4RW0A

Crystal structure of a member of the lipolytic protein g-d-s-l family from veillonella parvula dsm 2008
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
184
structure length
184
Chain Sequence
NAMEIICFGDSITRGYDVPYGRGWVEICDASIENVNFTNYGEDGCSVQGMIYNIENWAVTAVSDPTRHIFLMCGTNDILQGRDSTYVYKTLVKAIELASTKGMVIIGLETQIDSDMDGLDLVVREVNEQLKAYAAEHNIKVIDFYTTLFEADQIGQIVFAGEVHPNERGYRLMAYKALEVFTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a member of the lipolytic protein G-D-S-L family from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula dsm 2008
molecule tags Hydrolase
molecule keywords Lipolytic protein G-D-S-L family
total genus 66
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4rw0A00
2Q0SA 4Q7QA 4XVHA 2WAAA 5CD9A 3BZWA 3RJTA 4OAPA 4K9SA 1FXWA 4JGGA 5A4AA 1Z8HA 5B5SA 1BWRA 1WABA 3HP4A 2WAOA 1J00A 1ESDA 1FXWF 1PP4A 4K7JA 2VPTA 1IVNA 4RSHA 4M8KA 1V2GA 3P94A 1VYHA 5JD3A 5HOEA 1DEXA 3KVNA 4HF7A 3PT5A 4Q9AA 4OAOA 1BWQA 3MILA 1ESEA 3SLRA 4K40A 1DEOA 1JRLA 4LHSA 1ESCA 1VJGA 4PPYA 1YZFA 2Q0QA 1BWPA 4RW0A 3U37A 2W9XA 3W7VA 4K3UA 1K7CA 4JHLA 3DCIA 4JJ6A 2APJA 4NRDA 3DT6A 4I8IA 1ZMBA 4HYQA 1U8UA 3DC7A 4H08A 3DT9A 4JJ4A 4IYJA 3DT8A 2HSJA 2O14A 4TX1A 3C1UA 2WABA 1ES9A 5BN1A 3SKVA 4DEVA 4JKOA 4S1PA
chains in the Genus database with same CATH superfamily
3P4XA 2B5WA 4XDZA 1QH1B 2ZWAA 2PGAA 4PZCA 3KETA 2HLPA 1GYQA 1XRRA 3ZU3A 2VJQA 1KZ6A 1P45A 1N0WA 1OYWA 2IZZA 2AN1A 2ID4A 2FPSA 3DEYX 4LDZA 4KVGA 3WNDA 4NL4H 3OZAA 5DHUA 4G5QA 2PKQP 2MSCB 1USVA 4ZHQF 1BE6A 1XQVA 2QRKA 2VPQA 1UJ6A 2R00A 3VR4A 3CUUA 1TUBA 3F47A 2FHPA 4N0EA 3A1VA 1SR8A 1Y8RA 4ZQIA 2NV0A 3DR3A 2ATCA 4JVNA 1Y81A 3SLRA 4OBEA 2DHEA 1R18A 4HWTA 5JY6A 2LIPA 2V6GA 3QY0A 1BX1A 1ZD9A 1MUUA 3DBVO 4B4WA 5HKBA 2PUTA 2MHCA 4RTOA 3AFGA 3G8YA 3ORQA 3T95A 4R1PA 5JLJA 4BGIA 1QS0B 4GE0A 4DA4A 3RS2A 1GDHA 2FFHA 3A1DA 3PEFA 3R7BA 4BC1A 1SK9A 3G5AA 4G26A 4UZSA 5EJAA 1J06A 5I4BA 4Q1DA 2BONA 5HYVA 1EB8A 4KAFA 3ONWA 4B6RA 1QHYA 1V41E 1TU3A 1XRNA 1E9EA 2G9UA 2PZMA 1OC2A 4Y30A 2A9KA 2OSBA 1XA3A 4I81A 3IT3A 4MUNA 2Q5FA 4CMEC 4XVCA 2ZQZA 4B6QA 3RFFA 3OBBA 3C97A 4EGCB 5LB4A 1JU4A 4J49A 3AYZB 1ZJJA 2F4VB 1FDVA 5KNBH 2ILTA 1N1DA 1UP6A 2BRUC 4R31A 3WO1A 2CVOA 3G23A 4Y2JA 2HA3A 521PA 1HE3A 2IOQA 1C2TA 1X77A 4LDJA 5DCYA 3G1TA 3EAGA 1GYPA 2B0CA 3QE4A 4IEIA 3KKZA 1KK2A 1TVKA 3ZWPA 4EY5A 1VSVA 1ADCA 3GHHA 3GT4A 4YLYA 1U6JA 1ZSYA 2J59A 5D5HA 1G7RA 3DB2A 1K88A 4H1HA 2I4MA 1TZBA 3D7SA 4HNGA 3TQCA 4IH9A 1NKTA 4K0RA 4ZYUA 3PUZA 1KEPA 1TQ2A 5JXIA 1CULC 4HLNA 2Z6UA 3LQKA 4MGEA 1Q0ZA 3C7CB 2ZWMA 3LKZA 3NGXA 2WA2A 4L8FA 4TTQA 1SXJD 3TQFA 5DMHA 3ZK8A 5JDIC 2O57A 3RRXA 2EG5A 3ROXA 5GZ1A 2IS4A 4Q0MA 4AZWA 4AKHA 5KSPA 4Q3EA 1JR3A 1TLTA 1FYFA 1X94A 3AF3A 4PAQA 3TH5A 3GGJA 3EFEA 3HI4A 3K9CA 2WTBA 5C8DA 2JLVA 4ABTA 2VO1A 2A5YB 3TB6A 4P3PA 4PPNA 3QSGA 2PT5A 3TTUA 4O1MA 1M33A 4L5JA 3HRIA 3R3HA 2HOQA 2L2QA 3KYCA 3NIWA 1H2AS 4K03A 4DNPA 4RNDB 5KJCA 2C2HA 4L8VA 4C7KA 4JQSA 3FR8A 1R6BX 3HSSA 5IAJA 4PYQA 4ZV9A 4WGFA 2X86A 5SV2A 3G9ZA 1W4ZA 3WHLA 1XQXA 3B6IA 1Z5UA 3IT2A 3A0RB 3EGEA 1ZMTA 2F3TA 1FSZA 5AHOA 5SY4A 3FUVA 2ISCA 4PGGA 1E94E 5TEWA 1X7WB 4BRZA 2F55A 3P5BA 4UC0A 1FFHA 3FYTA 1A04A 1O54A 3NM6B 2QX4A 1GEGA 3AHGA 3F6CA 4IXTA 1E59A 2A0UA 3BX1A 3TUJC 1QE3A 2BJVA 5IC4A 2GVNA 4LOHA 1D2MA 1I36A 3EBLA 3VNUA 4G25A 1JPJA 4BUJA 1XLVA 4BYMA 1UC8A 3EBPA 4DHWA 5F5NA 1ZWKA 3KOUA 1CQJA 3ZEIA 1ZNYA 3D8SA 3OE7D 1PW5A 2W6ID 5K51A 4L7VA 3U4QB 1JQEA 4LV8B 4YRBA 3IRVA 1OGJA 4DLRA 2R8PA 2Y1CA 1T0JB 3E27A 2BGTA 2PUEA 1MO2A 2G4CA 4YRPA 3F4KA 3P4UA 4EF6A 2WTUA 3HADA 3UPDA 4QYMA 1GZHB 4V24A 1C7IA 3P9RA 4CM3A 4HGNA 3SMQA 2HDOA 1R8YA 5FBWB 4EMTA 2JK0A 3LY5A 2LBPA 2FQYA 4RPCA 5EIWA 5FYQA 3E4DA 4YB8A 4WCFB 4MWSA 1C14A 2BAGA 1V8OA 1T6NA 3AL3A 3KXKA 4HQKA 4RX1A 5B2ZA 4BVGA 4YV0A 1SKMA 3K5WA 4DUPA 4RZQA 5BUZA 2XV1A 3H19A 5FDFA 3JVVA 1W581 4KDRA 3RW9A 3CCBA 1GFZA 3FUWA 3SQNA 3TUIC 4MS4B 4CDNA 1M0WA 1JU9A 4IEFB 3QY9A 2HX1A 4DCCA 5KOJA 2LTAA 3TNJA 3KAQA 1MGOA 2FA9A 3KKEA 2MR6A 3ZY6A 1ODFA 4R05A 4S1WA 5BN5B 2ZYRA 5E4JA 4XGRA 2Z2JA 4HAVA 4LXHA 1XZDA 2MR5A 3WYBA 1CF9A 1XJWA 2JBAB 4U7WA 2B37A 2P5UA 4RVNA 1GTMA 2PHZA 1DPGA 3KLOA 4IIDA 3C43A 3UKJA 4EFKA 1IC6A 4UPVA 4YAJA 2XX3A 3N5CA 2BKAA 2W83A 3IUQA 3RBZA 4B35A 2H52A 5LFAA 3AVYA 5JCOA 4K9MA 1GOTA 1XEWX 4ZPJA 3PQCA 3WYGA 4E51A 5KYYB 3FNFA 5LBIA 6ADHA 1NR5A 3QVTA 4IJ5A 5KHOC 1PGJA 4ZDIA 1JNXX 5AQ1A 3N70A 5F2NA 2IYOA 1DL5A 1TM1E 1LDYA 4O4JA 1NYRA 5DI3A 5ITSA 5KINB 1ABEA 1GGKA 2C2OA 1R4AA 3DAFA 3R40A 1ZH2A 2A0YA 1X7YA 5B58C 2ZRQA 5IYZA 4N8SA 4Z0NA 4LGCA 5HKAA 1FYVA 5D3MB 2H9IA 4ZYZA 3O2SB 4XPIB 4KYUA 1I4LD 4D9FA 1MU0A 2QRMA 5T41A 3G2HA 3WICA 1LQ2A 2J6BA 4E4RA 4RKWA 1J49A 4EZEA 2BLNA 4Y2SA 1UOQA 3K6SA 4G85A 4MVYA 1MX9A 1RJ9B 5G4KA 1U2GC 1MT3A 4OXKA 4D3FA 3AI1A 3L7DA 1X1TA 1GNQA 3GDOA 4FYPA 4PGAA 4C2AA 1F20A 1SQ0A 2UZ3A 3CJRA 1J7JA 3OCUA 3PCRB 1KETA 3GJZA 1GSOA 3EGIA 1BRMA 3L8YA 4C88A 3CRRA 4JUFA 3RF7A 5JV5A 2RARA 2H1LA 4AJOA 1HKUA 2Q5EA 3OEEA 1QX4A 2SCUB 4YRSA 3W6PA 4HRXA 3A25A 4LIPD 4ITRC 2X1MA 3W3ZB 3LUGA 3U4QA 1WZNA 4DM3A 4O2AF 5BOSB 5I7EA 1V25A 2J4CA 3L4JA 3W8DA 3HB4X 2Z9BA 1IPHA 4V0KA 1SKAA 1J0CA 1XDWA 1PFUA 2DQYA 5AJYA 5EKUA 4EKIA 3DO8A 3OZUA 3VYTB 5JAIA 3I12A 1KARA 1GPYA 2CXOA 2VJMB 2WWIA 3CJTA 4RE5A 4K9KA 1NU8A 1VPVA 4RPHA 2BHTA 1HLFA 1V26A 3N2LA 3C48A 5J9FA 5JY1A 5ALTA 5ELMA 1RWPA 3IH5A 1F2TB 3LSYA 3V7NA 1AKQA 4BCBA 1N25A 2GAFA 1X7HA 3H3JA 4JIGA 3RSSA 4YMVA 1G6HA 3N2EA 4HQNA 3OPQA 3E7DA 2VF7A 3GNSA 3QBEA 3HZRA 4I66A 3OQMA 2B9EA 4CGZA 5LQSA 4E5MA 1JTFA 3BOSA 3UMCA 3F5MA 1JILA 4M1TA 3J7TA 5CT5A 2AVNA 3K9GA 1JXQA 1ZW6A 4NSNA 2VIIA 4KE8A 4PE5B 3SF8B 2GOYA 4EKNB 4IIXA 1TQ8A 2HWXA 2WUGA 5FHQA 3Q10A 1ZXXA 2X1VA 5IJAA 5H70A 1GSAA 5F9MA 2JCYA 5FJIA 2QS9A 5D85A 4DA9A 2VSOA 2O3SA 5KHAA 1AN9A 3P94A 3CRVA 1ZUD1 4BLUA 2A1UB 2ZJ8A 4D43A 3KQWA 4MIOA 1XRQA 4C7XA 1DMRA 1QIDA 4TSFA 1EVQA 2OR3A 1C8LA 2VQ6A 2C00A 1IM5A 1GSIA 4JFRA 2E21A 3UAXA 2OECA 4P86A 3UHFA 4RS4A 2Q6VA 4J2TA 1FRFS 3QLUA 4E5YA 3V9AA 3AP3A 2H2FA 1Q1ZA 4XR9A 4YAFA 5HF8A 721PA 5LZ5A 1Z68A 2F64A 4D9NA 3MJCA 1KO4A 3AB3A 2P6MA 4KAXA 4PQGA 4MV7A 3KKOA 5DOZA 3ZBTA 1LC3A 2LKCA 2JAUA 1BKDR 2VLIA 4FHGA 4OKSA 3AU8A 3UOGA 3MBOA 1A7AA 1NT2A 1DELA 4TVOA 3RS7A 4EGQA 2O0JA 2MJLA 3DE1X 2YW9A 3OCXA 4GRIA 1LBQA 4DY6A 5CD1A 1YMUA 2GN9A 2JLRA 2MYUA 2VP9A 3PC7A 4BO2A 2HEIA 3ED5A 1DIBA 2IBTA 2JLBA 3WIUA 1J90A 2WUEA 5TPZD 4DDTA 3U9LA 5EVJA 5LVAA 1EK5A 2IF2A 4HDKA 3TCXB 3SKXA 8OHMA 4H4DA 1ZW1A 3RS5A 2HBYA 4FHDA 1D5CA 1UBTS 3ZLBA 1OCEA 4NU6A 3HNRA 2I5PO 1IU9A 1SC3A 3V1NA 5JNUA 1W34A 3C3MA 1XCMA 2BM0A 1WW2A 2QR5A 3EQ9A 4R0VA 4RKYA 4KPGA 5ILQA 5AHRA 2P65A 4OP3A 3K30A 3M5PA 3PE6A 3TFQA 2GM4A 1J2RA 1J21A 1OPXA 1SOVA 4HD8A 3H75A 4NDZA 4N01A 1KZYC 1Q12A 2QD5A 2VTDA 3AF5A 3U5TA 1JG1A 1RCFA 3VU0A 1LD3A 1UT8A 3FN4A 4GMDA 1BNCA 3LK7A 3TK1A 1XHFA 2YQZA 4XJTA 1NMQA 1ULZA 4FZJA 2QUKA 2X9GA 1U6IA 5BV0A 3TG2A 3ML1A 4RTPA 1JB9A 4I1SA 1MVNA 3KAPA 2PS1A 3KJZA 1EM6A 1VQ1A 5EKTA 3SJ7A 2GF2A 3O4FA 5DSXA 3FVQA 4MWTA 1LTKA 2O07A 5KTSA 3JRXA 1CQXA 4PG6A 3G2KA 4JJGA 4F2HA 4DXHA 3EXG2 4PSCA 2QMOA 5IM5A 1SHZA 3WGGA 1GPBA 3K72B 4YP1A 3HKCA 3V42A 2E4WA 4AQDA 1FX0A 3GMIA 1PWHA 2BZSA 1A8IA 4RCVA 4RK5A 2ZYHA 5KJ6A 3LXRA 2QL6A 4ZA2A 3BWMA 1SXGA 4I6EA 1QHHB 4C4XA 4N9WA 1SO8A 1W47A 3R0QA 5CD9A 1YVDA 1RMQA 1RHMA 3I9FA 4X6YA 2H65A 3DEKA 3DFKA 3MM4A 2DUWA 2Q41A 4IQFA 4TWZA 4AS3A 4CDMA 5EN4A 5LIRA 2VH1A 2G08A 4Z3OA 3PNMA 3PLAE 1F17A 1U1GA 1OKKA 2FWJA 3BFKA 3MTAA 1OKKD 4OP2A 2RGDA 3HSYA 1TTQB 3KOWA 4R2XA 5AOVA 9LDBA 1EM8B 4GQIA 2Q45A 2Z08A 3KOYA 1FU7A 3L8GA 3IQEA 3R3XA 4FEEA 4GYYA 3WSVA 3A10A 3G2MA 2XRZA 1MRSA 1T13A 3OA0A 3LHFA 1G3UA 4LRSB 5FYDA 4BMXA 4AAYA 3MBIA 3CZ4A 3L02A 4Q7EA 1KGSA 4EH1A 4DA6A 1KI3A 2WOOA 2PYDA 1FNDA 3GVXA 3M6FA 4FONA 4QHYA 1PEAA 2CJPA 1A7KA 2JHGA 5LP6F 1PR0A 2ZZKA 1BXGA 4KLNA 5BV7A 2PBZA 5JJ5A 3WLIA 3JATB 1JALA 3ZQ6A 3E5NA 1DJMA 3UKOA 3PDIB 4KXVA 1W5SA 3NV9A 3LY7A 3RRYA 5KTNA 2HQRA 3SVLA 3HBLA 2QUIA 4UU1A 1E62A 4X94A 1OVMA 4UVGA 3ESBA 4TLMB 3W8FA 3RTEA 2ZB2A 1HSOA 4PBRA 3HO6A 3UV7A 3RFUA 2OCYC 2IEIA 3M3PA 4EARA 5EXTA 2HXYA 2V4UA 3ANSA 3K0BA 4TXHA 5FR2A 3SOPA 3WLAA 3ZHVA 3ZVKA 4BB9A 4YMLA 3L0BA 3PNPA 1P0MA 3BGSA 3OCVA 4A0RA 5EP3A 3B70A 4FU0A 4RLQA 3PEVA 4A8HA 4B3HA 4TYNA 4XGIA 1KF0A 4E5PA 3FYUB 4AJLA 2OESA 3E22A 2EW8A 4AZ0A 1BWPA 3QKUA 1TFRA 4RW0A 4CIDA 3KJFA 3VVCA 1Q3HA 3WL4A 1A97A 3NLLA 4FOTA 4KSCA 5K0SA 3TR5A 1S1CA 2EJBA 1J0BA 3O9ZA 4M4SA 1TTHA 1M7HA 4PSAA 1H0HA 3U81A 1RVV1 4B47A 2IXEA 1XD2B 4QBHA 1J8QA 3ABIA 1PQWA 1PK7A 2WRZA 5TPWA 3ROTA 3RVOA 3WJ1A 1YFLA 1BFUA 3ODGA 1R4ZA 2V1UA 3HM9A 3DWGA 3BORA 1RC0A 3U4AA 1EYZA 1Q0LA 4IIFA 1VMAA 5GADl 1REQB 1ZMRA 4I8IA 5I9TA 3V4VB 4RZHA 1XA0A 1U2PA 1CR2A 2DRIA 2DJIA 2GASA 3ZU4A 4RY8A 3MT8A 1VHTA 4A2WA 5E7MA 2ZRAA 1AHNA 3GT7A 4DSUA 5CBPA 4YVFA 2C2XA 1MV8A 3EAFA 4DXDA 1KHHA 2YMPA 1Q3TA 2M9MA 1CS0B 3EOBI 3OETA 4I4LA 4E4TA 1XTSA 3GL9A 1CDEA 1D2EA 4L8WB 4XXHA 2QT1A 3WK7A 3BRCA 4DIKA 3TOVA 3CF2A 4KHPB 4O33A 1Y6JA 4CMIB 2GFIA 2C0CA 1TW2A 1ABBA 3DZ8A 1QZ3A 4TMFA 4V39A 4MQEB 1ZD1A 2H3HA 1DAKA 1SIUA 3WLKX 2HCRA 2WHRA 1GFSA 3SZ3A 4GLBA 3E1SA 1BW9B 3AIKA 4FPXA 4MP3A 5AXCA 1XYYA 1E3TA 1ZPDA 1SJ9A 3IQWA 4D0RA 1SVOA 3L6CA 1AA9A 4OP1A 3ICCA 2Q4OA 3C8DA 3ST7A 4PYIA 3IAM1 5UKDA 1V11A 4Q7QA 2VJLA 4IJWA 4GUDA 2QL9A 3H97A 3UK0A 4GLFA 1XYGA 3WRYA 3I64A 2CDRA 3U49A 2FSVA 4H1UA 1T8TA 3CMCO 3W1VA 3LF2A 1Z0IA 2JFQA 2WBLC 2WIKA 4OUDB 4B17A 3VDQA 1XD9A 4REOA 2PEYA 3ZIUA 1M5RA 1EVIA 4D6YA 3KSAC 2O9JA 5EIBC 1YCDA 1RYMA 1SUIA 3DVQX 2ZPUA 3OPYA 5KDLA 2IPOA 1FJXA 3HU5A 4PLYA 3EXG1 4TVSA 1R6TA 4Q3CA 3H5IA 3R0JA 3S5UA 4KRYA 3CZRA 2GAIA 1WPXA 4K7JA 2FDRA 1BN6A 4NWIA 3DLIA 3FPSA 3FTDA 1GA1A 1GZ4A 4IHKA 2DSTA 3OOWA 1R88A 1PTKA 3R5TA 1KSFX 4P32A 4Z3DA 2XF2A 1S1MA 4TT3A 3TQRA 4F5WA 5I7OA 1NYTA 2P0EA 3ISTA 4LRQA 2PANA 5A3VA 1JHYA 4EG5A 4M2LA 5G0WA 5IF9A 2XGJA 3PT5A 4MI6A 2XGGA 2WSLA 4J1QA 2JD2A 2J67A 4CU5A 4E5NA 5HIKA 2ZYSA 3ZD6A 1GGEA 1PT9A 1G21E 3V4ZA 2VZEA 2OBYA 1BMDA 2ODEA 2WILA 3MOSA 3JCZA 1GRCA 1IEQA 5HJ2A 1ZN9A 2Z8YM 4S1TA 1UKVY 3FNGA 3GRZA 2GEBA 4NE7A 5FA8A 1MENA 4CNQA 4K46A 4I50F 2PSEA 3BJEA 1IJFA 4XUEA 2FR8C 1JLRA 1YFJA 2C5HA 4R8MA 5FADA 1MBZA 2Y93A 5FA5A 4B85A 1C3EA 1YQGA 2OXEA 1YRQA 1JLHA 1SCNE 3NHRA 3QMVA 3R5JA 3VR6D 3EASA 1E9CA 4Q9IA 4MVWA 1U8FO 1DWQA 1YR9A 3K09C 3MCTA 3SS9X 2F4NA 4GL2A 4KFUA 3DCIA 4CM4B 1D3AA 3CVUA 1J5PA 1YCFA 3P2JA 5LWHA 1IY8A 4NF2A 4TXLA 4N7RA 1L4NA 1LWNA 2I3BA 3O2JA 3HYNA 1TX4B 1VMDA 3RK1A 4BEVA 5JXGA 3LCJA 5JC1A 4Z9XA 1P2SA 1GA4A 1USUA 2QP3A 2O50A 2NTNA 2AC7A 2QT0A 5F7JA 3AVQA 1Y6FA 1ZS9A 1UBSB 2BTOA 4G5OA 1QGUB 4JB8A 2KYRA 2A78A 2VA9A 3M6WA 3QUQA 4H6WA 4MWZA 3U7HB 3QLVA 3DPIA 3TQTA 1N2CE 4Q6WA 1EIZA 3R1IA 1QX3A 1F6WA 1UZNA 3BULA 3I1YA 3ILHA 4D99A 2WKPA 1XI2A 4JH0A 1WY7A 2L0XA 2V58A 4AJNA 1FW8A 1GTL1 2Y1KA 5HTKA 1L7PA 2CNKA 1HURA 2WFLB 3EVAA 3SPXA 5MDHA 4E2ZA 3NKLA 3ZDCA 1YULA 3CO0S 3RJZA 2ISQA 1J4AA 2DM6A 4ACAA 3SHTA 5HW0A 1XWFA 2BBSA 3ESCA 3JVUA 4C6RA 2MSEB 1IOLA 2FF7A 4N40A 2AMVA 5KPDA 1AV6A 4NENB 5SYAA 1U5BB 3THYA 4U6NA 1X1SA 2DWUA 2JVIA 3R8FA 3A9UA 5LA6A 1KPHA 1Q77A 4CIVA 1UBHS 1KVRA 3AO0B 5KNCH 3DD5A 2GXQA 1YTLA 2C1EA 1KZ1A 2PBLA 2JZNA 2ODPA 3CT4A 5I3ZA 4G8JA 3LXUX 4B81A 2OAEA 4URXR 4RL6A 4UNSA 3R6DA 5BXYA 3AL0C 1XR3A 5TQ0A 2JCBA 1A9OA 1DOZA 3T3DA 4D8YA 1W87A 3R44A 1G8KA 2XLCA 2ZS7A 3P9KA 4GMXA 4RDIA 2NMVA 1V8ZA 2ZTLA 3JPYA 2ZR7A 2P4UA 3KHUA 1CY7A 1UMDA 1KI2A 4RXTA 5IDVA 4ZV4A 1T6BY 2WD7B 4QA9A 1V1JA 1US8A 4PNZA 1F6BA 1NV8A 1DCMA 3E2MA 1XVUA 3THRA 1WKBA 3KQLA 2Z56A 2XZLA 2ZFUA 5CYPA 3IEPA 4RULA 1E32A 4GECA 3L4SO 1DCKA 4GPAA 1ZSVA 1A9PA 3MZ0A 4ZT7A 4I1UA 5EVCA 2XWSA 1A9QA 3HKEB 3KR0A 1KQNA 2FPGB 3P2OA 2XA2A 1B1CA 5FPYA 4WESB 5ECYA 1JS1X 2QRHA 1GG5A 4FLMA 2NUBA 1YQWA 4BNHA 3OQBA 3K35A 2QQ0A 1ZC4A 2QTZA 3KWMA 4IVQA 5M3BA 1SKBA 4H31A 3GRPA 4AIRA 1NUHA 4EW3A 3LQFA 3QXJA 3CONA 2FMXA 3R0IA 4YCDA 2CHVA 4OHWA 3B3FA 5JWRA 5T6MA 1RI4A 5C18A 2DF8A 2OWDA 2WSIA 3BWDD 5CFQA 4FDLA 1HTTA 4KPUA 1LW6E 3TO5A 3INYA 1ZJ6A 4OI2A 4FYMA 4Q4JB 1GPNA 2FSUA 4YROA 3E2IA 4CCAA 1FRQA 3R3WA 2I1QA 3N0XA 4KE7A 3ZU6A 4CIBA 4N7MA 4DQDA 3RU7A 3AGQA 2JCXA 4M7WA 1ZQ9A 5FWXB 5BV1A 4Z7NB 1M1YE 1QGUA 4XFJA 1O6GA 4HVTA 5L6MB 3ZHTA 2QF7A 3B53X 3OSZA 3QVLA 4JUDX 2V9PA 3OCZA 4LYHA 4KR9A 3UYKA 1J2UA 4YA6A 3EVZA 3OY7A 3QI7A 1M8GA 2JBWA 1QV9A 4TLAA 1EXVA 3UK6A 3V4PB 2MT9A 3M6AA 4CCYB 3N87A 3K71B 2JEOA 1SG0A 1KAQA 3W8EA 4JT2A 1ST3A 1YL7A 5G02A 1RQLA 4U2KA 2XCOA 5DF1A 1QH8B 2WC1A 3KWFA 2YV5A 5CP8A 3C6KA 4M0KA 2FSFA 2VXOA 4QO7A 1NC1A 2BFWA 2JBAA 1EP2B 1C30A 4QC2A 2BHSA 3RROA 1B16A 2IY7A 3QYFA 1LTHR 1SCBA 1NW4A 3JYLA 4MINA 4PHHA 4QFCA 4W9NA 1U02A 4XYBA 5KCMA 4ENSA 3TB4A 2P91A 1MAVA 4HPWA 2Q8NA 4OSOA 4RFLA 4KL8S 4E7OA 2O2ZA 4LUCA 3VRHA 5C5CA 3JARB 1WVMA 4A91A 3B1KA 4EW1A 3WTBA 2YR0A 3BQNB 3L5OA 2GM3A 3A9TA 3B8HA 5JI3E 1PJTA 1ADBA 3N6RA 4P5EA 4QM7A 1SVKA 1T1JA 2ZSFA 4IM7A 4J90A 1C0IA 3QUCA 1DX9A 5KYUA 3FZYA 1PNTA 2C82A 4EA7A 4U2CA 1CEQA 2WFAA 1QAQA 3TEJA 2ZVPX 1JP7A 1NOIA 1SG9A 2AEEA 2O2GA 3ELUA 3FWPA 4OJTA 4QNMA 2R8BA 3ZS8A 1II9A 4DPKA 4ZT6A 3RNLA 1QOPB 1ECJA 5EKXA 4JKYA 5CLHA 3MK31 5T4FA 4QTUB 1YOVA 1ZISA 3M1YA 5B6PA 1Y1KE 1VKRA 4MW4A 4PU0A 5EHXA 3MOGA 2OD7A 4IQ4A 4WZ6A 4BO7A 2B4AA 3ZH2A 3NHAA 5KJ1A 3WISA 4R2MA 5JSUA 1H8EA 3H42B 2ZBVA 2H17A 3HLKA 3RYFB 4FKZA 2BUAA 3V55A 1PKXA 2ZUEA 4XDYA 5KWEA 2HTFA 2C4VA 2DR0A 3DBRB 2X4LA 2C59A 2EGGA 3W5HA 2W6NA 3VZSA 4CLEA 1MQAA 1USWA 4M76B 4B7CA 3GFPA 3FNRA 1VZ3A 3LXXA 4MKXA 5KC9A 1OU4A 4E22A 2X4IA 3UANA 1E2DA 1RCTE 5EUQB 4BMCA 2I91A 4ZQFA 2I3DA 2AQIA 1KAEA 3U3KA 5DX8A 3NH9A 2CDNA 2AVDA 3F8WA 2EQAA 2NXJA 3NTUA 4Y2RA 4C30A 5CCBA 1L7DA 4MB2A 4OXXA 2GKGA 1XKXA 2OVFA 3QXSA 4RJIA 3S1AB 3TOCA 4C89A 4G41A 4YMSA 1M1UA 2FPIB 4YRKA 3CU5A 3SR3A 1CUAA 2HBQA 1L0BA 2BL4A 2NO1A 4L76A 4WGGA 1FVFA 2BC9A 5HKLA 3WKCA 4CCYA 1KWKA 5BW6B 3F71A 4C6SA 1PSDA 4QWMA 4ZCMA 3W4JA 4AXXA 3QI2A 2PVSA 3Q7SA 1HMYA 3KUCA 3CEAA 4R8LA 1T2VA 3JASA 3L41A 3BZUA 1X13A 2J6CA 1N92A 2V7UA 2HHAA 1FTSA 4C4ZA 2Q5JA 3K32A 1C0EA 3MIZA 1P17A 1TIBA 1MC4A 2ATXA 1LUAA 3K8YA 5CT4A 3DM5A 1AKWA 3OJXA 3GC6A 1OB2A 1QXSA 1OV6A 4GI7A 2FEPA 5CNKA 4OL0A 2QROA 2JIPA 2EKDA 4BNKA 4R9SA 1DQZA 4GOKA 4LNUB 3ZDQA 3U6BA 4MV6A 2GR9A 4BVLA 3BRWD 4D1YA 3BPSA 3H9GA 4TUYB 4YRNA 3DM9B 2VK2A 3VI4B 1KWGA 4XKJA 4Q9DA 1L3BA 3LPCA 3BJRA 4K81B 5CM2Z 2H2HA 4QPNA 4ND6A 1FDIA 2CY0A 2FEAA 5JNTA 1XWWA 2B6HA 5ALYA 1BJTA 4MDHA 3JYNA 4WBNA 2AFIE 4NNPA 1CUEA 1I3OA 3LUKA 1VL1A 1SVNA 3WGOA 5BSEA 3HMKA 1DEHA 3TTYA 3TSYA 4DDMA 5AUOB 4QUHA 2CXNA 1ZOSA 1W49A 3OA2A 3SEQA 1QTNA 2UUOA 5B1DA 2J0UA 5ITVA 2FG7C 4B1FA 3ANYB 1LPPA 4MDFA 1XMPA 1L5KA 5KAMA 1Q0UA 2C5FA 3STVA 4LOKA 5E9WA 3GLQA 2VK8A 2CHEA 3IE2A 3N39C 1X2BA 3QKTA 1IJEA 4ALNA 2P0AA 3AX6A 1S2GA 1SC1A 3GEHA 3UMYA 1LBHA 4NBKA 3PYLA 4RVSA 1P6XA 1Q92A 1B1AA 5ALPA 1I1NA 4B3RB 1UINA 3MYRA 4OJYA 5FNVF 1E99A 2R5NA 1L8OA 2Q3EA 4PTZA 5H0IA 1KIMA 1OT3A 2W6IA 4K5QA 1Y9JA 2ODWA 4NCHA 4RETA 1RYYA 2IIBA 2YBEA 3RK4A 3O4VA 1KFEB 3GOQA 2GN1A 4YLEA 1L4EA 5AI0A 3TE6A 4JX9A 4KOAA 3VH4A 1TAUA 4AVYA 4JQYA 3VR5H 4RFVA 1RWOA 3L0ZA 1A8PA 2I6QA 4GKJB 4ZCPA 2XODA 5KSYA 4OXQA 3GVCA 4FEAA 1KY3A 5K05A 4YJ2B 3E5HA 3UO8B 1BW9A 1TMOA 4H7FA 4O4JF 4G56A 5JZSA 3OQIA 2Q1SA 4HXFB 5LYYA 3EUFA 3K9WA 4DZZA 1RXWA 4PX3A 3H4IA 3P0JA 1ONOA 2HPAA 4I46A 5AKHA 3FETA 3E9EA 1EE2A 1IULA 3TIXB 5HM8A 1ZN2A 3QUSA 1N5JA 2GPWA 4IINA 2BP7B 1PJBA 4H0FA 1XK6A 3IC5A 1SCIA 1WNTA 2HJVA 1X9GA 1XDUA 2C29D 2WIAA 2WTNA 3B1JA 3KR9A 4YJ3A 4YJHA 3WK9A 5MGBA 1KYIA 2VI5A 2MMGA 1K1EA 3EVCA 3T06B 3NDIA 4JZKA 4EOGA 2UYHA 1OI2A 2O2HA 4ZAGA 2FX5A 5HWSA 4FFWA 1RI2A 4DA0A 3KSBC 2QR2A 1CEYA 1LZKA 3AFOA 1CDZA 3FSGA 3N2GA 2QT9A 4G84A 5D87A 3GB9A 5TQ2B 1PAUA 2DECA 1X15A 2E37A 1K8ZB 2PWBA 1M8FA 3KEFA 3P19A 1TVCA 4GUAA 4Z99A 5AVSA 4FGWA 3D4PA 1ESCA 4FMCB 4BNFA 1JG2A 3G0OA 5HGXA 3WGNA 1OHHA 2ZU0C 1DDOA 1EX7A 4QQRA 1N6PA 4FJ1A 2GJ8A 4CMCA 4UM9D 1S7GA 4MKFA 2ZJ0A 2W9XA 3D8UA 2I2CA 1SH7A 1U2DA 4LAFA 3TECE 4RK6A 4LOLA 2LP4Y 1XZEA 4PNPA 5AI4A 2GILA 1NVWQ 3RVNA 4YX9A 5C3MA 1KAOA 4HXYA 1JFSA 3EARA 1U28A 1IAVA 4TYQA 4ACBA 2V7QA 5LQAA 1QE0A 1P5ZB 1BKSB 4RY0A 4L3WA 2YOHA 1PFQA 2DCMA 1HYQA 2PZEA 4J3FA 4I1IA 4L16A 4Y1FA 4UDOA 1JH8A 2D2XA 2HU5A 4KVAA 1IB0A 2VH5R 3OTIA 3L82B 4DCMA 2REOA 2FFJA 4H7HA 4HN4B 2ZIXA 1T0IA 2ZPTX 3TLKA 4F56A 2I6XA 2GCNA 3MCVA 3MTJA 3Q12A 4WW0A 5IABA 3D6JA 4RFSA 5AK6A 4H7PA 4IVRA 1COZA 1KK3A 2Q3JA 3B9BA 4BECA 3GY0A 2WVHA 3DA8A 3U17A 1KFCB 1T6YA 1JL3A 2V5AA 4J6FA 3RV3A 1T8SA 4PZZA 3UFXA 4MR8A 1Y3DE 1CP2A 4DMFA 1RQXA 1T5DX 2QYOA 3GMTA 2QJRA 2VYFA 4N03A 2X8JB 4QOEA 5LKAA 3V8QA 4N5LA 2XXAA 4ZVOA 3I58A 221PA 2JATA 4C78A 3WLJA 2VT3A 4E5VA 5L7WA 1W35A 4FT4A 3FHOA 2P9HA 3R0VA 1RQNA 4PO3X 5TSDA 1K75A 4NV3A 2HWKA 3H1FA 2J45A 5DHTA 4DRXB 2R1TA 5KU1A 1MH1A 2BP7A 4QVGA 4S2UA 4UJ5A 1BXRB 1PX2A 5EZSA 2C3MA 3ZVLA 4CF6A 2OTCA 4PFQA 4QJ4A 4CDRA 3K70B 3ZN2A 1H6BA 4C0SA 4IAOA 4HHEA 4DQ0A 5HK8A 2PJUA 3B52X 4OXYA 4HNTA 4NEGA 4WK2B 2QZ9A 1Q0RA 3SYKA 4EK9A 2VCYA 4FZVA 3H7IA 5DVZA 4ARZA 1S2OA 1CJCA 3C3DA 3KVVA 2CZQA 2O8BA 1TQ6A 3IJ5A 1J00A 3T5MA 1NI5A 2JAXA 1G5HA 2E6UX 4F93B 1JFFA 16PKA 4LECA 5EERA 4X7MA 1P1RA 3G2IA 4JJKA 4RORA 3UK7A 3TUZC 3OOSA 1OLXA 1Z5NA 1A9YA 3FRIA 3ISJA 3JAWB 3LC1O 4XUCA 5IP5A 2HCTA 2J0VA 4FZRA 4CI9A 1OBVA 4PQYA 5L3VA 3LIIA 4KI7A 3R09A 5J40A 3WJAA 3H04A 2P9FA 5HRCA 4A2PA 3F8SA 1U3WA 2W98A 1MJHA 1IBCA 4HH1A 4RK7A 3KU4A 3HN6A 5DIFA 3L05A 4DIFA 4DJEC 5A02A 4BNLA 1Y7TA 2O48X 1XZKA 5ED0A 5GTDA 2C95A 2ATVA 2OHVA 2PD6A 4Q9AA 4HGYA 3PD1A 1KTIA 1Z4PX 3Q41A 3SR0A 2ZUDA 1ZUIA 3H16A 1Z13A 3Q5EA 3WNBA 3MMZA 4DMHA 4ZOAA 2O05A 1WZCA 1WS6A 3NVDA 1LX6A 4MVXA 4NIMA 4R41A 1U0BB 5HJ7A 5ALLA 3GZTB 1A5AB 3VPHA 2AFHB 2O8EB 2V03A 4JJFA 5BT8A 4ZYLA 5KYTA 2WJ6A 3KSUA 1FUKA 1WP4A 2I6GA 2IYPA 5JZBA 4C87A 2QVCA 4HSGA 2Q5HA 4ALKA 1T8UA 2VTBB 1NMXA 4JQCA 5D8DA 4IOKA 1O5TA 3CO5A 4HDKB 5BVGB 4MB6A 1XV5A 4I50B 5KOYA 1K7YA 2XKBA 1V47A 5ALGA 3KKNA 1H2FA 5DLYA 4M60A 3STTA 4F8JA 4ZZIA 1VSBA 3Q40A 3ENZA 3DAHA 4LSGA 5FFMA 1BGWA 2EP8A 2RCYA 3R4VA 4HDMA 3PEWA 1V5IA 4ZCQA 1Z4JA 1PR1A 1H0KA 2D1TA 5ICEA 3SJAA 3L8DA 4QFMA 1R3UA 5B3JA 1LFAA 3C3JA 5A3QA 3BUSA 4DLYA 1KC3A 1B42A 1JTEA 1TUGA 1UPTA 1J09A 3MHPA 3PYXA 2X5NA 1DQNA 3FIUA 3Q3EA 1QQ5A 2GLTA 3ZIDA 2YJ5A 4TUYF 1MIHA 2REQA 3M2PA 1PG2A 1YS4A 4KYTA 4YRRA 1E7MA 5CM8B 1I2DA 2E4AA 5DM60 4X6XA 5JTUA 1J25A 2G0AA 3QPAA 4IV8A 1WTAA 3WB1A 1FY2A 3DMTC 4P1ZA 3V3TA 1D1QA 2EZ9A 5JMOA 3AJAA 1Q91A 5TRTA 1P4JA 2QV7A 4ZP1A 4AG5A 2XNSA 1AE1A 5LXTB 1NAIA 3TOXA 1LK5A 2GHIA 2HY7A 3REQB 1CE8B 4C05A 1ZGHA 2QE7D 2YS7A 2LWIA 3WYEA 4HAXA 2MSWA 3KFLA 2P67A 3VGJA 4H7KA 3KPYA 3RDPA 5EHIA 2VZ9A 1IY0A 2ZRFA 4XH9B 2WVAA 4ZKEA 3UOAB 3QEBZ 3ICEA 3IPAA 2VWGA 1JBEA 1L5YA 3AH8A 2XWPA 4TKMA 3W3AH 3S44A 2WEKA 2FVYA 2OGSA 5GP1A 2XVZA 4Y2UA 1TO6A 4MQBA 3RR2A 1KU6A 1XMIA 3P27A 2HREA 3WDMA 1Y1RA 3TR0A 3D4OA 1MA3A 3HCBA 1CZUA 1RHUA 4ILKA 1NN0A 5EHZA 1EH5A 3A4NA 4IJVA 2WOJA 5HF5A 4DRXA 2PRSA 1R50A 1T91A 3PDCA 3MQ2A 1NN3A 4UCQA 4YALA 3VR0A 3R9IA 2FMTA 2R6ZA 3F78A 3HS3A 3NHKA 1M0TA 5KWSA 1C8KA 2NNLD 5LZ8A 2A6PA 3A1SA 1V3QE 1W0KA 1I3MA 3LGXA 3SEAA 2M1ZA 2R6DA 3WL6A 5LSAA 1NN5A 1C41A 3AG6A 1ZIOA 1B43A 1JHZA 3LHDA 2EJCA 3QVOA 2CLHB 2QUJA 3D4BA 3P9NA 4TMYA 4XAQA 1P2TA 1RWMA 3QUBA 5B7PA 3CSUA 3HUDA 1TC2A 1QO0A 3OC0A 3GBPA 3EISA 4YP9A 1QO0D 2BEVB 3DHYA 3EGVA 4TV8F 4HX2A 4U7JA 2P78A 3DLTA 1ULAA 1WP9A 2AV6A 2D5AA 3H5WA 3JZFA 5J5VA 3TZKA 4UOZA 3TTWA 2E0IA 4UFPA 1DVRA 1XZJA 3QMMA 1GKIA 3GDHA 4TWAA 1DKMA 2BTQA 3FTFA 4R2WA 4D9HA 3A9SA 3D3WB 1RJDA 4LRUA 2CKMA 2WWGA 1ML3A 4CLOB 1Z37A 1CNEA 1EEXB 1I6LA 4G1CA 1OZHA 3UMMA 1WOMA 3UAZA 1UPBA 1UIMA 3KEOA 3M9XA 3O0DA 1Y48E 3QVXA 5F73A 4QARA 5DN6D 5FTLA 2TMDA 2AOUA 3RC7A 2GAAA 2X77A 3PQ4A 4JASB 1I9CA 2YJ4A 3VH2A 3AK4A 1YZKA 3N28A 4R1MA 4RIGA 3FWZA 3TL2A 3RCBA 1GV0A 4KPYA 3JWJA 4M54A 1PG0A 3KK0A 1F60A 2M2IA 4OAQA 1N34B 1RWXA 1WV0A 2WF5A 1DDGA 5ULLA 3V4OA 4CUJA 4CL2A 3P0RA 3LBHA 1KKUA 1T1GA 2DFVA 4BV9A 1KAMA 1EVLA 1LNZA 2I2XB 1IXSB 1JXOA 1RE0A 4OQEA 3GROA 4E94A 2YV2A 5K3SA 1NW5A 3RYHB 4UHKA 1HZJA 2XUDA 4AF8A 3URMA 3R3VA 4LFCB 3EA0A 4HZUB 3G7UA 3VVMA 2AIRA 1WDKA 5D01A 4EUNA 2Y1FA 3I62A 4B3IA 1V7CA 3R6LA 4QL3A 4C5BA 1U2DC 5AI5A 2FZVA 1YBVA 2HSGA 3CR7A 3RWBA 3FOZA 4PIPA 4BMZA 1QRSA 5U9CA 1JHDA 1NJSA 1U8UA 3DVLA 3PWKA 4JN6B 4M53A 2G82A 2Y1DA 1JF8A 2A9JA 1M1NA 2IHUA 2I8AA 4ENTA 4QECA 5ICSA 1YMVA 3OTQA 1FX1A 2G67A 4I3FA 5AI8A 4BP8A 3QLUC 3A06A 4DMMA 2JLUA 1K7FB 1HE8B 4WN9B 5DJ5A 2FEXA 2H48A 3NTQA 2JGLA 4UEJA 1K6XA 2V7BA 5FOUA 4YPVA 1T15A 2QW1A 3NTVA 4LHEA 1PO7A 3LVQE 1WUIS 3BWCA 1JMVA 1FUEA 3RADC 4Q3NA 3USCS 1HDYA 4IDQA 1QP8A 1NM5A 1SK8A 2YJGA 4RLFA 5EJ5A 3RRJA 4ZZ1A 2VQFB 4B2PA 2G77B 1R5NA 1OLXB 3FCXA 3GEEA 5SZJA 1OX4B 2YNMA 1WXXA 1P9LA 3SSAA 4RMHA 4ETWA 5K4HA 2BHRA 1IWOA 4S1PA 2O52A 9LDTA 2D5IA 1NXPA 1H2YA 3E3MA 3LT1A 2W4IA 4NH0A 2VBIA 1CLEA 4UJ3A 1ZR4A 5LYJB 1FP7A 4LRWA 2H7VA 1H8ED 2LIVA 1KJJA 1O6ZA 2SKDA 1M6HA 5EMNA 4KIUA 2YXBA 2OOKA 4LXYA 3SHVA 2AD1A 4B4DA 4BNJA 5HXAA 2UKDA 3WQQA 4BVHA 2I3ZA 3H9UA 1UKBA 2IYAA 4HWKA 1F4LA 4MUMA 5E1MA 3RAGA 4FFVA 1U04A 3MXOA 3QE0A 4RHXA 2GDJA 3ZDYB 1PI3A 4BX9A 1KOLA 3LBAA 5BQFA 5IKPA 2C20A 4XARA 1RQGA 5HQJA 5CDGA 1NQUA 2CFTA 4KHZA 2H2DA 5FPTA 1VG0B 4MGKR 2FZWA 3L7IA 4INAA 5T4BA 1R5JA 1I33A 4F06A 3H8JA 1X7ZB 3EOAI 4X44A 3T9AA 2VPTA 3FGOA 4PAMA 1IVNA 2Q9BA 3WYFA 1JDUA 5CT9A 3CGWA 3U39A 1KIAA 2J9FA 3RTBA 1FDSA 4EUFA 1RIIA 2FW0A 3JZDA 4NOJA 2W6JA 3DH0A 3ZIAD 4DNFA 4OYLA 5FWYB 4KV9A 4LZNA 4FFPA 4DADA 5LA6B 1RJEA 2CF5A 4NARA 4D3SA 1TT5A 3KVYA 1XNHA 4IIHA 3ELBA 5K3OA 3C70A 1QGYA 2B83A 1ISPA 4ZVNA 4FQ8A 2E18A 4CUKA 1H65A 4P5DA 4YR7A 5A9SB 2JIQA 4TQGA 3WB9A 3S27A 1V7PC 5I4IA 1N6KA 1K6MA 1DC6A 2PS0A 2VAWA 3IULA 4QKQA 5HFNA 1D0SA 2HK8A 4L5BA 1JHOA 4B44A 1IN8A 1SEVA 1S8NA 2ONJA 4M0MA 2ZJ7A 3IUSA 3LP5A 3ROQA 1CFJA 2Q0QA 2PZBA 4YJGB 1O0SA 1J70A 1JKFA 3CWQA 4NMHA 3SVTA 4IKEA 3DYVA 4WOJA 4D46A 2PU5A 1PUJA 3OVMA 2ZKLA 2OG1A 4ARVA 2IQIA 1ZJYA 4W99A 2MYTA 3AONB 2F9FA 5H68A 4LSWA 4Y1RA 1H4QA 1FB5A 4RANA 2B8TA 2X13A 2PXHA 4YRTA 4GD3Q 4Z0PA 3VM6A 4RA6B 3H5NA 4ZPXA 4B34A 3QWBA 4AZTA 2OEPA 4DR3B 2QTGA 4YBZA 1J6UA 2YHSA 8ABPA 4HZUA 1C3LA 4I1YA 4ZV7A 3RV4A 3TZCA 1GXSB 2C9OA 2BN4A 4AUKA 3Q87B 3WZMA 4C3ZA 2YCLA 3IR5A 2C0PA 5DX1A 1ID1A 1IBRA 3NNDA 4OMUA 4CQLB 2DPLA 2FPRA 3AR9A 1S8FA 3BKXA 4O08A 5CPBA 1WZ2A 8MHTA 1HT3A 1UXKA 2QW8A 2WYOA 2WYWA 3F9RA 3ILVA 4G3XA 3WIOA 3GGGA 4OFBA 4ESVA 2NX2A 2ZBFA 3NBXX 3KQOA 4R84A 1M66A 2NZ2A 5I9SA 3FKQA 3Q5DA 3P4YA 5CCXA 2VZ8A 3N8HA 7AT1A 2I7CA 4ECAA 4L4YA 4NYIR 3GBVA 1NVUQ 1AS0A 4FR5A 4B6OA 2H06A 5A6SB 3NWEA 4GRDA 2FR8A 3PPXA 4J75A 4AJEA 1OBOA 5A4IS 2LCIA 3V1UA 4HK4A 3GFTA 1TL7C 4UREA 4RHFA 4YT2A 1FP4B 2QRVB 4JDPA 1U1IA 4FGJA 3QXGA 3RJTA 2J9FB 4YFVA 3WBBA 2AC4A 2C4HA 5D51S 1D8TA 4R5MA 4HSEA 3GGCA 1TK2A 2DWCA 4GX2A 1O96A 4M36A 4WADA 1RXCA 2LDXA 3KXIA 4CFSA 4TZKA 4NBLA 4FFDA 4X66B 2HQOA 1K86A 1BDHA 1A98A 3OM0A 4MWEA 3VVBA 1D9XA 3OE4A 3LCCA 1G3IA 2F9MA 4P3XA 3PFGA 4WKNA 3MB5A 3W4IA 3RUDA 1UK8A 3WR5A 1UBEA 2FZGA 4AL4A 4E5DA 2QTHA 1N2JA 1YWGO 1ZHFA 1RAAA 1XQWA 1X7WA 2BMFA 2PYIA 3D8TA 3GA0A 1JUDA 1VIDA 4QLBA 4QDKA 4UHHA 4DPMA 2UVDA 2YRFA 3K0FB 2FMUA 1JEQA 4ZTZB 4HF7A 3WDSA 1JHXA 4IV5A 1L5RA 4B6PA 3ZHOA 2Q5LA 1GFWA 1V16A 2JL1A 2ZCUA 3C5HA 3MWGA 4IKOA 1IHOA 1TM4E 3GGPA 4FNOA 1U5BA 4Y0NA 4GS5A 5HFJA 5M29A 2J5KA 1N8NA 1KMHA 3LO8A 4RYDA 2B94A 1XU9A 3KQPA 3WMWA 2A14A 3PENA 1NNLA 1V43A 2PFGA 4IDAA 5JQWA 1ZRSA 3MSXA 4EUEA 1HKHA 4PM4A 4K9DA 5CT6A 3WRYC 5B3KA 1I7DA 5ECGC 5LM3A 2Z30A 1R2QA 3JQBC 5ESWA 2QENA 2EWWA 2QTRA 4JP3A 5DLPA 3IHTA 3NT4A 4M9XA 3DZCA 2H31A 3E8MA 3WXMA 1GAQA 5LMZA 1SXJC 2P6NA 1G5IA 3T3MB 3IAHA 5ALXA 4EB6B 3REOA 3QX3A 4G89A 1H5UA 3I76A 4R0NA 2AJBA 3PUVA 4G1BA 2X8BA 1NT4A 1DUVG 1MH9A 1IN5A 3DMGA 1XLUA 1ULUA 3HDJA 1AKEA 4NYMQ 3NB0A 3PFIA 2AC2A 3F1LA 3QG5A 4PLGA 2IUSA 3GLGB 5FBHA 3WC4A 3WS7A 1EUCA 2F8TA 3U5ZB 2XNHA 3L1IA 2P6UA 3ROMA 1KQFA 1R37A 5FFFA 1K89A 3MJHA 1JVSA 3ZCUA 1H2WA 1Y1LA 3QGMA 1QKIA 2H16A 2IC5A 3ZY3A 4OQ4A 1OFIA 2LVBA 4C29A 2QTVA 3EHDA 3JY6A 1RJGA 4BO4A 1U0HC 3IIKA 4I0WB 1F06A 2CXHA 2RBGA 3BK7A 4FSHA 4IFIA 4MW9A 1L1EA 3EWSA 3OT1A 4Y2QA 3ZBUA 3ZGNA 1OLUA 4EX6A 1UMCB 1PUIA 1P72A 1T34A 3ZWQA 4TWBA 1GL3A 3D7RA 3N75A 3LPDA 3SYRA 1TCVA 4Q39A 1KE1A 1UMDB 2FDXA 1QZXA 4E2XA 4F60A 1KZ7B 3FFXA 1V39A 1JJIA 1LY1A 4BQOA 1IB6A 4JKOA 1M54A 2A7QA 4DCVA 4LJ9A 2DGDA 4KXWA 1B3RA 3TCNA 5AJZA 4I9NA 4H4CA 5B7NA 3SSMA 3TRDA 1UADA 1JW9B 5EGSA 3DQPA 2A1IA 3R41A 3PXDA 2OC4A 1LU9A 1GGNA 2X42A 4GP9A 4HVAA 1I4TD 4BVFA 3TNYA 2NYVA 4XCVA 1UR5A 3RS4A 4DHEA 3PNVA 2C0QA 1W2GA 2ZRHA 1E2JA 3TEFA 1N6RA 5KVVA 3W8NA 3IQDB 5L4LA 1AQJA 3ORSA 3BERA 2H7YA 1K0FA 1ZIYA 3CM0A 5L3QB 1OTYA 2VAMA 4LG1A 5AW7A 1SHKA 2VPXA 3L0OA 3DOOA 2ETXA 4OO3A 2I7VA 4B87A 3U56A 5FTJA 3FSJX 2OORC 2GHTA 4C0JA 1M10A 2YZNA 1NUQA 4ZT4A 4TT8A 4CV0A 3NATA 4YRLA 4I2NA 2B8WA 2CL7X 3LBNA 4B4VA 4LXIA 1FVXA 3RVSA 2ZM5A 3LL4A 1M6EX 5JD3A 2C1XA 5K1ZA 4MHSA 3S28A 2IGBA 1UJNA 4JVOA 3SDSA 2CUNA 3I9JA 4G0VA 4HLUA 2R87A 3R7WB 4D2IA 1U3DA 3AP2A 4P38A 5AOAA 1U8ZA 4BU0A 1UJ5A 1Y4DE 3QU4A 5BSKA 1QR6A 3KTFA 4FQ5A 5DNCA 1A72A 2OCDA 1HLGA 4GXTA 3ND9A 4V0SA 3RVLA 3WLTA 4Y0AA 5JZ9A 3AY6A 1KXZA 4IUCS 3M1IA 1KNQA 1WSBA 3AGPA 4X45A 3LCRA 1ZVVA 3I9MA 4DMUB 4F2PA 2GHQA 4UTOA 2HA7A 2NU7A 1GPLA 3R9WA 1NJ2A 1ENZA 4EJSC 5JANA 3BWXA 4YQEA 3UB4A 3EUWA 3O8OA 1CJSA 5BQ3A 1EUYA 1HT2E 3SX2A 2HADA 4FW9A 4NCIA 1E2QA 1KI8A 5CJ2A 3L04A 5EFOA 1Y4SA 2NXCA 3M6XA 4ZANA 2C7QA 4IP0A 3NR2A 2OBMA 2DXIA 4M0CA 4ZOLF 2IV7A 2QSJA 1SB9A 4ER0A 2QVZX 1ZHHA 4FN5A 1G4UR 5A5DA 4F5ZA 1PL7A 1D6JA 4I8DA 3FOEC 1WETA 1EK1A 2GEVA 3PR1A 2GN2A 2C2MA 7REQB 3IHWA 1YBHA 4MUKA 3K09A 3FSRA 1XYVA 4YBRA 3TQIA 1XKLA 5BN4B 4KAAA 5FF9A 3RU3A 4L95C 1E3WA 3BMQB 3MTQA 3PIRA 1CUVA 2GEDA 1ORDA 1M2NA 2ID9A 4U9HS 5L4NA 1E3LA 4RYLA 1PV4A 1VKZA 5BR4A 3O92A 1QRRA 4Z51A 4YO7A 2V9ZA 1N57A 2WT8A 2ZB4A 3EDYA 3OPYI 2DBZA 2DFDA 1JKMA 3F6RA 3H3XA 5IKEA 3ETDA 1NA5A 1YH3A 3JQFC 3LFUA 5TEVA 5LOVA 2CVHA 5A7GA 2ASEA 1A7UA 2HU2A 3DZDA 3PA8A 2AMYA 3F5SA 4IMRA 3M89A 1LI5A 3DZKA 4PWYA 4CTJA 3PX7A 1FNNA 1ZMOA 4HWSA 1R8QA 3I5YA 3T3PB 2C5SA 3UWPA 4II7A 4ZVSA 1XKTA 3WK5A 1O6BA 3OFJA 3ZDFA 1I6WA 3AUXA 4QYTA 5JNLA 1FJGB 3I6ZA 4BWFB 3CLKA 5J2TB 2IF0A 1B2LA 2IVZA 1VBFA 4HO1X 1W52X 2AXPA 1Z7BA 4J0KA 5KTMA 1PE0A 3LRTA 5IJ0B 4BTLA 5JS8A 2QQFA 3E9MA 3HRKA 3O93A 2QUAA 4LI0A 2P4EA 2W90A 2PSJA 4X1KB 1PFVA 3UTDA 5K9ZA 5DT9A 4BV8A 1I4WA 1MAUA 2ZE5A 1LV7A 3ELYA 4G36A 3TVYA 1AOXA 2G28A 3PITA 3SC4A 1AQUA 1TTTA 3ECCA 2HPVA 4FUTA 4C4AA 4OG2A 2ZE7A 3NHJA 5EPUA 2XMCA 4XDGA 5L3RA 1JIUA 5KSZA 1ZLXA 4OHPA 5D6OA 2IYYA 1UBRS 3GFVA 1ARZA 2AN5A 4J4HA 4G86A 4WERA 3UKDA 4FB4A 4NE9A 4X20A 3HXQA 1YQ9A 5LMUB 3PGMA 2MYPA 3NX4A 5DWDA 3ZZ0A 2VJBA 1EINA 1PNQA 2AG8A 2GJKA 3CLUC 3I9NA 3OEHA 4GI5A 1I1QB 2NU7B 4PZAA 2QRZA 3BTUA 2H4HA 5FI5A 1NJ5A 1UCFA 4JY7A 5TVKA 1E3WB 3BMQA 3RUCA 1VP3A 2EJUA 3R4CA 2VDLB 4NYMR 2MU1A 2A92A 2EZTA 5EZ6B 3EXIA 4CIXA 4EKEA 2C3OA 2AOUB 2RB4A 3P97A 1P7WA 3W78A 4HMPA 4L57A 1A76A 1GRQA 4RGBA 5ICGA 1S0UA 1RSZA 4EATA 1M5TA 2FW6A 1GL7A 3C5CA 3DE3X 3D7KA 3T1YB 4HTAA 4L3OA 5JWHA 1SXPA 2VT7A 1F2TA 3QLVC 1EFKA 4OQMA 3ZY4A 3ESYA 4CL3A 5I7UA 5M2QA 4ID3A 2R1TB 5JMPA 3P0EA 3MN1A 2GJAA 1N2GA 2CLSA 3VHLB 4XWYA 2Y3IA 5IJ0A 5G3ZA 4KNWA 4F96A 3ND7A 3L06A 2AOVA 4CTKA 4IDHA 3DDCA 1E2LA 5JDCC 4B74A 4JOBA 4F5EA 3ZEAA 1ZONA 4MX8A 2C98A 1G0NA 5BRAA 1JB1A 1SXJB 2BMWA 2ZQYA 3EIWA 3I05A 2KHZA 3G2PA 4FEGA 4GFDA 3UXEA 4ENQA 3GRKA 5FNZA 1FSGA 3H87A 4AS1A 5HIJA 3UAYA 2KPOA 5IXJA 1EWKA 3NXKA 5LOVB 3DMPA 1ZIPA 3NTLA 1JLLB 1W36B 2W11A 1YJ8A 2RAUA 4RFSB 3NRBA 4LXGA 4OV6B 3D6NB 2NVUB 1SZDA 1X1QA 1ND5A 4ALLA 1MGPA 1WG8A 2CC2A 2XIJA 4M55A 5T7BA 1DLIA 4WAUA 2BR3A 2JLSA 4TYPA 4YTEA 2BJWA 1W0JA 1YDHA 1TO1E 4ZOLA 3THWB 3E7PA 4BVEA 2VDWA 2JFGA 1OHHD 2EFGA 4P3KA 2YZ2A 5K3AA 3BIXA 1BYIA 1SQFA 5DW0A 5ESXA 4YI5A 5CG1A 4L73A 5M5BA 1OXUA 2AOWA 5KQRA 2ZUFA 4A15A 1M9NA 4DABA 1OYOA 2ENWA 4YCBA 1MG0A 1EFVA 1TYDE 5ISMA 2O4UX 3Q0EA 3VTFA 3QVJA 5SICE 3GW8A 1ZC3A 3NU1A 5GONA 1HDIA 3K2QA 1GGHA 3NO4A 3NBKA 4K9PA 4J3NA 4YAGA 1PJ4A 3HBAA 2HRDA 3U4IA 4AROA 1YS7A 5E0KB 2OV6A 3G7SA 4DT1A 4YV2A 5A1JA 7ABPA 4WK4B 1MABA 1WULS 2X40A 1LH0A 4GYJA 1L7VC 1U28C 3F6YA 4RSRA 4X91A 1POWA 5F3RA 1JG4A 3CUYA 2I2AA 4R4JA 5K0FA 3USZA 4G5YA 2VF2A 3HFRA 1R15A 4QOSA 3Q2IA 3L1VA 2WW8A 5K0BA 1I14A 5J1SB 2QP9X 1JLKA 3V1LA 4WFIA 2AFRA 1F4VA 1WUTA 4MR7B 5KVCA 4P8RA 3LYHA 3NVAA 1ECCA 4HDNA 3PHJA 1P4HA 3GX1A 1ZD8A 1PFGA 1F38A 1S8AA 3WK4A 5AHXA 5E6SA 2GYYA 2C78A 1E64A 3CXRA 5D7BA 1VC2A 5J3JA 2Q2NA 1GG2A 1TF5A 2YWJA 3W6UA 2FOLA 3ANXA 5K3BA 5JHGB 4AN0A 1MD9A 2UXBB 1MJGM 2F2TA 5JEDA 5C8YF 3UHJA 3WGYA 2Y0DA 3L8ZA 1QIMA 1BC5A 4C4TA 4FYYA 4RLHA 5DNEA 2HD4A 5I7SA 4EY7A 1G291 1FXWF 2Q5CA 1X80A 4EHHA 4O8CA 4F3TA 2WT4A 1A8SA 3C15C 2ZEJA 3FNHA 1DT5A 2VHEA 3G9UA 2XBUA 3E3OA 1YB1A 2OA0A 3DVSX 1RI1A 3HCRA 3TZQA 2LUOA 3C6MA 4BX8A 5M7EA 1OIVA 4LNHA 3B9QA 3D3NA 2RJOA 5DV9A 2WJ3A 4YP5A 4QPPA 4BFVA 1XCOA 2JGNA 3U3JA 3I8OA 1H22A 3OE5A 4OYRA 5B3LA 5JQGF 3CXUA 4FQ7A 5K0LA 4AMBA 2R5WA 1K9VF 3PXXA 4LCBA 5TX7A 2Z43A 2D1YA 4GLLA 1XDZA 3WI7A 1W36D 3ZNQA 1AK2A 1W2WB 3MJSA 4K05A 3K5PA 4FDAA 2ZKIA 2X14A 1RPZA 3O8LA 4JU8A 3EZYA 1Z6XA 3GJ5A 1Y1QA 5IXSA 2ACKA 4TQAA 3A4TA 4OTZA 5ITZB 1QLWA 3ETGA 3ZHBA 1LTQA 2QMHA 1PGNA 1SHTX 1WMDA 3AVWA 1DFGA 1HETA 1NRJB 1NURA 1U4SA 3IODA 2FWIA 1Y4ZA 3BXOA 3O3CA 5KVSA 3U1BA 2IS1A 4L8LA 3MA0A 1HDXA 3ZWMA 4E13A 4W82A 1ZGGA 3SBDA 3IQFA 4EPXA 3CZAA 1MO3A 5AH0A 4IJ6A 3MEQA 2ZI5A 3HR4A 4ETIA 2QORA 5EQTA 3ZK9A 2FZEA 1K9SA 4DSZA 2PX2A 3AHIA 3THYB 1U7PA 2X3YA 1GTG1 2DH6A 2WUFA 4L0DA 1LBIA 4D4HA 3E53A 1U7OA 1G8JA 2O3TA 4WNAB 3WQHA 3HYSA 3GUCA 5TGTA 2APJA 2XB6A 1K3TA 3KUUA 4HMOA 4TLDA 3ZDAA 1YRBA 4PG7A 2ZJYA 1Z47A 2YIVX 1B14A 1BHSA 2WAMA 5TPZA 1Z73A 4QNNA 5C3UA 4RTQA 3QF4A 3UCFA 3KUDA 3EX7C 4OBXA 1SHLA 2VP5A 3EPHA 3GQBA 4BE7B 1PZMA 3K0EA 3VOAA 3BRSA 3BICA 3WLRA 1T3SA 4PFKA 2Q1XA 3JXEA 3KZMA 5AKYA 1R9MA 3G9XA 1RXEA 3NPMA 4CMHA 2NTYC 3IXLA 4FXPA 3T61A 5AW8A 4WOCA 2CVFA 4OOFA 1TK9A 4NV1A 4EEXA 2V3CC 3X3HA 2DC1A 3AJEA 2JHPA 3VJKA 1WR8A 4EPTA 1MDBA 3AF0A 1PDVA 3RS0A 5KYXA 2ZZMA 1XQYA 4BNWA 5CPFA 3BJZA 3BEOA 4OLJA 3WSTA 4D57A 2Z8XA 3DV0B 4PHCA 4S3MA 2XZOA 3EYAA 3QU7A 3T5PA 3HN2A 1Y9ZA 3GOHA 3V8VA 3BFXA 1P9NA 2CBGA 3SD7A 4JT9A 4OHUA 4KQXA 4FVTA 1PU2A 3OIUA 3LUPA 3V8PA 3ZBPA 4KXFB 4NECA 2FQQA 2GBFA 1H6AA 4QDZA 1LEHA 2P0YA 5DKFA 3L4BA 1NBAA 4MI9A 4AP9A 5B7GA 1VFPA 5CDFE 2J0SA 3IAEA 4ZQBA 4CTOA 3PQ5A 1ZGJA 5BT9A 4WJZA 4WLEA 4PFJA 3IJEB 4CEIA 3RWOA 1Q1BA 4D96A 1BWRA 1RRKA 3VC2A 4FKMA 1YQEA 5H80A 5FLXA 1AO3A 5GJBA 1FX0B 4PFSA 3B9RA 1ZVQA 3A3YA 1PG5A 3DP9A 4QG7A 4ND8A 2WDZA 1DC7A 2VCEA 1P0FA 4WCFA 4R3NA 4Y9RA 4YYZA 5L3SB 1KY4A 2GBLA 1FL9A 1EJ6A 3DZFA 3BD8A 1UMKA 3GJ4A 4L22A 3CWCA 1U0SY 5C5IA 1Y8QA 2OILA 3BF7A 2YWRA 1ORHA 3RIEA 2FN8A 3L0SA 4RNCA 4CN9A 2VK4A 2RI6A 1CIVA 4QG3A 1FTNA 3JQAD 4EUSA 3FTNA 3PHLA 1JEJA 1ZK1A 2DOKA 3GPIA 1EQ2A 2VNKA 3HB5X 4I1OA 4A92A 4TZ0A 2R7AA 2Z6QA 4AB1A 1NVMB 1OIWA 3JZAA 4IJKA 4L9AA 4P4SA 5HS4A 4HFNA 3X2SA 2WJVA 3VSBA 3HVIA 4BJ1A 3RC3A 5TB5A 3DEFA 2VQ3A 5F4BA 2CLDX 4HYTA 2B36A 3HL0A 4MARA 3OO1A 3M4JA 1M34A 4O0LA 2VAPA 4FGUA 4F12A 1I3NA 2ZUBA 4EENA 1BE0A 1HK7A 2QD4A 4ZT5A 1MFPA 3BE6A 2QMZA 1ZVMA 1U2GA 1O3YA 3HVKA 3HO8A 3DZJA 3C8MA 1JIJA 4TGLA 1FSFA 2WWHA 3KB6A 1K5DA 5CX1A 3ZWVA 4D5EA 1XQ9A 5T8KC 3WLMA 9ABPA 3QTLA 4JOSA 3CG0A 1KDRA 3GHYA 1AM4D 3GZNB 2RSLA 3VFDA 3FCEA 1G2PA 2XD4A 4A6DA 4MWCA 3I04A 3TTTA 2JCVA 3EXEB 4JJ6A 3O8BA 3KO8A 1OC4A 1OAKA 2XQGA 3AKEA 3R20A 4ZGBA 1X8LA 1TYCA 1KZ4A 3GRFA 2FCRA 4MWGA 1U80A 5FOWA 4KFSA 4WKOA 3FRHA 6REQA 5FH9A 3JTEA 1X7GA 4QFDA 2HIAA 4JYPA 1GQRA 1WO8A 4LVCA 5NULA 3IMEA 1D09A 1GAJA 2NTVA 3O4IA 2QK4A 1DXHA 4CEHA 2JLCA 2H57A 3VI3B 6ABPA 5FWXA 3GMSA 4WN9A 1YRYE 1MRNA 3NUQA 5G3YA 4D3ZA 1IBKB 2BE9A 3C3BA 3LHSA 4RJKA 4X1YB 4XWOA 5KO2A 3KYIB 4KMRA 5H4GA 2WM8A 3BRQA 2FKAA 4MQLA 1YZTA 2I1WA 3MIIA 3N6XA 4WJLA 5CB4B 3HDTA 3MT0A 2PFSA 2YN0A 3G9TA 3QNWA 1Z5GA 4KPUB 5J5AA 4KLAA 5L6LB 2QTVB 3BG5A 1PN3A 3OHSX 5EI5A 4MVJF 1FTGA 3MS4A 4OK6A 3DDNA 1NYLA 2VEDA 3E70C 3DL2A 1E3DA 4S24A 1CEXA 2O6HA 4UNNA 2NZUG 3SXPA 4K9OA 1VRCA 1B00A 2NACA 3GLHA 3V4LA 4C76A 4NE2A 3KELA 1U9IC 4YYEA 4BFCA 4INJA 2ANCA 2AWOA 3Q3IA 1DC8A 1I51A 1JYFA 2PKWA 4XLTA 3ZGZA 3B1VA 3E5RA 4LC9A 2JANA 2OK7A 3HKDB 5BVHB 3EZNA 3H5VA 1IMJA 3RC2A 4B5KA 3RSGA 2ZTVA 4IZOA 4Q47A 3S2YA 5CK5A 1OWPA 4FDTA 1KR2A 2QJFA 1KNXA 4RCZA 3FBGA 5IFLA 5LZ4A 1W46A 5EKDA 1Q50A 4W5NA 1MORA 3ZS9A 3Q7EA 2DWOA 1GM5A 4RK0A 2FK7A 3MJEA 4B82A 5B57C 3AJ9A 1NQWA 2AKYA 4EG4A 4R71A 5IKMA 2I99A 1ST2A 2OZVA 5HSGA 3G85A 3B5EA 5B53A 1Q1NA 4CG0A 2ZBQA 5AJWA 1RRPA 5AXBA 1DFHA 4HLUC 2OHFA 1APBA 2OUIA 5K01A 1NY6A 3IIMA 4KBFA 4ND7A 3GD5A 4M1YA 4Q18A 4AYWA 3IDOA 1DOAA 4URUR 3O1JC 1K7EB 1UC5B 6Q21A 2EC5A 2ZVDA 2C99A 3NALA 5AVYA 2DBVO 5T4EA 2G1KA 3KYCB 3CRQA 3GFOA 4EZIA 1DJQA 1RXSA 2G5CA 1GZUA 3K0FA 4XI9A 3PCXA 4YMIA 3B6KA 3HU3A 1L9XA 1LV8A 3ROZA 1N9GA 1C3VA 4DQKA 3DKIA 4FFBA 4RZUA 1JHMA 2R66A 4GVLA 2V65A 5KOHA 1BO6A 2XTAA 4YJKA 4F9GA 3B12A 4PPGA 1E4EB 5A4FS 3DLPX 5HJEA 2NM0A 2PUWA 1YDMA 2COUA 3IO3A 2WZDA 1XXHE 1CJMA 3OLXA 1IRXA 2A5DA 2QVGA 3OUZA 4DIOA 1OH7A 2CSUA 5KMGA 1KJZA 2AF4C 1E8NA 1LB1B 1BDJA 2V7XA 3KLMX 3VDRA 3VZBA 1Z4IA 4OGGA 1VIAA 2J7PD 2OHHA 3BH6A 1JEYA 3MJFA 1SN7A 4YPOA 3ZDBA 1IUKA 3H5TA 4QDUA 4E88A 2ZRLA 1VECA 4JC4A 5ENVA 4OYHA 3AIMA 3CH4B 1NPYA 4EELA 2CBZA 1SG6A 3H8SA 3RUPA 2YDYA 4EHFA 1H2HA 1TAGA 2GLUA 2VWHA 4GO1A 4ARZB 3H0KA 4XD2A 2FPPB 1KBZA 1O5OA 4RZ2A 4W9NC 5JJKA 3K31A 5YASA 1XPOA 1UXIA 3TAXA 2L19A 3IEIA 4FD2A 4RF2A 3TW6A 1KI9A 3LVBA 1FFXB 4K9NA 4XEUA 1FSSA 4R7TA 3GJXC 3ERCA 1JQDA 4WA8A 3FF1A 4OB7A 1UBLS 4AZVA 1BQEA 1Y7PA 4JMLA 3TLGB 4PTLA 1RTKA 2J5RA 3AUAA 3BZBA 1T2FA 2O1XA 4C4OA 3AOGA 3HKDA 5A1TA 2G9QA 3F49S 5FAXA 1SCAA 3SLGA 1WJGA 1VL5A 1BCRB 3EDOA 1CU1A 1KQOA 2R1ZA 1XMSA 4N3GA 3T3HA 1RRCA 2V7EA 2XQFA 2NYUA 3VTZA 1YC5A 2HK9A 2WWXA 2VQSA 2PWPA 2VTVA 2AUTA 1H2BA 2P9BA 3OLYA 1H94A 1I6MA 4PZUA 4ZD6A 5BSRA 3IE1A 4OLBA 2VP0A 4FCCA 4LJAA 1T5BA 1DBQA 2G4LA 2IHKA 3FLAA 2PJRA 1T36B 5FT9A 3VNBA 2HJRA 2IFTA 3I04M 1CRQA 1XZHA 1GD1O 1JE0A 2OB2A 1ACJA 1CCWA 5JS1A 1OFHA 4AN1A 3H86A 4E03A 4P7GA 4QGGA 2NUTA 3GEDA 2ONCA 3N05A 2EFJA 2VP3A 2ZSKA 5HG0A 3RC9A 2GDZA 3KDPA 2BKVA 4K6KA 4D42A 3BCUA 4YMGA 2JLZA 4TLLB 1TGYA 2RHBA 4J0DA 3VJLA 1GARA 1R0CA 3EMKA 5GJCA 1E1RA 4KN8A 2MMCA 2JA1A 1GNLA 2BFCB 2C31A 2FWRA 3RU9A 5LQUA 4CF7A 4LF7B 2HIHA 1I1HA 1HRDA 3UW1A 4JWKA 5DLQC 3S4YA 3WYDA 4EKGA 2R2GA 2AJTA 4MEJA 1JIVA 3OZFA 1X74A 2QG6A 4ONEA 1BOFA 1CLUA 4KMMA 3DL4A 2N0SA 4AKIA 3FPEA 2COKA 2QLNA 3OURA 3LC0A 1N0HA 2WM9B 3RHTA 1V5FA 4C7JA 2TMYA 1P5FA 3DOHA 4YONB 5GPBA 1G1MA 3C4VA 1CSEE 1FCJA 3LHIA 1XAHA 2Q8PA 2RAPA 3QK7A 5EZYB 3ROKA 3UJ3X 5A4MS 2Q07A 1GNTA 1U94A 2F1RA 5E4FA 5IFKA 1ZXLA 1ZA1A 3Q8XB 4MKZA 1CR6A 4MVJA 3FYHA 2H63A 1XN4A 4R8SA 1YRAA 1D07A 1PBNA 1XZLA 3ON5A 3INRA 4LY9A 1PJCA 4IUBS 2D59A 3OIFA 3S70A 2H1HA 2ZYVX 4QXOA 1RAEA 4W5HA 3FH0A 4RY2A 3LPLA 2E5FA 2QQ5A 4G2TA 1DC3A 4DIDA 6AT1A 4NMXB 2OBFA 5J4HA 3MJTA 3OCYA 4H6PA 1GU0A 3AINA 3CB4A 3E82A 1Y80A 1RWNA 4P22A 2OC9A 2BGKA 3R6WA 5DZSA 4ZMBA 3O9MA 3E4CA 4LCJA 1AMNA 5CVUA 3BL8A 4RMGA 3OJFA 1ZJ5A 1IAQA 3QOXA 1KFKB 1NI4B 2Y27A 3SLKA 1QHNA 3W05A 1KZ9A 1SA0A 3C5EA 2R60A 5BR1A 3W7AA 1XU7A 4ZCSA 3LWNA 1R27A 1XMVA 2W4MA 1QFXA 3E22B 4R2KA 3PJGA 3HFSA 3QBTA 4UVIA 1ORVA 1Y9AA 2EZUA 2IYEA 3KBBA 3OWHA 4L5IA 5E8JA 3KKKA 2H1IA 1SBCA 4KG7A 3CNLA 2VG8A 4ZVMA 1TZKA 1SHJA 4HATA 3W9BA 4DUGA 4H1WA 5IVPA 2ZT6A 5ALHA 1AKNA 2Q50A 4UFOA 4Z9FA 5FPQA 1I5OA 1AHHA 4MVJG 3TJMA 4JBNA 3O94A 5G2OA 2IX9A 3CUEF 4OHXA 1IVYA 3DCJA 1ONBA 3KT8A 1QFJA 4IXMA 4DV4B 2NZ8A 3WAKA 2YZKA 1SVWA 3MERA 2A4MA 4D82A 4LHVA 5IAAA 2IK8A 3VU9A 3IS3A 2JIRA 3VZQA 2WNSA 4DGSA 2XY4A 2GM5A 2H2AA 3L7JA 2A1TS 2A1UA 4I5EA 2VNHA 4FKBA 2QP4A 2FXVA 1YZHA 1YI8A 4MP6A 4YQZA 4A6EA 3TCKA 3GT0A 2DUMA 5B7QA 3UIEA 2TMKA 4MNTA 3AP1A 3WJ2A 1KEKA 1OX5A 1XZBA 2REQB 5EXPA 4WSOA 3UHPA 3QWHA 2JIBA 5H81A 4C06A 4D9IA 4CJXA 1J56A 1E8DA 4D9JA 4L9SA 4KFCA 2X5JO 2FW7A 5KDDA 1C2YA 2V54A 3OPXA 4PXYA 2YW2A 2LR0A 2CYBA 3FLMA 5H3CA 1Q20A 4YS6A 1NFQA 1SY7A 3MJVA 3PHHA 4WY5A 1ZJWA 1C9MA 1QHHA 3OE7A 4NZNA 5AUQA 1SD5A 3VA7A 2FYTA 1ZQ1A 1UC9A 4MPTA 4QDTA 4UE3S 3LHKA 5AXDA 1QONA 1R5BA 4JITA 3KJXA 4U2BA 3IP3A 3I4LA 4BO9A 4GHWA 3M4ZA 4P3NA 2EQ5A 1YS1X 2NU6B 4RPLA 3VDMA 4KPEC 1ZOIA 3GXBA 4HFJA 4Q3AA 4R2JA 2YS6A 2QU8A 5EJ6A 5E7JA 5LBTA 3AXSA 3W6NA 2QRGA 4WXEA 3DGEC 2AFHA 3I01A 3MPUA 5C1BA 1H9BA 5CXSA 2GXUA 2WICA 3E2PA 3RVBA 4N65A 3ADBA 4GSYA 3VUFA 3CH6A 3M9WA 3A7EA 1GV1A 4HEHA 4P9NA 4OLHA 4Q4HB 2P9YA 4QREA 2A9QA 3HCNA 4AWAA 2SBTA 4R8VA 1SZPA 2ATIA 2UZ1A 2EF0A 3AV3A 4B3FX 3OQVA 2R8ZA 3BXXA 3R7LA 2OPHA 4M0EA 2AT1A 3B36A 2FQWA 4Y9TA 3CLUD 3H9QA 5DT2A 1JQAA 4AF7A 5E3HA 4DQVA 5DHPA 2FWAA 1MZPA 5H82A 2YICA 4BFUA 4OBWA 3QJYA 1P39A 2FWNA 3LBFA 3AVPA 4GSKA 4QXAA 3BBPA 2F3SA 3N58A 4P33A 3GYGA 1E4VA 2F43A 2PH1A 3R8XA 4R1UA 4AMYA 5IU6A 4MA5A 2ERYA 1HDOA 2QE7A 1U2RA 2IDZA 3IAM6 2W2KB 4ISBA 1VBMA 1G64A 2OM2A 4J9UE 1E7SA 1CF2O 2ZG6A 4RTRA 2C96A 4MVJI 4HYYA 3QX9A 5NLLA 3HXTA 4Y9DA 4EO9A 1DJPA 1U4NA 3BS4A 4D9BA 2XDAA 4UEQA 5JAMA 3HU1A 3SY8A 2I54A 1G8AA 3D4NA 3BYZA 3D02A 1OE0A 1YFZA 5HKKA 4IDOA 3KOXA 2C5EA 2IU6A 3FA2A 4TV9B 3HRHA 3TG8A 2IEYA 3V8RA 3WAJA 3OMXA 3TDMA 1QP7A 3EXFA 2G83A 2XUOA 2IZ6A 2JFNA 2Z5GA 3GLTA 1I2ZA 2IYTA 2W6ZA 2XTZA 3I2FA 3NNSA 1QIHA 3O90A 4Q7JB 1M1YB 1KKLA 5IARA 3HL4A 1VYUA 5FEUA 1UWKA 3PR2B 3AESA 1K3UB 2PZJA 2XCQA 1PEKE 1KVSA 4TLEA 4X6LA 2C7GA 5C52B 2I4NA 5JYBA 4MS3B 3G8AA 4UHJA 2NW6A 1NQOA 5AUNB 2G6BA 5B6IA 2G6TA 2W93A 1W4CA 1N2ZA 3D6FA 1TPYA 5C4IA 4KNYA 5CK4A 1LSSA 1U2SA 2ONZA 1V45E 4OOEA 3V7YA 3HU2A 4LJ4A 4HUJA 5ANRB 4UBJA 3GLHB 5CB4F 1JR4A 3KHSA 4COKA 3FUCA 1A1SA 2W0MA 4ZOCA 4JA2A 4TS3A 4TT3D 2N1MA 1P1CA 3EODA 3A36A 2GRAA 3IKLA 4WEOA 3PE4A 1NKSA 5DN6A 3VMMA 4MRAA 1QV6A 4KB5A 4HQLA 1Y6GA 2Y2VA 3PDHA 2CLIB 3VTAA 4ESHA 3KL2A 4MPJA 2LCQA 1DRJA 1XELA 2IEGA 3ZW9A 4DDKA 2Q2VA 3GD7A 3N2ZB 4H3SA 3UMRA 1B7GO 1MB3A 2B8EA 3UF0A 5H9WA 3L0YA 4PX5A 3OTOB 1AV7A 3HSKA 4ZEVA 4RS3A 4IOJA 4DZRA 3U7JA 1VMIA 1B8PA 3FUUA 4L4ZA 1O97C 2G04A 4OX9Y 3FB1A 4PV7A 5CR9A 1C3OA 3GNTA 3STUA 4RJ2A 1P4GA 3SK0A 4FIZA 2A5LA 1F48A 4NVRA 3AOEC 1JBQA 2JGDB 4O2AA 4BNNA 4WK6A 4D9EA 2VP2A 3IESA 4MPPA 3EDQA 2FEKA 4MPRA 2IBSA 1J2EA 1DAOA 1DCFA 4F2GA 1G8SA 5LLSA 1H05A 2DR2A 4G09A 3ZWDA 1ZH0A 3CX6A 3W9UA 1GTRA 1KYWA 1ZFNA 5HUQA 1QFMA 4CM6A 2GZAA 2PGXA 3A2KA 3WYNA 1PJSA 4M1KA 1Z6ZA 2AMJA 3X1JA 3DVAA 1NW8A 6GPBA 3EGDA 1VE3A 4MYCA 4CQMB 3U1VA 4QGHA 3ZLJA 4YP7A 2GZ3A 2GTPA 4RF3A 5BSTA 5E2IA 2R86A 2Q9UA 3K9QO 2PH3A 4DBVO 4ZO7A 5JXJA 2O5EA 4BGUA 1TD9A 2FAXA 4NJOA 1AGNA 4UUPA 4J1TC 5ALKA 2NQ8A 3DT6A 4J94A 4ZVTA 4NPAA 1Z6QA 1NW9B 4DV2B 3OJOA 3O8QA 2CHGA 2GPBA 2X6QA 3ICVA 4W9RA 3D3KA 1XQ1A 4KKXB 3A31A 1FQKA 1KAHA 2E5WA 1IZ9A 1GLVA 4UCWA 4G4SP 1MA0A 3DHEA 4KQFA 4Y2HA 4GI3A 3LX8A 4KZPA 4BB0A 5EIOA 4BP1A 2IEAA 5A3JA 4RTSA 3ZTWA 4DFDA 1T2AA 3TQHA 1J33A 3KTAA 3GN1A 5AJTA 4ENWA 1JDBB 2C84A 2J6IA 3ITKA 3NUGA 1P1BA 4DEVA 3WBJA 4DR7B 2ZIEA 1RHKA 2QLJA 3CS3A 2JDID 1MQ9A 5G0VA 1QE5A 3GJ0A 2WD8A 3KM0A 4IOLA 4KE9A 4BLSA 1IL0A 1RAGA 2DY1A 1JIQA 3E1GA 4V3CA 1RFLA 5DTIA 4MUGA 2WHQA 4AYTA 4G0NA 1ZM7A 3CKKA 1ULTA 1UQUA 4WV3A 4ZI5A 2A86A 4ZOLB 2PSHA 1OI3A 1ULHA 3WLLA 3RM3A 3MTEA 3IIEA 1HH4A 3FVWA 1I4DD 2QE6A 1W5EA 2WDPA 1CRZA 2YNMC 1SAYA 1DHTA 3CSDA 1JAYA 4FI3F 4J8PA 4JI3B 3VR2A 5JAUA 2P7IA 5H8WA 3CH5A 2X0FA 4KX3A 3Q7IA 3K4QA 5EL0A 3WHPA 1Z0JA 2JNWA 2O0LA 1KDOA 3JQ8A 4GZMA 4M1EA 3HPQA 4UPEA 1NJ8A 2BGIA 2VBFA 3WY9A 4UVHA 1L5GB 1XLTA 1SBNE 3BDVA 3SE7A 3TQSA 2AA3A 2X2EA 3O8NA 3ZKWB 1L8XA 2EL7A 2QLBA 4D6PA 2ZAYA 4D0NA 4DMCA 1N9ZA 2O2CA 2ZIAA 3OPVA 4LC0A 3HBMA 4RO0A 5CUQA 1VI6A 3D3EA 4WFJA 2FE4A 4YAWA 2FRDC 5DNDA 1QCDA 1WSWA 1JG3A 4OEHA 4W5QA 1Z34A 4QEZA 2CNWD 2EEZA 3H2GA 3LUJA 4F5YA 1X7DA 3ETLA 3L8HA 4FI3C 2JZCA 1CG6A 1NBMD 1BN7A 1X87A 3NETA 4BNVA 1O77A 1NF9A 4DR4B 1FPMA 4K9RA 4MR9A 3RIHA 2XDYA 1E9RA 2VJYA 3E61A 5F33A 1XZFA 2I33A 3ER9A 2Q6TA 4Z49A 4JLAA 1PVVA 3RLIA 1I9GA 1C1XB 3SBEA 2H1SA 4DF3A 3ZXSA 1KH2A 3EZ9A 3HV2A 3DHVA 3ZHRA 1KOJA 1ZHOA 1MNQA 2VLBA 3GEPA 3PDUA 4KXQA 2WG2A 1P0PA 3OFNA 3AC0A 3ZHYA 2FSPA 1MFZA 3PS9A 3DMRA 4GZ6A 5CCEA 4W5TA 1FDTA 1Y7HA 4YGXB 4BX3A 5SYNA 3V8BA 4WZAB 4CHTA 1D6NA 4ZHQB 1W9MA 1T3TA 2GUWA 4G8DA 4M46A 3UUWA 1CUXA 5EJ2A 4OMDA 4BAZA 2FPGA 2JGAA 3KLBA 1THGA 2XW6A 5DGXA 3GV0A 1R0WA 2QPAA 4Z0TA 1AK1A 2A1TR 4MV3A 2JKZA 1L1RA 2C2YA 1N6IA 4UBKA 1F4PA 1JEQB 1RC1A 2VPWA 3EUEA 1SUFA 4PR3A 1FP1D 3IUJA 4UXJA 3RD5A 2G1AA 3UT6A 1RKBA 1W44A 2RGXA 2XYVA 5KCZA 3NAZA 4LZZA 3C1AA 2Z2ZA 1VIMA 1Z88A 2QSUA 4L7QA 2GF9A 4BZQA 1DARA 4ZFNA 4HVLA 4FS8A 1B8OA 1VLHA 3HXLA 2LPMA 3LL7A 3GK3A 1SKUA 2Z2IA 4H08A 1DBPA 3O3MB 3NHUA 3LWBA 1OZ0A 1S9DA 2FJPA 2GAOA 3QXCA 5D7NA 1C80A 4DR2B 1FYEA 3EXAA 4R16A 3TL3A 3LE8A 3KPJA 2ZB7A 2PNJA 1DIAA 3KXDA 2GCEA 3A04A 4XGKA 3A6ZA 3WDKA 4RM3A 2Q99A 3DFIA <