4RW8A

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor'
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
548
structure length
548
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 136
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw8A05
1SL2A 5CZ1A 2HB5A 1B9DA 4RUAA 3L2VA 2XCAA 4MK9A 1X9MA 3HO1A 1JXEA 1HQUA 4M94A 3BGRA 4WXOA 2P5OA 2Q3SA 4FJKA 3HVWA 4RW9B 5J2QA 3AVFA 1VSFA 1JLAB 4O3OA 2QXFA 4B9VA 4R5PB 4H8KA 1WNSA 5KFFA 3IGNA 3M8PB 3E51A 3VQDA 1EKEA 4CF8A 1RBTA 3H5XA 3AVCA 2AGQA 2R7YA 3OYDA 1U45A 1S9FA 1HRHA 3JSMA 1RYRA 3E01B 3C6TB 1BQMA 5JXSA 4QW8A 1RTJA 1B9FA 1I39A 4E7JA 3TAMB 1JLGA 5J1EA 1R0AB 4GW6A 1ZETA 4KFBA 4M45A 3V1RA 3OYEA 4CJFA 2WHOA 3WNGA 3NMAA 4LSNA 1J5OA 3VQEA 3TAQA 2F8SA 1K1QA 4EP4A 3V6DB 4EYHB 3AVIA 4DTJA 5DLGA 1HNVA 5K14B 4RNFA 4PWDA 1S1TA 1DTTA 3PHEA 3NE6A 3VQ9A 1IH7A 3C94A 3NDKA 3PW4A 3IN5A 1SUQB 4QPXA 3KHLA 2G8UA 4E7LA 5J2NA 4IG3A 5F8GA 1ZBUA 2OZSA 1CZBA 3RMCA 4N41A 4DL2A 3QETA 3DOKB 5EWEA 2XGPA 4KHQA 3BQ1A 3KLFB 1RBUA 3OSNA 4HYKA 4FZZA 3TAFA 2W9BB 3MEGA 4BE2A 5KG2A 4CJUA 5CYMB 1QAIA 3KHRA 3FFIB 4DQIA 4Q45A 4OKKA 4Y1CA 3LZIA 4IR9A 1RDDA 1T3NA 1L3TA 3DI6A 1RNHA 5KG7A 5SZTA 1SL1A 1ZBFA 4RW7B 4QW9A 4CGHA 1RTDB 3IS9B 3SFUA 4CIGA 2DFEA 5EWFA 2Z1JA 4CJ5A 4N56A 1RT7B 3DYAB 5J2MA 4DSKA 4PQUB 4F4XA 2QV6A 4NCGB 3PVXA 3KLGB 4FVMA 1HMVA 4B9NA 2G8KA 5HROA 4CEFA 2OZMA 4CEQA 2I1RA 1TL1B 1DLOB 1XI1A 3GV7B 1C2PA 4Z4EA 1XHXA 3BSOA 2FBYA 2HVIA 4ID1A 3QERA 2VWKA 1Z26A 2B43A 4DSLA 4URGA 1X9WA 1SKRA 1QSYA 3QLHA 1Y97A 4QWEA 2ATQA 3DOLB 4JS4A 2YHAA 4ZTFA 4ZHRA 5KT5A 4I2QA 4IKFA 3G6XA 2W9CA 2HWHA 3N6NA 5J2PB 5KFKA 3OVNA 4M42A 2KFZA 2HNZA 1NK9A 1JLQA 1U09A 4W5RA 2IC3A 4FJGA 2VG7B 3GV5B 2R8IA 4KB7A 4FLVA 1RT3A 4GC6A 4Z4HA 3TAPA 4F2SA 3FSIA 2EC0A 1J54A 4MKBA 3AO3A 4F8RA 4M41A 4HUEA 5JUMA 5EU7A 4H4MA 3ZT2A 4CF0A 3V9SA 3RMDA 5KG4A 4RW6A 3CWJA 1TL3A 4HUGA 2YKNA 2O4IA 2OPRB 1LAVA 3CIZA 1REVA 1W9HA 4FLTA 3L2UA 2ASDA 1VRTB 2AGOA 4BWJA 4KE5A 2YKMA 4NLYA 3PX0A 3V9ZA 2R2TA 2RDJA 1LWEA 4CK3A 4KTWA 5FRNA 3BQ0A 2GIRA 1RT5B 3M8QA 2FVQA 2RKIB 2OPSB 4B9MA 1TKZB 4TN2A 2AU0A 3SI6A 4DTSA 1TK0A 4K4YA 2FVSA 3RAQA 1NKEA 2ASLA 1NNDA 3TAGA 2X78A 4Q0BB 4E7IA 4I2PB 2FLLA 4LH5A 4J2BA 3EPIA 3PUFA 3NL0A 2HHSA 2FVPA 4CIFA 1KFSA 3HM9A 3KLHA 1A5XA 5C5JA 1FK9B 2WOMA 4F50A 1SH3A 1ASVA 1D9FA 2IM2A 1U49A 1HQEB 3GYNA 2R2UA 2ZKUA 4CF9A 4ID5A 2ETJA 4NLTA 4BACA 2UVWA 4LQ9A 3PO4A 2XRIA 3OYJA 3NF6A 3DRRB 4RW9A 3VN5A 1JLAA 4KKOB 1T05A 1HQUB 3BGRB 4R5PA 3LZJA 4OJRA 4YP3A 2AJQA 3M8PA 4B08A 5I3UA 1JXLA 1NOZA 3MEDA 3HVTB 2JC0A 1D5AA 4EO6A 4MIAA 4TYAA 4HUFA 4BE0A 3DM2A 3E01A 3QO9B 3C6TA 3PX6A 4FJLA 2E9TA 4QWAA 4O4GB 3JSMB 3ULDA 3CG7A 1BIZA 1R0AA 4O3RA 3L8BA 1RTJB 3KK1B 4K4ZA 5HP1A 2FLNA 4GMJB 1I6JA 4ECXA 3ZT3A 3OY9A 3HP9A 3T5LA 3ISNC 5HRPA 3V6DA 1UA0A 2Y1JA 2G8IA 3LP0A 3CO9A 4O3PA 1LWCA 5K14A 3U3GA 3O3FA 4NLPA 4IRKA 3QEPA 1D8YA 1HNVB 3CJ0A 1SUQA 4CJRA 4CJPA 4PWDB 1S6PB 4J9QA 2B5JB 4RNHA 4CEEA 4K8ZA 2JGUA 2I5JB 3Q8PB 2ATLA 4Q44A 1VSKA 4URQU 1WSIA 1QSSA 3LP1B 4IG3B 4M3ZA 4DS5A 3SZ2A 2W9BA 1JL1A 3EPGA 4DS4A 5F8MA 5CYMA 4Q5VA 3FFIA 5HBMB 4TY9A 4BDZA 3MECB 4K50A 1K1SA 1CXUA 2PYLA 2YNGB 1F21A 2UUTA 4CEAA 4RW7A 1RTDA 5DGBA 4ZTJA 3UQSA 4ECWA 4AH9A 1RT7A 1JL2A 4J9NA 4EP5A 4PQUA 3CJ5A 5KFZA 3B6OA 4FJXA 2E6MA 1CLQA 5KFTA 3VQ6A 3CFPA 3KLGA 5SWMA 5J2MB 3PY8A 4NCAA 1TL1A 2P5GA 4CECA 4CGIA 1NK8A 2BQRA 4CJEA 2HNYA 4AILC 5HROB 3HXMA 3P83D 3RB3A 4C8OA 4GC7A 2EX3A 2JEIA 3ZSZA 5KT4A 5JS1A 1KTQA 2RPIA 3G6VA 3AA4A 3M9NB 1RTHB 4ECUA 2WRMA 3ZT0A 1SKWA 3HVRA 3MTKA 1XR6A 3S9HA 5J2PA 1WAFA 4OLAA 1S0NA 5KFBA 3OYBA 2VG7A 4IG0B 1HARA 3C6UA 3T3FA 3K2PA 2ZQBA 4ELTA 1B92A 2IC3B 4J9PA 5DLFA 2F8TA 2ILZA 4M3XA 4DL4A 3SQ2A 4ED7A 4WZQA 5DK5A 3QINA 4JRPA 5C25B 2Z1HA 4Q8FA 3K5NA 4KREA 3JYTB 4H4MB 4ED8A 4B9LA 1TL3B 4FM2A 4CJ4A 1EX4A 4EEYA 3S3OA 1SKSA 4JS5A 2PZSA 1REVB 1QHTA 3PR5B 5KT6A 1KRPA 4NYNA 2D7SA 5KT3A 3VQCA 3QYYA 4F2RA 3KIOA 3OYHA 1C6VA 2RKIA 4G3IA 2OPSA 2IS3A 1LWEB 5KT2A 4Z4IA 2BRKA 4ZPBA 3PW2A 2J6TA 2W42A 4R0EA 3ZT4A 5L1JA 4ZVGA 4KI4A 3ZSYA 4DFJA 3I5BA 1S1XB 4Q0BA 1RBSA 2HHVA 3ZSVA 2HHXA 4QAGA 2V9WA 4J9RA 1UWBA 4OL8A 4EBEA 2XY7A 2XCPA 4KB0A 3NGZA 1FK9A 4FW1A 4DL7A 4ELUA 4ECZA 4FZXC 3V9UA 3UPFA 3CJ3A 3NAIA 2A1RA 2HAIA 1HQEA 3ITHA 4IKAA 5EDWA 3VQ5A 2WOMB 2HMIA 1L3UA 4DSIA 5HRRA 4OVLA 2HHUA 4W5NA 3QGHA 3RBEA 1NHVA 2V4QA 4IOBA 4CEBA 1NJYA 3DRRA 4KKOA 2IJFA 4ID5B 5C24A 2KQ2A 4BDPA 3KLEB 3BDPA 3IG1A 4W5TA 1HPZA 3SQ0A 4IRCA 4DL5A 4KHYA 1T05B 2F96A 1C0TB 3UDLA 2WCXA 1BIUA 2OH2A 2XY6A 1RA6A 3FQKA 3HHKA 3HVTA 3OHAA 3RB4A 1WSJA 1MMLA 4HCBA 5I3UB 3QO9A 4FJ5A 4FJ8A 3QGIA 4ZPAA 3PV8A 3MEDB 1N4LA 4O4GA 1CZ9A 3DM2B 5F8JA 1N5YA 2E4LA 4OGCA 4JV0A 3LWMA 3KK1A 5KFMA 4ZPCA 1X1PA 1T8EA 3DDKA 5HP1B 3ALYA 1NK7A 4F4KA 3LAKA 4TXSA 4J9SA 2HWIA 1A5VA 4KBIA 4RW8A 4ZP7A 3QZ7A 1RCHA 2C2DA 4DTPA 1NJXA 3LP0B 1LWCB 3NGIA 4IFVB 3PJXA 3SPZA 1S6PA 4DF8A 2F8EX 2B5JA 4CJWA 3KOAA 1U04A 1LW0B 3T5HA 2I5JA 2BQ3A 4Y1DA 1IO2A 3ZSXA 4OPJA 2C22A 1QE1B 3LP1A 4TLRA 4E3SA 3O4QA 3AVGA 3VA0A 4Z4FA 2FJWA 4K4SA 4ED0A 5KFQA 3QIPB 5HBMA 3V6HA 3MXJA 1YTUA 4KAIA 3MECA 4KHRA 2GBZA 2YNGA 1N6QA 4KSEB 4KHNA 3KK2B 3M8RA 3GIMA 1RDCA 2OYQA 3H40A 3BSNA 3OS0A 5FROA 4ECQA 4N47A 4FK4A 3SNNA 1LAWA 3K5LA 2R8HA 2JLEA 4G1QB 2KW4A 3NAHA 3QIDA 2QKKA 1JKHA 4B8AB 3EY1A 1NJWA 1RT6B 4J2AA 3MR6A 2KFNA 4O3NA 2HHWA 1FXXA 2XY5A 4HKQA 3H2LA 4LQ3A 1HYSB 2PYJA 2HNYB 5DG7A 2C2RA 1IKVA 3LPTA 4NLWA 1J53A 3NGDA 2UUWA 4FCYA 2BDPA 2IM0A 4YR0A 3O3HA 1RTHA 4DSFA 5KG3A 2YNFA 3TR8A 4E7HA 2Z1IA 5FDLA 3PW7A 2G8VA 3OYFA 2XO7A 1NK4A 4ECRA 3TANA 4MH8A 4QWDA 2OA8A 4IG0A 4F4ZA 3H4BA 5KFDA 4DTRA 4KB1A 1OS5A 2Z1GA 1Q8IA 3ZCMA 4FJ9A 1WSHA 3DLBA 1S5JA 1KLMB 3HPOA 4WZMA 4JV1A 3C6UB 5DG8A 1TV6B 3QESA 4U6PA 1JLCA 4M3RA 3DRPB 5KI6A 3I0SB 1RBVA 5KFWA 5C25A 2KZMA 2BANB 4Q8EA 3JYTA 1S1WB 1EP4A 4AHVA 4B3OB 4DU4A 1T7PA 1QSLA 3GIIA 1RDAA 4NLUA 3I5CA 4IRDA 5F8NA 2PY5A 4L8RB 3KJVB 4FLUA 5KFCA 4DFPA 4I9LA 5JS2A 4K4VA 4E89A 3RB6A 4YMEA 2D5RA 3OL8A 3KHHA 1XR5A 3TAEA 3HYFA 4LY7A 3O3GA 4QWCA 1W0HA 3KKSA 4CHOA 1VSDA 2FJVA 4IH6A 1S1XA 3VQ7A 2HVHA 1BCOA 1HNIB 4KO0B 3FDSA 2G8WA 1QQCA 3I5AA 4OKEA 2VG6A 3LPUA 4DSJA 3DRSB 1WN7A 3CQ8A 1UWBB 3DMJB 1N56A 4M95A 1S97A 2P1JA 3KD1E 2ALZA 4RG8A 3NF7A 4FJ7A 5D3GA 1XC9A 3SV4A 1UAXA 2OPQA 3ITHB 4WYWA 2IM3A 2HMIB 3G6YA 2UVVA 3G0ZA 3KLEA 3HL8A 2XWYA 2E6LA 1TKTB 4ICLB 5C24B 3MAQA 1A5WA 1C0TA 3S3NA 3IG1B 1HPZB 3PW5A 3CFOA 1Q9XA 3H59A 4YQWA 4F4WA 4IR1A 1JXBA 3TARA 4FBTA 3DLEB 4K4XA 5KFLA 2E9ZA 2W9AA 1S10A 3LANA 3I0RB 1WAJA 4EZ9A 4J2DA 1VRUB 4WE1B 4K4WA 3MXIA 4E1NA 2RF2B 4CJKA 1N5YB 4ECYA 3VQQA 3SJJA 5CZ2A 4TQSA 4B9UA 3CVKA 2B6AA 1T03A 4K4TA 4BWMA 1ZBLA 1TAUA 4DL3A 2JEJA 5F8IA 4K4UA 4I9QA 1L5UA 1C1BA 1U48A 3D5MA 2ITGA 4RW8B 4IFVA 4O0IA 1ASWA 4CGJA 4PUOA 5DQHA 2D0CA 5KG1A 3RBDA 3CFRA 1D1UA 2GC8A 1LW0A 3Q8RB 1IG9A 1ITGA 1WLJA 1QTMA 2DPIA 3M9OB 5L1IA 1S6QA 1QE1A 4CJTA 1C1AA 3PZPA 4H54A 3P5JA 1KVCA 2IA6A 4C8NA 3CYMA 4YR3A 2FBVA 4M3TA 2R2RA 3PO5A 3QIPA 1KSPA 3F9KA 1SV5A 4E7KA 2YHBA 4ECTA 1Z4UA 4FM0A 3SCXA 1QAJA 2FVRA 4C8MA 1KVAA 4CJQA 4KAZA 3KK2A 1KFDA 3DLHA 4QOZB 4FW2A 2ASJA 2R8GA 3L2QA 5DMRA 1XR7A 3QIOA 2VG5A 1N6QB 3OL7A 3CDWA 1EETB 1JIHA 3HSTB 3P1GA 1BL3A 3V1OA 3QEWA 2QK9A 2IGIA 3H5UA 1S0MA 4CF2A 1L3SA 4CGFA 2HHQA 4G1QA 4CJLA 4CHYA 3VQAA 5KG5A 4H4OA 1QUVA 3L3VA 4ZP8A 1ZBHA 1RT6A 4CCHA 4XPCA 3WNEA 1FKPB 3AO1A 4KHUA 4IH5A 4NRTA 1NJZA 2D3UA 5KFVA 1JKHB 1BCMA 3VQPA 2DY4A 3AO2A 3F73A 1HYSA 2A1SA 1S4FA 2IBKA 3T5KA 3SFGA 3NF8A 3OSPA 5F8LA 3B6PA 4CHNA 5KFAA 4O4RA 1IKVB 4KTQA 4Z4CA 4O44B 1UA1A 3OS2A 4DFMA 2DPJA 4IDKA 4DTXA 1NK0A 2YNFB 4HCCA 4OGEA 5FDLB 2C28A 1YT3A 4DG1A 2R2SA 5KG6A 4O3SA 1KLMA 3T1AA 1TV6A 4WXWA 5F9LA 4CGGA 3I8DA 3DRPA 1BHLA 2AQ4A 3RR8A 3HKWA 3KK3B 4M3WA 3RB0A 1S1VA 3I0SA 3TABA 4DLGA 2BE2A 2AGPA 3V6JA 2BANA 1JLCB 3RWUA 3AVBA 4KRFA 1S1WA 3V81B 2UVUA 4FZYA 1RT2A 4ZP6A 4KI6A 3ICLA 1DTQB 4B3OA 5KFSA 2XY8A 4MIBA 5KFEA 1EP4B 3VQSA 4IBNA 3HJFA 4B8CA 3KJVA 3ISND 4Y34A 3TWHA 4ZVFA 3UIQA 3K57A 3QEVA 5L1LA 4WFYA 2J6SA 4DEZA 5HRSA 1KLNA 3THVA 1ZBIA 3GIJA 4EYIB 4NYZA 1UOCA 1S9GA 1JX4A 2UVRA 3AVAA 3BSAA 3D45A 3OJUA 1TK8A 4FS2A 5EWGA 1HNIA 2XGQA 3OJSA 4KO0A 2YV0X 4ZVEA 1L3VA 2BGGA 3OLAA 5KFHA 4URSA 5KFOA 4TQRA 4RU9A 3DRSA 3MFIA 5F9NA 4PA1A 4W5OA 3DMJA 4F3OA 1VSLA 4KV8A 2VG6B 2ZD1B 1WSEA 2WONA 3CJ2A 1GX6A 1KVBA 3MR2A 5L9XA 3FRZA 4HHTA 2D0BA 5T7BA 2FBTA 4C8KA 4DTMA 4MK7A 1TP7A 1XHZA 4AHCA 4FLZA 2G8FA 5KTQA 1IM4A 2X6SA 5D3GB 1IKYB 3BSCA 4FJHA 2VWJA 2OPQB 1TKTA 5KFYA 3A2FA 3VQ4A 4CE9A 1BGXT 4ICLA 3OL9A 3DLGB 4J9LA 2B4JA 4E19A 1SH2A 1S9EB 1G15A 3RMAA 3AV9A 3DLEA 1VSEA 2AX1A 4MK8A 1MU2B 3K5OA 3V9WA 2XHBA 4Z0UA 3I0RA 4KHSA 4W5QA 2AWZA 5KFNA 4O0JA 1RT4B 4JV2A 1U47A 1EXQA 4RUCA 1VRUA 4WE1A 4CEOA 1KHWA 2W8KA 4CK1A 2RF2A 3M8SA 4C8LA 2HHTA 4TY8B 3SUPA 3LP3A 4R8UB 3QNOA 4CEDA 4RW4B 4FK2A 3MR3A 4O3QA 4LSLB 2X74A 1FKOB 1VSJA 3OYGA 4NRUA 3GILA 4CHZA 2B6AB 5HLFB 1T03B 5DQIA 4YR2A 3IAYA 3ZSOA 3QEIA 5CYQA 3GIKA 2DTUA 1KCFA 3SI8A 2QE5A 3KHGA 4CHQA 3GQCA 3OL6A 1C1BB 4CGDA 1RYSA 3NCIA 3SQ4A 3SUOA 4AHUA 3OHBA 3BREA 3QNNA 4PUOB 2IAJA 1RT1B 3C95A 3LDSA 4O5BA 2YNIA 2YNHA 4MFBB 4KPYA 4Q43A 3T5JA 4DU3A 3OYMA 1N48A 3LP2A 5C42B 2D3ZA 1S49A 3AVNA 1O1WA 1S6QB 1NK6A 1S48A 3SUNA 1RDBA 5KFIA 3UR0A 4DTOA 3M9MB 3G86A 4WYLA 1SV5B 1YVFA 4CFDA 4CEZA 4Y2CA 4CK2A 1LWFB 3PJWA 5HRNA 3HPHA 3WNFA 3TQ1A 1EETA 4N76A 3IRXA 5KRSA 4NZ0A 4Y2AA 1IKXB 2XI3A 4J2EA 3NHGA 2VG5B 3Q8QB 3N6LA 2W7PA 4HVJA 3NKYA 3NH0A 3AA5X 1CXQA 1I3AA 3V4IB 1TAQA 2BR0A 4FM1A 1FKPA 4NLGA 2GV9A 4F3TA 3RRGA 4H4OB 2ILYA 1BI4A 4YNQA 4FYDA 3U3YA 4RNNA 1VK0A 3EYZA 3BJYA 1C1CA 1KHVA 1WSFA 4ZMMA 2FJXA 4ED6A 4O44A 1TKXB 4FJIA 4CF1A 1WNEA 1JLFB 2R8JA 4CFBA 1S1UB 4DL6A 1TVRB 1VSHA 4IDKB 3AA2A 2FLPA 3LAMA 5DGAA 3RAXA 3HP6A 2DFHA 2KTQA 3DLRA 1BQNB 4NLOA 4TSXA 4DG1B 2JEFA 1RTIA 3H4DA 2FBXA 2FC0A 4LH4A 4DQSA 3KK3A 2LSNA 2VA3A 1RDRA 5DG9A 3KLIB 1C0MA 3AO5A 3V81A 1D9DA 1HJRA 1S1VB 3D28A 3NBPB 1DTQA 2BE2B 4TYBA 3MXMA 2HW3A 2P51A 4I7FA 4NCBA 1RT2B 3K59A 2JC1A 1ZTWA 2ZE2A 1D0EA 4NLSA 1SH0A 1LW2B 3GV8B 2WTFA 3AVMA 3MEEB 4CFAA 2CKWA 4KHWA 2XC9A 3HK2A 4FS1A 4RNMA 3V6KA 3CDEA 3KLVA 4YFUA 3NGYA 1S9GB 4JUZA 1TKDA 5EUHA 4EZ6A 3NAEA 1K6YA 4IQXA 5KGWA 1JLBB 3QEXA 4CJ3A 2HNDA 2J6UA 1J9AA 3AA3A 5I42A 4ELVA 3U6FA 3EZUA 2ZD1A 4EBDA 2D0AA 4FBUA 3H98A 1YVUA 2NUBA 4WFXA 3DLKB 3AVKA 4KV8B 3OYNA 1IKWA 1WSGA 2WONB 4OPKA 3T19A 3K5MA 4IFYA 3HPGA 1ZTTA 1IKYA 3CDUA 3AVJA 4AHSA 1RBRA 4OKJA 4DSEA 4FLXA 1QS4A 1VSMA 4OLBA 4DLEA 4Z4GA 3DLGA 4X2BA 2JEGA 2OPPA 3KNAA 3ZSRA 2IM1A 3KMSA 4NLDA 3SYZA 1TGOA 1C0UA 1S9EA 2W8LA 1JLEB 1MU2A 4CIEA 3MR5A 4DQPA 4FJNA 4PY5A 1BISA 1NOYA 1RT4A 4HTUA 3ZSQA 2AX0A 5E41A 4TY8A 3WNHA 3OYCA 3SPYA 4R8UA 4EBCA 4RW4A 3PW0A 4DF4A 1RILA 4JRQA 4LSLA 4FLYA 1FKOA 5J2QB 1RAJA 4NYFA 2E9RX 5HLFA 4CJSA 3BR9A 4RNOA 2G8HA 3H08A 4CERA 1HYZA 3D0PA 4NLRA 2IMWP 3TAMA 5CYQB 3CM5A 2IOCA 4B9TA 2RN2A 1BQMB 3NH2A 3KD5E 4DQRA 3QZ8A 4DFKA 1RT1A 1HYVA 4K8XA 2QKBA 5KGXA 3RMBA 1JLGB 4MFBA 2X6NA 4DWIA 5J1EB 5KFPA 1GOBA 5C42A 2IAJB 4KFBB 1U4BA 3PX4A 2YNIB 2YNHB 2GUIA 5FRMA 1RA7A 4LSNB 1J5OB 3LP2B 4JLHA 3ZT1A 1NKBA 4QWBA 4MQ3A 4FXDA 1Z25A 4ECSA 1LWFA 3SQ1A 5F8HA 1S1TB 1DTTB 5KFXA 1ASUA 3O4NA 2W7OA 4BDYA 3L3UA 3DOKA 1IKXA 3VQ8A 3L2WA 4CJVA 3HT3A 3KLFA 5J2NB 3NH1A 2DFFA 5KRTA 3K58A 3IRXB 4J9MA 3S3MA 1CSJA 3CM6A 1TQLA 3FQLA 4O55A 4N5SA 3V4IA 3IGVA 5CY4A 5DQGA 3NF9A 1NHUA 3MEGB 5KFRA 4FLWA 2O5DA 4J9KA 2WB4A 3V1QA 3G10A 1ZYQA 4ZVHA 5T14A 4J9OA 4UQGA 3NFAA 1W25A 1VSIA 1SL0A 3TVKA 1BI4B 1XWLA 2VA2A 3IS9A 3CJ4A 3AVHA 1TK5A 3DI6B 3DYAA 1TKXA 4ZP9A 4ED3A 4NCGA 3QGGA 5KFGA 4ECVA 4CHPA 4B9SA 1C1CB 1JLFA 3VQBA 1NK5A 1GOCA 4GVMA 2KZZA 4M3YA 3HVAA 3LALA 1S1UA 1TVRA 1DLOA 4QCLA 4AHTA 1HMVB 2V4RA 1BQNA 3OYLA 3PR4A 3OS1A 3AVLA 3TI0A 4FK0A 4FJJA 2CJQA 3LWLA 5L1KA 3DOLA 3Q8SB 4ED2A 1RTIB 3KLIA 3KMQA 1LV5A 4WFZA 3OLBA 3QLHB 4MKAA 4CFCA 3ZSWA 4LD0A 2GIQA 4ZHRB 3NBPA 4I2QB 3SV3A 2W9CB 4NLVA 2IDOA 3H5SA 4KHMA 3BQ2A 3MF5A 4IH7A 4EO8A 2HNZB 1JLQB 4I7FB 4CESA 4M3UA 1LW2A 3SUQA 2FVCA 2IJNA 4KTZA 2ZE2B 4ZPDA 3VA3A 1RT3B 4DQQA 1YTAA 3MEEA 3N6MA 3ASMA 2BQUA 4FJMA 4XPEA 5KFJA 3V9XA 2C2EA 2OPRA 3RR7A 4RW6B 2YKNB 1VRTA 5KT7A 1T94A 4XIUA 1GOAA 1JLBA 4E0DA 4XO0A 1X9SA 2EHGA 3L2RA 2R8KA 3OYIA 4DTUA 4Y3CA 2YKMB 3EZ5A 1RT5A 2HNDB 4F4YA 3DLKA 1TKZA 5I42B 4E1MA 1GX5A 2WK4A 4BE1A 2Y1IA 3KKRA 4RZRA 3RTVA 3M8QB 1S0OA 3KTQA 3AO4A 4I2PA 1IKWB 4DMNA 4NLXA 3OYAA 4DU1A 2D41A 2XI2A 5KG0A 4IFYB 2BRLA 5KFUA 3MFHA 1Q9YA 4AHRA 2V0NA 3OYKA 1NKCA 3H5YA 2RDIA 4DTNA 1JLEA 2OPPB 4U7CA 3KLHB 2O4GA 3RRHA 4NLQA 4ED1A 1C0UB
chains in the Genus database with same CATH superfamily
1SL2A 3G4SS 1B9DA 1WOOA 1X5OA 4FPIA 3TQEA 4RUAA 3J7AN 3L2VA 3HO1A 4M94A 3R1XA 3HZEA 5BREA 1OYDA 2GEMA 4I69A 3HVWA 1KAXA 4UY8T 4O3OA 3EVMA 1EARA 3E51A 1DJ0A 3M6GA 1ZBTA 1KD1T 5CZVA 1RYRA 4BC5A 2A40A 5JXSA 4E7JA 1HD0A 3IBWA 2XMUA 1JLGA 1R0AB 3VAKA 3OYEA 4CJFA 4DR3K 3NMAA 4LSNA 1X5PA 1FVQA 2VD3A 3VHQA 1NDPA 1F3VA 2ABYA 5HATA 3SMPA 3V6DB 2DRBA 3POTB 1HFEL 4NPOA 4RNFA 1S1TA 2DEIA 1VBZA 3PHEA 3NE6A 3KVGA 1XN9A 2VIHA 3K17A 1PBAA 2J7UA 5J2NA 2RHKA 1HWIA 3KG1A 2JRSA 2OZSA 4XAKA 3DOKB 4KHQA 3D6MB 4WK3A 1RBUA 3OSNA 1U1KA 4HYKA 1P9YA 1Z1ZA 3VEYA 2VFVA 1YJNS 3N4PA 3RSEB 1ULRA 1NGIA 4DQIA 4I6YA 1FDNA 3NVKA 3QBXA 2V7ZA 3IBCB 2MQMA 3LZIA 1DQ8A 1JNRB 5SZTA 2BVZA 1OPZA 1D8ZA 4QW9A 1RTDB 4CIGA 1NDCA 3H42A 3I32A 3DYAB 4F4XA 4BG8A 3M32B 4NCGB 4NI2A 4QS9A 1P1LA 2G8KA 2AJ1A 1Q86O 3ZTOA 3GV7B 1NGJA 1OYEA 1JCFA 4Z4EA 1BY9A 1UETA 3BSOA 3HDSA 2OTLS 3VGVA 4ID1A 2B43A 4DSLA 1U02A 2OI2A 3UE5A 1QSYA 3H2VE 4QWEA 3WEEA 1YZ6A 4ZHRA 5KT5A 4IKFA 2EG2A 2W9CA 2UUAK 2BKOA 5KFKA 1SZ2A 3OVNA 2H3GX 1GLAG 3VAIA 4LBPA 1WG5A 3MHYA 1NK9A 3IDHA 2VG7B 3LGNA 4JI7F 4FLVA 3OFFA 5AQHA 3RW7A 4OJ3A 4ZN1A 2GZOA 4F8RA 4HUEA 1SC3B 5IC6B 2QEXS 1V5IB 2LA6A 2FGOA 3TEGA 3UCZP 3IR5B 3ZT2A 3IBFB 3V9SA 3M2RB 3RMDA 4DR1F 4OPHA 3D6TB 3IFEA 4HUGA 3W8GA 2YKNA 2OPRB 4RL1A 4AQYJ 4BY9C 1REVA 4ZVRB 1Q5VA 4NXMK 2XHCA 2AF6A 2Q0RA 1VRTB 3S8SA 1H6KX 2ROGA 1H72C 1VQ5S 4CRJA 3R5GA 3TTCA 2LQ5A 5JMNA 2RDJA 2EEYA 1N36K 5A8KA 1J5EK 4BRIA 2G2ZA 2IFXA 2MY8A 2V50A 2ZJQQ 4KTWA 5FRNA 2GIRA 2OPSB 1X3NA 1K0TA 1XMQF 1RU2A 5EGYA 4K4YA 3PM9A 2Z57B 3BKUA 4OPAA 4RBTA 2X78A 5CHCB 3O5TB 3EPIA 4G6VB 2Z2ZA 4L73A 2HHSA 1U8SA 2FVPA 4CIFA 3HM9A 1A5XA 5C5JA 1WUUA 1FF2A 1BQXA 4GRSA 3T69A 1YAGA 3JB9k 4YOVA 4ALZA 1HQEB 3LDQA 1N88A 3GYNA 3S01A 1B0TA 4CF9A 3QMLA 2UVWA 2UXBF 4LQ9A 2P9NA 2XRIA 2FJEB 2V67A 1N32K 2CGJA 3BGRB 3M2VA 4B3RK 4R5PA 3OFHA 3AD9C 3H7HB 3HCXA 4YP3A 3HSZA 3M8PA 3ETOA 5I3UA 3KWIA 3MM8B 1S22A 2GX8A 5K8MA 2JC0A 4EO6A 2UXDF 1D5AA 4BR4A 4HUFA 3DM2A 3E01A 3QO9B 1YRXA 1NAQA 5AQNA 2E9TA 3ZZUA 2CQ3A 3CMEN 5LSRA 2IRUA 1RTJB 3UD5A 4GMJB 3ZT3A 5E26A 3M3ZA 4USHA 3HP9A 4CLLA 1IQTA 4HDHA 3OTOF 5HRPA 3OXLA 2ASPA 2M52A 2K2PA 3C19A 3M6UA 2DR9A 4CJPA 1S6PB 2W40A 4RNHA 2FB0A 4CEEA 1VCTA 2I5JB 3Q8PB 2ATLA 4URQU 1IBKF 1WBBA 3VF0B 1FXRA 2NUHA 1WSIA 1NGEA 3C0BA 4M3ZA 2ASYA 4PXEA 3FEXB 1JL1A 1S72S 4BQLA 4DS4A 3NXZA 1E6YA 3FFIA 4RWXA 4LFCF 5HBMB 5DM7Q 4LF5F 1AA1B 3L95X 2OAUA 4LF1A 2PYLA 3F2KA 3P31A 2VUGA 2LYVA 3LW5C 4CEAA 4RW7A 4YOWA 1TL5A 3MMBA 1YBTA 4ZTJA 3UQSA 4ECWA 4YHHJ 4AH9A 3DGPB 3SAFA 4EP5A 4CZFA 4FJXA 5EHHA 2GHPA 2GHVC 5KFTA 3CFPA 1S6OA 5KQ8A 1FTCA 5SWMA 2M5YA 3B4MA 3PY8A 2HLTA 5ETRA 4H0PA 3L3CA 3I56N 3CPWR 4RPFA 1VHFA 4GC7A 2JEIA 2YJEA 4M5DB 5KT4A 1YGYA 4U7UK 2VC1A 5IT0A 3G6VA 2H5EA 4ECUA 2H54B 2D9PA 3MXHP 5HK4A 3MTKA 4UUXA 3D2FB 1S0NA 4LFAF 4FWRA 1RWNB 3QSYB 1UFKA 3QPIA 4IG0B 4CZHA 3T3FA 4NXNF 4WF9L 1E3MA 3FBEA 4ELTA 1B92A 5BYRA 4GO5X 5I3PA 1A6LA 5DLFA 3JQMA 3SQ2A 3BDEA 1QZ6A 4ED7A 1ZZFA 3HHEA 5E3PA 4WP9A 4Q8FA 3K5NA 4QS7A 1IBCB 1ZAXA 3WXLA 4K0KJ 1N5QA 3WQPA 3J80U 4B9LA 4CJ4A 4V1Ak 4Z2XA 2FTRA 3CPEA 1H74A 1KRPA 3J7ZT 1UZHA 3D2WA 4CQ1A 1YJ7A 3A3OB 1WHXA 4LR9A 3OYHA 2EFOA 1LWEB 4Z4IA 4ZPBA 1T9VA 3I31A 3DJCA 2W42A 1DBDA 3M5RA 5E33A 4X65J 3I5BA 1BC6A 4Q0BA 1RBSA 4USKA 3R1LA 4LF4K 2V9WA 1VC6A 1RHJB 4LRDA 5LMNJ 4EBEA 1GMWA 3TU5A 2KHCA 1BG3A 3G96A 3M8YA 3UDVA 4UOGA 3F56A 4IKAA 3CC7N 2CVEA 1RWUA 2HMIA 5AQXA 4CZKA 3UI3A 4LREA 5BRFA 3I96A 1LQ9A 4IOXA 2V4QA 3JAMO 4IOBA 3DRRA 1GLBG 4KKOA 4ID5B 3KLEB 3VV2B 5GIOA 3IG1A 1CJVA 5DJBA 3FSYA 3F44A 4KHYA 1T05B 3VGUA 4X66F 4EFHA 2WCXA 1RDUA 1RA6A 3UDCA 3RB4A 4LUBA 4DN0A 3BZQA 3ZC4A 2KHDA 4FJ5A 4FJ8A 3W7BA 3PV8A 2FHMA 4IO9L 1RHQB 5I4MA 2G0CA 1FJ7A 4O4GA 1AFIA 4ES2A 2QSWA 3THWA 2ZDPA 1NSKL 1QQOA 2CGLA 1CVJA 3W2VB 5AXNA 1LOTB 1T02A 4DX6A 5HP1B 3ALYA 2YWHA 4WTYA 1FO1A 2BJ1A 4JYAF 3QRQA 3CCES 3KWGA 2HBKA 5AZJA 2F8EX 3SAGA 1MDUB 4CJWA 3J81j 3T5HA 3MGJA 3LUYA 5GADP 3ZSXA 4OPJA 3O9SA 1TU0B 4FVUA 3FK4A 3O4QA 3AVGA 3CPWM 1NZ8A 4K2XA 4ED0A 3QIPB 3CCUN 3VWSA 1K73T 3FEYB 4KAIA 3MECA 4LF2A 1ZA1B 4LF9K 2PEHA 4KHRA 4KC5A 3JTPA 4DUYF 2X1AA 4J9UE 4KHNA 3KK2B 1S7HA 5GAEI 4A8QA 4WFNL 5K8NA 5LJVA 4QIFA 4N47A 3SNNA 4AM6A 2R8HA 4OJ1A 2KW4A 2RQ4A 2X3GA 3NG8A 4J2AA 5FPMA 2N4CA 1OIAA 4DCPB 2P8IA 4GVBA 5HSPA 1TELA 1JJHA 4LQ3A 3QAUA 4CO2A 1X31C 2HNYB 2RRNA 3JTNA 1IKVA 1J53A 4X4VA 2UUWA 2BDPA 2IM0A 4B3TF 3TOQA 4YR0A 2EC2A 1RTHA 1CC7A 1JCGA 2CQBA 2P9UA 2M2BA 2Y0BB 4YN3B 1HW9A 2DHHA 4ECRA 2XS2A 3TANA 4GKKK 2K3IA 2HQGA 2FPHX 2O8CA 4KB1A 5HQMA 2B4OA 2W41A 1DRZA 1Q8IA 3A3PB 1WSHA 4A62A 3T41A 2NUUG 2KRBA 3C6UB 1MROB 2YX6A 1TV6B 3MMCA 1G6BA 2UUCJ 1O13A 3VEWA 3I0SB 1HQ2A 5I9EB 4DI6A 5C25A 1RGIA 2IVFB 3JYTA 1S1WB 2RUGA 1IJFB 4HDGA 4AHVA 2P6SA 4DR6K 4GV6A 3CD5A 4B3OB 2K06A 3SCJE 1ELOA 3FBFA 3D4JA 3DKDA 1RDAA 1IM6A 3AODA 2JLGA 4L8RB 3KJVB 3AA8A 4K4VA 3RB6A 2CIMA 2D5RA 1PG5B 1XR5A 2YPYA 4GO7X 4X62J 3U1MA 2MKSA 1M0SA 5CCMA 4CHOA 3VALA 2FJVA 3PIOQ 2B9XA 1S1XA 1VQNS 1BCOA 4KO0B 3FDSA 2G8WA 4CBXA 5E3QA 2KFYA 1REGX 2LVWA 4OKEA 1XERA 2CJXB 2VG6A 1OWXA 2AP1A 3LPUA 4QIEA 3C3LA 1N56A 2XO6A 2LDYA 1S97A 1H7WA 3HOSA 2E7XA 4RG8A 1K44A 5GMEA 3NF7A 2HZCA 2FZCB 4FJ7A 1XC9A 3SV4A 3MDFA 1UAXA 4HI1A 3ITHB 2V8DA 4WYWA 1YJ9S 4DV2F 3G0ZA 4CNYA 3F41A 3HL8A 4AT1B 1ZOTA 2EBGA 1HPZB 3PW5A 3CFOA 2NPIA 3A4TA 5CD4H 5L8RC 1B7FA 3TARA 1FESA 3RGIA 4K4XA 1GMWD 1S10A 5BYQA 3DHXA 3I0RB 3TA0A 5IV4A 4EZ9A 4J2DA 1RXOB 3MXIA 4OZ5A 1HNWJ 3SJJA 4ECYA 4TQSA 5IT9U 5FLXY 3CVKA 1EQ0A 1QUPA 1RBAA 3NNHA 2JEJA 2QWLA 2W1BA 4Q2LA 4KGKA 4RW8B 4IFVA 3IC1A 1PGZA 1HW8A 2JFKA 3JSRA 3SIPB 5KG1A 3RBDA 2A18A 3CCWA 1LW0A 4DV0F 2CZ4A 2A3JA 1QTMA 1WLJA 2DPIA 1S6QA 1C1AA 1U8WA 4EI2A 3J7Z5 3PZPA 1KVCA 3JS6A 2QLJB 1U2VB 4RTFD 2J9CA 2ASMA 2DO4A 4ZIWA 4DB3A 1SV5A 2MKJA 4DV5K 4FM0A 3QDKA 1QAJA 2KJWA 3AOCA 4MLEA 5ETSA 2OFHX 2FF3B 3HJVA 4OHWA 1KFDA 1HBNB 2D0PA 3IM8A 2R8GA 3OR2A 1U7LA 4M63C 5DMRA 1F5CA 3CDWA 2ZBIA 2CPYA 3FLCO 1IBMF 1S0MA 4MDAA 4ZJQA 2HHQA 4G1QA 2KB2A 4KH0B 4CHYA 3VQAA 5GADU 1WKKA 2QT7A 1YHQN 4ZP8A 1ZBHA 2FHOB 5LSLA 1UW4A 3ZNUA 2MLYA 2MY7A 2QA4S 2D3UA 2HF3A 2YKPA 4CLYA 2XZDB 1JKHB 4BRNA 4I6MA 3VZIA 3F73A 1HYSA 2RHQB 2A1SA 2UV8A 3T5KA 3NVMA 3SFGA 2Z2MA 1VQYA 2HIQA 5F8LA 4KTQA 4Z4CA 3W64A 5ADXA 4MIWA 4ZVOB 5IT9Y 3QWPA 4HCCA 5IWAK 5FDLB 4NZ6A 2XYGB 1CQNA 1HNZK 2Q31A 2YHYA 1TFYA 1Y7PA 1KLMA 2P9IB 1HJOA 5F9LA 5F0UA 1MLAA 3I8DA 3RR8A 1BHLA 2AQ4A 2K1RA 2VC0A 2ZH9A 4CIOA 4I4BA 3BYRA 1JLCB 2MZRA 3SDEB 2UVUA 1RT2A 4ZP6A 3T9NA 1VQ7S 1Q8KA 4DV6K 3LDLA 1MWZA 2XY8A 4BRGA 2XMWA 3PRVA 4MIBA 3DLLL 3CC4S 5AQYA 3MCOA 3PKMA 2VONA 1ZA2B 4IBNA 5FPDA 4PL8A 3A12A 3K57A 3QEVA 3DHWC 4WFYA 3GIJA 4NYZA 3L9ZA 1JX4A 1R8BA 3T1HK 2OEJA 3QMQA 5E0OA 4BC9A 5A76A 1DAXA 3C2PA 3UE2A 3Q24A 2HVZA 4B3SF 1EKSA 4JKDA 4FS2A 4UOFA 1CS4B 2FDNA 4A8SA 2XGQA 3OJSA 4DV7K 1FCAA 4PXDA 5ETTA 2VQEK 1YLXA 4URSA 4JI6K 4RU9A 1G3OA 5AXMA 2YX1A 1U1LA 1VSLA 1SIWB 1PILA 4CJ7A 5AZIB 2NXEA 2WONA 4LVOP 2M70A 1YI2N 5DETA 2D0BA 4HH1A 1TP7A 2QLBB 5D4OA 4FLZA 4JKCA 3PXGa 5AXLA 5D3GB 1IKYB 3UNGC 5M2RA 3MUMP 2OP5A 3ENQA 4CLTA 2GAHC 1NO8A 2ITMA 4CZCA 2BABA 3KJFB 1UTAA 2N7CA 4C6AA 4E19A 5HN0A 1G15A 3DLEA 2DNHA 4C48A 1W7WA 3V9WA 3EDQB 2XHBA 1MWQA 4KHSA 1GLJO 4O0JA 4WU2A 4JI0J 2ZM6K 4RUCA 4WE1A 3J7A1 3G9CA 2VYPA 2ZWHA 4V19X 1OH5A 3MMAB 4EAHD 3SUPA 3FCVA 4R8UB 4FK2A 3QT5A 2M88A 3FJ2A 3MCMA 4O3QA 2FUG9 3OYGA 5LM7E 1D3WA 2OMOA 2XLJA 3P5TL 5HLFB 4UUWA 1KKHA 4YR2A 3W0LA 3GIKA 2YY3A 3SI8A 2QE5A 1M90O 4CHQA 2C3YA 4RBUA 3TJ8A 1LNQA 3SUOA 3TRGA 3W2WA 2AD9A 2W01A 4JI2K 2ZH6A 3HD2A 1RT1B 3LDSA 2YNIA 1KN6A 3T7ZA 2YNHA 2Q1NA 4K2JA 4Q43A 2ZJPQ 5C42B 2WZ1A 3THYB 1T3OA 3C16A 3A1YG 3ILIA 2GELA 2FSNA 5D78A 1T9YA 1ITPA 1RDBA 3QGPA 3PJ9A 5CR4A 2EI5A 2LA4A 1YVFA 1YITS 4CK2A 5AQWA 5HRNA 1CBKA 3HPHA 3R7SB 4PKDB 3TQ1A 3EKSA 4CLSA 2P9SB 1RQ0A 4C7QA 4N76A 2R3VA 2Z0GA 5C2FA 3N28A 2XI3A 1AW0A 4J2EA 3QFUA 3NHGA 1FXDA 3N6LA 4HVJA 4P74A 2VGNA 1BWVA 2BYCA 4FM1A 4NLGA 1VHIA 2BH1A 3RRGA 2CNOB 1ESVA 2ILYA 2DHGA 4OI6A 1MN7A 4DR1J 1YHQS 3U3YA 2Q3PA 1CULB 1OSCA 2XULA 5AJ3J 3AQOA 3CCJS 3BJYA 2FY1A 1C1CA 1I5OB 3IUCA 4ZLPA 1WSVA 2CPJA 1SS6A 1TKXB 4FJIA 1GH8A 4CF1A 6AT1B 3ZYYX 1S77D 1YTYA 1Y5IB 5IZHA 4DL6A 1YJTA 3A5NC 4DPUA 2YWWA 3LAMA 1VIXA 4USMA 2A10A 1F9FA 5AQTA 6FDRA 4N7TA 1WB9A 4LR8A 2FBXA 4LH4A 4DQSA 4DR3F 3KK3A 3TP2A 5C2CA 2LSNA 3IAS9 1WUAA 1V3ZA 2ZNZA 1MWKA 1N0UA 1XJWB 2R42A 3V81A 1NUEA 1XK8A 4WTOB 4LRBA 3CD0A 3UN3A 3D28A 2JWLA 1DTQA 1Y5NB 2GHWA 1PC5A 3SBGA 4NCBA 4I1TA 4KYZA 3K59A 3Q8YA 2JC1A 1H3DA 3W5YA 3RJMB 4A61A 2ZH8A 4LRAA 3GV8B 4WK1A 2UXBJ 4M63A 3LQVA 2RUSA 4FPAA 4X4SA 3OFGA 4CFAA 2E2OA 4F7VA 2AMCB 4M5IA 2XC9A 4HT7A 4YFUA 2M0GB 2ZH2A 1E6VB 2OIHA 1S9GB 3NGYA 2B3TB 4BRAA 4YB7A 2GQQA 3L6QA 2CNLB 5EUHA 2UXDJ 2F9TA 4CT9A 2XHWA 5ETOA 1HWUA 1K6YA 2RU9A 2V34A 2J6UA 2NRTA 4WKYA 4HH0A 3OV7A 5IFMA 4AFFA 5AQQA 3HHLB 4JI4J 4JAXA 3AVKA 3MCPA 3OTOJ 1T9UA 4OPKA 3IM9A 3Q7CA 4IFYA 4HR2A 1ZTTA 1KQGB 4JV5K 3CDUA 3QFWA 3HZ6A 1QS4A 3ZX3A 2JEGA 1RAFB 3ZSRA 2IM1A 3KMSA 3SYZA 1TGOA 1C0UA 1NBEB 3C7NA 4PRFA 2RAQA 1H98A 4L3QA 5A2QU 2UUAF 5A0YB 3G71N 2MZJA 3ENVA 2D9OA 3MR5A 4FJNA 4PY5A 2CWXA 1BISA 4OZ3A 1S59A 3S41A 1RT4A 4OLOA 4NASA 3ZSQA 3OUYB 2HBJA 4WIIA 3WXMB 4QZVB 3QT8A 3Q83A 5AQLA 3WNHA 3SPYA 2ZHAA 4LF5J 4DF4A 2WW8A 3VERA 3ISZA 1Q86T 2JWNA 1KAYA 1HBUA 2CZ9A 2NREA 4RNOA 3J81U 2ASOA 3O3LA 1W97L 2PMWA 1W7AA 4O8KA 3CCQS 3CM5A 3ILOA 1F6TA 3E66A 4NXMF 3K5PA 4DFKA 5K8PA 5KFPA 1GOBA 4J8FA 1U4BA 1N36F 3AXKA 4NEZA 3QBWA 2G9OA 1NB2A 1U6FA 3LP2B 3R6LB 1TUYA 1U6BA 3MAAB 2MGZA 2LQJA 5BN8A 4FXDA 1Z25A 3AQPA 1LWFA 3J7AP 5B0BA 5HI7A 1ASUA 4LFAJ 4QJVA 3N0VA 1Y10A 2W7OA 2KM8C 1IKXA 4CJVA 3PDNA 2DFFA 5F3TA 4DR2K 3K58A 2Z2YB 4W90B 1TQLA 1WOPA 4O55A 3V4IA 1RUSA 2BKPA 3LDPA 1NHUA 3MEGB 2KRRA 1GK8A 4ZVHA 2RNEA 4J9OA 1W25A 2UXCK 1BI4B 1XWLA 1NMEB 3CJ4A 3OW2R 1OJ4A 4B3RF 4ILLA 2ZWPA 3ZZRA 4ED3A 2VPYB 5KFGA 1JLFA 1GFWB 4L3NA 4M5HA 2LQ8A 1H38A 1YX2A 1S1UA 3MMVA 1UW9A 4HWIA 3VGSA 4D3GA 4KH6A 2V4RA 2E2QA 3M30B 3OS1A 1KD1O 1T6CA 2CJQA 1K8KB 3P6YC 2DHAA 4HHUA 4TNOA 3K89A 3Q8SB 4GKJF 1LV5A 2D1KA 2EKYA 3QLHB 1VQON 4I2QB 1OH7A 4FWNA 1SB6A 2KL8A 1Q4RA 2OKQA 4IH7A 3GG4A 4PPDA 4I7FB 3T6JA 2QXLA 3TJ9A 3SUQA 2JX2A 4O0NA 5F2RA 1RT3B 1YTAA 3MEEA 1VOMA 2YVSA 4ED4A 5DM6Q 4NB4A 3ENHA 1UPPA 2PFDA 2QWQA 1NZAA 5AFUH 2MEWA 5H9FK 3O9QA 2VF3A 3W62A 5HVFA 3PKYA 2L08A 3D3CJ 4E0DA 4M5NA 4WPAA 4ZJLA 3CF5L 4KR0B 1I94J 4YOTA 1RWMB 2GVDA 2H1YA 4F4YA 1E4GT 4CZEA 1UP1A 2WK4A 4CBWA 4RZRA 3M8QB 3AO4A 1ZM2A 4I2PA 5IQQA 1IKWB 2LEAA 4WFNQ 4B1YB 1URNA 2XI2A 5KFUA 3OBYA 4ISFA 4UOCA 3E9PA 4B17A 1VQKS 1Y00A 1NKCA 3QRPA 3QQCD 3VPZA 2YX4A 1JLEA 4LF6F 2GWKA 3CJBA 4ED1A 5B0EA 2YHWA 2HQ3A 2RS8A 3HD1A 3ZX2A 4ZVQB 5CZ1A 2DH7A 3N9UC 2V2ZA 4CZIA 4MK9A 3TUZC 1SPBP 2F4VJ 3P39A 1HQUA 4WXOA 3LL3A 4KT0C 2E5LJ 4YB5A 4RW9B 5J2QA 3P38A 1JLAB 3CCMS 4CT8A 4H8KA 1WNSA 3LDOA 2DK2A 2OTJN 4CF8A 1RBTA 2QX0A 2YH1A 3AFGA 3OYDA 1U45A 1S9FA 3AAQA 3CCLS 1BQMA 4HTJA 1VAZA 1I39A 1FX4A 5LXRA 5DDPC 4ER8A 5J1EA 1ZETA 1PKUA 3CT9A 1JQGA 2GGPB 4KFBA 2HBQB 1YZ7A 4A8MP 2QTDA 1HR0K 4CZMA 2FSKA 3VQEA 1IVZA 4EP4A 4B3TJ 3OW2M 3TYTA 4DTJA 2J7KA 5K14B 4DR5K 4PWDA 1NGHA 1FWPA 4FO0A 4CP5A 3C94A 1Q18A 4LF4F 4QPXA 2K8GA 3ILLA 3KHLA 2MXYA 4E7LA 4F36A 1OH6A 1FD2A 4IG3A 2XG8A 3MN9A 1CZBA 3RMCA 3QETA 1SC6A 2XGPA 4ZITA 1ZS6A 3D6RA 2W9BB 4BE2A 5KG2A 4CJUA 4YY3K 2ROPA 5CYMB 1U6ZA 1VHXA 4ED5A 3H0PA 4Y1CA 1MA9B 2F40A 3C15B 4IR9A 1KVJA 1RDDA 1T3NA 1L3TA 3DI6A 3OQ2A 2QA4G 1RNHA 1KAZA 2XYPB 3IS9B 3SFUA 4WIQA 2DFEA 5EWFA 2Z1JA 1RT7B 2QL7B 5J2MA 4DSKA 4PQUB 2VU5A 2CJYB 5GAHI 2QV6A 2A0FB 3MAHA 3KLGB 2GTDA 5HROA 2OZMA 4CEQA 2I1RA 1TL1B 2QM1A 1XI1A 4JD2B 1C2PA 4IDHA 3GZ7A 4KGXB 5LMUK 4HI2A 4IFEA 2VWKA 1ROFA 2DHSA 4URGA 2VOPA 1BA0A 1X9WA 2QWOA 3ZEUB 1NEEA 2UU9J 2F5GA 4ZTFA 4A2AA 3TSUA 3R6GB 3MCAB 3RVCA 3G6XA 1CJTB 4ITSA 2L48A 4OHZA 5J2PB 4DV1F 5LXYA 1C0GA 1FT8A 4TU7A 4AQYK 2DNRA 4M42A 4W5RA 1BWEA 5ETVA 2IC3A 4FJGA 4ENOA 3M2UB 1HL6A 3CCSS 3GV5B 2R8IA 4KB7A 2HGMA 4GC6A 4A59A 4Z4HA 1VQPN 3TAPA 4LJMA 3FSIA 4DV2J 2EC0A 1GMVA 4M41A 3EM1A 4FXVA 4P73A 4CF0A 2BW7A 5KG4A 4MYUA 4RW6A 1APSA 1LAVA 3MMJA 3RYLA 3CIZA 1W9HA 2QI2A 4FLTA 3L2UA 2ASDA 4IO8A 4BWJA 4KE5A 3V9ZA 1FNOA 4H5NA 3ZETA 4LF7K 3BQ0A 2GV1A 4YDUC 3QB0A 3SQGA 4B9MA 2C1EB 2POKA 1TKZB 3JTOA 4TN2A 3SI6A 4BREA 2HIYA 1FDBA 2DNMA 3RAQA 3ZNJ1 1MMNA 3Q0AA 4XDDA 3TAGA 4E7IA 4KPCA 2X51A 3R97A 3NL0A 3BGLA 1IBKK 4DV0J 2MZSA 4DN9A 2EFGA 4DZDA 3SBMA 2EFQA 2FC9A 3DDNA 2WOMA 2BJDA 2ROEA 1U49A 1YIJN 3H2UB 4LFCK 4PG7A 4GKKF 1SJ1A 2R2UA 2ZKUA 2CPFA 3GU0A 2ETJA 4BACA 2A2CA 2DGQA 2J76E 5E5NA 4WWSA 3A5OC 3CJSA 2HLUA 2ZOFA 2RU3A 2D4WA 2KVQE 1FJCA 4NYPA 2AJQA 3VEZA 3ELHA 5U47A 3CCRN 4HTIA 2LXIA 3V4MA 3MEDA 1RKIA 4BE0A 2GW8A 3FR0A 4X64K 2F1FA 1RP5A 1SVDA 1R0AA 1U1NA 3JAMU 5G0RA 4O3RA 4K4ZA 2OO4A 4ECXA 3OY9A 2AKWB 3TZZA 3T5LA 1IJEB 3EXYA 5DZ7A 3UO0A 3V6DA 1UA0A 3OXFA 3POTA 3LP0A 3CO9A 3I9ZA 2DH9A 3DLLQ 3U3GA 2DY9A 3V2UC 1HA1A 4NLPA 4TVAB 3WUHA 4RUBA 4OYXA 1FRJA 1PJ5A 1WC4A 4H5VA 4DR7J 4CJRA 4IOAL 3ZTSA 1OSDA 5ETKA 1Y9OA 2NXJA 1VBXA 2RQCA 2WBNA 5KPTA 2EFNA 4OYAA 2J7WA 2H48B 3SZ2A 3EPGA 5F8MA 3SLCA 3R5DA 2ZJQL 4PABA 4NO7A 3Q23A 1D4XA 4Z94A 3LPYA 1K1SA 2EW9A 2DNQA 3DRYA 3UDEA 1IN0A 5J1PA 2BM0A 1GNKA 1RTDA 5KAKA 5M1PA 4X4RA 4J9NA 3CJ5A 3B6OA 3M32A 3GG0A 2E6MA 4FPBA 1YSJA 2V8GA 3KNGA 1U0HB 5BR8F 4NZ7A 4NCAA 2P5GA 4DMZA 4NI2B 1NK8A 2BQRA 4CJEA 4B3SJ 4A57A 3CJ7A 1NSQA 2DR5A 1CJUA 3RB3A 4C8OA 2G4BA 2EX3A 1O0PA 5GMKa 1TMJA 2SXLA 3M9NB 2WRMA 3WZ0A 1NMDA 5T7LB 1X7VA 2HRYA 3GR0A 3EE3A 1WAFA 2NYHA 4DL0C 2VG7A 1RKJA 1NSPA 1YJUA 2B9WA 4GY2B 4J9PA 4O8UA 3Q8VA 2ILZA 4X66K 2DGUA 1ATNA 5E2QA 2IVNA 3C6HA 3PCOB 5CHIA 4JRPA 3I4PA 4CZGA 4DBQA 3FEZA 4KREA 4DV3F 1VISA 4OYPA 4ZCKA 2VFTA 1EX4A 2OSRA 3NLCA 2D1CA 1SKSA 3MPYA 4J91A 2NXCA 4B3MJ 1REVB 3PR5B 4L76A 1NDLA 1Z05A 2E1ZA 4NYNA 2D7SA 5KT3A 1R8HA 1RCOB 3GLJA 4L6V3 4B02A 3FZBA 4F2RA 2IS3A 2OPSA 2O67A 2D0OA 2HAFA 4ZCIA 4JYAK 3ZT4A 1W26A 3ZSYA 2DNOA 3QWUA 5DM7L 1XNQK 3ZSVA 2ZH5A 1DARA 1DGKN 1VQ8S 4P72A 2XY7A 4R0JA 4KB0A 2A3ZA 3NGZA 1NM2A 1N33K 1BUXA 2AEFA 2DPNA 3UPFA 3CJ3A 1URRA 2HAIA 5IWAF 1HQEA 5EDWA 3VQ5A 2C3OA 3HHDA 3O1BA 1HNZF 3HI0A 3AB2B 4DSIA 4OVLA 5AQRA 2J9DA 1PYSB 4CEBA 4P75A 2XMJA 2IJFA 5C24A 3BDPA 3GG1A 4WP3A 2P9EA 2P9NB 4W5TA 1NRKA 3NCPA 4IRCA 4DL5A 2QW9A 2F96A 1R7IA 1EHWA 3KUGA 3FQKA 3OHAA 1RAIB 3UW1A 4HCBA 1FVSA 5I3UB 3QO9A 3CCRS 3QGIA 3MEKA 4HACB 4Y0WA 3TX8A 1N4LA 3MM6A 1GEHA 3DM2B 4P2XA 4OGCA 3LWMA 2RVJA 1NH7A 3ZO7A 1X1PA 5HANA 3DDKA 2QA1A 4BC4A 8AT1B 5LSOA 3I6PA 3T1HF 1NK7A 4F4KA 1YJWN 3A8EA 3VGKA 1RCHA 4YDUA 2C2DA 1NLKL 4DTPA 3GIRA 4DV7F 3BEGB 2LKZA 4OV1A 3SPZA 1S6PA 2VQEF 4JI6F 2QLWA 2I5JA 3DXSX 2RDDA 2BQ3A 2D3O1 3GFHA 1VQ6S 1QE1B 3G8SA 1ATSA 4DR3J 4Z4FA 4K4SA 5KFQA 4YOUA 5HBMA 4ZOSA 5AQIA 3MXJA 1YTUA 1N5TA 1E6YB 2VFUA 1N6QA 3K0JA 4KSEB 1X9JA 1VQ9N 3PEJA 3M8RA 4MYTA 1RDCA 1X5TA 4O23A 2PA3A 3BSNA 3QSIA 1WD6A 1WKJA 4D3HA 1XQIA 4FPRA 3PFOA 1ICEB 3MMBB 2JHEA 1GLDG 3NAHA 3QIDA 5JJBA 4F0MA 3PSIA 1RT6B 2BOPA 3W61A 4XH5A 2DHXA 2KFNA 4JI3J 4Z7YA 4RR5A 4K5RA 1H73A 1FXXA 3U1NA 3LPTA 2NZ4A 3NGDA 1VQ4N 2FZGB 2UUCK 1OY6A 3UNYA 4ILMA 4DSFA 1AROP 4ZVSB 5KG3A 4ETZA 2X1FA 3CJ1A 2Z1IA 3RUBL 3D2FA 5F3ZA 1PJ6A 2XO7A 1WEXA 5HJXA 2PD1A 3R5BA 4L74A 1NK4A 3FZLA 4EFAC 2PFFB 4IG0A 2PEBA 2VKRA 2MKKA 4JI2F 2IMOA 3T9ZA 3H4BA 3UFCX 4DTRA 1WF0A 3JQJA 1OS5A 4FJ9A 1X0FA 3HPOA 2DXDA 5DG8A 3QESA 4M3RA 4BR5A 3DRPB 4CLZA 1RBVA 5KFWA 2X1GA 1EKRA 2KKZA 4I0WA 4WFAL 2UUAJ 2BX6A 2HBZB 1PAEX 3VMFB 4J37A 2YQ3A 1QSLA 3GIIA 3I5CA 5F8NA 3EX7B 1GQEA 3ONQA 5KFCA 5ETNA 4I9LA 1M90T 3OL8A 2RIJA 3HYFA 3ZTPA 4OZLA 4QWCA 4KH5A 2CJ9A 6FD1A 3KKSA 1Y4ZB 1VSDA 1YF5L 3U7JA 2HVHA 3EE9A 3MD1A 1UAWA 1XMOF 4NXMJ 3U02A 3G87A 3DRSB 2ZGYA 2HZAA 3DMJB 4ZVPB 3CGIA 3KD1E 4OZ0A 1P9QC 1HI0P 1XEZA 1J5EJ 4LIRA 1CLFA 2XWXA 2OPQA 3NY0A 1RE1B 5C2GA 3VVTA 2HMIB 2UVVA 3KLEA 1HNWK 3DXKB 2A42A 5AQKA 2XWYA 1WI8A 4KY3A 4OI3A 4YOYA 2NSCA 1EJ7L 3I82A 1R0CB 2F65A 1P8GA 1IBMK 4NMLA 3IG1B 4OFZA 1YJVA 1Q9XA 1FX2A 4USWA 4F4WA 4PAAA 1JXBA 2B56A 3KHYA 3DWLA 1R43A 3QJJA 2HFSA 3ZFVA 3L7PA 5E84A 5FPEA 3W2VA 1VRUB 2RF2B 2LP4A 1N32J 1T03A 4K4TA 1ZBLA 4B3RJ 3C14B 4QIVA 4ILHA 1TAUA 3KXDA 1WF1A 1PO6A 2A2DA 1BE4A 1U48A 3KWMA 3MCSA 1I1GA 2D0CA 3FFKB 4ERDA 1D1UA 5DO2A 4UQTA 4DV4J 3VTIA 1IG9A 1VK3A 2X3DA 3CD6N 4KIAA 1NPPA 3JSBA 2ZBCA 3PIPQ 5AZJB 3THXB 3NGKA 2J0SD 4H54A 5K8OA 3LTOA 4BROA 3CYMA 1IWAA 2FIUA 3NGRA 4RUHA 1T44A 4CH7A 3QIPA 2EXUA 4C3LA 1G1XA 4ECTA 2R7XA 4JV5F 4LF8K 1NDKA 4TU9A 4NA3A 4CJQA 3PIOL 4PCQA 4KAZA 3KK2A 1IBLK 3DLHA 4FW2A 4Y2IA 4FVCA 1XR7A 4OX9F 1EETB 1JIHA 3HSTB 3GJSB 1SQKA 3P1GA 2CQ4A 2QK9A 3H5UA 4CF2A 1L3SA 5DDRC 4CGFA 2DNYA 1SKUB 4CJLA 5KG5A 2HHHJ 3A8IA 3L4BC 4CCHA 1FKPB 4CWBA 4AF1A 2NNWA 1BCMA 2NRWA 2MZQA 2IBKA 3CC2N 1UEVA 3OSPA 1I51B 4M8LA 4GVBB 4CHNA 2R7TA 2XB2D 2P9CA 1IKVB 3OTEA 1HLUA 5T41A 2CA9A 2GIFA 3FMBA 4DTXA 2QA2A 2UUBF 4R79A 4FKXA 3R5CA 1WACA 3TVYA 3NNAA 2WVCA 1TV6A 1TUVA 3GPAA 1LFWA 3D7SB 2HSTA 3DXMA 4M3WA 3RB0A 1ZXOA 3I0SA 3MMCB 2N82B 3FZFA 3RWUA 3AVBA 1S1WA 2HFNA 4UT4A 2DNKA 3Q89A 4B3OA 2HRTA 5M1FA 2ZGZA 3HJFA 3KJVA 4Y34A 1OVQA 5BR9A 4DUZJ 4DR2F 1ZBIA 4CO1A 2WSEC 1KQFB 4EYIB 4JKAA 1UOCA 3C8YA 2O8BB 1F5BA 3BSAA 1TK8A 2LMIA 3D0GE 4KO0A 2UXCF 5KFHA 5CABA 5GAHP 2VCPA 5KFOA 2A6AA 3CEDA 4M1KA 2W7AA 3AAPA 3NNCA 3C6AA 2IRXA 1K8AO 4KV8A 2VG6B 2ZD1B 1IR1A 1RZMA 2B0GA 2ZJRL 5D0RA 3I8BA 1F60B 3CJ2A 3FMWA 4NYOA 2HYIB 3FRZA 3EGWB 3IWNC 3IWLA 3PRBA 5D0EA 5T7BA 2FBTA 4DTMA 4I6WA 2F63A 2X6SA 2CPEA 2ZVSA 2VWJA 4CE9A 1WHWA 3A2FA 2NZTA 2LLZA 3VGTA 2MQNA 2OD4A 4LF4J 2LFVA 2B4JA 5HVHA 2QWRA 1SH2A 2ZOMA 1S9EB 4JK8A 3AV9A 2JWKA 1NLVA 3VAMA 2KH9A 3K5OA 4Z0UA 3I0RA 1SC4B 3ENWA 4JV2A 2XS7A 2CQ2A 1B0PA 4C8LA 4TY8B 2OCEA 3QNOA 3TZWA 5AQUA 4LSLB 2X74A 1FKOB 2PI4A 4NRUA 3PFEA 4CLFA 3P4IA 4CHZA 5CYQA 1TYQA 3MOJB 3DN9A 3KHGA 3GR1A 4CGDA 1RYSA 3NCIA 3BREA 3QNNA 1GLCG 2F9JA 5ETPA 3KK7A 2NXNA 2A6MA 4MFBB 2MQQA 2V94A 3T5JA 3CD6S 1U2VA 1S49A 2IYGA 1S6QB 2F3JA 5CD4A 4C23A 2XQCA 2BMBA 3SUNA 5KFIA 4A5BA 3G86A 1SV5B 1ZM9A 4Y2CA 1KVKA 3PJWA 1HBNA 3WNFA 3HLUA 5KRSA 3OR2B 2DGXA 2M3DA 1Q7YO 2W7PA 3NKYA 3NH0A 3SSRA 1TAQA 3AY9A 1QD1A 4MDBA 3CULA 3M6XA 3MM9A 4FYDA 1SCJB 1JWWA 4LF9J 4F67A 3CMAN 4WJBA 4OX7A 5E3AA 1L3KA 1KHVA 1ACMB 4JN4A 3HHLC 3CDBA 4BS2A 2L9DA 4H5WA 4H0TB 3EEQA 2R8JA 3T1YK 4PYDA 1SJ4P 3AA2A 3CSKA 4G9ZA 1XNRJ 3O2IA 3HFZB 2DBBA 3RAXA 3KFWX 4NLOA 4TSXA 2CRLA 2M4MA 1RTIA 4OI2A 3H4DA 4BGAA 4ZIVA 1QTNB 1WKLA 2FD2A 2FC0A 2VGMA 4AUKA 1HR0F 1HNXK 3KLIB 3VCDA 3L4QA 5LJWA 1VFJA 3SDEA 3A0IX 3SMSA 3HSCA 3ULEB 4JNEA 1WC0A 2O8EB 4KGMA 4DR5F 5L46A 1YJRA 1RT2B 4YB1P 5AQMA 2DR6A 4GKKJ 1M1KO 1SH0A 3FC9A 5F1XA 3NP5A 5I3QA 2WTFA 2BJ9A 4M5KA 2P9LB 2W4PA 3I55N 2F8MA 2CKWA 4HT5A 2ZJPL 3OVAA 1JJCB 4FS1A 4RNMA 3CDEA 4YY3F 3AA9A 3MPWA 1CS4A 4JUZA 4IOAQ 1WTBA 1RWOB 1TKDA 1QQNA 2WW4A 2KLAA 2R7VA 1LK7A 4DR6J 1FRMA 4HEA9 4IQXA 3CW2C 2H51B 1JLBB 3OR1A 4CJ3A 2HNDA 1UVIA 4NX9A 4USTA 5I42A 4JB8B 1FFWB 3CJ8A 3EZUA 2W2OP 1XUPO 2NRXA 5GAGP 3H98A 1VBYA 1DT9A 4WFXA 3DLKB 3CO0P 3AGRA 2WONB 3T19A 2A41A 1IKYA 3AVJA 4CH1A 5B8HA 2AT1B 5LMUF 2JVRA 4FLXA 2KG1A 1EO1A 3L09A 1WC1A 2OPPA 2V4JB 4BR2A 1WOSA 2B9EA 5GAHU 3G6ES 2W8LA 2V6AA 3VAFA 2RJZA 3CJAA 3BGUA 1NOYA 4AQYF 4HTUA 4WBFA 4N77A 2AX0A 2PIIA 1XMBA 2H5IB 1YUWA 1VC5A 3OYCA 3A8YA 4R8UA 4EBCA 4I56A 1RILA 2Q6CA 1RAJA 3UCGA 1BD6A 4P7TA 5HLFA 3FZKA 2LU2A 3SMZA 4CJSA 5B0FA 3BR9A 2I2YA 4Q2MA 3AD8C 1KWMA 3HTVA 2G8HA 3H08A 3D0PA 3SSSA 3TAMA 1AT1B 2V8PA 1DURA 3KD5E 3R9PA 2Q1LA 3QZ8A 1RT1A 1HYVA 3GDQA 3HSDA 2X6NA 4GKJK 4EU0A 5C42A 3THYA 3PX4A 2YNIB 4LF7F 2YNHB 4CBUA 5JICA 3QBCA 1KOOA 1J5OB 2X7IA 4IJNA 4BRQA 1TL4A 5ETMA 3EZOA 1DTTB 3AOBA 2LCWA 3O4NA 1LWXA 2P9SA 4BDYA 1J6ZA 3KLFA 4CYUA 2MPUA 4FWKA 1S6UA 3WXKA 4XK8C 1NPRA 3PYFA 3S3MA 1CSJA 5RUBA 2B4VA 2QMXA 3NF9A 4BC7A 3V1QA 1RK8A 1B70B 2UV8G 4DV5J 1V6HA 3BH6B 1RCXB 5AR0A 2VA2A 2E1PA 2AJ4A 4BRFA 1YK9A 1FRLA 4DCHA 1TKXA 1MMDA 1VGYA 4ZP9A 4CHPA 1C1CB 3VQBA 2KZZA 4GVMA 1D09B 2CAJA 1LXNA 3HVAA 4OYZA 4C11B 4MAKA 1NSAA 1DLOA 4X64F 3H25A 1HMVB 5IOLA 2DY1A 5FLXO 3CIPA 2ZFHA 2I7NA 3WBZA 2V7YA 3EJMA 3SSQA 4UY85 3DOLA 5H9EK 3B54A 1RABB 4LF6K 5JVHL 1U0SA 1PC4A 4OYMA 4FOEA 2R4FA 3MOZA 3CHWA 3H5SA 4KHMA 5GMDA 3MWTA 5IWAJ 2HNZB 1JLQB 1R8AA 2YXLA 1HNZJ 2ZH1A 2FVCA 2V8VA 1Q16B 4PPZA 4YHHF 5H1SQ 3U9ZA 1BA1A 2X1BA 4FJMA 1OMSA 1YQHA 3US5A 4USJC 3QFPA 1S76D 2DB1A 3MM5B 1EQYA 5FPNA 3BYPA 3I55S 2LDIA 3RR7A 3MPDA 2B4UA 4JOUA 2CADA 2BJ3A 2MTLA 2O1PA 3ETMA 1VQLN 3BS9A 1FWLA 5KOXA 4DV6J 2DJWA 1X5SA 2AA4A 3CI5A 2EHGA 4ZPWR 3KG4A 2R8KA 3OYIA 2YKMB 3MN7A 3QICA 1RT5A 1PBUA 3HHLA 1GX5A 4JKFA 3VAGA 2Y1IA 3KKRA 1WJ9A 3KTQA 4DMNA 1H2VZ 3K8VA 5KG0A 4IFYB 2E5LK 2UYTA 4DV7J 4UF4A 4AHRA 2DKOB 1FWKA 2V0NA 2VQEJ 4JI6J 3KYLA 3GB0A 2Z56B 2V2VA 3KLHB 1YDLA 4FYVB 4CNZA 4K0KF 1C0UB 3C7NB 1HLWA 1BU6O 4BRCA 3OUYA 5HMXA 3AJDA 2XCAA 5GAGU 3CETA 2O01C 3ZTQA 4V19S 4AXIA 4FJKA 2YKQA 5EX5A 1S5ZA 3VF4A 4IZ9A 2BKNA 3PYDA 4LMZA 4FZVA 2Q66A 3IGNA 3VQDA 1EKEA 3AJ1A 2DO0A 3H5XA 3AVCA 1TL7A 2Q97A 5HL7Q 2VJVA 4J5OA 2HF4A 1HBUB 2BM1A 1HRHA 2M8DB 3JSMA 2B51A 5FIIA 4QR2A 2VPWB 2ZWOA 3SEOA 3C6TB 1RAHB 4QW8A 2J0QD 1B9FA 4CD3A 3HM8A 2VBYA 3J80Y 3CMES 2Y8WA 2ZM6J 4RJVA 1BWFO 3CCVN 4M45A 2PO4A 3V1RA 2QLXA 1WSRA 3WNGA 1LFPA 4K59A 4WFAQ 3L7OA 5DM6L 3TAQA 2F8SA 2AV5A 4FYYB 4OQJA 1K1QA 4OYWA 4EYHB 4DV1K 3BM7A 3MAAA 1HNVA 2ZF5O 1H2TZ 2PT0A 2BXJA 1XNQF 4C2MA 3VQ9A 2B9YA 3PW4A 1SUQB 2G8UA 2MSTA 3G82A 4JI2J 2PAVA 3GWCA 1KDNA 4DL2A 1N33F 5EWEA 1CQMA 3BQ1A 3P45B 1R59O 4FZZA 3TAFA 3MEGA 5JLFA 1QAIA 2QMWA 3TA2A 4FYWB 4Q45A 1QZ5A 5IM0B 4F0KA 2V5HG 3BBBA 2H4WB 1SL1A 1ZBFA 3AGKA 3I33A 1KXPA 1WG4A 2JOQA 3PVXA 1BHNA 2XSFA 3D2EB 2V51B 4B9NA 4ILJA 4CEFA 1WC3A 1WWHA 4PKGA 4QIGA 5DS7A 1LOUA 1XHXA 2E5GA 3I56S 4M7XA 2ZH3A 3QERA 1Z26A 4Y2MA 2W2NP 1SKRA 3AH6A 3QLHA 3HMJG 4JS4A 1YBUA 2PDAA 4I2QA 2AYBA 2JL9A 4DPWA 3N6NA 3NOCA 5GIPA 4OMFG 1U09A 2EG1A 1RT3A 4UOHA 4F2SA 3LO3A 4KHPK 4MKBA 1NGDA 5DRKA 2HS4A 3L7UA 3T6BA 5JUMA 5EU7A 2GA7A 3AB4B 4H4MA 1G99A 2HBLA 5BRDA 1TL3A 5MAOA 4F02A 2DT9A 4P9SA 4FYXB 2AYEA 1LEOA 2AGOA 1U2CA 2C3MA 3O1LA 3PX0A 2R2TA 1FEEA 4H0VB 2MZ1A 1F9EB 2E8AA 3R7NB 3TJAA 2B7CB 4M5GA 2BBEA 1SAZA 1Q78A 3M8QA 2DD8S 1VQMN 2FVQA 2RKIB 2BE9B 4MLHA 3GE1A 2AU0A 1X4FA 5GADI 4DTSA 1UL3A 5HMYA 1UVLA 1NKEA 2ASLA 3UD3P 1S12A 1NNDA 4I2PB 2FLLA 4LH5A 4QQBA 1HBOB 4PYAA 3SBTA 2RHSB 2UUCF 4U7UD 1KFSA 1SI9A 3FCHA 3W3DA 4AL6A 4H03B 5AFUA 3P3DA 1FK9B 1Q5YA 4EUVA 1M5OC 3G4SN 1D9FA 2XLKA 5A8RA 1QQMA 5AQFA 2G2YA 4ZJOA 2XMKA 3CC7S 3HHLD 4NLTA 1EX8A 1CZAN 3PO4A 4P6QA 4YEAA 4H5RA 1HKAA 4OV6A 4RW9A 4JV5J 2P2CB 1JLAA 1HQUB 1AZSB 1NU4A 3DGVA 4X62F 3BPDA 4B08A 1GXTA 3L4IA 1JXLA 2L3MA 1V9OA 4PQAA 3HVTB 5BR8K 2GS8A 5F0XA 3PX6A 4FJLA 4DR7K 1GXLA 3ULDA 3NEKA 1BIZA 1RAOA 4DPXA 3CD7A 3L8BA 3KK1B 2GGPA 5C7PA 2FLNA 1I6JA 3FBCA 5D4NA 3J7YI 1BMQB 1JB0C 2BUNA 2XMAA 3W65A 3WQTA 1ZAVA 2DNNA 2G8IA 4USVA 1LWCA 5K14A 3O3FA 2MKYA 4L3KA 4IRKA 3GONA 2DISA 1EQMA 3CJ0A 3JS9A 3VGLA 4PWDB 3F0NA 4J9QA 2B5JB 1GTEA 4J9VA 4K8ZA 2JGUA 4Q44A 2K7JA 4BRPA 3LP1B 5AQOA 4IG3B 4DS5A 2W9BA 4ZPVR 1T6DA 1YJNN 1WDDA 4U8YA 5CYMA 4DV3K 4Q5VA 1FNMA 3VESA 1C4CA 3CCUS 4BDZA 4UZCA 4K50A 1VJWA 3C15A 2MSSA 1CXUA 2YNGB 1KOHA 1HNWF 1F21A 1WG1A 2UUTA 2ZJRQ 3PYGA 1WBDA 3PLAA 5DGBA 1YRUA 2DGWA 1RT7A 1JL2A 1AUDA 4PQUA 5KFZA 2YJFA 1CLQA 2HKEA 2VQFJ 3VQ6A 3KLGA 3UB5A 4CW7B 5J2MB 3O9UA 1TL1A 4CECA 4CGIA 1WEZA 4JI1K 1FA0A 5CA5A 5HROB 3HXMA 2OTLN 3P83D 3ZSZA 5K20B 1VLYA 2UXCJ 2OEMA 2RQMA 1XIQA 2NRZA 4FF1A 1UJ5A 1X4HA 2HBRB 4PKIA 1GAOA 2Y3YA 3ZT0A 5M1QA 3HVRA 4B1VA 1XR6A 1CJTA 3S9HA 2ZHBA 5J2PA 1JJ2R 5E3RA 3FSXA 2CVIA 2P9PB 2J4RA 1HBMA 5KFBA 2I9SA 3OYBA 3M2UA 4B3MK 1OH8A 1Z2LA 1DZ5A 3K2PA 1SIZA 2ZQBA 2IC3B 2QEXN 4AM7A 1ZPVA 1FRHA 2E88A 3D66A 1CEZA 4M3XA 4DL4A 5C10A 2DH8A 3VEOA 3BH7B 3VTHA 2Z1HA 2DNLA 1M1GA 4ED8A 4LF8F 4JHDA 5EOYA 2V8HA 1FI4A 1IBLF 4FM2A 3KZBA 3S3OA 2PZSA 1VQ5N 3BUZB 2ZKTA 3O4WA 4FF4A 2GO9A 1NBWA 3VQCA 2ZOGA 3HOTA 1YRTA 3O6QA 5HQ8A 1C6VA 5KT2A 1Y11A 3O44A 2J6TA 4R0EA 5L1JA 5IC4B 3G25A 4DFJA 5H9FJ 4IOCQ 3IKMA 2HHVA 1H0HB 3R7BB 1Z6RA 1Y3JA 1UWBA 2DCLA 3BGFA 2LEPA 2XCPA 3HULA 3QT6A 1Q53A 3D1OA 1GXUA 4FW1A 4DL7A 4FZXC 3DOMA 1RU1A 3V9UA 2AZ1A 4WU3A 2A1RA 1JNZB 2CNNB 2WOMB 4C0BA 1P1TA 3GOIA 2HHUA 4P71A 2Q36A 3GJRB 1QM9A 1HWJA 2FZKB 1VS3A 2KQ2A 4MO4A 1UPMB 1X60A 3SQ0A 4C8YA 1PIEA 1NG9A 2EK6A 1C0TB 3UDLA 3IR6B 2MQLA 3HHKA 1WSJA 1MMLA 4X4UA 5CH7B 2CJAA 1DQAA 3MEDB 5TKWA 4M5MA 3BN7A 1CJKA 5F8JA 1N5YA 2G1HA 3CCTA 4QYZK 2AEMA 2N3LA 5A8WB 4ZPCA 2QC3A 1T8EA 2GWJA 4DR4K 4JK7A 5G0RB 1X4EA 3SCIE 2ZZMA 2HVDA 4LRFA 2CYYA 4M5LA 2AJ2A 3WC2A 4F3MA 1KEKA 1MW7A 4MTPA 4TXSA 4J9SA 4F3QA 1A5VA 1ZZNA 4ZP7A 3QZ7A 1B64A 3R3TA 1WORA 3H45C 3X3UA 3LP0B 1MG7A 3NGIA 2PMZD 4DF8A 1U04A 1N8RO 2WC9A 5C2DA 4BC3A 2YWEA 4LFBK 3ID8A 2C22A 3IR7B 4TLRA 4NL5A 1S72N 2IPOB 1HR0J 2FJWA 4ID8A 1ZC6A 3M7VA 3P4UB 3EL2A 4JKHA 2W6LA 4JI0F 3GYXB 4JI3K 1QVFR 2NRVA 2GBZA 4M7YA 4DR5J 4MO5A 4BG9A 3IA0A 3D6FB 4BR0A 1JJ2M 3GFXA 1RBOB 3O08A 4JI7J 2D3OR 3OS0A 4WQ4C 5FROA 4ECQA 1G2EA 2GVZB 1LAWA 2BACA 2JLEA 1U0HA 2CQIA 2XBPA 1N5VA 1NJWA 1OO0B 4YY3J 1KQSR 2CDRB 1K8AT 4K42A 3M05A 2XY5A 2XS5A 4HKQA 2Z30B 3H2LA 3N4QA 2WVEA 2IDEA 1XMOK 2PYJA 1CJUB 4NLWA 1VMBA 2PFUA 3O3HA 1BO5O 5T7LA 2YNFA 3TR8A 3PW7A 1R8CA 2CH5A 1WI6A 3OYFA 4GVEA 2C3UA 4AL5A 4QWDA 1U25A 1TUGB 1XMQJ 3UVJA 5KFDA 3HX9A 3ZCMA 4QYRA 3DLBA 4WZMA 4JV1A 2P6TA 3A8KA 5AE2A 5LMUJ 4U6PA 1RHKB 3LDNA 2KG0A 1R0BG 4JI8K 4JKGA 2KZMA 2BANB 4Q8EA 3R8YA 1GLLO 1EP4A 1NJIT 1NCLA 2XTJP 3MUTP 1RHRB 5AJ3F 4DU4A 1T7PA 2H65B 1U1RA 2MKIA 2WVDA 2OFGX 3RG6A 3NGTA 2FHJD 4L72B 4DFPA 2BUPA 4QS8A 3GBTA 2AIRB 2GUPA 4E89A 1U26A 2EFVA 3KHHA 3TAEA 2HQCA 4LY7A 1I3OB 1W0HA 2CUYA 4NEYA 4XDCA 2LECA 1RLCL 4NLCA 3VQ7A 1HNIB 1RJJA 4PWWA 1HHTP 4EK2A 1QQCA 4DCJB 1UVNA 4DSJA 2VPZB 3M8ZA 3QJLA 3CQ8A 1NWKA 4GVLA 3HRGA 4U8VA 2P1JA 3LM9A 3KDNA 2ADBA 4MT1A 2ALZA 3T1YF 1DY3A 4LF7J 2XSJB 4IEIA 1YI2S 4U95A 3N4WA 4G65A 4P2MA 1Q7YT 2CXEA 2VBXA 2WAQD 3KKFA 4OX9K 4A8WA 1Q8BA 2E6LA 1TKTB 1HNXF 4ICLB 5C24B 1DEJA 1IBKJ 3H59A 3BY5A 2H5JB 4FBTA 4HACA 2VICA 3A3NB 1G4CA 5KFLA 5M1KA 2W9AA 1UWAA 2CH6A 4LFCJ 1WAJA 4DV4K 4QR1A 2OMLA 2HQIA 4K4WA 3MM6B 2HOEA 3O9RA 4CJKA 3VQQA 5JVHQ 3S6EA 4B9UA 2B6AA 3DU5A 4BWMA 1QVFM 4JI4F 2E1MC 4XEIA 3MN5A 2KYZA 1M1HA 3LGMA 5MLCV 3LH2S 2HGNA 4GMKA 5F8IA 2UUBK 1C1BA 4OZ2A 3N01A 2G2OA 3M1VB 3CCEN 2GMJA 1ASWA 4PUOA 5DQHA 2DGTA 4HVZA 4X64J 2IIRA 4MJKA 5L1IA 1QE1A 1WC5A 3P5JA 1KQSM 3WXJA 3R2CJ 2IA6A 4C8NA 3TUJC 4HHHA 4M3TA 2R2RA 4RBVA 5SUHA 3PO5A 1Z2ZA 4CLKA 2HHHK 1M1KT 1KSPA 4OHYA 3IXQA 5M2PA 3SCXA 4ZK7M 2I7PA 4FOIA 2E29A 4C8MA 1KVAA 4H0OA 4KH1B 1A0OB 4BR9A 4QOZB 2ASJA 3QIOA 2CG8A 2VG5A 4NXNJ 3PYEA 1N6QB 3OL7A 1BL3A 5B0CA 3MDQA 3V1OA 3QEWA 2IGIA 2DNGA 1EB0A 5BPNA 3RAMA 2WBRA 4H4OA 1QUVA 2BE7D 2JJ4D 2HWTA 1RT6A 4XPCA 3WNEA 5A2QY 1FJEB 3AO1A 4KHUA 4IH5A 4NRTA 2ZITA 5KFVA 9RUBA 3AO2A 3MX2A 3FBBA 1S4FA 3UKUA 3RW6A 1HHSA 3OTDA 3TNVA 3VF2A 3B6PA 3VF6A 4O4RA 3P96A 3VOVA 4O44B 1RB0A 4DFMA 4IDKA 1NK0A 1RAEB 1TR0A 3HFVA 5BN9A 3ATUA 1Q79A 4OGEA 2C28A 4Q7AA 2DIVA 3WHIA 4DG1A 2R2SA 1SBRA 5KG6A 3J81Y 2NQPA 4DXLA 4OI0A 4DUZK 3T1AA 4JI5K 1IR2A 4WXWA 1UMJA 3CJ9A 3DRPA 3WDOA 1Q82O 1S1VA 3TABA 4DLGA 2BE2A 1DFDA 3V6JA 2FC8A 4DPTA 3BO2A 1K9MT 5HMZA 1C4AA 4RO0A 5DZ6A 1Q1KA 2DVIA 5KFSA 1H2UX 2DRAA 3HSJA 1T9TA 1V4TA 2L41A 3UIQA 3AD7C 5L1LA 4YDXA 2J6SA 4DEZA 4FL9A 5HRSA 1KLNA 3THVA 3PIPL 2I38A 2E2NA 4A8FA 2IYIA 5J1NA 4WQ4A 1VK8A 3FKBA 5GAEP 4CTAA 4X66J 1UFLA 2WTUA 3SQOP 3OJUA 2CJBA 4WCEQ 4RWTA 1VQNN 3TVZA 2MQ8A 5EWGA 2EK1A 4OIXA 2YV0X 4ZVEA 1L3VA 1FJGK 1ZAWA 4C1NI 3CJKB 1N34K 5LT5A 2PGCA 1F9HA 2E7VA 4TQRA 1KVIA