ1A 1XALA 3GWGA 1SBQA 3IPLA 2J0EA 3S7TA 2NU7A 1I3KA 1ZICA 1ADGA 4JJAA 2ENWA 1KMIY 1AC5A 2G6BA 1UBRS 1DRWA 2XYHA 1DU4A 2AEJA 4BRSA 2V97A 1P4JA 2W4QA 3PGLA 2H4HA 2VXOA 4B7UA 1F0KA 3HRKA 2CF6A 3KJGA 3EPRA 1YL7A 1V5IA 2I2BA 4OIMA 5I3ZA 4IKPA 2O8FB 3K6JA 1YDGA 3OFKA 5FBZA 4F5YA 3AHHA 1QYDA 4UUPA 5C4IA 1E2QA 2DECA 3PD0A 1QHXA 2GN0A 4IGKA 2IIBA 3A4MA 4EEKA 1EQUA 3FUUA 3QVTA 1SKYE 2ZQZA 1IONA 1Z2PX 4AKSA 2R1UA 1EQ2A 3H2ZA 3MAAC 3MEQA 4Y2XA 5FOVA 4YAJA 3PLNA 1PDOA 4EJSC 1CY4A 2A1UA 3KQMA 4L76A 3TZQA 4WIAA 4R83A 4TT3D 2IDJA 2JAHA 3D1LA 2C96A 4V0NA 1SUAA 1YZGA 1R3DA 4NBLA 3DEYX 4HPJB 2VDQB 2I4NA 1J20A 1RTTA 4MKZA 2QSZA 1Q7EA 3W4JA 1AGPA 7AT1A 1U2SA 4UEKA 5CFRA 1PZFA 4B4WA 5KYNA 1Z9BA 2C7OA 3BMNB 3O92A 3BWVA 3OT1B 4FFOA 2OLEA 2IEAA 3ND5A 4II7A 4RZSA 5IANA 1KOGA 2PUFA 1Z15A 1DWPA 5CIQA 1APBA 3L4KA 3VKVA 3MTJA 3L05A 2X86A 4S04A 1PT6A 5TF0A 3PJDA 4K6OA 4Y0AA 1G7TA 3OJFA 1KYTA 2O7RA 3T06B 3QVSA 4M1OA 4C6TA 3DMNA 4LJAA 4B44A 1EFTA 3W5AA 1QRSA 5K03A 4RABA 2ZVQX 3V3TA 5EPUA 4A9AA 2C7BA 3QVKA 5ITWA 2HHCA 2Q46A 3MT8A 2YW2A 1V3UA 3KXLA 1IUPA 2XSZD 1ZXLA 1VB5A 3ZE1B 5GTDA 2F59A 3WGKA 4L75A 1AUVA 4WMLA 4DKXA 2WYVA 3QE9Y 2IV3A 4TRMA 4FEGA 3C3JA 3H75A 2H8GA 2X8BA 4H0NA 4JBNA 4KLAA 1RLIA 3KSRA 3BB4A 1A0OA 1V1JA 4G37A 3FPKA 1RAAA 4RQBA 4R8KA 4L8YA 2OD2A 3QMMA 1MNQA 2IXBA 3E84A 4X91A 3RC9A 2Q3LA 3DMGA 4IICA 3HPRA 1ICEA 5T64A 1W49A 3GJZA 1S4MA 1YE8A 3EN0A 4MR7A 1BG6A 5ALRA 1PYGA 3TIFA 3L4EA 1QYRA 4EJSB 4OHXA 2VPYA 1RLTA 1XDUA 3FDZB 3MS4A 2FWJA 1MX5A 4AWAA 4AQYB 5FL7D 2JJYA 1G7SA 3LFTA 2XMPA 3HXLA 4O2BF 4XXHA 3U3XA 1G20A 3X1YA 3AL3A 2QUBA 3RBVA 3WLJA 3ZLBA 2DEUA 4FYKA 4ZAYA 3GD5A 4UVIA 2YINC 4HH1A 1K8XB 3EVZA 2E6KA 4FOSA 1ZNWA 4IIDA 5LLSA 3WGJA 3GFQA 2HQ1A 3AEQA 1IPEA 2ZI6A 2QF7A 2H57A 4H9GA 3R9KA 5HGJA 3MQ2A 3A6FA 4G2NA 2AGVA 2C82A 5B12A 1P7WA 4QDJA 4AJJA 2NMVA 1ZZGA 2QL6A 3AHCA 3FGZA 3LX6A 3D8HA 3O4RA 4NSNA 4I8XA 2IHVA 1MH9A 1C7QA 4XTCS 3TYXA 4ARBA 1BFDA 2GLUA 3ZD6A 3K1TA 3W5HA 2E7ZA 3I45A 4GDFA 2QYSA 4HMPA 4MRNA 1GPKA 1L4LA 3UJ3X 3FNIA 4YV2A 4A1FA 5KDDA 2PT9A 2VEDA 3NEAA 4EY7A 4KE7A 3WYCA 3DV0A 5JH7A 1PVDA 2AG1A 4U63A 2IEDA 4FE7A 4I50A 5DB4A 3HU2A 1J24A 1L7QA 4CNQA 2SKEA 3L9XA 3QVJA 5LMNB 1CZOA 4ICIA 3GLFE 4IRMA 5BYKA 1BW9A 4G6ZA 4TSFA 1S8NA 4BMYA 1MD9A 5TX7A 5FUQA 2JB9A 2QYOA 3QYFA 1N8KA 3FNHA 2WTBA 3ME5A 3THRA 4W7IA 4QM7A 1HDIA 4MHOA 3LVBA 3DBRB 1L7PA 4IRXA 5EJ6A 3K3PA 1NP6A 4NU0A 3TIGA 4N47A 4RMGA 1T5IA 3FYUC 4RK4A 5I7SA 4D46A 3B6JA 3EG5A 2X1HA 2ZR9A 3IUEA 2JRLA 2XMRA 5JQGB 5I3CA 1UBHS 1U9JA 3I9V1 3NXKA 4QXOA 2PYZA 4RGBA 1B6GA 1P5FA 2AR9A 1Q0SA 4NCKA 3I2IA 3ABSB 3UKOA 4CLRB 4TXLA 3O2SB 1Y0BA 4ZCMA 4AXBA 4MROA 2XZLA 4GW3A 3A0RB 4YNBA 4GM1A 2YHSA 2H0RA 2FWBA 2CNDA 2HQBA 4WUVA 3QVXA 4ZGGA 1AUPA 5BN5B 1M8GA 3KHUA 5LP6B 1C0IA 3DFZA 1F6WA 3VC1A 1EAYA 4UBOA 4BIMA 3PKIA 2BSQA 2R11A 2GRUA 2G83A 5T5QA 3E82A 1CUXA 3TTYA 2H7YA 1HGXA 1TKRA 3F97A 4C04A 4KI0A 5KNDA 3BXHA 3Q87B 4G1BA 3QXHA 3II6X 4JQSA 4EGQA 1UAYA 2DE0X 1UDAA 4YJ3F 3DE6X 4CIWA 3U7HB 2IUUA 2FDCA 1MJGM 2FUG1 5IXJA 2CLSA 3M89A 2VT6A 3OMLA 5A6SB 1ZVVA 3CUEF 4HNAB 4I8IA 1EGVB 2WTEA 1AF7A 3N3BC 5DHTA 4PZYA 2XRZA 4FIZA 1DCTA 3M3PA 1RYYA 2RKWA 3RK4A 1EIZA 2GUGA 1GTG1 2X5JO 4YK7A 5FV4A 1X74A 2FHSA 2Y99A 4NS1A 4PCVA 1QIIA 1QG4A 2XR1A 1O5IA 4MVJE 3TLCA 3AHJA 1NNUA 2H1RA 1SXJA 3DKIA 1I30A 3SSMA 4BX3A 2OFWA 1R0XA 5AXDA 1R16A 3IP5A 5AM2A 3EFOB 3SBEA 4UHEA 3RVOA 3RM3A 1F9AA 3RK1A 1GZ7A 2CJFA 4RY8A 4BLVA 5I7OA 5JFGA 2JCGA 1UPFA 4KWTA 3AKZA 5JCPA 2E5FA 3L7DA 1GTSA 1TEHA 1ZPDA 1KSGA 2YWXA 3RU7A 2NQ2C 3HDTA 3KX2A 2RARA 3ONEA 4KOAA 2P1ZA 3K4HA 3VNQA 5CXSA 4E5YA 821PA 5DULA 1DRKA 1T9GR 2BIFA 2ZTMA 1P18A 2PFGA 3AR4A 4ISCA 3LQFA 2WP8J 3EXFB 3HYSA 4CKBB 5A9TA 4KIJA 3L7IA 2QL7A 3KQQA 4C22A 5B1IA 2CJYA 1OX4B 3A3NA 2EP5A 3IIKA 2H5EA 1JQ5A 1M54A 1KJYA 3GEGA 3WYBA 5JCJA 3LUPA 5LXTF 5D51S 1RJFA 1C3XA 1VDZA 3TNFA 2FPIA 4GBED 3UICA 4Q7QA 1J5EB 2JRCA 3JQ9C 4P6VF 4YC7A 5GJCA 4DR5B 3DF7A 1B14A 4JB2A 4TN5A 1X8JA 3O4VA 1K7FB 3N2IA 1VRWA 2XD9A 4DMKA 3T1NA 3W5IA 1OY1A 2W93A 3LA8A 3AQIA 2PH7A 2JLQA 2H85A 4UC0A 3E5NA 5KI6A 3H3JA 3RF6A 1DIBA 4NBKA 5H70A 2CNBA 4C07A 5E4JA 2WHXA 1IPHA 1WVGA 4IIEA 3AO0B 2WFLA 1PLLA 4R5MA 4D1YA 5E9WA 5K4AA 2I7CA 3MBOA 3VKFA 1VFPA 3ENVA 2V3WA 2C03A 3GMTA 2C00A 3D6MA 4JL5A 3Q0EA 2XMDA 4EHDA 1N9GB 4N8EA 3PC8C 3TB4A 1Z47A 4FHFA 2Q5LA 2Y9MB 5KUTA 4EW6A 3EVDA 3WP1B 2PUHA 1GCAA 1UDRA 3ZTTA 1UINA 1UWLA 3B9BA 3F1KA 4I14A 2DHQA 2QTFA 1P4GA 3FW1A 4INOA 3T4PA 1CKEA 2W4IA 2RH5A 3ISVA 1C7ZA 4QDKA 1HC7A 4RGQA 4QXQA 2FU5C 3CVUA 1S8OA 1U94A 2Q3HA 1HT0A 3NZEA 6CHYA 3E9MA 1EMDA 2CHVA 5CVCA 2CF5A 4PFSA 4AJ2A 1OI7A 1W88B 5CGZA 4ZCLA 1VIYA 2C2MA 3HBNA 2N0SA 4K6FA 1PGNA 2JI8A 1X7XA 3QWAA 2GNAA 5J2TF 2VJPA 3G9TA 2Z56A 2DTXA 5L3QB 2LP4Y 4A8JB 1XA3A 2IP1A 1QVWA 2Q3MA 1F0YA 1MB3A 1U7PA 3N2GA 4HGQA 2I4RA 3WDSA 3UK1A 2YHIB 3OJLA 1DPGA 1AGNA 8LDHA 4KNYA 2QRVA 4M0FA 5K8VA 2O59A 1TD1A 1XR3A 2QA5A 4L1KA 2R97A 4RMIA 2J33A 1GYQA 1TJPB 2H00A 1LNZA 1KEEA 3ZZ0A 3PUIA 1CDEA 1C2YA 1GG8A 3BB3A 1U0OC 4E3ZA 5HIKA 4LRYA 2AG8A 2F3UA 3OQIA 4HXYA 5B30A 4QTTB 4Y6RA 4D3ZA 3MWDA 4CCYA 2ASEA 4JDPA 4DIBA 2A6PA 1B16A 2I6QA 4D45A 4DMMA 1Y8QA 1VPWA 2K6GA 3DZIA 2IE8A 3OZCA 3QJGA 1VE7A 2QT1A 3VR2D 3QG5A 3DP9A 3R3ZA 4MK4A 1RZRD 5EIWA 1RZUA 1S96A 4OBWA 2F9MA 3ZDFA 4C08A 4Q03A 2G80A 4NF2A 4D9BA 3M9WA 5GJBA 1NQAO 1ZBQA 2PZKA 4XRGA 5K3EA 5JCXA 4YIHA 2IHJA 3C5WP 3ENWA 1UDWA 1R5NA 1I24A 2RH9B 2XRYA 2A3RA 2BFWA 3PEEA 3QPDA 4I8DA 4NHOA 2AKAB 1WL8A 3W34A 3LDGA 2CKMA 5DNWA 3PKZA 4TKZA 3UJAA 3OPYA 2RH8A 2HSDA 4C0SA 4DIUA 3O9ZA 1G8JA 1QYWA 1WR8A 1X3LA 2H11A 2OCAA 2EYUA 1ZUHA 1L7DA 2GI4A 2XE4A 1IHDA 3A8TA 2MDTA 1UL1X 1Z75A 2QMZA 2QY9A 1JMVA 4H1VA 4HAYA 4NZPA 5BXQC 2YR0A 2ZANA 4D9FA 4YEDA 2OAP1 4LDJA 4UVHA 4MWTA 4KX3A 4YJGA 5HWSA 2QL9A 3DMTC 2AIRA 4YPOA 2C4TA 2XMSA 2X41A 4OM8A 4P80A 1OF1A 1K5GA 5L3QA 1O54A 5F2NA 2C8LA 2PUCA 1VPTA 1DX4A 3JYPA 3TTUA 3SG0A 3WMRA 4AKTA 1SKAA 4IUDS 1W88A 2GSWA 2EC5A 1CHDA 4Q4JA 2FXVA 4ZU1X 1W9MA 4KR0A 1E92A 1PLJA 1J99A 1GYRA 1T5LA 4U02A 5D8DA 1U0GA 5KNCA 5FWXA 3IIIA 4R2MA 3D7RA 3WK9A 1FNNA 4US0R 1Z88A 1I1NA 1E94E 3L4BA 1WZUA 2PXXA 4JCOA 4QYIB 3KB6A 4LJLA 3HR8A 4G0XA 4LWZA 4RK0A 3ITDA 2V6GA 5JSQA 4ZARA 4JV5B 2F62A 3JQ7A 1U2GC 4ODIA 5GIOE 1DQYA 4JUIA 1CQPA 3AR6A 1X94A 1D3AA 3IAHA 3X44A 1J2UA 1Z2NX 1VHJA 3DA8A 5KNBA 4MNTA 3E4DA 4HAWA 4UREA 4WD3A 4DMGA 4EABA 1UR5A 4M9CA 4F92B 1A8QA 5EIOA 3ZDBA 3FVQA 2PZBA 3PR1A 2EZTA 3RLIA 4BZZA 4MAMA 3FNRA 4GR4A 4BMNA 3GUZA 4DLKA 1PJZA 1AA6A 1Z5NA 3PJGA 4EKGA 1YZYA 2J45A 1CZUA 1ETHA 2V54A 1JR6A 1CY2A 3VPAA 3VU9A 1JSLA 2J9YB 2UZ4A 1VKHA 3PNVA 1J2EA 2DFDA 4NX2A 2GNPA 3QEBZ 5C9ZA 4E5VA 1K7XB 2VLBA 3UMGA 1Z4IA 5ULLA 3Q8LA 2RHTA 4FXOA 1DV2A 1GA6A 5EPOA 3K9QO 3B60A 1UT8A 3V32A 4AS2A 1XJ5A 4CM1A 5KTKA 4BNYA 1XZHA 4MI6A 5B36A 1M2JA 5IUNC 4EELA 5KREA 1JI0A 4M7RA 5HCUA 4PFKA 3RANA 3VPSA 2WG2A 4EA9A 4QDUA 1M76A 1VHDA 2GD1O 4KPGA 4MIKA 3WB9A 2PT6A 3F5DA 4FGZA 3ZHOA 2VQ3A 4F6RB 3GARA 4R16A 5JCOC 2J67A 3U6BA 4QEZA 5LSAA 2JS7A 1NXVA 2HL6A 4HY3A 1G2IA 1R4NA 1SK8A 3OTHA 4QT0A 5DXFA 4FFLA 1U9IA 5AI6A 2ECOA 3TNLA 4KFUA 5HIIA 3CEAA 4M4SA 1FMFA 2WLSA 3D2AA 3PE4A 4IRUB 3SMVA 5K8JB 3U0BA 1D0VA 1U7XA 3OFNA 3EFEA 2ET6A 2JDIA 2C7PA 5B1SA 3FLMA 4P4LA 1T2AA 4E07A 2WWRA 3RV4A 4DLVA 2NX2A 2XMGA 2BEVA 4LY6A 1H0RA 4RBNA 4PPNA 4I1UA 1JKJB 2ZRQA 1EWQA 3LYAA 2EARA 4Q3DA 3HEAA 3DL2A 4CKCB 1Y3FE 4PSVA 1MQ8B 1XMJA 3OEHA 1WMEA 4NTZA 4A0QA 5JARA 5EMLA 2BFBB 1AV6A 5ARCA 2EX4A 3FUVA 2Y1DA 5AKXA 4QRIA 4EYSA 2OZVA 1NXWA 3VTAA 3EISA 3EQ7A 5EE9A 2ZJ8A 4FWBA 1OR8A 5E8RA 3DHNA 5BN4B 3ZGXA 4TVSA 3L7MA 4PO8A 5LD2C 1JR3A 3STYA 1YDMA 1T6YA 1XTSA 2DC1A 4JT2A 4X65B 2IXDA 2R6R1 3FBWA 2JGIA 3B6IA 3RD5A 4GNKA 2AC2A 4PZ9A 2VKQA 4G07A 2ZYTX 3PX2A 3CRW1 4TTRA 4XSGA 1CUVA 3ZG6A 4NYMR 4QFBA 2L18A 3GEBA 3UPUA 3GFVA 4Y7DA 4Y30A 1IIBA 3TM4A 3TTVA 1ORIA 4WKPA 2BZ0A 4U39A 2G67A 3SHQA 3P0HA 3B5EA 4XE5A 4G5FA 2NTVA 5FWDA 3S29A 5BSGA 4U6QA 4LZOA 3TLMA 4E32A 1OTXA 4UTVA 2ZR7A 3BQMB 2ERXA 3MIIA 1WLYA 1TRHA 2FR8A 2DPMA 3QWHA 5K6AC 2YHUA 4FEAA 4R1SA 5ETJA 1Z13A 2FF5A 1LUAA 3U3MA 5EE5B 1KAHA 3GLGB 2UXDB 1FZTA 1P31A 1RXUA 3IP8A 3NPMA 4YMWA 3SGLA 3KV1A 1DTEA 1RWMA 5HF5A 4H1TA 4XFKA 4OYYA 1NOJA 2J6HA 1L5YA 2SNIE 1K6JA 2Q1UA 1NVMB 3EZNA 4JFAA 4NH4A 2WWGA 4URXR 5JWOA 4M7OA 1FYFA 1DAFA 1JV2B 5BWBA 2FMTA 4P2BA 3VDMA 2FP4A 1XRPA 4GSLA 2ZYWX 5AKIA 3UGKA 4BMOB 5KQMA 1YT5A 2C1XA 3OUTA 3DWGA 3A26A 3VR3D 3ZJVA 8GPBA 2GN9A 2QAGC 4BMPB 1UWKA 4W7SA 3VPDA 1XEFA 2PS0A 3A32A 3JVIA 3FLEA 3T5TA 3WJAA 5JTUA 1KYZA 1R8QA 4WHMA 4E4TA 1CVIA 4C30A 1M34B 2A9RA 1FFAA 3HGMA 2Q4DA 2ZAMA 2C2WA 5LZ9A 3PWSA 3FPSA 4KSYA 4E88A 3KE9A 1XZPA 4JMPA 3TTSA 1GLGA 4G5GA 1Y34E 3BSWA 4B34A 2E21A 4PTYA 4PX5A 1G0OA 1T2EA 3D4PA 4XQGA 5E1OA 1DG3A 2HXGA 2CJPA 3VJKA 5C8XA 5AHXA 3OZUA 5TPZA 3A2KA 1DX9A 2NU6A 3KWMA 1JSRA 1QLWA 3VVCA 1BVHA 1SQ0A 2PS3A 4ND1A 5L8VA 2GCGA 1HR0B 5L53A 4GICA 3IB3A 4J1NA 3FTPA 4UXJA 2GXQA 4FC6A 1X7GA 4ZQBA 1K4KA 2XWQA 5U4QA 5CNKA 3W77A 2O2EA 4D4MA 1PEKE 3GJ8A 1M67A 1MVNA 1ECGA 5JJ5A 4E31A 1WQ3A 1X8LA 4JC4A 4O0LA 4Q1VA 4NCIA 2FWMX 3L7JA 1FLVA 3FMOB 2X9VA 4J3NA 3TW6A 3P20A 1I01A 1WHSB 2PIAA 4E5SA 1NJSA 2PAAA 2X2OA 4BNVA 3FNEA 2CLFB 3KPWA 1XROA 1GZUA 1CT9A 1X7YA 2VK8A 3DPSA 5C4GB 3JVUA 3R5SA 1G8GA 3HCPA 1S7GA 4CYMA 2X19A 3K6SB 2I66A 2BRUC 3HSSA 1A7UA 3QKIA 1UK6A 4H0FA 4D0GA 3D4NA 3MFYA 1S3GA 1OSNA 1Z5WA 2LIPA 2YV1A 5EJ2A 2CFTA 2PVPA 3UPDA 3HO1A 1QR6A 2ZXFA 2Z43A 2G70A 3H0CA 1THTA 1QWSA 3R0IA 4H1UA 3UJ7A 3E22B 4PYMA 5JZ9A 1A5BB 1T91A 4LRQA 1YR6A 2W48A 3Q8MA 2JVIA 3PHIA 4RIFA 5LNK1 2WZCA 3ERCA 1P7ZA 3KC2A 1T36B 4QJIA 1ZD2P 3ZVMA 5AOBA 5ICSA 2IZ7A 3M6IA 2BCGY 1AURA 2I8CA 3CPHA 3GHYA 4LCBA 4E5NA 3VR6A 1IHOA 1MO2A 3G49A 2R68A 5LN1A 2YWEA 3PQ7A 1GEEA 1Q91A 1XEXA 2HADA 2VP6A 1KVQA 3DXXA 4DTIA 2O4UX 3VH3A 1RKQA 1SRRA 1N2JA 1T1IA 4K9MA 1JR3E 5JLJA 4NCAA 4PTLA 2PSDA 3ORHA 4FJ0A 4A8HA 4JLKA 2YH2A 3FCYA 4I36A 4JX9A 3O74A 4P5EA 3LOQA 4KL8S 1WM1A 1UXOA 5BPFA 1NL3A 5KWJA 3D2BA 2W4MA 1RXCA 4KLCA 4DJJA 2A78A 3I9LA 2QPAA 2HQOA 1E60A 3QVMA 4HBZA 3RUPA 3TOXA 5BY2A 2GJAA 4BNMA 4IH1A 1BW9B 4LE1A 4MAAA 3T9AA 3JD3A 3VA7A 3D6VA 3H13A 3SICE 3RSQA 1PX0A 3CWCA 1X13A 3SU8A 3OTQA 5I7FA 4KMRA 3A14A 2ZUVA 4POAA 1KDVA 4MW9A 2J7KA 2ZB4A 3S2GA 5B7GA 1DJNA 1QCCA 1TQ4A 3P9XA 1QTQA 1SXJC 5AJTA 5EZYA 3VKHA 1X9HA 3KEOA 3FOBA 4HD8A 4YCNA 2ZEJA 4KW7A 1AQLA 3UK0A 4A0SA 4CIDA 5F9FA 2NTNA 2GEUA 3NWEA 2BMFA 2I76A 4A0HA 2R65A 4D3FA 3TCXB 1N1MA 4QUGA 4S1NA 4C4SA 4EUEA 3BBLA 1EE1A 2NSYA 3SZUA 2IZ0A 3AF3A 2M6KA 2W83A 5CB6A 2E85A 4DAEA 1EIWA 2W58A 2PWZA 1OJ7A 3DVLA 3IRUA 3LXUX 5IUJC 3GXOA 5IDYA 2EWWA 1EUYA 1U2DC 2W6CX 4P4NA 1PNRA 5A0FA 3LHKA 2JH3A 5DLQC 4DBZA 4Z1OA 3VU9B 2L82A 5LKRA 1R0CA 3ECCA 1EWVA 3AH8A 4CLHA 1PEYA 1D0SA 2BBOA 5J4VA 3TIXB 4KQCA 3RVKA 2P4EA 4MEJA 4QU0A 1T8RA 2I4IA 3ILYA 5ITZA 5AW5A 4ITRC 2ZSIA 2FQ1A 2H4FA 3L7OA 3QEAZ 1C3LA 2ODNA 1PWHA 2DSNA 3WLNA 4IIJB 3O8RA 5EQJB 3FWZA 2XZOA 3SHWA 4KVFA 2YUIA 3IC5A 3RU2A 4POOA 4DCPA 3HNRA 5BSKA 5GONA 4F56A 1JQKA 5INTA 2IC5A 5K2MA 4BL5A 3HB7A 3ZD9A 3K2QA 5DP2A 5CYOA 4NWIA 1IY1A 2JJ2D 1AHPA 4YB8A 1H5QA 3TL2A 2G8NA 3IQXA 1ZH8A 3BEOA 1S2NA 2NAFA 4TMXA 1JA0A 3PC8A 2WWVD 4N9WA 3DB2A 3OBBA 3EDCA 3L01A 1WUHS 3L6UA 4Q9LA 1DNPA 1TCVA 3HCNA 3ULKA 5F33A 2IIPA 2Z8ZA 5AR1A 5I45A 1T13A 4JIMA 1PWEA 1E2UA 4UAVA 4DQXA 4L4SA 1N0VC 5K05A 4XGIA 3IBTA 1UZMA 1VG0B 3HBLA 2PR2A 1ZN9A 1FDVA 3S55A 2IEYA 3JASA 3UT6A 1OTYA 2CEKA 2QX9A 4HAOA 4JOCA 4LQCA 1Q1EA 2I3ZA 1SUPA 2I0FA 3ZV3A 4UDOA 1U9CA 3SLRA 4CL0A 2Y68A 3PXEA 4ENUA 1W4ZA 2P9ZA 1ADCA 3IEUA 5DT9A 2EF1A 2HA7A 3I6QA 1R8YA 3NW9A 3T4UA 3EZYA 2QRLA 3BRSA 4UCXA 2QNBA 2YNMD 2O8DA 1FTQA 1Z29A 3EF0A 4PM4A 5BYAA 2SKDA 4G23A 3K8QA 1EBUA 5T8KC 3RS7A 1KS2A 5E2AA 5ED4A 3C98A 4Q18A 2V5VA 1YJAA 2Y93A 2PY6A 1IBMB 2BGGA 4NU6A 1WOYA 2I4TA 3C39A 1ZK4A 2QTWB 4RLQA 3RS3A 5JAPA 3O4FA 1HLDA 1UP7A 1U3UA 3W7AA 2XD4A 4G0WA 4WESA 1EK2A 1XDWA 4C2UA 3E6AA 1EB8A 3RV3A 3O5AA 2AA3A 1GPJA 4HPXB 1PR0A 3R7FA 1C1HA 5JC1A 2WWYA 4QICA 1DFGA 1VKNA 2XADA 4OL9A 4YLYA 3AERA 3VC7A 3ZCXA 3VISA 4YALA 1DQZA 5DOVA 1SUEA 4XDGA 4CKCA 3AP1A 1M6HA 1NT4A 5MDHA <