4RW8A

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor'
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
548
structure length
548
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 136
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw8A05
4DSIA 1JLQA 4FLVA 1D9FA 2BGGA 2B5JB 2JEGA 3TANA 1XR7A 3G6XA 3TI0A 1HQUB 5KT4A 3DLEA 4K4SA 4M41A 4CEFA 3S3NA 4CERA 2FJVA 4DTOA 4HUEA 4K4VA 3BSCA 1NK0A 4NRUA 1S1VA 4K8XA 3OYLA 3CM6A 5K14A 3GYNA 2DPIA 1S1XA 4ZP9A 3T1AA 1D9DA 3DRPB 1D8YA 3LP2B 2IM0A 3NGDA 3AVGA 1XR6A 3KLEA 2E9ZA 4KO0A 5CYQA 4CJRA 3SQ4A 1ASWA 4PQUA 4Z4HA 2IAJA 3C6TA 4RW6B 4EBDA 1C0TB 1L3VA 5KFVA 3SFGA 1NK7A 3KTQA 3N6NA 4MK7A 4EBCA 4Q8EA 2QXFA 4M3XA 4TQRA 2C28A 5KFZA 3L2VA 1TGOA 2A1RA 1RBRA 1HNIA 3TAQA 3V9SA 4CGIA 5KFTA 1S1UA 3G10A 3CDWA 4KO0B 5DLFA 2YNGB 4FZXC 3H40A 4H4OA 1JLEA 3RRGA 3HXMA 3SUNA 4OKJA 4C8NA 3AVKA 1EETA 4ED8A 4DSKA 2JEIA 1EP4B 3KOAA 4DQPA 4KAIA 4MK8A 1HYSB 3WNFA 2NUBA 3MR6A 5EWFA 3HT3A 1S6PA 4EYIB 4KV8B 3VQ4A 3RMBA 3KLFA 1MU2A 5I3UA 1Y97A 4CFBA 2YKNA 3CJ5A 4Q8FA 2OPPA 4CEOA 1C6VA 3BREA 4CHQA 1ZYQA 3PW7A 3I5CA 3ZCMA 4IG3B 4DTPA 1BI4A 4NLVA 2OPPB 3V6DB 2FBXA 2FVSA 2BANB 4OGEA 3PVXA 3VQ9A 4ICLA 4CJKA 3K2PA 1SL0A 1TK8A 3M8PA 2F96A 3LP0A 4CF2A 3UQSA 2YNIA 2YKMA 2UVUA 4ID5B 4ED1A 3NF7A 4N5SA 3ZSOA 1RT5B 5C25A 3V1RA 5HRNA 1WSEA 4R8UB 3V6DA 3KK2A 1NOYA 3OYBA 4DS4A 3HVTB 5C25B 4CEAA 1WAJA 3RMCA 3V6JA 3AVNA 4KHYA 4I9QA 1BCMA 4TQSA 2BR0A 3WNGA 1VRTA 3OY9A 5FROA 1BCOA 3K5LA 4O3QA 3KKRA 3RB6A 3LWMA 1T3NA 2W9AA 2R8KA 4MH8A 3PX4A 4KB7A 4J9NA 4BDYA 3C6TB 1RYSA 5CY4A 4MK9A 3RAXA 5CYMA 4B9VA 4TLRA 2YHBA 2AGOA 3LWLA 3U6FA 3FSIA 4TYBA 1JXLA 4ELVA 4NYFA 4K4XA 4K4YA 1REVA 3RTVA 2VA3A 1HQEB 4RNOA 4LY7A 3NMAA 4AHCA 4NLRA 3EZ5A 3H08A 1QS4A 3LP3A 4CK1A 2X6NA 2DFFA 3WNHA 3VQBA 4CECA 4ZTJA 2OZSA 5KFFA 5KFDA 1U49A 2VG5B 1QAJA 4KTQA 4BE1A 3CFRA 4O3PA 5KFAA 1KFDA 1FKPB 1KTQA 1ZBFA 4H8KA 3AA3A 3SZ2A 3JSMB 2BANA 1JLQB 1S49A 1SV5B 5EWGA 4CF9A 4W5OA 4ZPAA 4KI6A 3NCIA 3D45A 1S1UB 3K5OA 2Y1IA 3KLHA 4LQ3A 4DFPA 1NJZA 1KFSA 4YNQA 5J2QB 1XHXA 4DWIA 1T8EA 1BIZA 1RILA 3L3UA 4BDPA 1C0UB 2F8EX 3RWUA 4J2AA 4RZRA 5HRRA 1EP4A 4ZP7A 3QLHB 4IH6A 3KD1E 3UDLA 4LD0A 4W5QA 5KFGA 4B8AB 1VK0A 4AHSA 3MXJA 4OPKA 4ZVFA 4K4ZA 4KB0A 3AO5A 3SJJA 3S3MA 4DU1A 4DQSA 5KG5A 1S97A 3JYTB 4IR1A 3QGHA 2HHWA 1RYRA 5FDLB 3CM5A 5F8HA 4CJSA 3M9MB 4FZYA 5JUMA 3Q8RB 3SQ1A 4F3OA 3SQ0A 2X78A 4NLWA 4CHZA 3CDEA 1VRUB 3ISND 4OVLA 1VSMA 4CEEA 3TAMA 5HP1B 4H4MA 4H4OB 5DG9A 4G1QB 3PR5B 1TV6B 4JV0A 1NK4A 1I39A 4C8KA 3LP2A 1TKZB 4O5BA 4F4XA 4DQIA 4GC6A 4CJWA 4B9LA 1JL1A 4F50A 4FLUA 1N6QB 1CXQA 2OPSA 3K58A 3MECA 2I5JB 2V9WA 4KKOA 2YKNB 3CG7A 1FK9A 2ZD1B 5KFLA 4CJTA 4Y1CA 1VSFA 5I3UB 2RF2B 1OS5A 4FJ7A 2QK9A 3C94A 2RDJA 4WXOA 4BACA 4YMEA 1YTAA 2X6SA 1C1BA 4DG1B 1HYVA 1TAQA 3ZT0A 3M8QB 3L2RA 1JLAB 4KHUA 1EETB 3NF6A 2G8VA 4O4GB 3TR8A 3RBDA 4FS1A 5DQGA 1SUQA 4RNHA 4FJ9A 3DRPA 5F8IA 3SQ2A 4IOBA 4YR3A 5KG2A 1DTTA 1RAJA 3OS2A 1T05B 3QERA 1WNEA 4Y2AA 3QINA 5KT5A 2XGQA 1EXQA 1S6PB 4O0JA 3HPOA 1MMLA 4NLSA 4NRTA 4YP3A 1S1TB 3QZ7A 1ZTWA 1VSLA 5HP1A 4I9LA 3KK1B 2OPRA 1TP7A 3SV4A 3M9OB 4ZVHA 1FKPA 4NLTA 3DDKA 2R2UA 4KBIA 3FRZA 1VSIA 2HB5A 2HNYA 2IM3A 3OS0A 2GV9A 2AQ4A 1YTUA 1NJXA 1Z26A 3V9XA 2F8TA 1RBSA 5KFWA 3V9UA 1ASVA 4FJKA 1SL1A 4DG1A 2QKBA 2ZE2B 1SH3A 4WYLA 2FJXA 4J2EA 4L8RB 2B6AA 4NCGB 1U47A 3SFUA 4CEQA 2W9CA 2RKIB 4DTRA 3BQ0A 1W9HA 1GX5A 2XY6A 5KT2A 3M8RA 3KLEB 4MFBA 4F8RA 3HVAA 4AILC 2V0NA 3KJVB 4HYKA 2XWYA 3BQ1A 1KVAA 5F8JA 2XC9A 4BE0A 1K6YA 4RNMA 4MKBA 4FJIA 1SV5A 5T7BA 1WSHA 5KFXA 2JC1A 1XWLA 4O3SA 3MTKA 3I0RB 2AGQA 4JRPA 4QW9A 2AWZA 3RRHA 5KFSA 4FLWA 4CF1A 4CK3A 4PY5A 3RAQA 2F8SA 2FC0A 4CJVA 3LANA 2HAIA 1RTIA 3HK2A 1NKCA 3U3YA 2W9BB 1CSJA 3FFIB 1N48A 4PWDB 4B9TA 4M3ZA 1HPZB 3N6MA 2RKIA 2AX0A 3I0SB 5KFEA 3F73A 4OL8A 3QETA 2W7PA 1DLOB 1U04A 2J6TA 5DGAA 3PUFA 4QOZB 4Z4FA 3LPUA 1J5OA 5DQHA 3DLBA 2C2EA 4C8OA 5KFIA 3HJFA 3K5NA 3AO3A 4RU9A 3MR2A 4B9NA 4NLOA 1CLQA 1UOCA 1UAXA 3OHBA 1RDDA 3NH1A 4J2DA 3L2QA 1JKHA 5J2NA 2OPQA 1K1QA 4TSXA 2W42A 4JS4A 1JLCA 3NDKA 4ECWA 4BWJA 3V1OA 1JLGA 1LW2B 1S9GB 1KVBA 4BWMA 3CWJA 4WFZA 2OPRB 2C22A 2ITGA 3HL8A 4OKKA 1KLNA 4Q0BB 3QIPA 2DFHA 5SZTA 3AVBA 3AO2A 3DYAB 3SUPA 2RN2A 3P83D 4CJ5A 4KHRA 4AHRA 3OJSA 3OYDA 4J9QA 2FBYA 3LZJA 5F9LA 4OJRA 1TL1A 4WFXA 3IRXA 3KKSA 1RT4B 2HMIB 3NAHA 1R0AA 2FVQA 2D0CA 2UVVA 4ZTFA 4KREA 4F4ZA 5DG7A 4IKFA 2WONA 3NBPA 4GVMA 4Q43A 3KHGA 5SWMA 2Y1JA 3H4BA 4OLBA 1T03A 2XHBA 2B6AB 1QQCA 2R8JA 4M3TA 4F2RA 2RPIA 3MECB 3NKYA 2Q3SA 4Q45A 1WNSA 4KAZA 4GC7A 4CJQA 1RDAA 4ECXA 3RB4A 1S1TA 5J2PB 2OA8A 4KRFA 3OYGA 4I2QA 4CESA 3DLGA 4DS5A 2OH2A 3PX0A 4TY8A 3V9WA 1TKXA 1NJWA 3K59A 2G8IA 1QE1B 3AV9A 1RT3A 3PO5A 3TAFA 3FQLA 1ZBUA 5HRPA 1JLFB 3T5HA 2EHGA 4Z4CA 1LW0A 1LWFB 4I7FA 5D3GB 1SL2A 4CJ4A 1VSHA 4FLZA 3SPYA 2HVHA 5L1JA 4Y2CA 2XGPA 3MFIA 3GILA 4CIGA 4OKEA 4CFAA 1NK8A 2IGIA 1C2PA 2E6MA 3ISNC 1N5YA 3ICLA 4RW7B 3RMDA 3FFIA 4HUGA 4W5NA 3SI6A 1GX6A 3SYZA 2A1SA 4IRDA 4M3UA 1WAFA 5KFKA 3TWHA 4E7IA 4KHSA 2W9CB 3HKWA 1BGXT 1ITGA 1J5OB 1S0NA 1BQNB 5C24B 2I1RA 1NK6A 3SPZA 5KG1A 3GQCA 5J2MA 1IO2A 4CF0A 2B5JA 3SCXA 3G6YA 4U6PA 2AX1A 1TAUA 2FLPA 1DTQB 4QAGA 1W25A 4NLYA 3PO4A 1KRPA 1TL3A 1B92A 4MKAA 4ZHRB 2EC0A 2YKMB 2R8GA 3M9NB 1VRUA 1KHWA 5KFRA 3TVKA 3T5LA 1LWCA 1ZBHA 3M8PB 1J54A 5HBMA 1NK9A 2ILZA 3NF9A 3KLIB 3KK1A 1NK5A 1RT3B 4PQUB 3L8BA 3OHAA 1IKVA 2R2RA 1A5VA 3KMQA 4JV1A 5C5JA 4BDZA 3MEEA 4WE1B 1RTJA 5DMRA 1GOBA 1Z25A 2ETJA 3ZSWA 2RDIA 1N4LA 3HHKA 1TV6A 3K57A 4IFYB 5DLGA 1FKOA 3OYCA 2BE2A 4LQ9A 1L5UA 2PZSA 5L1KA 4LSNB 4FVMA 2D0BA 3AA4A 3QIPB 2XCAA 3HP6A 4E7JA 3DRRA 2HWHA 4NLUA 2VWJA 2WOMA 1VSDA 1RT2B 2D3ZA 1BIUA 3VQ7A 3MR3A 5JXSA 4E3SA 4ECRA 4IRCA 3S9HA 3KJVA 4IG0B 4DF8A 3IGNA 1F21A 1JLCB 4FBUA 3KHLA 2HHVA 3NAEA 2C2DA 4CGGA 5I42B 1C0TA 3HVRA 4FLYA 1IKYA 2FJWA 3PR4A 3TARA 3LP1B 4CEDA 5HROA 3CJ3A 1S9FA 2W7OA 3E51A 5FDLA 2YNHA 3IG1A 1HRHA 1HARA 3DM2B 4O0IA 3BSAA 2VWKA 4M3WA 1TK5A 2P51A 3MEDA 4DL2A 4DTNA 3BSOA 1C1CB 3V6KA 4ECZA 5J2NB 3OSNA 2FVCA 4XIUA 5KI6A 2IC3A 3E01A 4O4GA 4IKAA 5DQIA 3IGVA 3NAIA 1TQLA 2GBZA 4G1QA 2O4IA 3MEGA 5KT7A 1ZBIA 1NKEA 5KGWA 3RB3A 1S5JA 5KFBA 4K50A 2FVRA 1JX4A 4GW6A 3OL7A 3KD5E 4CJ3A 3LPTA 4EP5A 4R5PA 4O3OA 5KFQA 4YQWA 4I7FB 5D3GA 1L3UA 1S1WA 1RT7B 4AH9A 1Q9YA 4EZ6A 4EO8A 3AVCA 5HBMB 2E9RX 3V4IA 3QIOA 4ECUA 1T7PA 3KIOA 3BDPA 2BQUA 3L3VA 2YNFB 4LSLB 5JS2A 3FDSA 4ZP8A 3VQCA 3DRRB 3QEVA 1FXXA 2E6LA 1X9WA 4E0DA 3KHRA 4O4RA 4CCHA 3V81B 1S0MA 5J2PA 4ICLB 3VA3A 1RT6A 2ASJA 1RDBA 1IKWA 5KG0A 3QGIA 2PY5A 4RG8A 2HNZB 1FKOB 1RNHA 1BQNA 4HHTA 4F4KA 3CO9A 2R2SA 2O4GA 4IG3A 2JGUA 2G8UA 1KVCA 4MIBA 2VG6A 1HYZA 4URQU 2EX3A 1TKZA 1CXUA 1MU2B 3ZT4A 4RW8B 3HPHA 4QWDA 2D3UA 2YNHB 1RT4A 2HMIA 3TAEA 3NL0A 4DTMA 2ASLA 3QNNA 3B6PA 1RDRA 4NCGA 4Q5VA 4B3OB 4NZ0A 3O3GA 4YR2A 1QHTA 2BQRA 1LWFA 3HO1A 3PJWA 3AVHA 4DFJA 4CIEA 1N6QA 3T19A 3Q8SB 4QWBA 4ZHRA 2Z1GA 1RCHA 4FK4A 4TN2A 3AVLA 2KFZA 1RT1A 2IJFA 4TYAA 3EPGA 1S9GA 1JLGB 1LW2A 2WOMB 1RT1B 4ELTA 4CFDA 3H5UA 2Z1HA 4J9KA 2XY7A 4H4MB 1WN7A 3I5AA 5CZ2A 3QIDA 2VG6B 1JKHB 1S1VB 3GIJA 3CJ4A 3CFOA 1ASUA 1WSJA 2G8KA 4DSLA 4CJPA 5C42B 4DL6A 5L1LA 3NGYA 3MEGB 3QEIA 2BRLA 4KHQA 4JV2A 4DF4A 1HJRA 4UQGA 3AVIA 4FJNA 5EUHA 4DU3A 1D0EA 4CHNA 3ULDA 3PW5A 1EX4A 4B9UA 2P1JA 4NLQA 3G6VA 1JLEB 3MEDB 4RNFA 5KFCA 4FJHA 3T5KA 5HRSA 2KTQA 5KFYA 4C8MA 3CFPA 2V4RA 3RR8A 3H2LA 4E19A 1C1BB 3HPGA 4Y1DA 4B08A 5CYMB 1RTIB 1YVUA 4EEYA 4FK0A 2B4JA 2HNDA 5JS1A 4OLAA 2QKKA 5DGBA 3O4QA 2R2TA 1FK9B 2VG7A 1VSEA 1C1AA 5J1EA 2IMWP 2OPSB 4IG0A 1J9AA 4Z4EA 2G8FA 1KLMB 1TKXB 5F8GA 4CGJA 1UA1A 4KPYA 2AGPA 3H5XA 3GIMA 2J6SA 4K4UA 5E41A 1DTQA 1S10A 3JYTA 4HUFA 4LH4A 3E01B 4QPXA 4YR0A 4DL7A 1S1XB 1XR5A 2QE5A 2OPQB 3OS1A 3JSMA 3KK3A 1JLBA 2GIRA 4MFBB 1TKTB 1C0MA 4E7KA 4Z4GA 3MFHA 2D7SA 2QV6A 2VG5A 1CZ9A 3VQEA 1QSSA 4FM0A 1KHVA 2IAJB 4ECSA 4ZP6A 2YHAA 4CK2A 1S48A 1C1CA 3IS9B 4CJEA 4KKOB 1TL1B 5KRTA 1NOZA 3PJXA 4RW8A 2WHOA 3IS9A 4NLPA 4FJ5A 4GMJB 2VA2A 2C2RA 2HVIA 4F4YA 4NCAA 4M94A 4FS2A 2DTUA 4CEZA 3UR0A 4ED7A 2D0AA 1U45A 3IAYA 1HMVB 2XO7A 4I2PA 4M42A 3RB0A 3M8SA 1B9DA 1A5XA 2ZKUA 3Q8PB 3MF5A 1TL3B 4NYNA 3CJ0A 3HVTA 3AO4A 4I2QB 3QNOA 2DPJA 3OYJA 3EPIA 3H4DA 2XCPA 2Z1JA 4XPCA 2JEFA 2IC3B 3KNAA 3VQPA 1QUVA 5FRMA 3DOKA 3U3GA 3OSPA 2ZQBA 2IM1A 2XY5A 5KFPA 3KLFB 3IN5A 3ZSVA 4O3RA 3CDUA 4WFYA 4RW4A 1HMVA 3BGRB 4QW8A 1JLAA 5F8LA 3LZIA 1UA0A 4IDKB 4J9RA 1U09A 3C95A 3P1GA 4F4WA 2IDOA 2HNDB 3V9ZA 3VQ8A 3NBPB 2WONB 2OZMA 1L3TA 3DRSB 2FBTA 4MQ3A 3QGGA 1TKTA 2ZE2A 5KFNA 4Y3CA 1NNDA 4R0EA 1SKWA 3ZSXA 5J2QA 3GV8B 2WTFA 3D5MA 1HNVB 3OYEA 1Q9XA 3O4NA 2WRMA 3NE6A 4ED2A 3VN5A 4CGDA 4EYHB 4M45A 3CYMA 3NFAA 4CHPA 1WSIA 1LWCB 1NJYA 4DSJA 2KZZA 5J1EB 3T3FA 4CFCA 3BJYA 1S0OA 5T14A 4E7HA 1T94A 3MAQA 3TAGA 2FLNA 4M3RA 4Q44A 1IKXB 5EU7A 5KRSA 2HWIA 3OL6A 4DTJA 4N47A 3NGZA 3NH2A 4ECQA 1U48A 4F3TA 4FJXA 3CJ2A 4O55A 4LH5A 4IH7A 2ATQA 3KLGB 1REVB 4EP4A 3WNEA 4IR9A 1K1SA 2W8LA 3IG1B 1XHZA 1SKSA 1UWBA 3AVFA 3PW4A 3HSTB 4W5TA 4RW6A 1A5WA 1IKWB 4KE5A 1RT6B 4O44B 3BQ2A 1QSYA 3CQ8A 2UVWA 3OYHA 1L3SA 3BSNA 3BGRA 4RW4B 5DK5A 3UPFA 2FVPA 3DOLA 2R8HA 4BE2A 1RBTA 3VQ6A 3AVAA 2IOCA 2FBVA 3DYAA 2B43A 1S9EB 2IBKA 1ZBLA 2YNGA 3VQDA 5HLFB 5L1IA 3AA5X 4JS5A 2HHSA 3VA0A 1S1WB 1IG9A 1RTDA 4N41A 3KLVA 3OYNA 3SI8A 5I42A 5L9XA 2J6UA 4WYWA 4J9LA 1G15A 2CKWA 1X1PA 4B3OA 4K8ZA 1DTTB 4IRKA 4HCCA 2AU0A 2WCXA 3QEWA 4FJGA 4FM1A 1XC9A 5KFJA 3NF8A 1BI4B 4JLHA 2IJNA 5EDWA 4HVJA 5EWEA 4DL4A 3QO9A 4DL5A 4FXDA 4WZQA 3MR5A 1LW0B 2FLLA 1HYSA 3H5YA 1R0AB 3RBEA 2D41A 4PUOB 1NHUA 3SUQA 5KFOA 3PX6A 3SV3A 3KK3B 3D28A 1WSGA 4U7CA 3O3HA 2KFNA 1N5YB 4KSEB 4FK2A 4RNNA 2UUTA 3PW2A 4FLXA 2HHXA 4Q0BA 3TQ1A 1Q8IA 3MXMA 2YNFA 1IKVB 4LSLA 4ECYA 4FW1A 4CHOA 5KFUA 3NGIA 3KMSA 3C6UB 2D5RA 2KW4A 3ITHB 4LSNA 4TY9A 3ZT3A 3HM9A 3G0ZA 5DG8A 3V81A 4KHNA 4HKQA 1RT7A 3DLRA 4DLEA 5HLFA 3EYZA 4IBNA 2XI3A 2R8IA 2WB4A 4FJLA 3LDSA 3SNNA 4J9PA 4R5PB 2HW3A 3QZ8A 1B9FA 3CIZA 3DMJA 3AO1A 4ZPCA 1BQMB 4DLGA 4IQXA 3QEXA 4Y34A 4RW9A 5F8MA 1U4BA 4FJ8A 4JRQA 1X9MA 1HQEA 5KTQA 5CZ1A 1GOCA 4TXSA 4OGCA 4URSA 4FLTA 1SH2A 3MXIA 3T5JA 4FJJA 3H98A 1JXBA 3KLGA 1SH0A 5KG6A 3P5JA 2W8KA 3H5SA 4IFYA 3OLBA 1QAIA 3V1QA 3ZSZA 3O3FA 2WK4A 5F8NA 3I5BA 4WE1A 4CGHA 4YFUA 4ZVEA 2HNYB 4B9SA 4IFVB 3VQ5A 3F9KA 4CGFA 4NCBA 1QSLA 4ID1A 4EBEA 4XO0A 2JC0A 4ED0A 1RT2A 1RTDB 2ALZA 4W5RA 1KLMA 4NYZA 4KHMA 4KFBA 2GIQA 3ZSYA 3G86A 5KT6A 2IA6A 3OVNA 4KI4A 4N76A 3FQKA 4DFKA 1QE1A 2GUIA 2IS3A 1KSPA 1I3AA 5F9NA 4E89A 4AHVA 3L2WA 4J2BA 4J9MA 4FCYA 3QEPA 2P5OA 4QWCA 3QYYA 1LWEB 2UVRA 2AJQA 3HYFA 4E1MA 1VSKA 1EKEA 3QO9B 4CJFA 1S6QB 3DLEB 4DEZA 2X74A 5HROB 1DLOA 4KB1A 1QTMA 2ATLA 2XY8A 3KLHB 3GV7B 1WSFA 2BQ3A 3L2UA 3KHHA 2E4LA 4DU4A 4DFMA 3ZT1A 4FW2A 3MEEB 3OYFA 4ED3A 1JIHA 3OYMA 1RT5A 1D5AA 1RTHA 4M3YA 3SUOA 1SKRA 2UUWA 4I2PB 3PZPA 3RMAA 1RBUA 4CHYA 5FRNA 4K4TA 4DSFA 3PW0A 4C8LA 3VQAA 3DLKB 3VQSA 5KGXA 3PHEA 3NH0A 4O3NA 4ECTA 1S9EA 2KQ2A 5C24A 3QESA 4NLGA 4FYDA 3HP9A 4DTXA 5KG7A 2I5JA 4TY8B 4QWEA 4DSEA 3UIQA 3THVA 4KTWA 4MIAA 3TABA 2P5GA 4ZVGA 3M8QA 4WXWA 4CJLA 2G8HA 3DMJB 1RA6A 1RTJB 4ELUA 4IH5A 4Z4IA 1XI1A 2HHQA 3LALA 4M95A 4ED6A 5C42A 3TAMB 3DM2A 3ZSRA 3N6LA 4G3IA 3LP1A 5KG4A 2V4QA 4ZPBA 4QCLA 3A2FA 3LAKA 3KLIA 4ECVA 4QWAA 3ALYA 2PYLA 3AVJA 3DLKA 5KFHA 3KK2B 1YT3A 4RW7A 1WLJA 1HNVA 1D1UA 5KFMA 3GV5B 2DY4A 2W9BA 1BQMA 3V6HA 4N56A 1X9SA 3LAMA 4FZZA 2GC8A 3TAPA 4DTUA 2HHTA 4CF8A 3DLGB 2VG7B 4PUOA 4RUAA 3PY8A 2O5DA 4NLXA 3V4IB 3PV8A 5J2MB 3AA2A 3B6OA 4WZMA 2RF2A 3AVMA 4JUZA 1C0UA 3CVKA 3ZT2A 4DL3A 1CZBA 4CEBA 1S6QA 1RDCA 4Z0UA 4E7LA 1T05A 3VQQA 2PYJA 3Q8QB 2YV0X 5K14B 4FJMA 3DOKB 1TVRB 1SUQB 4ZMMA 3BR9A 3OYAA 4KV8A 1TVRA 3OLAA 1GOAA 2IM2A 2LSNA 1I6JA 1HQUA 2HNZA 1Z4UA 1LAWA 4OPJA 4IDKA 3ASMA 4XPEA 3H59A 4O44A 1W0HA 4DQRA 4CIFA 3DLHA 2G8WA 1ZETA 1LWEA 2BDPA 4E1NA 4F2SA 4H54A 3I0SA 4CJUA 4DTSA 3DI6A 1HPZA 2HHUA 1TKDA 4ZPDA 1BISA 1JLFA 4NLDA 1BHLA 2R7YA 4KTZA 2Z1IA 3IRXB 2ILYA 2XI2A 4B8CA 4HCBA 2JEJA 3S3OA 3EZUA 1YVFA 1RTHB 3OYIA 2YNIB 1BL3A 4J9OA 1JL2A 2KZMA 4KFBB 2XRIA 2E9TA 1RA7A 3ZSQA 3QLHA 3ITHA 1S4FA 1N56A 1RBVA 1NKBA 4AHTA 3C6UA 4B9MA 4EO6A 4EZ9A 2ZD1A 1UWBB 2JLEA 5CYQB 1J53A 3NHGA 2OYQA 2BE2B 1VRTB 4J9SA 4CE9A 1T03B 3OL8A 1JXEA 3OYKA 1IH7A 3OL9A 1ZTTA 1LAVA 2CJQA 1IKXA 4RW9B 5KT3A 3DRSA 4AHUA 1IKYB 4DQQA 1IM4A 3GIIA 4ID5A 1TK0A 1JLBB 4FBTA 3OJUA 4PA1A 4FM2A 4X2BA 5KG3A 3GIKA 1KCFA 4K4WA 4DMNA 3D0PA 3I0RA 1VSJA 4RUCA 3I8DA 4PWDA 4KHWA 2ASDA 3EY1A 4R8UA 4URGA 1O1WA 1LV5A 3K5MA 2DFEA 3RR7A 1HNIB 4HTUA 3DOLB 4IFVA 3DI6B 1NHVA 2BRKA 3HVWA 3LP0B
chains in the Genus database with same CATH superfamily
2QLBB 3AD8C 1D9FA 4DBQA 2BGGA 3W65A 3MAHA 2E2NA 1RJJA 3F5TA 2DNOA 1HHSA 2EW9A 2V4JA 2Q79A 2E5GA 3PRVA 4K4SA 1Y3JA 3S3NA 3VAIA 1JCFA 3MM8B 2DR6A 4NRUA 4K8XA 3OYLA 1U8WA 3CM6A 1FRJA 1X5OA 1Y0HA 1X4FA 5L9NA 2GMHA 3A5MC 4LF7J 3AVGA 4D3GA 3SQ4A 4DV4K 2PI5A 2KN4A 4AD6A 2IAJA 2F9WA 4LMZA 2XTJP 1NK7A 5CD4H 4M5DB 2IA0A 4CQ1A 5F1XA 4EBCA 1E4FT 2FXUA 4B1XB 2YX7A 4LF8J 4Q8EA 4TQRA 2A1RA 1GLLO 4IQMA 1RXOB 2U2FA 3V9SA 1WUUA 4CBUA 3PJ9A 3CDWA 5DLFA 5D78A 2W01A 3PLAA 3H40A 4OIXA 2GGPA 4P73A 2LQ8A 2VBXA 1WHXA 1EETA 4L72B 2P9IA 2RUSA 4DSKA 2JEIA 1EP4B 3EE8A 3HSDA 2WTUA 1HYSB 3MR6A 5EWFA 1V6HA 1S6PA 2MXYA 5HAOA 4KV8B 3R6LB 1ATRA 1HNWK 3FUYA 4OI6A 1FWLA 5I3UA 2DR7A 3BV8A 1Y97A 3BREA 3I5CA 3ZCMA 4IG3B 4DTPA 1BI4A 3OFHA 4C1NK 2IHR1 2HRYA 5AZJA 2FBXA 2FVSA 3BYPA 3VQ9A 3M8ZA 3K2PA 1D8ZA 1S6UA 2X1FA 2F96A 4C3LA 2EKNA 4CO3A 4DV7J 1FX4A 4DUZJ 2YNIA 2UVUA 3BR8A 2ADCA 4N5SA 4QR2A 4K0KF 3BP8A 2F9DA 3ZZZA 5C25A 1WSEA 4R8UB 4ZCLA 4CBXA 1HR0J 1YAGA 3IP0A 3RW7A 3HVTB 2Z2LA 4BC9A 5G0RB 4CEAA 3AVNA 4KHYA 4BCAA 2G9OA 1VRTA 3MPUB 4LRBA 3UWTA 2GEMA 2B4UA 1ELOA 2OSQA 3LWMA 2FC9A 5CABA 4MH8A 3L0QA 1ZM3A 4M5MA 4KB7A 1RHJB 4ER8A 3C6TB 2CJYB 4DV1F 1YQHA 5GAGU 2ATCB 3G71N 4TLRA 2ASMA 4TYBA 2RHQB 4DR6J 2H9ZA 2VA3A 4M5NA 4RNOA 1Q8LA 4L75A 4AF1A 4NLRA 2HFNA 3LP3A 4XEIA 4CECA 3IM9A 4LF9F 1CLFA 4ZTJA 3EVMA 1NH8A 3UKUA 1X4BA 2O01C 1J5EJ 3MM5B 1XNQK 5BPMA 2I7PA 2JZ5A 2HBMA 4BE1A 2OTLS 4WP8A 1QDUB 5KFAA 1VQKN 1WJ9A 1KEKA 1ZBFA 2BANA 2PFDA 5T41A 1S49A 4F67A 5B8HA 1YJNN 3F9MA 4DU8A 4JI2K 2PA8D 4X65K 4KI6A 2XM3A 3D68A 1SJ3P 1X4AA 4PKHA 2LA6A 2Y1IA 3KLHA 3DN9A 3AXKA 5FLXU 4YNQA 5IWAK 1BIZA 5CAAA 2WAQD 3M05A 4RZRA 3O1LA 5HRRA 2VHGA 1T6DA 4IH6A 3GG4A 4USJC 3AJDA 2PAVA 2G0JA 2GX9A 2GVDA 3IBFB 4AHSA 1FA0A 3WC2A 3FEYB 4K4ZA 2GWJA 2B9EA 1HBNB 5DDPC 1SS6A 2D1KA 5KG5A 1S97A 3JYTB 1DHMA 1IBKF 5FDLB 3UD5A 1R3NA 5JUMA 3SQ1A 3DHWC 1HNXF 4FOIA 4NLWA 4IJAA 1K44A 2JL9A 4BROA 3MX5A 4CEEA 3K2YA 4WQ4A 5HP1B 3J81O 2RNEA 3MMAA 1UFKA 1NK4A 3SBGA 4BRPA 2ZM6K 1TKZB 2JFDA 1OIAA 1JCEA 3CETA 4F50A 1CXQA 1X60A 4DR6F 2X1BA 2HVEA 2V9WA 2E7VA 2YKNB 2RQ4A 4RBVA 2ZD1B 4CJTA 5I3UB 2VONA 4G9ZA 2RF2B 4DV0J 2NRZA 3B6BA 1NGAA 4YMEA 2X6SA 1TAQA 2J8SA 1JLAB 3CCZA 1EETB 3ILLA 3TR8A 2J9DA 5LXYA 3EXCX 5DQGA 1FJEB 4FVUA 1SJQA 5KG2A 3OS2A 3VENA 2MY8A 3SK3A 2PT0A 2AYGA 2NRXA 2XGQA 4A47A 1EXQA 3G8QA 3HPOA 5F2RA 1PCAA 3CJ8A 5HP1A 3K9KA 1F1BB 2OPRA 3SV4A 4MYUA 2XLKA 2R2UA 3FRZA 2HB5A 2V2ZA 4DB3A 4WFNQ 4QIVA 2E1ZA 2GV9A 1IBMJ 1NJXA 3VAGA 2W4CA 4PXEA 2DB1A 5LMNK 2F8TA 4DXLA 5IQ6A 4FO0A 2YWHA 1SH3A 4WYLA 2B9YA 2QL7B 4LJMA 5K9FA 3SFUA 2MZJA 4AQYK 3BY5A 2W9CA 2HIYA 3WXKA 4LFCK 1GXTA 2DY9A 4PG6A 2QLXA 2V0NA 3KJVB 1FNMA 3T1YF 2XWYA 3BQ1A 1G4CA 1LNQA 5BREA 3P49B 1Q86O 3SCJE 3P45B 3D2FB 4JEPA 5HSPA 1RBAA 1WSHA 4BR0A 2RQCA 1H74A 5B09A 4O3SA 4LF8F 1ULRA 4CK3A 3MPYA 4CJVA 3HZEA 3C7NA 3B8HA 2CUYA 3VVUA 1RTIA 3A3PB 5C7PA 1I94F 1NKCA 3QT7A 2VJVA 1BOTO 4O8UA 2D1CA 3O6WA 2ZJRQ 3BH6B 3IMXA 4C7QA 1HPZB 1EHWA 3N6MA 3QETA 4OL8A 2BX6A 5CHIA 5DGAA 3ET6B 1X4EA 4HHHA 1FD8A 4GNIA 5DQHA 3DLBA 2C2EA 2GVZA 3HJFA 2KDOA 3K5NA 3AO3A 1UOCA 3QJJA 4YY3J 2BUPA 2G2OA 4TSXA 2W42A 3D1QA 4A59A 3QFWA 4HLBA 3GL1A 2IIHA 1K8AT 1T9TA 3I6PA 4CYUB 4QPTA 1VQPN 1JLGA 2K7JA 1SQKA 4IJNA 3GG0A 2XNRA 2ITGA 4QS8A 2LQ5A 5D4NA 2L48A 1CS4A 4HACA 1ITPA 3D6TB 1K9MT 2AP1A 5AQGA 2W2OP 4CJ5A 3OYDA 3QAEA 1GLBG 2HVZA 5F9LA 4WFXA 1JMTA 3KKSA 4HEA9 2D0CA 4X62K 2UVVA 3KHGA 2ROGA 4WU2A 2LYVA 4OLBA 3H42A 5EHHA 2BE9B 5DS7A 2ZJQQ 1L3KA 3JQJA 1IV0A 2XSJA 2Q3SA 1N5TA 3TVYA 3PYDA 2FGOA 4GC7A 4CJQA 4PG8A 3T69A 2J8AA 2A10A 5LM7E 2E88A 2LKZA 5HI7A 4CH7A 4CO1A 4DS5A 5IFMA 1KC8O 1TKXA 7AT1B 1MWMA 3G82A 1CJVB 1RT3A 3GDQA 3FQLA 3W0LA 3MTJA 1NLVA 1Q82T 2EHGA 4Z4CA 4LF4F 4WJBA 2CZVC 4I7FA 3JAMY 3J7AP 1Z1ZA 4Y2CA 2CNKB 2XGPA 3MFIA 3CCMN 2BABA 3RBXA 3KKFA 4CFAA 3G96A 1FJ7A 5DETA 3QBWA 3FFIA 2VD3A 3DFEA 3SI6A 5M1FA 4OYZA 1Q5YA 5K8MA 4KHSA 1VGYA 2EXUA 3DC2A 2HGNA 1J5OB 1URNA 3Q2TC 1S0NA 2DXEA 3KDNA 3VPZA 3J80U 3R7NB 4ALZA 4BR9A 4BVOA 3G6YA 2DNLA 3BGLA 5E3AA 1TAUA 4LIRA 1DTQB 4NMLA 3SIPB 5A8WA 3WUHA 1W25A 3PO4A 3EDRB 1U1PA 5DM7L 1B92A 2E1RA 4CVNE 3A5OC 4ZHRB 4GVLA 1FKAF 2EC0A 2YKMB 1VRUA 3O3LA 3D0IE 3TVKA 2LEAA 4B1YB 3OTOF 3M8PB 1OY8A 3CJKA 1MW7A 2F7VA 2NPFA 2FTRA 2ILZA 1RT3B 2BZ2A 3C16B 4X66K 3OHAA 4RKUC 2MDAA 4RWXA 1IKVA 2R2RA 1A5VA 4BR7A 5DM6L 3OTEA 5AQNA 1LKZA 5E3RA 5KPTA 4FPIA 4OI3A 2RB7A 3VGTA 2ZGYA 1WC5A 1OJ4A 4Z7YA 3ZSWA 3OV7A 2RDIA 2Q1LA 1IUJA 1TV6A 4DR7F 4IFYB 4A8FA 1RTZA 2DHAA 1L5UA 3CCWA 2PZSA 3SJHA 2Z57B 4BC5A 5IV3A 2X51A 2KRRA 4LSNB 3HSZA 4FVMA 1Y5NB 1Y5IB 1BA1A 5A0YB 3KG0A 1BQXA 2VCPA 4QS9A 3MDQA 2RVJA 2HHHF 1ACMB 4E7JA 1GEHA 1VQLN 1VHIA 2DHXA 1WF1A 2D3ZA 2O8CA 1HHTP 3M5RA 3VQ7A 2NZ4A 5JICA 3MR3A 4ECRA 4IRCA 3CF5L 3KJVA 1T9YA 2PMWA 2HHVA 3T1HJ 2CA9A 4CGGA 3GCXP 3MX2A 3HVRA 4USKA 2R4FA 2FJWA 3PCOB 3PR4A 3EJMA 1IJEB 2W7OA 1DZ5A 3E51A 2CH5A 2YNHA 3IG1A 2ZNZA 3AQPA 1HARA 1HRHA 3R9PA 2OKQA 4ILRA 1FFGB 2VWKA 2RE2A 1DGKN 2P51A 4DL2A 3BSOA 3HFZB 3V6KA 4U8YA 4CT8A 2KT5A 2RU9A 1JJHA 3ETMA 4JD2A 3RAMA 3NAIA 8RUCA 3K0SA 1TQLA 4RJVA 2O4IA 1T9VA 2DGTA 1VBKA 2FVRA 3KD5E 3LPTA 4EP5A 4R5PA 2MKJA 3ET6A 4O3OA 1IN0A 4YQWA 5D3GA 4KBOA 1S1WA 2HRTA 4DV0K 2XMJA 5HBMB 5GAGI 2EWHA 2E9RX 3OTOJ 3D0GE 2J9CA 4IYQA 1NG9A 3V5RA 2M3DA 3MM7B 2YNFB 1FJGK 3BN7A 4UZCA 1ZH5A 3I55N 3QT5A 3QEVA 2YX6A 4X4OA 4E0DA 3QRRA 3QFUA 4OQJA 4GKJK 4CCHA 5AXKA 2V2QA 3T9NA 3QGIA 1VQ6S 4HVZA 3BEXA 1FKOB 1BQNA 3T1YK 3CCES 3CO9A 4FF3A 5AQFA 5BR8J 3D6RA 1Q18A 2P9KB 2B4OA 4A61A 4URQU 2EX3A 3VESA 3SEOA 4B3RF 5K8OA 3HSGA 1RADB 3VAFA 4BRFA 1K73O 2ASLA 3TQEA 3VGKA 3UNGC 2A6AA 3B6PA 3HM8A 1HWIA 2MQLA 3WX8A 1JJ2R 3WDOA 5HN0A 3B8AX 1CPZA 3Q8SB 4ZHRA 3BEGB 2GJFA 1RAGB 2KFZA 3MGJA 2IJFA 1U24A 4KH4A 1RT1B 3PIPQ 3R5BA 2PEHA 4J9KA 2XY7A 4H4MB 1WN7A 3LH2S 5CZ2A 2VG6B 2YKPA 3LM2A 3LDNA 2ZH5A 2Z30B 1H98A 3CJ4A 4CJPA 5C42B 4P71A 2FJDB 4DL6A 3Q8UA 3QEIA 2MKSA 4KHQA 2V8DA 2RH3A 3IO1A 4NZ7A 1VCTA 2IY5B 5GVQA 4NLQA 3A8IA 1JLEB 4HDGA 3ZZ0A 2DGWA 4RNFA 4UOHA 3THXB 5KFYA 4AL5A 3RR8A 4E19A 1C1BB 5E33A 2E29A 4Y1DA 5CYMB 1D3WA 2CQ2A 5MLCQ 2VC0A 3IBWA 4QIWD 1SC3B 3KUEA 3HD2A 4ZLPA 2RIJA 2QWOA 1X0PA 1VIOA 5J1EA 2EFVA 2PGCA 4L74A 2Z4PA 2G8FA 1KLMB 2KI2A 2H54B 5MAOA 2HFUA 3CJRA 2AGPA 3SQOP 4Z94A 2QLWA 1S10A 5A8KA 4FOEA 4OX9K 1VHXA 3O44A 9RUBA 3TTFA 3E01B 3W62A 4YR0A 2A2DA 4DL7A 1S1XB 1XR5A 1WORA 2PO4A 1QM9A 2HS3A 2DNPA 3GFYA 4Z4GA 1CJKB 2QV6A 2VG5A 4DV2F 1T44A 3C2PA 2E66A 2MQNA 4FM0A 1Q86T 4WU3A 2XWXA 3LM9A 4CK2A 3OXFA 2X3DA 1C1CA 4CJEA 2LEPA 5KRTA 4FF1A 5G0RA 1NOZA 1XMQJ 2AJ0A 1REGX 4PKGA 3IS9A 5T7LA 2NPIA 1S79A 2DGUA 3AOAA 3UN3A 4DV1J 2VA2A 4NCAA 3T6JA 1HHQA 4JI7F 2NUHA 2H48B 1U45A 1YSJA 4UOCA 1HMVB 2XO7A 1QQOA 4I2PA 3C65A 4M42A 5D0RA 3JAMO 1B9DA 2OI2A 2XYPB 2IVPA 1U0HB 4NYNA 3CJ0A 1U2VB 5C15A 3CMQA 4I2QB 2PDAA 3J80O 5AFUH 4NA2A 4GO5X 2CYYA 2F4FA 2IC3B 3KNAA 3VQPA 3OSPA 2ZQBA 2PA3A 2XY5A 5KFPA 4H5WA 4IO9Q 3KLFB 2P9KA 3NG8A 2O8DB 1Q0NA 1HMVA 1JLAA 1YRUA 2QMXA 1U09A 4I68A 2BJ3A 2IDOA 3A0IX 4K25A 1ZAXA 2FJBB 2FHKA 3Q23A 1P9YA 8AT1B 4MQ3A 2MZTA 3QGGA 4BR4A 2VQFJ 4Y3CA 2VFTA 5HJYA 2HFVA 1TFYA 3THXA 3GFZA 3ZSXA 3GV8B 5LMUJ 5D6GA 4EGLA 3MWTA 4M63C 2JNJA 2VODA 3OYEA 1T3VA 1WELA 1FXDA 4Q2MA 3LGHA 4CGDA 4EYHB 1QVGR 3QICA 5E84A 4M45A 2KT2A 3JQKA 4A46A 4J5OA 5ETLA 2KZZA 1FCAA 3JXUA 3BJYA 2HHHJ 3GIRA 4QS7A 4XH4A 3L4IA 4M3RA 2E20A 2HQ3A 3UDEA 1S0VA 1WC4A 1DEJA 3DNCA 3LDLA 4DR6K 2OO4A 5KOXA 4LBIA 1CBKA 4LH5A 4IH7A 4NZ6A 5SUHA 3IG1B 1UWBA 4FKYA 4MJKA 3AVFA 3PW4A 2FSJA 1XMOK 1T11A 2HSTA 3HTVA 1HD0A 1UJ6A 4OYWA 1YTYA 3ZNUA 3H90A 1EZZB 3UPFA 2FVPA 3HOTA 1IQZA 4JYAF 1IBLF 3VQ6A 1UPMB 2UXDJ 4PG7A 3DYAA 4DR3F 3J7Z5 1YZ6A 3VQDA 1DURA 2H3GX 2BE7D 5ETPA 1S1WB 1EB0A 3HULA 3OBWA 2ROEA 1SQEA 4A2BA 2CKWA 1RKIA 1X1PA 4AM7A 3Q0AA 2D4WA 1X9JA 3SBMA 1DTTB 3P8BB 4CP5A 2J0QD 4HCCA 1KWMA 2WCXA 2QIFA 1XC9A 2R3VA 4R25A 3NF8A 4IOAQ 1B0TA 3NGUA 2YBVA 3A8EA 3HI0A 4WZQA 5AQSA 1LW0B 2W24A 1S77D 3BBBA 2BKPA 1KVIA 1R0AB 3RBEA 4PUOB 1NHUA 2LP4A 1FXRA 2CPEA 1F60B 3SV3A 4RUHA 3D28A 3CPWR 4U7CA 3DOMB 4ZPTR 4FLXA 2N4DA 1EIYB 4LT6A 3MXMA 1I3OB 3M6UA 4ECYA 2MMYA 5LSOA 5DZ6A 3KMSA 4OYAA 3ENVA 3FE1A 1PILA 3ITHB 1IJJA 3QSYB 3G0ZA 4HKQA 4KGZB 4ZVPB 1RT7A 4U7UD 3H8YA 5HLFA 2CPHA 3ILJA 3UKRA 4FWSA 3P38A 2IVNA 3GCWP 3DMJA 4EFAC 1NMEB 4IQXA 3QEXA 1MDUB 5B0BA 1YBTA 2QWLA 2HLUA 1NCLA 5F8MA 3ADAC 1X9MA 2LDYA 4USTA 1JNRB 2L9DA 3H2VE 4K2JA 2M4MA 1Q5VA 4TXSA 1S7HA 1NB7A 3E3XA 3CCJS 3VF6A 3J7YP 4FJJA 3H98A 2AA4A 1YITN 3LDPA 1H2VZ 1SH0A 3CULA 2W8KA 1KQSM 4DUZF 2IDLA 3NMUA 1QAIA 1FI4A 2EC2A 2BJ9A 2NUUG 5A6PA 1V9OA 2WK4A 3I5BA 2LQ9A 2ROPA 4FYYB 4ZVEA 3TUPA 4MO5A 4B9SA 1QSLA 1KAYA 1D09B 4XO0A 4LF6K 3LGMA 2CPIA 4P74A 4JI7J 1OYDA 3CJ7A 4KHMA 4KFBA 2Y1RI 3VGUA 4BREA 5M2RA 2UXCK 1HLUA 4CLUA 3G86A 4BRDA 4MDAA 1WDTA 4EI2A 3FQKA 3CJQA 1QE1A 4CLSA 2ZBQA 2GUIA 1PYOB 4ZVTB 2LXIA 5CHCB 5F9NA 4LR7A 1MROB 4AHVA 2ZFHA 1YJWS 1HW9A 3QEPA 1PG5B 4QWCA 2XSFA 3QB0A 4FWNA 3VAMA 1LWEB 2B56A 2UVRA 3JTPA 1B70B 4HHJA 4CLFA 3J81j 1GLCG 3A4TA 5EX0A 5LJVA 3MOZA 4DEZA 4LFBJ 3R2DJ 3GYXB 4GV3A 3GE9A 2HQGA 2POKA 3H20A 3J7YU 3VEYA 2HGMA 1WSFA 3KHHA 3QGPA 3OYMA 2Z2ZA 1D5AA 3D3CJ 2XLIA 4CD3A 1XTZA 3W2WB 1NDPA 2UUWA 2CDRB 1X4HA 1HKBA 3W5ZA 5AXNA 3PW0A 2HQFA 1HBUB 5LT5A 3VQAA 3DLKB 2VICA 1E6VA 3R97A 3NH0A 2CQDA 4O3NA 5GADI 1HA1A 2LLZA 3D0HE 2BA9A 3QESA 3K89A 1U6FA 4NLGA 1VC0A 4JI1J 4DTXA 2BRKA 5KG7A 2I5JA 3VAKA 4QWEA 4DSEA 1J2VA 3THVA 4DCOB 3QFPA 3KDOA 2DPNA 2D9PA 3CD6S 2XBPA 4CJLA 4PKIA 2DXFA 2KYZA 3LOUA 3DMJB 4OX9J 5FIIA 4WK1A 4OHWA 2HHQA 4V19X 4M95A 4UY8O 3TAMB 2U1AA 4PZVA 1F2GA 4CO5A 1U1OA 1PYTA 3N6LA 4G3IA 3UDCA 5KG4A 2V4QA 1P90A 1ZXOA 4NOHA 4ZPBA 3LAKA 4ECVA 4QWAA 2G2YA 4TU7A 3S7RA 5KFHA 3H3OB 4M5IA 4GKKJ 1YT3A 1HNVA 1D1UA 1PYSB 3GV5B 5THWA 2W9BA 1VLYA 4N56A 1R43A 1IQTA 2NR0A 3SMPA 4CF8A 3W8PA 3UKRB 3AB2B 2VG7B 1WG4A 4RUAA 3PY8A 4WQ4C 2O5DA 6FDRA 3V4IB 3PV8A 5E26A 2ZH8A 2VZ9A 4LF2A 1VQLS 3SSQA 4OPAA 3AA2A 3L4BC 1SXLA 4DL3A 2ZZMA 2E1YA 1RAHB 3MN5A 4CEBA 1S6QA 1UZHA 1RDCA 4Z0UA 3JS6A 4CO4A 3MWBA 1T05A 1N36F 1NPPA 4UZBA 3MN9A 4B3MK 4FJMA 3DOKB 1TVRB 5BYSA 1SUQB 2QA4N 4E1JA 4DV3J 2IM2A 1I6JA 2Y8YA 1CJKA 3PG9A 4DPUA 4OPJA 1S72N 1WBBA 4DQRA 2XZDB 4CIFA 3DLHA 3JTNA 2J7UA 2G8WA 2W6LA 3C16A 1GMWD 1GTHA 4WF9Q 3CCUN 4RUBA 2FHMA 2R7WA 3Q8VA 4DTSA 3DI6A 4DR7J 4NLDA 4WTYA 2MQOA 2GJ2A 2RILA 1BHLA 4ZJLA 4NLCA 4L73A 1YHQS 1XNRK 3S3OA 1YVFA 5IV4A 4GVBA 1YJTA 1GLJO 5LMUK 4Y00A 1RP5A 2PD1A 1BD6A 1FESA 1RA7A 2ZF5O 3VTIA 3ZSQA 2D0PA 3ITHA 1S4FA 2BJ7A 1RBVA 2DR8A 3IWLA 4EZ9A 2ZD1A 1UWBB 5CYQB 1WTBA 3NHGA 2YVSA 2CNLB 4I6MA 1UZDA 3VALA 1UVIA 3OL8A 4QZVB 2XO6A 2IRXA 3OL9A 1NLKL 5ELZA 5AQYA 1CC8A 1IKXA 4RW9B 5ETSA 1X0FA 3DRSA 4K2XA 1SKUB 2E5LF 2NNWA 1WC6A 4ILJA 5I3PA 2AYEA 4FBTA 3Q2SC 4FXWA 1KBRA 4X2BA 3I9V9 2CADA 1R8CA 1KCFA 3VAJA 5LSLA 4TKTA 2B4PA 2WSEC 3EY1A 1Q16B 4OZ1A 4URGA 3O4WA 1I94J 3K5MA 3RR7A 1R0BG 3M6WA 1I5OB 1U02A 1UJ5A 1OY9A 1UFWA 3HVWA 1JLQA 3VV2B 2GZOA 2JEGA 2ZKTA 2ZC4A 4EHUA 2CRLA 3P4IA 3CCSS 5B0AA 3SSSA 2HBQB 1HQUB 1JJCB 5KT4A 2QI2A 3O8MA 3DLEA 1N8RT 5FPDA 2F9JA 3C0BA 2V5HG 3SMZA 3BSCA 2HGLA 1WC1A 4M7XA 3T6BA 1S1VA 2DPIA 3GYNA 3MK6A 1S1XA 4ZP9A 3T1AA 3VGLA 3LP2B 4NMXA 3NGDA 4DUYJ 4DR5K 4KO0A 5CYQA 2ZH3A 4Z4HA 4WK3A 2YY3A 4RW6B 4MKVA 2G1HA 1C0TB 1L3VA 2BXJA 3KTQA 3N6NA 2QT7A 2QYCA 2HQDA 4OI0A 4J9UE 3R6MA 3AARA 2QXFA 4M3XA 2C28A 1TGOA 4DMZA 2DNKA 2Y0BB 3WQPA 1Q4RA 1HNIA 3M6VA 4CGIA 2L08A 3I96A 2ZWHA 4KO0B 3QAUA 2YNGB 4F3QA 4H4OA 3E66A 1JLEA 3QT8A 5A2QU 4WF9L 4C8NA 2K1RA 5AQXA 2QTDA 3NS6A 1U1QA 1M1HA 4JI8K 3GMGA 2XEXA 1LFPA 3KOAA 3H25A 4DQPA 4KAIA 2OLWA 3VCDA 5B08A 3MN7A 3HT3A 3BO3A 4EYIB 4OYXA 2BYCA 3VQ4A 1RWVB 4JI1F 5K8PA 5GMDA 3R8EA 1MU2A 4LR9A 1WHVA 4A48A 2OPPA 5AZIB 1ZYQA 1HNWF 1C6VA 3RUBL 3I56N 3K8VA 1VQ4S 3KNGA 2NXJA 3V6DB 5A76A 3CC4S 1TUYA 4J37A 2DRDA 3IM8A 2X3GA 4OGEA 4EFHA 4ICLA 2VBZA 2XG8A 1HR0F 4MO4A 4B1UB 3AY0A 1SL0A 1TK8A 1EQYA 2BKOA 3UQSA 1U8SA 4ATNA 4KT0C 3MM5A 4ED1A 2KKZA 3NF7A 3J81Y 4EIAA 3G6EN 1FXLA 3T1YJ 4GKKF 3ELHA 2HBLA 1NOYA 3OYBA 4X64F 5A2QO 3CXCM 1WAJA 3BKUA 1KS2A 3PIOQ 2BR0A 2H4YB 3OY9A 4JP8A 1T3NA 5IWAF 5ETKA 1RYSA 4HDHA 3C19A 4MK9A 3UW1A 3RAXA 2ZGZA 4B9VA 4WFBL 3CD6N 3U6FA 1DQAA 1JXLA 4B1ZA 1REVA 3RTVA 2NSCA 1HQEB 3TSUA 3NMAA 3EZ5A 3EZOA 2GVDB 1QS4A 1BWFO 4CK1A 5HMWA 2DFFA 3WNHA 5C2DA 1KOOA 3VQBA 5B0GA 1FRIA 4FVCA 4FKXA 5KFFA 3W9IA 2NXNA 2VG5B 4ZLLA 4KTQA 3ZZTA 1SVDA 2ZJQL 3CB4A 3CFRA 3CHWA 1OH8A 1FO1A 3FBCA 1RDUA 1KFDA 1R89A 3ENHA 3SZ2A 3JSMB 1VBZA 1JLQB 2KXHA 4CF9A 4W5OA 4QBUA 5GINA 4BR2A 4ZPAA 3AOBA 2F1FA 1F0XA 3NCIA 4HT5A 2P9PA 4ES1A 2EFPA 4DFPA 1M5VC 5GMKa 1XHXA 4DWIA 1QJHA 2GHVC 3R6GB 3MM8A 3UNYA 2MLYA 4C3MA 3V2UC 1HNZJ 3L3UA 4BDPA 4UF4A 5AQPA 4EAHD 1RHMB 2XMKA 4J2AA 1EP4A 3GJTB 3ILIA 3UDLA 9ATCB 1NB2A 3I32A 3QWPA 3IR7B 1IR1A 1XERA 1VK0A 2VQEF 2Z2MA 1PBUA 4RBUA 1N36J 1YX2A 3K0JA 4P52A 4DV2J 3CCEN 2AZ3A 3SJJA 4YDDB 3ID6A 4DU1A 1RYRA 4DR3K 3CM5A 1IBKK 3TYTA 1VRUB 3K17A 4OVLA 1VSMA 1R27B 3GONA 5JLFA 4H4MA 3GPAA 1FNOA 1EAYC 3CMEN 2KJWA 3W61A 1U1RA 4F02A 5H1SV 4O5BA 4DQIA 4HWIA 3MPWA 3I56S 4KKOA 5AZIA 1NZAA 1FK9A 3CG7A 4DV5J 2AD9A 2BM0A 4LF4J 4DU7A 4H0TB 1VQNS 2QN6B 2QK9A 2NXUA 3N9UC 1EKRA 2RDJA 4WXOA 5FLXY 1YTAA 5HQ8A 3KHYA 1Y10A 4DG1B 2V6AA 3ZT0A 1SZ2A 3Q86A 5AQMA 4O4GB 1N33J 4OJ3A 1PC4A 2V8PA 2ASYA 3QERA 1WNEA 2YQ0A 1FDAA 4I6WA 5KT5A 3CCQS 3MM9A 1MMLA 1FX2A 2VASA 3FRYA 3ZXWA 4I9LA 4LF5K 1TP7A 2P9IB 3M9OB 4NLTA 1VQKS 3DDKA 2W4DA 4KGVB 1VSIA 2GQCA 2IM3A 1U1MA 1AW0A 3OS0A 4LF8K 3VETA 4ZCKA 4K5SA 5K8NA 1QUPA 2V51B 1Y64A 3DXSX 3DGPA 1JJ2M 2CGLA 2QKBA 2ZE2B 4ES2A 2P9SB 4QIEA 3OVAA 4BQZA 3R7SB 2DNZA 3L7UA 4BC7A 2XULA 4J2EA 3VGMA 2OGUA 4Y28C 2B6AA 2KRBA 3G71S 4J90A 4E2FB 4F4AA 5AXMA 4ZVSB 3BQ0A 3GR0A 4LIWA 1W9HA 1GX5A 4B1WB 1KOHA 2KM8B 1ZBSA 4U67L 3TTCA 2C2OB 1GH8A 4DZDA 4IEEA 4IO9L 4HYKA 1H7XA 4DHVA 1HWLA 4BRIA 2B51A 3MPVA 4NI2A 2XC9A 5F3TA 4KH0B 4N8NA 1K8AO 4EWTA 4RNMA 4MKBA 1H73A 3NCRA 4CI6A 2VH7A 4BRHA 2R7OA 1VYAA 2JC1A 2UXDF 1UEKA 3MTKA 4JRPA 2HOEA 4LRCA 3KFWX 3RAQA 1V3ZA 5HMYA 1WOSA 4X4QA 3THPA 2W9BB 4ISFA 2DNRA 1XMQF 3FFIB 1VQ5N 1VK8A 1I94K 2AIRB 1XQIA 1HR0K 1Y4ZB 4ZK7M 5KFEA 4U67Q 3RG6A 3S8SA 4QOZB 4LSZB 1J5OA 3LPUA 3SAFA 4QR1A 4C8OA 1FFWB 4PABA 4B9NA 1CJVA 5AJ3K 3RZAA 3W5XA 1RDDA 3NH1A 3L2QA 1JKHA 5J2NA 2OPQA 1K1QA 4ERDA 3UO0A 1VBYA 4FN5A 4NASA 5E3CA 1FWPA 1KC8T 1KQFB 1LW2B 1YJVA 3ILOA 1KVBA 4Y2IA 2BUNA 2OPRB 2HYIB 3IXQA 2LECA 3HL8A 4OKKA 5HATA 2PFFB 4DV6F 3ENWA 2DFHA 1Q82O 3AVBA 2OMOA 3CCUS 2RN2A 3C15B 3HSCA 4AHRA 2FBYA 3LZJA 3HHLD 1TL1A 5GADP 2OFGX 3NAHA 1N0UA 4ED4A 4KREA 1UVNA 3A5NC 1X4CA 4Q43A 2J76E 2DH7A 2Y1JA 2VDHA 1QQCA 3D9BA 3LW5C 2P9UB 3D67A 5IWAJ 2RPIA 1H3DA 3MECB 1SIWB 4LVOP 2CVIA 3G2XA 3CCRN 4X65F 4OI4A 5GIOA 4ECXA 3RB4A 1MWYA 2FSNA 2KO1A 4I6AA 4M8LA 1E6YB 2VQEJ 3OYGA 4I2QA 4DR2F 3PYEA 4IO1A 2KFYA 2OH2A 2IYGA 2KJVA 4OYOA 3PX0A 3V9WA 2H1YA 1NJWA 1RISA 1FE4A 1V3SA 3TAFA 2ZBPA 2XS7A 3MCOA 4WQ5A 3LPEA 1JLFB 3AFGA 3T5HA 1QZ5A 3O1WA 1SL2A 2UXBK 4WP9A 1BA0A 3M2VA 3EN9A 2HVHA 3D2EB 3ZEUB 3SPYA 1KNZA 2YH0A 2FF3B 4CIGA 1NK8A 2IGIA 1C2PA 2E6MA 3ISNC 4B3SF 2QEXN 4Y0WA 2R7UA 1WI6A 1U0SA 1SC1B 5C10A 2A1SA 2ZM6J 1WAFA 1OYEA 2A42A 4TLQA 2DH9A 4NWBA 3N0VA 1M1KO 2FZCB 1BGXT 2HQCA 1ITGA 3MMCA 5LY3A 3HHLC 4XH5A 1NMNA 2OTJS 3GQCA 4C97A 5J2MA 3CDAA 4EK2A 2IDEA 4OV6A 3CMES 2UUCJ 3HFKA 1KXPA 4NLYA 1N33F 2MLXA 4OJGA 4DPYA 2B8PA 2YWKA 5KFRA 2GQQA 1V3RA 2QWPA 1X5TA 3AD7C 1YBAA 1MWZA 1NK9A 1J5EK 3NF9A 3VOVA 1XNQJ 4CZEA 1NK5A 3UI3A 3CCVS 2BV3A 3C14A 1PO6A 3NOCA 4B17A 4BDZA 2FY8A 7FDRA 4OI2A 3MEEA 1NU4A 1WI8A 1LWXA 1OPIA 2V69A 2G0CA 3H0PA 1GOBA 2ETJA 1IBMK 2HPUA 4LF5F 1N4LA 4OJHA 1TFWA 2HG4A 1FRLA 3EUNA 3OYCA 1VLOA 5L1KA 2L3MA 3OT9A 4USWA 2ZH7A 5CXTA 3DRRA 2HWHA 4MKYA 4NLUA 3QBXA 3T1HF 1YI2N 2F3JA 2HIQA 5GAEI 5BPNA 2WOMA 1UW9A 4LC9B 1WHWA 3A1YG 1HBNA 3KWMA 2Z0GA 3MMVA 3N4WA 3W2VA 3BZQA 4C48A 3HSJA 2J7WA 4IG0B 5IM0B 3IGNA 4DR4K 2O67A 4K42A 1VIXA 2GMJA 2MGZA 2C2DA 2Y1LB 5I42B 1OH5A 4UTGA 2OEJA 1BUPA 4I6YA 4KGXB 3US5A 1SJ1A 1K8KA 3LP1B 4CEDA 1M1KT 3NP5A 4YB6A 3DM2B 3NS5A 1YITS 4O0IA 4O5FA 3MUVP 4M3WA 4USVA 4ECZA 3E01A 3IGVA 4JI5K 2GBZA 3BPDA 5AQWA 5KT7A 2QXLA 5KFBA 4K50A 1Q7YT 3AB4B 1JX4A 3EMTA 2ZVSA 4CJ3A 2HK2A 2E7WA 2PEBA 4B3TF 1RT7B 3IR6B 1Q9YA 2O8DA 1CJTB 2OAUA 2CQHA 1XNRF 4JKFA 3QIOA 2LDIA 1T7PA 2BQUA 3MI7X 2VOPA 1NGCA 4JI0F 2XYHB 4WPAA 2F4VF 4DCJB 1NNEA 5BR9A 2HS4A 4LFAK 4ZVRB 1UL3A 3DRRB 5LJ3Y 5BRHA 4A8YA 1X9WA 3TO8A 3ZTRA 3J7AN 3V81B 3H1QA 1S0MA 5J2PA 2ASJA 1Q1KA 2JLGA 3NGKA 1GQEA 2HNZB 1RNHA 2E7XA 4F4KA 1UPPA 2VC1A 3L6QA 3K5PA 1WOQA 4C11B 2VF3A 2O8FA 2CAJA 1Q95G 2VG6A 3F2KA 1CXUA 4RW8B 3AA8A 4QWDA 4DI6A 3FNNA 2D3UA 2YNHB 4JV5K 3HFVA 2FPHX 3NGTA 4OJ1A 1F3VA 3MEKA 3OXLA 3QNNA 4JB8B 5M1QA 1ZPVA 4NCGA 4CLWA 1WEZA 2CGKA 4CZKA 5I4MA 1LWFA 3HO1A 1VQYA 4PG5A 1VQMN 1TMMA 3OFFA 3T19A 1OVQA 1RCHA 4TN2A 3AVLA 4XK8C 1NWKA 1NSPA 4TYAA 1SBRA 3WT0A 2DJWA 2O8CB 3BZKA 4YOYA 4ELTA 2CNNB 2W7AA 5FLXO 4PAAA 4C8ZA 2Q66A 2BW2A 1FD2A 2XMVA 3CFOA 4DSLA 5HOOA 3W63A 3G25A 1WF2A 3MEGB 2BRLA 3KWIA 4UQGA 3AVIA 4FJNA 5EUHA 4FDFA 3PW5A 4B9UA 1TYQB 2P1JA 3G6VA 5KFCA 4C8MA 1D4XA 3BGFA 4CLYA 3VERA 4HH1A 2BJ8A 3W1YC 3HPGA 1OMSA 5GMEA 2UXBF 2OJ3A 2HNDA 5JS1A 4OLAA 1N0VC 2F7TA 1HNWJ 1FK9B 2DBBA 3O9TA 1HIYA 1SAZA 3MM6A 4Z4EA 3CC7S 1Y5LB 5F8GA 3SDEB 3TX8A 4CGJA 1RU2A 4KPYA 2QTWA 2J6SA 1DTQA 4XH1A 3JYTA 3CJ1A 4LH4A 3OA9A 4QPXA 5JVGL 2QWRA 4F36A 3OS1A 4F25A 4DV7K 5GAGP 1JLBA 1PC5A 2YKAA 1C0MA 3AH6A 2VL1A 1UAWA 3M30A 3FZBA 2N4CA 4ECSA 1WEXA 5JLHA 1X4DA 3PKMA 3PJXA 3LA0A 2RSQA 4V19S 2FHJD 2IMOA 1RAIB 5KPRA 4X62J 1X7VA 2ZUGA 4F4YA 4CZJA 2X1AA 2DTUA 1NGGA 4CEZA 1MNEA 3UR0A 4NA1A 1P6TA 2D0AA 1A5XA 3IAM9 5E3QA 1TL5A 2Q6CA 3JTOA 3CXCR 3MF5A 1TL3B 2NQPA 2MLZA 5C2GA 3AO4A 3HVTA 3VTHA 2DPJA 3OYJA 3H4DA 4MYTA 4XPCA 2C3MA 3PRDA 2JEFA 1QUVA 1WWHA 1Z2ZA 1H2TZ 4DV3F 4OFZA 4P2FA 3ZSVA 4O3RA 3CDUA 3ONQA 5F8LA 2E5LJ 3LZIA 4IDKB 3X3UA 3I4HX 2O8EA 5AQQA 3ETOA 1RFQA 3VQ8A 4ZVQB 3NBPB 2WONB 3UR3C 1L3TA 3UFCX 3DRSB 4YOEA 3GOIA 4EMDA 2I9SA 5E0OA 3A8YA 1FJCA 2HVDA 3R7BB 2P9EA 3WZ0A 1S76D 3OTCA 2WTFA 1VQ5S 1N8RO 1HNVB 3AJ2A 3UN5A 2OMLA 3TRGA 1HD1A 3NVKA 4FPRA 3ZZPA 4ZCMA 3ZTOA 1KN6A 1NJYA 4P72A 1VQPS 1U1KA 5J1EB 3EXYA 1G3OA 4CFCA 2LA4A 1S0OA 5T14A 4E7HA 1T94A 2ABYA 2VPXB 3MAQA 3TAGA 3IDHA 5KRSA 1F5AA 2E1AA 3VR1A 3EE9A 2GWKA 4L6V3 4F3TA 4O55A 2HBJA 3P6YC 4GRSA 3BS9A 2MY7A 1FJGJ 4EP4A 1JWWA 1WKLA 2RJZA 3R5GA 2ZH6A 3BF1A 1YGYA 4W5TA 3CJ9A 1IBLJ 4BVPA 1A5WA 3N4QA 1IKWB 4KE5A 1O51A 3BQ2A 4FWMA 1XMOF 2K3KA 1T95A 1QSYA 3C6AA 3CW2C 3NS7B 3BGRA 2WSCC 2A2CA 2VGMA 1VRQC 2XLJA 2CG4A 2HF4A 4H0XB 1H1VA 3G9CA 2UV8G 1NGIA 2IBKA 3OW2M 3NNHA 2MKCA 1EO1A 1VI7A 1HBOB 2WFBA 3NCPA 1SQFA 2JVRA 2M70A 3SDEA 1RTDA 3PKYA 8ATCB 3KLVA 1YI2S 3SI8A 4X4VA 2KLAA 2FLOA 2VUGA 1G15A 3MAAA 3HHLA 1FF2A 4IRKA 2IVFB 2FHJA 2COLA 3W3DA 5D4LA 1M5SA 1LOTB 3OPKA 2K7KA 4FM1A 5KFJA 1AZSB 1S12A 2NYIA 2V50A 3LGNA 4F0MA 2GQ2A 1BI4B 4I6MB 5EDWA 4HVJA 3OD2A 3F41A 5EWEA 4DL4A 1NSKL 4KGMA 5AQIA 1ZA2B 4C0HA 4HI2A 2AT1B 1X4GA 4PEOA 4D3HA 1YBUA 3VEXA 2FLLA 4DR3J 1RU1A 3EVOA 3MURP 3SUQA 2MJUA 4X4UA 3L95X 2F9TA 3KK3B 4P7TA 3RVCA 1GFWB 4KSEB 4FK2A 2CNOB 1P8GA 3DGVA 1M5HA 4AQYJ 3TQ1A 1Q8IA 2YNFA 1IKVB 5DM7Q 1U26A 1B0VA 4ZA1A 3C6UB 2PC6A 2D5RA 4DR5F 3BDEA 3TSQA 1E6VB 3HM9A 1EQMA 3MMCB 3V81A 5AQUA 4KHNA 4PWUA 3VF4A 4IBNA 2R8IA 2LFVA 4ANDA 4R5PB 3TVZA 2WBRA 4DPOA 1BWEA 3AO1A 4ZPCA 5EXWA 3PIPL 2V9KA 1BQMB 1NJIT 4GO7X 1BY9A 4J91A 3BF3A 2GJIA 4JRQA 1HQEA 4CLPA 1MSWD 1CJUA 2ZJPQ 4USHA 4DOZA 3M2VB 4URSA 3MXIA 4LRDA 2R7TA 1BO5O 1JXBA 5KG6A 3AQOA 1BUXA 1RUSA 1I1GA 3P5JA 3H5SA 2DGQA 1YUWA 2YCHA 3ZSZA 3OBIA 5F8NA 2MSSA 1YZ7A 3THTA 4CGHA 1AB8A 2HNYB 4IFVB 1NGBA 1UMJA 4EBEA 4OLOA 4PPZA 5JVHQ 2QSWA 3HHNB 4OMFG 5C12A 4ED0A 1RT2A 1RTDB 2ALZA 2IPOB 1X5PA 4G1PA 2HFZA 2LQJA 2GIQA 3U1MA 5HL7Q 2B9WA 2P9UA 3ZSYA 3NEKA 3ZX0A 3E9PA 3HI9A 4N76A 3W3SA 2V2VA 4JI6J 3D3BJ 5GIPA 1I3AA 4OYBA 4GY2B 4J2BA 3L2WA 3GJQB 1GLDG 4A2AA 2Y8WA 1H72C 2GO9A 4YDXA 4ZKAA 5LJ5Y 3HYFA 4FWOA 1VSKA 3QSIA 3A12A 4YOUA 2LU2A 3NWRA 2HK3A 4GV9A 4ZDNA 2X74A 2F40A 1M5OC 2XY8A 3AGKA 2OP5A 3KLHB 1CQMA 5AE1A 3L2UA 3D4JA 2R42A 3DJCA 2BOAA 1FERA 5GAHP 1KAXA 1HWKA 3MXHP 4DJBA 3I33A 3OYFA 1RTHA 3MMBA 4M3YA 2HFOA 3SUOA 4OZ2A 4L3QA 1URRA 3S41A 2ZH1A 3RMAA 4BG8A 5FRNA 4QIGA 6FD1A 4K4TA 2WUSA 4HACB 1BLUA 2P2CB 2B9XA 3OHRA 1AFJA 3R5DA 2KQ2A 5LOQA 2KG0A 3KZBA 2E2PA 4JOUA 5LL6d 4YY3K 3N4PA 2G8HA 4Z4IA 1RTJB 4ELUA 3M4XA 1XI1A 2W2PP 2O8EB 2RHKA 4ED6A 3U8XA 1UCNA 1YJ7A 3DM2A 4RU2A 3ZSRA 1NPKA 2H5EA 2HRUA 4A57A 1H6KX 1KKHA 1XMOJ 1N5VA 5ETMA 2DNNA 4N77A 1JJ4A 3TZYA 1RGVA 2E1CA 1VS3A 1FDNA 1N88A 3FEXB 4O0NA 2NSBA 4DTUA 3N28A 2HHTA 1DBDA 4K7QA 5J2MB 3FZKA 1HI8A 4IO8A 2YJEA 3B6OA 4WZMA 2RF2A 1IR2A 5J1NA 2AYBA 4YORA 4JUZA 1C0UA 3CVKA 3ZT2A 3EGWB 1VJQA 3M32A 1VHFA 3VQQA 2J0SD 3THWB 3Q8QB 2IIRA 1Z6RA 5K14B 4F04B 2UZAA 4KV8A 1TVRA 3T7ZA 2YKOA 4Q7AA 5D0EA 1X31C 3OLAA 1NBWA 1GOAA 1HQUA 4AXIA 5BR8F 1LAWA 3WBZA 3ASMA 4XPEA 5H9EJ 4B3RJ 2E5LK 5HVHA 5AFUA 1LWEA 2BDPA 4E1NA 2DT9A 1B4SA 2I0XA 2M7SA 1CJUB 2ZM6F 4ZPDA 1BISA 3U27A 2YTCA 2Z1IA 1FVSA 2ILYA 2XI2A 2OELA 4HCBA 4JHDA 3EZUA 3DDNA 2YNIB 2OUGA 4AQYF 2ZHAA 5HJXA 1U25A 3UE5A 2KB2A 4BGBA 3ZTSA 4CW7B 3Q83A 1JL2A 4LVNP 2KZMA 4RLEA 4KFBB 2XRIA 1N56A 4RX6A 1S72S 3C6UA 4KH6A 1EARA 1T9XA 1J53A 1SPBP 2VWBA 4NI2B 1VC5A 1VRTB 2G1DA 3HF5A 4B1VA 4I1TA 1IG8A 1JXEA 1QD1A 1IH7A 1MLAA 5A8KB 3KUGA 1ZTTA 2G13A 2CJQA 4ZN1A 2OD4A 2NYHA 2C3OA 3GSIA 2VDIA 2EVZA 1JLBB 3EL2A 1NO8A 5KG3A 1PIEA 3PYFA 1TL7A 4K4WA 4DMNA 5LMNF 2UV8A 4PYAA 2G2ZA 3Q7BA 2PFUA 4WIQA 5AZJB 1LV5A 1HFEL 5AT1B 4DR4F 4BY9C 3A3NB 5GADU 4IFVA 2N7YA 2UUAK 3DI6B 4P75A 3CQXA 4DSIA 4FLVA 1Y11A 2B5JB 3KVGA 3ATUA 2MQPA 3TANA 3G6XA 3TI0A 2I7NA 1W2BR 3QDKA 4CZMA 4GV6A 2CQ0A 1AYEA 2FF6A 2FJVA 3SBTA 4HUEA 4K4VA 1NK0A 3CJAA 2QW9A 3QRQA 1HKGA 1D9DA 1D8YA 3VEWA 4DR2J 1JB0C 2IM0A 2QA4S 1XR6A 2E9ZA 3LO3A 4CJRA 1ASWA 1VDHA 3WQTA 1SJFA 3C6TA 2ZBIA 3WHIA 2AHOB 2UU9K 4EBDA 3KWGA 5KFVA 3UB5A 4UY85 4MK7A 4OZ3A 4QOTA 3MPDA 3VEZA 3L2VA 4ZJOA 5JMNA 3EGZA 1RBRA 4LFBK 3TAQA 3H3NO 4FPAA 3UE2A 3G10A 1ZAVA 3FZHA 4B3SJ 4IXCA 2LXUA 3U1LA 1GLFO 3NWGA 3SUNA 2F5GA 2MKYA 3AVKA 1R8PA 1DJ0A 1LXJA 4IOCL 4J8FA 1CQNA 2EEYA 3H45C 2FD2A 3DRYA 1DKGD 3KLFA 2YKQA 2A41A 4CFBA 2YKNA 3CJ5A 3U02A 4C4WA 4JI1K 4CHQA 1NGFA 5FPEA 1RAAB 1P9QC 4P2SA 1NEEA 2CDQA 2HZCA 4H5VA 3K7RA 3R9LA 2E1MC 2HBKA 3FEZA 4W4MA 4CJKA 2XNQA 1KP6A 2XYGB 2KG1A 5HQLA 1RBLA 3M8PA 1F3FA 4X64J 4L76A 1XNQF 5AQHA 3B54A 2YKMA 4USMA 4XDCA 3ZSOA 3B4DA 3EKSA 3JSBA 1EKSA 3V1RA 1MG7A 5DDRC 5HRNA 3FCVA 3V6DA 4K0KK 1Q78A 5HANA 5C25B 2ZVIA 3PHTA 3RMCA 3TZWA 2FZKB 4M5HA 2OTJN 4I9QA 3CIMA 1VQ4N 2VKZG 3TUIC 2C2MB 1BCOA 3K5LA 3KKRA 1R8BA 4CTAA 3THYB 2W9AA 3D1OA 4LF1A 3M3ZA 4MT1A 1N32K 1R8HA 4WBFA 4YOXA 5CY4A 1RWUA 3FSIA 4IOCQ 4ELVA 4K4XA 4K4YA 1V5VA 1D9AA 2CQIA 2R7RA 4KYZA 2EBEA 4S0MA 5BRFA 3QJPA 4AHCA 3BB5A 3MZIA 1F9FA 1FWKA 1XJWB 4G6VB 2OZSA 5KFDA 3M30B 1QAJA 1YJNS 1FHTA 1CULA 4WKRA 2ACYA 3AAPA 1FKPB 4H8KA 2EWSA 1OVYA 4QYZJ 2QZ8A 3A5LC 3FLCO 5EWGA 2A3JA 2QGFB 3WIVA 5L38A 3UDVA 2WVFA 2YWGA 1DY3A 3K5OA 4YB5A 1CG2A 4OX6A 4DN0A 1NJZA 1T8EA 1N34K 1P1TA 2GFFA 1RILA 1C0UB 3CJCA 2F8EX 2MTLA 3MCSA 4ZP7A 3QLHB 3KD1E 2VBWA 2ZDOA 4IFEA 4W5QA 2DR9A 4JK8A 1FEEA 3THYA 2HZVA 3DRXA 4DR1J 3CCSN 3MXJA 2PE8A 1S22A 4OPKA 4ZVFA 4KB0A 2BOPA 1AFIA 4C11A 4DQSA 1B3TA 3QGHA 3FFKB 2HHWA 4PQAA 4CJSA 5E3PA 4TU9A 3GG1A 2LCWA 4WYBA 3SQ0A 2G0IA 2V4JB 4JYAJ 2CPDA 3CDEA 1R59O 3S01A 3ZX3A 3ISND 1YJRA 4H4OB 1B7FA 7FD1A 3L7PA 1I51B 3PR5B 4K43A 4OZ5A 4C8KA 1AT1B 3LP2A 4F4XA 5M1OA 3O80A 4GC6A 4CJWA 5AE3A 4B9LA 1V5IB 4FLUA 1N6QB 5M2UA 3O5BA 3M6XA 3K58A 3MECA 1SJ4P 2A18A 2ZZTA 5KFLA 2Y0SD 4JNEA 4Y1CA 2M52A 4BRCA 1WBDA 1OS5A 3BPSP 2RQKA 3C94A 4ETZA 2W1BA 4CZGA 1YJ9S 1C1BA 1H0HB 2RE1A 4K5RA 4KHPF 2P9LA 2MSTA 3NF6A 2G8VA 3RBDA 2DISA 5E5NA 3CCMS 4RNHA 3DRPA 4IOBA 1DTTA 1RAJA 3FMBA 2OD6A 4NE9C 4ILGB 3QINA 5EOYA 1S1TB 1ZTWA 4BRGA 3FVYA 3KK1B 2DKOB 3TWZA 2OFHX 3D2FA 2XZWA 4P9SA 4BC3A 2CXEA 2HNYA 3PDNA 1N54B 5EX5A 3WEEB 4X4SA 4MDBA 4UOGA 4JKEA 4B3TK 4ZPWR 1Y00A 2CWKA 3V9XA 2GTDA 1RBSA 5KFWA 5LJWA 3V9UA 1ASVA 4FJKA 2CPFA 2OSRA 4LF7F 2MZSA 2ZBCA 1V4SA 2VQFK 1UEVA 3IFEA 2VKRA 2FJXA 3HRGA 2CZ4A 2EG2A 4L8RB 1U47A 4A4JA 1VQ8S 4CEQA 2NXCA 3TW0A 4JI8J 5ETVA 1MROA 3KLEB 4MFBA 1S3XA 1NZ8A 4F8RA 3HVAA 1GK8A 1PKUA 4GKJF 1KVAA 5F8JA 4BE0A 1X8DA 1O5JA 4HR2A 3M1FA 4P2XA 1WKKA 3ENQA 5T7BA 1WDDA 2DGVA 3EEQA 5KFXA 3I0RB 2AGQA 1B7YB 1BMQB 4QW9A 4CF1A 4PY5A 1VQ9S 2P9NA 3CSKA 4QIFA 2FSKA 4NYPA 1RKJA 5DDOC 1SC6A 3HK2A 3U3YA 2IRYA 1M5PC 5CCMA 2E1PA 3HZGA 3P39A 4M3ZA 1JCGA 2AZ1A 2RKIA 3I0SB 2W7PA 1AUDA 1NM1A 1DLOB 2J6TA 3PUFA 4ZCIA 1H7WA 3GLJA 3GZ7A 3S6EA 5KFIA 2QA1A 1Z2LA 4OO1J 4JI4J 2DIUA 4NLOA 3OUYB 3PYGA 1S99A 5KAKA 2MGZB 1G6BA 2JJ4D 3CO0P 5ITHA 1U2VA 2UUBF 1RB0A 4ECWA 2NS1B 4BWJA 2MKKA 1Z05A 3NOGA 1S9GB 2QLFB 2I6WA 3CWJA 3A8JA 4R0JA 2B3TB 5C2FA 4QJVA 3MM9B 1HJOA 5SZTA 2RU3A 4ZN3A 3AO2A 2DRBA 1GLEG 4JI3J 3JB9k 2E44A 3P83D 3TUJC 3OJSA 1ROFA 4J9QA 3TJ9A 4AXJA 2E5HA 4OJRA 2QL5B 3IRXA 2GIFA 2HMIB 5CZVA 4ZOSA 1R0AA 2FVQA 4JI7K 4DKWA 4ZTFA 1WOOA 3G4SN 4F4ZA 4IKFA 2WONA 3NBPA 3SLCA 1GTEA 1EWQA 1T03A 2B6AB 5HMZA 2GVZB 1V4TA 4M3TA 4F2RA 3NKYA 4KAZA 3LTOA 2XMAA 1HBUA 4DV7F 4MMOA 1W2IA 2MZRA 4OZLA 1S1TA 2OA8A 2BEFA 4JK9A 4KRFA 3W9HA 2VJUA 1OO0B 4DCPB 1MN7A 4CESA 3DLGA 2DHGA 4BRNA 4OPHA 4TY8A 1TMJA 3MD1A 2FUG9 1RE1B 3K59A 5L39A 4A8WA 2G8IA 1R6YA 1S59A 3AV9A 4DV2K 1HI1A 2VBYA 3PO5A 3FC9A 1ZBUA 2D74B 1NDCA 4QU7A 3DHXA 1S7IA 5D3GB 3FSYA 4CJ4A 4ZS6A 1VSHA 4FLZA 1IM6A 1YKWA 3AJ1A 3MMJA 5BRDA 3CPWM 1FRHA 1N5YA 3ICLA 4RW7B 3RMDA 4HUGA 4IOAL 4A5BA 5L46A 4M3UA 4HTIA 5KFKA 4WQ5C 4AE5A 4E7IA 4Y2MA 1FTRA 3C14B 4FWKA 2M8HA 2W9CB 3HKWA 1HPMA 1BQNB 4NX9A 2I1RA 2BW7A 1NK6A 1U2RA 2ZH4A 3SPZA 5C2CA 5FJ4A 4ILLA 3MCMA 4F3MA 4ANEA 2D3O1 2W2MP 2B5JA 3FR0A 2UXCJ 3ULEB 1TL3A 1Q7YO 2GO8A 3TUZC 3QQCD 3QMQA 2R8GA 2E8AA 3M9NB 4GMKA 1KHWA 4O23A 3T5LA 1LWCA 4Q2LA 2HQIA 4TNOA 1J54A 5HBMA 2A3ZA 2H51B 3KLIB 2VFUA 1N5SA 1VQON 3KK1A 4YS2A 3L8BA 2QYGA 3CT9A 1RWPB 4JKGA 3CJSA 3PM9A 3KMQA 4JV1A 1NUEA 1S5ZA 3O9UA 5ETQA 4X4NA 2VV5A 3K57A 2P9NB 1FKOA 3D7SB 3NNCA 2BE2A 3HX9A 2ZH9A 2JVOA 4NO7A 2FIUA 4NB4A 2D0BA 3AA4A 3GFHA 3QIPB 3I82A 2MEWA 2XCAA 4U8VA 4CO2A 3OTBA 3RGIA 2VWJA 2XMTA 4JK7A 1RT2B 2AJFE 1BIUA 5JXSA 4BLGA 4E3SA 3DLLQ 3J80Y 1F21A 1JLCB 2OTLN 2CJXB 2Q36A 4ED5A 3EO3A 4JN4A 3X1LB 2Q31A 3ZO7A 5ADZA 2J9DE 3CTRA 2BTFA 3FZFA 3AAWB 5FDLA 4JYAK 5AQZA 4XTTA 5ETTA 3L4QA 1TK5A 5M2PA 4A62A 1C1CB 1DQ8A 3OSNA 2FVCA 4L3KA 2GA7A 3ULHA 4O4GA 5HVFA 2V2KA 5DQIA 4MLHA 3TSPA 3JAMU 4G1QA 3THWA 2JWLA 3MEGA 1ZBIA 1QAYA 3RB3A 2V67A 3C66A 3DXMA 4GW6A 3OL7A 2YH1A 2HAFA 2KXFA 1FT8A 5KFQA 4I7FB 3R3LA 4EZ6A 3C46A 2EG1A 2ERRA 4CZHA 4Y6IA 3RW6A 2QM1A 3HHDA 4LSLB 1ESVA 2PI4A 3CCLS 3FDSA 4FXVA 2HFSA 3VQCA 2E6LA 3NCQA 3EZWA 4X4RA 1RHUB 2CJAA 4O4RA 4H0OA 3VA3A 4ICLB 5KG0A 2AJ2A 4HHUA 1LK7A 5AJ3F 4RG8A 3MN6A 2BKNA 4XDDA 2CQ4A 3KXDA 3D2WA 2HKEA 1LCUA 5H9EK 1KVCA 4MIBA 2A1BA 2UXDK 4CH1A 1TKZA 1MU2B 3ZT4A 3HPHA 3FCHA 2HMIA 2UU9F 4WKYA 3NL0A 4DTMA 1AA1B 3M2RB 4Q5VA 1RBOB 1P1LA 3HHLB 2J9EA 4YR2A 4TVAB 2BQRA 1QHTA 1M1GA 2EBGA 3PJWA 1GLAG 4OI1A 3AT1B 1RT1A 3SQGA 2QL9B 1S9GA 1JLGB 2WOMB 5CA5A 3BH7B 4CFDA 5HK4A 3H5UA 2Z1HA 2W2QP 1X3MA 3I5AA 5TKWA 3QIDA 2RRBA 4FPBA 2JLFA 5F0UA 2EFOA 3JXOA 3GIJA 2DNGA 1ASUA 1WSJA 2G8KA 2KKHA 4YHHK 5L1LA 5MLCV 3NGYA 1GXUA 1YJ9N 2NREA 4DF4A 4JV2A 4JI2J 4FNIA 4DU3A 4JI3F 4CHNA 1EX4A 2CQGA 3OFGA 5ADXH 3MEDB 4FJHA 1SJRA 2KTQA 3CFPA 2GAGC 1FEHA 2FJEB 1U6ZA 3AA9A 2FC8A 1RTIB 1FDDA 4EEYA 4A8KA 4KJIA 2WSFC 2QKKA 3O4QA 1RQ0A 3PACA 2YQ3A 2R2TA 4LFBF 1TL4A 2VIHA 3E2EA 2IMWP 2X7IA