4RW8A

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor'
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
548
structure length
548
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 136
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw8A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw8A05
5DK5A 4YQWA 4KV8B 3VQ8A 2XY5A 3QLHA 4ED7A 4ELTA 3MEGB 1CXUA 1J5OB 2GBZA 2RKIB 4E3SA 1TKTA 4ECQA 4K4SA 4H4MB 5KFPA 4DTJA 5K14A 3G86A 3LAMA 4ZP6A 5C5JA 2B6AA 4BWJA 3SUQA 5SZTA 1K1SA 3L3VA 4FW2A 1TAUA 1BI4A 3Q8SB 5CYQB 4CJSA 4F3TA 4FLTA 4O3OA 4CJKA 1ZYQA 4BDPA 3P5JA 3V81A 3CJ4A 3NKYA 5CYMB 1QSYA 2OZMA 4IRCA 2IA6A 3HPHA 4QAGA 4J2EA 3TAMA 3L2RA 3T5HA 4DSIA 2KTQA 2R2RA 3ZT1A 3CG7A 4KV8A 4NCBA 4E7JA 2WOMA 1C0TA 2HWIA 3BSAA 3MXMA 3DLBA 3DRSB 3CJ2A 3MEGA 1J5OA 4M3YA 4CHYA 1NKBA 2C2EA 4FJ7A 2R2TA 3VA0A 4NLPA 3QNNA 3VQBA 3ZSRA 5HRPA 3LDSA 4CCHA 3K58A 1WLJA 2YHAA 2KZZA 3HPOA 5J1EB 3HSTB 5CYQA 1GOAA 4K4VA 1U47A 3NF6A 4G1QA 2XI2A 5J2QB 4IG3B 3GV5B 3GIJA 4F4XA 1NK8A 4KFBB 4KRFA 4WFXA 4B9TA 2FC0A 3C6UB 4Z4GA 2ETJA 3CFPA 2HHTA 3DRSA 4LH5A 1VSFA 4J2BA 4B9NA 1KFSA 4GC7A 4IG0B 4B9LA 3HXMA 1S10A 5C25A 4DFKA 5DLFA 2WK4A 2F8TA 5JXSA 1RT7A 2ZQBA 2WHOA 4WE1B 2FBTA 1C0MA 1JL2A 3L2UA 3S3MA 4RW4B 4DQQA 4KFBA 1S1TA 4DFJA 1W9HA 3SI8A 1IKXA 3FSIA 4J9SA 4O44B 4FZZA 2BRLA 4CECA 1RA7A 5HRSA 1KSPA 1BGXT 3KOAA 3OYFA 1ZBUA 4ZTJA 3GILA 4DSFA 4MK8A 4TLRA 4AHVA 2V0NA 4CJLA 4O3NA 4NRTA 1NHUA 1L3SA 4FLVA 3GQCA 2NUBA 1S1VB 2YNIA 4FM2A 4KPYA 3V9WA 2JEIA 1RDCA 5HRRA 4Q5VA 2W9CB 4WE1A 4DFMA 3M9MB 3HL8A 3OVNA 3K57A 2BQUA 3O3HA 4QWBA 5JUMA 3H40A 2D0AA 4WFZA 4ECUA 4ID5A 3BGRB 5KT2A 2XGPA 1EP4B 4CHQA 3SV4A 1UWBB 3OYDA 4NYNA 4KTZA 3P83D 4O44A 5CZ1A 4CE9A 2ZD1A 4LQ9A 2VA2A 1VSMA 3ICLA 4R5PB 1ZBFA 1DLOA 2EC0A 4FJ5A 3CQ8A 1WSEA 2B4JA 2C2RA 4LSLB 1XR7A 4E7IA 3WNGA 3NAIA 4CESA 2FVCA 5HLFB 4IFYA 4DL6A 4AILC 3E01A 3LP1B 3MECA 4LSNB 1WSIA 2HHUA 2OPRB 3H2LA 4Q0BA 4KSEB 5I3UB 1KFDA 5KT4A 4FS2A 1Q8IA 4B3OA 2HVHA 3C95A 4E0DA 1IKWB 1EP4A 2QXFA 1S49A 3D28A 2D41A 4CERA 4BE0A 4HUGA 3K2PA 2A1RA 3V9XA 2JC0A 1L5UA 2R8KA 4FLZA 4ECSA 3MEDB 4EYIB 5KFBA 4CEBA 4KHNA 4NLOA 1S5JA 3SQ1A 4ZPAA 4CIFA 1DTQB 1TV6B 2OH2A 4RUAA 3PW7A 3LWLA 1QAJA 4DF8A 2HNDB 3IS9B 1I39A 1SUQB 2AWZA 1RT6A 3LP1A 1ZTWA 2V4RA 4LSNA 3C6TB 3MEEB 4FJGA 4MFBA 4IBNA 3SFGA 5EWEA 3RBEA 1R0AB 3QGIA 3KIOA 1A5VA 2Z1JA 1TGOA 1Z4UA 3IGNA 1WSFA 5C42A 3QINA 4HCCA 3E51A 1S1WB 1UA0A 4K4YA 5KFNA 1XHXA 3DOLB 1IKYA 5KFGA 4JLHA 4JV1A 2UVRA 1DTQA 1TV6A 2IC3B 4MKAA 3OSNA 3QNOA 2IM0A 3VQPA 4I2PB 4KB1A 3IS9A 1TVRB 3FQLA 4DL5A 4CK1A 3NGYA 1YVUA 3P1GA 3MEEA 2R2UA 4C8MA 4EO6A 3RMCA 4Z4CA 3AVNA 4W5QA 3KTQA 1IG9A 4F4YA 3PJWA 4ZHRA 2J6SA 5JS1A 3VA3A 2YNHA 5KFDA 2GIRA 3NBPA 2EHGA 3PJXA 2YNGB 2R7YA 4CJEA 3PX6A 4I7FB 2HVIA 3DLKB 2XY6A 3H4DA 1LAWA 4ZP9A 1S1WA 4CEFA 2P1JA 4KB7A 3KLGB 5DLGA 4LQ3A 1VSHA 4BACA 2B5JA 3HVTA 3T5LA 3RMAA 2BGGA 1BQMB 4CFCA 1S97A 2J6TA 4O3PA 5KFVA 1TVRA 2BANB 4RG8A 3T19A 4IH5A 4W5TA 3NCIA 3M8QB 3GIIA 4M3TA 4KO0B 2RDIA 5KTQA 3UPFA 1S6QA 5J2MA 1ZBIA 5KG4A 3SV3A 4TYBA 2AGPA 2C2DA 1GOCA 1JXLA 4CF2A 2X6NA 1RTDB 4CIEA 4YR3A 3KHHA 2FBVA 2HNYB 1A5WA 1G15A 4Y3CA 5F8HA 4FS1A 2C22A 4WZQA 5I42A 4QW8A 4I7FA 3SI6A 1VSEA 5KFLA 4JS4A 4HCBA 3CVKA 4AH9A 3CO9A 1VRTB 4CGIA 2XGQA 4FBTA 3V6HA 2AU0A 5KFCA 5HROB 3DM2B 2I1RA 4HUEA 3DI6B 4DTSA 3DRRA 1SKRA 4Z0UA 4KO0A 4LH4A 4EO8A 3ASMA 4DQPA 5KG1A 2QE5A 2HNZB 4CEDA 4OJRA 1FKPA 5KFYA 4IRDA 4XIUA 2Y1JA 3RR8A 4EBEA 3OYMA 4DSJA 1RTDA 3KHLA 3VN5A 2PYLA 3KK1B 1S6PB 5J2NB 4F8RA 5J2PB 1BIUA 3UQSA 5KFAA 4B9SA 4ICLA 3RB0A 3CJ3A 1JLEB 1TP7A 4K8ZA 5CY4A 1F21A 1VRTA 5FRNA 4LD0A 3KMSA 4W5NA 4FK2A 1N6QB 4HHTA 3CYMA 2HMIB 1JLFB 3LP3A 2HWHA 1HYZA 3NF8A 4KKOA 3PW0A 4CF9A 3CFOA 3F9KA 1KTQA 3B6PA 1HNVA 2G8UA 2UUWA 1QTMA 1NKEA 3DLEB 4RW9A 1QAIA 3FQKA 3Q8RB 1BCOA 3WNEA 1SV5B 4FK0A 3VQDA 4IFVB 1GOBA 1TKXA 3QEWA 4URGA 3HT3A 3NGZA 2W42A 3KK1A 1FKOB 2DFHA 2E9RX 1FXXA 4ECWA 3H98A 4C8OA 5J2PA 1S0OA 1IKVB 4E89A 2R2SA 1XR5A 1JLEA 4DQSA 1JLCB 1LWCB 4ECYA 1BCMA 3HK2A 1N6QA 4IKAA 4CJFA 4NLDA 2D0CA 1N48A 1BISA 1JLFA 4I9LA 4W5OA 4I2QA 3HO1A 1B9DA 3KHGA 1RDBA 5HP1B 2OPPB 3PX4A 1XC9A 1VSDA 4DTUA 3TVKA 5F8NA 1JLBB 3VQ9A 4Z4FA 4TN2A 4XPEA 5FROA 3EYZA 1QSLA 5FRMA 1SV5A 1HPZA 4DG1A 3OYKA 3HVWA 4PQUB 1HNIB 3H5UA 3CIZA 4OKJA 4Q45A 1U45A 2E9TA 3AVAA 1MU2B 1IKVA 4J9MA 4ED1A 3DYAB 2UVVA 3ZSQA 1JLCA 2IJNA 4NYZA 4M42A 3BQ0A 1NK9A 4RW6A 2FJWA 2R8JA 4CGGA 4FLXA 3BREA 4BDYA 4KI6A 1RDDA 3EY1A 1RTHA 3IRXB 3QEVA 4KI4A 3KLFA 1TL3A 2RF2A 3AVJA 1HQEB 3ZSVA 5DG7A 2DPJA 4IRKA 5KT7A 4XPCA 2X74A 3ZSYA 4CGDA 1Q9XA 3V1OA 1DTTA 2E4LA 5L1LA 4TSXA 3OYAA 1CZ9A 1C0UA 3SZ2A 3RB6A 4MK7A 2HW3A 4H8KA 3VQAA 2Z1IA 3KMQA 3KLVA 2UUTA 1HNIA 4Z4HA 5KFWA 1JLGB 4DLEA 1JX4A 3O3GA 2HHSA 5KFZA 4CFBA 1JLQA 1JXEA 3D0PA 2G8FA 1RT5B 1X9SA 4J9NA 4RNFA 5CZ2A 4NLQA 3NMAA 3FFIB 4CFDA 2RKIA 3UR0A 1S48A 1LV5A 4J2DA 3OHBA 4H4MA 3SQ0A 4YR2A 1HQEA 4RW7B 1NJXA 4F2RA 3V1QA 4DFPA 4IOBA 4CF0A 2PYJA 4O3RA 5F8IA 1T94A 3MFIA 1Y97A 3KKSA 4C8NA 2ALZA 1N56A 4MIAA 3CFRA 1T03B 1VRUB 5CYMA 2F96A 3ISND 4NLTA 4EEYA 1J54A 4M3XA 3CDUA 3OL7A 3VQCA 1HQUB 4DTNA 3K5OA 4DU1A 3TABA 4WYLA 2DFFA 1D1UA 4F4ZA 3TR8A 3AVHA 2ZE2B 1D5AA 3N6MA 3QIPB 3PW4A 5F8JA 2I5JB 5KG3A 1RYSA 4RW7A 3AO4A 5HBMB 4Y34A 3PY8A 3QEPA 1TKZB 5J1EA 1ASWA 4GC6A 2D7SA 4WYWA 1RT3B 3LP0B 5C24B 3EPIA 4DTOA 5J2QA 3KJVB 3QIOA 4IG3A 4KHSA 3DRPB 4TY8B 3AVIA 4OLBA 4KHUA 4FCYA 4PUOB 3K5MA 1VSIA 4E19A 1RBTA 4HYKA 1HQUA 4DEZA 2DY4A 4O4RA 4CJ5A 3C6UA 3K5LA 4CFAA 5FDLB 4ZVHA 1KVCA 4C8KA 3ITHB 2BE2B 1D9FA 4NYFA 4OKKA 3KLEB 3QIPA 3BR9A 2I5JA 4Z4EA 4IG0A 4NRUA 3PV8A 3NF9A 3G6YA 4F50A 4PA1A 2FJVA 4O3SA 4AHRA 5HBMA 4CEOA 3UIQA 3T5KA 1Z26A 2PY5A 3PR4A 4EBCA 4NLRA 1YTAA 4M94A 4U6PA 1RT3A 3LP0A 4WXOA 5C24A 1NK7A 4ZVGA 3H08A 3KJVA 4NCGB 4JV0A 4H54A 4TY8A 4AHCA 1CSJA 3LZJA 4DL2A 1S1XB 4RW4A 2W8LA 5KGXA 3TAPA 4PUOA 3KLIB 4Q43A 4J9KA 4WXWA 3PO5A 3IGVA 1ITGA 4CJTA 3M8SA 2LSNA 4JUZA 1A5XA 5FDLA 3NHGA 4ED2A 3OYLA 3MR2A 4EP4A 1KCFA 4FJKA 2P5GA 3PVXA 2FJXA 3VQ7A 3L8BA 3SQ4A 4GW6A 4Z4IA 3WNFA 3MR5A 2XCPA 1TL1B 5KFQA 1YT3A 5D3GB 3G6XA 4DMNA 1S1VA 1YVFA 2ITGA 3OSPA 3OYNA 1S9FA 2VWJA 3KD1E 1IH7A 1SL2A 2BDPA 2W9CA 4CJ4A 3NGDA 1L3TA 4KREA 1WAFA 2HHQA 3RMDA 2UVWA 2GC8A 4YFUA 3AA2A 3BGRA 2KQ2A 2V4QA 3RWUA 3RAQA 2FVSA 1RTJB 2IOCA 2O5DA 4KE5A 1UWBA 4TY9A 2BRKA 3L3UA 4CJRA 5KT6A 4CF8A 1XWLA 3QO9B 3HM9A 4R5PA 3IN5A 3QERA 2JC1A 3N6NA 3V6KA 4ECRA 2B43A 4MQ3A 3MXIA 4E7LA 2OA8A 4LSLA 5KFUA 4BDZA 3ZT4A 4M3RA 3EZUA 3TAQA 3RTVA 5KFSA 5KGWA 5HLFA 3QIDA 3LPUA 3K5NA 3HKWA 4NLGA 1CZBA 4FM1A 2OPRA 4XO0A 2C28A 3U6FA 3H4BA 4Y1CA 3M9OB 3LZIA 5I3UA 5KFTA 2XCAA 1J9AA 5KFKA 4ZPDA 4O5BA 1IKWA 1XI1A 4TQRA 3RRHA 2KFNA 4WZMA 4PY5A 4Q8FA 4NLXA 3TAEA 4RW8B 4FBUA 3OS1A 3MEDA 2X78A 4DL7A 4JS5A 3AVFA 4EZ6A 3NH1A 4K50A 1W0HA 2AX0A 3KD5E 4KHRA 4ZMMA 2HNDA 3JSMB 3M8PB 1SUQA 5DQIA 3NAEA 4JRPA 4DU4A 1X9MA 4B9UA 1ZBHA 3TI0A 1YTUA 3C6TA 2Z1HA 5DGAA 5KFOA 1WNEA 3SUPA 2YKMB 1RT4B 2YKNB 1R0AA 1N5YB 1KLNA 4DF4A 4HKQA 3VQSA 2WTFA 3FRZA 3KK3B 4ZP7A 4K4WA 1S9GB 1LAVA 1RDRA 4O4GB 4BE1A 1LWEB 4DWIA 3QYYA 4RW8A 4FJIA 3SUNA 2D5RA 4YR0A 4CEQA 3QGHA 4TYAA 2O4IA 3RB4A 4KTWA 1SL0A 3DOLA 3CJ5A 4ED8A 3LAKA 2IC3A 4WFYA 3WNHA 3OS0A 1SL1A 2IS3A 4FJJA 4H4OB 3KHRA 4I2PA 5E41A 3O3FA 3AV9A 3OYGA 4EBDA 4ED6A 3I5BA 4R8UB 4CIGA 4DTPA 5L9XA 1LW0B 2XY7A 3OL8A 5DQGA 3GIKA 4IDKB 4FJXA 3BQ1A 1RT4A 4ELVA 5F8MA 1VK0A 4DL3A 2HHXA 5KFFA 3CM5A 2YNGA 3ZCMA 3KK2B 3BSCA 4FJLA 1S9GA 3V4IB 3DLKA 2P51A 3V9SA 3I5AA 1HYSB 1EX4A 3D45A 1CXQA 5L1KA 2YNFB 3KLGA 3AVLA 2PZSA 4ZTFA 1WSGA 1KLMB 1QE1B 4H4OA 3F73A 3SCXA 1BQMA 3DLRA 4ELUA 3AO1A 3RR7A 2JEGA 1U09A 2BANA 4NLWA 2ATLA 3HP9A 1LW0A 3M8QA 3V6JA 1KHVA 3VQ6A 3MTKA 3CJ0A 4FXDA 3SFUA 1KVBA 4IDKA 4KBIA 3TQ1A 4RNHA 3SJJA 3GYNA 4FLYA 1NOZA 4Y1DA 2ATQA 4TQSA 3CM6A 2HNYA 3DLGB 3OL9A 1TKDA 3ZT2A 2DFEA 3EPGA 2IMWP 4EZ9A 2R8IA 4KAIA 3G6VA 2OPQB 4OGCA 2AGOA 3AA3A 4CEEA 4DTMA 4K4UA 2W9BB 4M3UA 4FYDA 1KLMA 5HROA 3DM2A 1QE1A 1S9EB 4ZPCA 4Q8EA 1S0NA 4F4WA 2YV0X 3O4NA 3JYTB 4QWDA 3OLBA 2J6UA 3ZT0A 3QGGA 3H5YA 2XWYA 3DI6A 2HAIA 1BIZA 4Y2AA 2WRMA 3I8DA 2HNZA 4YP3A 2CKWA 4CK3A 2W7PA 1J53A 1ZBLA 4IH6A 2OZSA 3CDEA 1NK4A 4NLSA 3SPZA 3V9ZA 3K59A 3O4QA 4PWDB 5JS2A 3KLHB 4NLVA 1S6PA 3DOKB 5J2NA 3EZ5A 4M3ZA 3OLAA 1RDAA 1EXQA 1VSKA 3HVRA 4NLUA 1U49A 1SKWA 1RT2B 1SH0A 3FDSA 4CHZA 2FLLA 2G8HA 1HARA 1ZETA 4E1MA 1SH3A 1D8YA 1CLQA 1LW2B 1RCHA 3OYIA 2W9BA 3H59A 1S1UB 1NHVA 2HMIA 3BSNA 1RTIB 1B92A 3ULDA 4FJNA 1SKSA 4FJ9A 2ILZA 3RMBA 4KTQA 4DL4A 4ECVA 3CDWA 4J9QA 4OLAA 3T5JA 3DLEA 5EDWA 2KW4A 3QLHB 5KFJA 2KZMA 4DS4A 4IFVA 1FKOA 2VG7B 3VQ4A 3ZT3A 1IM4A 2B6AB 3H5XA 4MH8A 4B8CA 2FLNA 4HVJA 1KRPA 4K4XA 3CWJA 1LWCA 4I9QA 4Q44A 4K4TA 3AA4A 2FVQA 3V81B 3B6OA 5KT3A 4RUCA 3OYCA 1HYVA 4ZPBA 1UOCA 3TARA 4M95A 1RTIA 3H5SA 3TAMB 5HP1A 3HPGA 2OPPA 2R8GA 5EWFA 2WOMB 1JLBA 1C0TB 1RBRA 4PQUA 4DTXA 1L3UA 4K4ZA 1NOYA 2IM3A 3AVCA 4GMJB 2VG7A 1MU2A 3MR3A 3PW5A 1BQNB 3DYAA 1JXBA 3ZSOA 2Y1IA 2IDOA 3I0SB 1RYRA 1N4LA 4CJVA 5L1JA 4J9PA 4FJHA 4NCAA 1X1PA 1VSJA 3MR6A 4G1QB 3OL6A 1RA6A 3IRXA 1JKHB 2R8HA 1TK0A 3NGIA 3U3YA 3PX0A 4FVMA 5F8LA 2RPIA 2G8KA 2XC9A 4EP5A 3QEIA 2W9AA 2FBXA 2O4GA 3NDKA 4QW9A 4QWCA 3MF5A 3BJYA 3HVAA 4FW1A 2W8KA 1JLGA 3M9NB 4ECTA 5C25B 4QPXA 1BQNA 1RT7B 1NK5A 4ZP8A 4CEZA 4AHSA 4DS5A 2D3UA 3I0SA 2WONB 4ZVEA 4QWAA 1RT5A 1S0MA 1RBVA 5F9LA 3PUFA 3FFIA 4KHYA 3MFHA 3MXJA 3AVBA 1JKHA 4J2AA 2RDJA 2D3ZA 1S1TB 1NJZA 4J9OA 2QKKA 3DDKA 2DPIA 1IKXB 4F3OA 1C6VA 3SUOA 2Q3SA 2OYQA 1K1QA 3D5MA 5KFEA 3GIMA 3TAGA 3LANA 3HP6A 4E7KA 4AHTA 2ASJA 1U48A 3NL0A 4C8LA 1T03A 1C1AA 2E6LA 4KHWA 1NJYA 3LALA 1VRUA 3GV7B 4JRQA 3AO3A 5KG7A 2AGQA 2YNIB 2IM2A 1O1WA 3I0RB 2WONA 4CF1A 4CHPA 2ZE2A 2A1SA 1RBUA 5HRNA 4ID5B 3V6DB 1ASUA 1U4BA 1K6YA 3PR5B 4HUFA 1TAQA 1WSJA 4QWEA 3NH0A 2YHBA 1TQLA 4FK4A 1TKZA 4EYHB 2ZD1B 4JV2A 5KFXA 1DLOB 3HYFA 2WCXA 2XI3A 4N5SA 5SWMA 1C1BB 2JEJA 1UA1A 2ILYA 5L1IA 3DRPA 1RAJA 3S3NA 1GX5A 4FZYA 3QZ7A 3I5CA 4KB0A 1ASVA 4IFYB 1QUVA 3ALYA 3NH2A 3E01B 5EU7A 4DTRA 3MECB 5KT5A 3TANA 1LWFB 2X6SA 4Q0BB 2IAJB 3I0RA 2FLPA 2HHVA 1S4FA 2GIQA 4B3OB 3ITHA 2BE2A 3KLEA 1UAXA 4ED0A 3V6DA 4DLGA 4CHNA 4O3QA 2HHWA 4ECXA 2HB5A 4BE2A 4URSA 3C94A 3AVMA 1NJWA 4CJWA 3RB3A 4MKBA 2XY8A 3RAXA 5KFRA 5KG0A 5KFIA 1C1BA 3AVGA 4NCGA 1S1XA 3KLIA 3RBDA 1RT6B 4QCLA 1LWFA 4KAZA 2IAJA 4MFBB 1TK5A 1OS5A 4K8XA 1C2PA 4IR9A 1JLAB 1IO2A 3LWMA 3HHKA 4ECZA 4ID1A 3SPYA 3OJSA 3OYEA 4DQIA 4OKEA 4NLYA 1TL1A 5C42B 5D3GA 2XHBA 4ZVFA 2D0BA 2Z1GA 1WNSA 5KI6A 1T3NA 1Z25A 3L2VA 4FJMA 2VWKA 4M41A 1NK0A 4M45A 4N76A 2KFZA 1IKYB 5KG6A 3L2WA 2W7OA 2UVUA 2BQRA 3MAQA 5T14A 1RTJA 3OS2A 1WAJA 3Q8QB 3L2QA 4N56A 1NNDA 4BWMA 1JLAA 4OVLA 3QO9A 3VQEA 4ZHRB 5KFHA 1Q9YA 4CHOA 3PHEA 4Y2CA 2IJFA 2YNHB 4RNOA 1FK9B 3NBPB 3VQQA 2ASDA 5DG9A 3ZSZA 4CGFA 4IR1A 3LPTA 4GVMA 1B9FA 2EX3A 1HMVB 3PO4A 4YNQA 2GUIA 4E7HA 1I3AA 3QESA 5KRTA 2ZKUA 4OPKA 4RZRA 2AX1A 4YMEA 2B5JB 3HVTB 2QK9A 1QQCA 2WB4A 3AO2A 3PZPA 4CJ3A 4FJ8A 2JLEA 3S9HA 3Q8PB 1SH2A 1QS4A 1EKEA 4L8RB 4ED3A 1QHTA 3OYBA 3BDPA 1S6QB 5J2MB 1JIHA 5DG8A 5DQHA 1C1CB 1NKCA 5KRSA 3GV8B 2VG5B 1REVB 1FK9A 3TWHA 2F8EX 3DMJB 3T1AA 2G8VA 1RT1B 2GV9A 3NF7A 3JSMA 3M8PA 3TAFA 1QSSA 3KKRA 3T3FA 4FLUA 5I42B 3LP2B 1XHZA 3OJUA 1HMVA 2IM1A 4X2BA 3G10A 1RBSA 3KNAA 1HRHA 4IQXA 1JL1A 4DSEA 2YKMA 2YKNA 5F8GA 2ASLA 1N5YA 5EUHA 1BHLA 4N47A 5F9NA 2V9WA 4FZXC 3KK3A 3DRRB 3THVA 4OGEA 4O4GA 2F8SA 1LWEA 4B08A 1MMLA 3M8RA 1FKPB 1EETB 3S3OA 4O0IA 2JGUA 2BQ3A 1BL3A 4OPJA 3SNNA 1C1CA 2DTUA 2XRIA 2QV6A 2VG5A 3SYZA 1REVA 3DMJA 1RT1A 4CJUA 3N6LA 3ZSXA 4R8UA 3LP2A 4ICLB 4DSKA 1RILA 4CJPA 4IKFA 4DU3A 2XO7A 2CJQA 3SQ2A 5DMRA 2RN2A 3ZSWA 3QZ8A 3ISNC 4KKOB 4UQGA 1NK6A 3IAYA 2JEFA 3KK2A 3V4IA 1HNVB 1WN7A 1KVAA 1I6JA 4LY7A 1XR6A 2IGIA 3DLHA 4RW9B 1EETA 1HYSA 3QEXA 3AA5X 4RU9A 2YNFA 4J9LA 4FM0A 1TKXB 1ZTTA 2P5OA 3OHAA 4O0JA 3OYHA 3NFAA 3OY9A 2AQ4A 1X9WA 1T05B 1HJRA 5KFMA 5KG5A 5DGBA 4MK9A 3A2FA 4FLWA 2VG6B 1L3VA 4RNNA 3BQ2A 2VA3A 1T7PA 4B9VA 3IG1B 4F2SA 3PW2A 4RNMA 4HTUA 4I2QB 4R0EA 2QKBA 4URQU 3OYJA 4B8AB 4TXSA 1U04A 3DLGA 4QOZB 3BSOA 2FVPA 4E1NA 4MIBA 1D0EA 4DSLA 5KG2A 2FBYA 1D9DA 2OPQA 1HPZB 4DG1B 4CJQA 4CK2A 1T8EA 1TK8A 4M3WA 2OPSB 4DQRA 1S9EA 3JYTA 4N41A 1GX6A 1T05A 3AVKA 3V1RA 1KHWA 4F4KA 3G0ZA 2VG6A 4B9MA 4RW6B 4G3IA 4KHQA 3IG1A 4CEAA 3NAHA 4NZ0A 4O55A 2G8IA 1TKTB 1RTHB 4PWDA 4W5RA 3HJFA 3U3GA 3KLHA 2E6MA 2E9ZA 3KLFB 3RRGA 4KHMA 5K14B 1TL3B 2RF2B 3DOKA 2FVRA 4OL8A 2IBKA 4AHUA 4CGJA 2BR0A 1DTTB 1BI4B 1RT2A 3QETA 1C0UB 4J9RA 3AO5A 5EWGA 1WSHA 1LW2A 3UDLA 4IH7A 4CGHA 2OPSA 3NE6A 2G8WA 1S1UA 1RNHA 1VSLA 4U7CA 3VQ5A 3V9UA 2AJQA 1W25A 5T7BA 1JLQB
chains in the Genus database with same CATH superfamily
4JI7F 2KFYA 1RWWB 2ZZTA 2NR0A 3MEGB 2GBZA 1TKTA 4ID8A 5AXKA 3G86A 4ZP6A 4W4MA 4BWJA 3SUQA 4DCPB 1K1SA 1TUVA 2QZ8A 3OTOF 1BI4A 3T69A 4F3TA 4B3MK 2GJ2A 1X4FA 1GLJO 4IOCL 3WDOA 2FIUA 2MYFA 2HYIB 4EGLA 3MM8A 2XNRA 1QSYA 2OZMA 4JI1K 2IA6A 4QAGA 1SQKA 1EZZB 2R2RA 2Y9HA 3CG7A 3W7BA 4KV8A 2VFRA 1AUSL 3BSAA 4BR4A 3DLBA 1Q7YO 1Q8KA 1J5OA 4M3YA 1NKBA 2QWRA 3VA0A 2VPYB 3JQJA 2XS5A 3ZSRA 1CJUB 3CC7N 2YHAA 1N32J 4G6VB 3IWNC 3MWPA 1GOAA 4C1NK 5LMNF 1SC4B 2R3VA 2CGJA 3UWTA 2XSFA 3HX9A 3SBTA 2UU9J 4IG3B 3GIJA 4F4XA 3GFYA 3CCVS 1KKHA 2EKNA 3C15A 4LFCF 2HS4A 1KS2A 1N5VA 2C2ZB 3FZMA 5HMWA 3JXUA 2I7PA 3BM7A 4C3KA 1P8GA 4OLOA 4WKRA 5BYSA 1KFSA 2LECA 3J81U 2GZOA 3P31A 3CCJN 2F8TA 1YBUA 2QFJA 2ZQBA 4QU7A 4JI7K 1FWKA 5DM6Q 2WHOA 3BV8A 3IRWP 2UP1A 3UO0A 1FE0A 1N5TA 4CT8A 2CPXA 1SIWB 3QRPA 3LM9A 1Q53A 1DGKN 4RW4B 2HPUA 4KFBA 1K47A 3KHYA 2MQLA 3NLCA 1IKXA 4OYWA 3OTOK 4WFBQ 4FZZA 2OKQA 1Y9OA 4CECA 2CQGA 4JI5K 1RA7A 1EAYC 2PFUA 5HRSA 1X4BA 2YX7A 1Q16B 4ZTJA 4DSFA 2IDLA 1YRXA 4AHVA 2HK2A 3LO3A 4H0VB 4CJLA 2H3GX 2EBGA 2R7XA 1RADB 1PC4A 1Q82T 4C2MA 3D68A 5HRRA 4HLBA 5BXIA 4XH1A 1T6DA 3QJJA 2QI2A 4QWBA 5JUMA 3H40A 3I6PA 4ECUA 3BGRB 1QQMA 1FWPA 4FN5A 2O8DB 2QA4S 3HFVA 4MLHA 2VQFF 3L6QA 3P83D 2BJ3A 4OX9J 2DNQA 3OW2M 2ZD1A 5LMNK 3O4WA 5AQSA 4FJ5A 2ZM6K 5CA5A 3G96A 4K59A 4G65A 2D0OA 3D7SB 4DV3F 5AXMA 3WNGA 3NAIA 4LFCK 4DL6A 3LP1B 4LSNB 2HHUA 2OPRB 4Q0BA 4KSEB 2XLIA 1KFDA 5KT4A 2H5EA 2L9DA 4E0DA 3SCIE 4X66F 1OYEA 1EP4A 4FNIA 2QXFA 2D41A 2XTJP 3PIPL 4HUGA 3K2PA 1DJ0A 3R6GB 5KOXA 3ZFVA 4HTLA 2F8HA 1WG4A 1IWAA 2BX6A 2Z2ZA 4EYIB 5B0EA 4ZPAA 2QEXS 1TV6B 4FWOA 3IA0A 3O6QA 3LWLA 3R1HA 3EE8A 3GR1A 3M2UB 1M5OC 3GPAA 2V4RA 3C6TB 5HQMA 2DRBA 3SFGA 3IFEA 2F40A 5M1NA 4OZ3A 3BKTA 5EWEA 4A2BA 4ZN1A 1S76D 5H9EJ 4FWQA 1TGOA 1M5PC 3BO2A 2HAFA 1Z4UA 3IGNA 4F25A 2RE1A 4HCCA 5C2CA 2O8EB 4KHPJ 5BPLA 4K4YA 4L75A 5KFNA 4BG9A 3DOLB 5KFGA 4AE5A 5DJBA 3G6EN 3QNOA 2IM0A 5THWA 2DHGA 3AQOA 3SCLE 2NXUA 3IS9A 4YOVA 5T41A 2C2MB 3NGYA 2NRTA 1YVUA 2VQFK 2R2UA 3H2UB 4EO6A 3KTQA 2NRWA 3ENVA 3VPZA 4BR9A 3M2RA 3J81Y 2FJDB 2E88A 2ZKTA 1YVNA 4DZDA 4DV3K 2YNHA 5HJXA 3EJMA 3QWPA 4H5TA 2ZH7A 4Y6IA 4DV0J 3Q8UA 2YNGB 4HL9A 3LGHA 4I7FB 3DLKB 3H4DA 2DNHA 1LAWA 4ZP9A 2KJVA 3W9IA 1NGFA 3KXDA 2F9DA 1VSHA 3HVTA 3T5LA 4X66K 1BQMB 2A6AA 4O3PA 5KFVA 4K42A 1CJVB 3QFUA 2B9WA 4IH5A 3M8QB 1CPZA 2DIVA 1GXUA 5KTQA 2YX1A 3UPFA 4LF2A 4OX7A 1ZBIA 3HSZA 4TYBA 2C2DA 4A2AA 4PKDB 1LFPA 2DTJA 3GZ7A 3CQXA 4DV5J 4FS1A 2C22A 5I42A 1XK8A 4WU2A 4BC3A 4D3HA 4H0PA 3W60A 2EXUA 3QWUA 2GO8A 4WWSA 1RSCA 4FBTA 3AODA 4OYMA 5KFCA 2HG4A 4E2FB 4U96A 2QLJB 3DI6B 2O8CB 1SKRA 4Z0UA 4LH4A 2G0JA 2HNZB 4OJRA 2LFVA 2GMJA 5BR8F 5KFYA 4XIUA 1H3DA 4EBEA 3AJ1A 3KHLA 4PG8A 1S6PB 1BIUA 3UQSA 2VFVA 3CIPA 1UFLA 3RSEA 3G8TA 1JJ2M 2H5IB 4BQZA 4HI1A 2ZJQQ 1K0TA 2EWSA 4OV1A 4A8YA 3VEVA 1N6QB 1VQ7N 1LNQA 4CJ7A 2HMIB 1JLFB 1HYZA 2ZDPA 1YBTA 3PW0A 3AARA 5CZXA 1KTQA 4AL5A 3K0JA 4I4BA 3FQKA 2I2YA 3Q8RB 1FO1A 3VZHA 3GFZA 1SV5B 4WQ5C 4DN9A 3NGZA 3KK1A 2W42A 1FKOB 3LOUA 3D6FB 4C8OA 5J2PA 3ZZRA 2Y1LB 4MDBA 4DR7F 1X9JA 4YDUC 3UN3A 5CHIA 1JLEA 4ZVSB 5A8KB 4GKKF 3EICA 4MT1A 4ECYA 4IO9L 4IKAA 4NLDA 2VC1A 1N48A 1GTHA 4UOFA 1RDBA 2GA7A 2PAVA 4RBUA 2OPPB 1YHQS 2J0SD 4CZIA 1IBKF 1HW9A 2QLFB 1U2FA 4QR0A 1NGIA 1JLBB 3GG1A 4TN2A 2E1RA 1T9TA 4AQYJ 1QSLA 5FROA 5FRMA 3OYKA 1UPPA 3HVWA 1QAYA 4PQUB 1DARA 2KVIA 3E3XA 2P9PB 2E20A 1VBYA 2E9TA 3KUHA 1IKVA 1EHWA 3MM9A 3WX8A 5T7LB 2DHHA 2IJNA 4NYZA 4LMZA 1MN7A 4CGGA 4FLXA 2V34A 1NM2A 1HNZJ 3G71S 4DR2J 1P1LA 2W1BA 4C8YA 3MMBB 1SQFA 1VQSA 2X74A 2ITMA 4CGDA 1DTTA 4CZLA 3D54A 5L1LA 1CZ9A 3QJPA 1C0UA 3SZ2A 1ZXOA 1FF2A 4FF1A 3I87A 4QIGA 3MDQA 2YI1A 1JX4A 4DPUA 2HHSA 5E3QA 2GVZA 2GW8A 3UCGA 2MZRA 1EKRA 3QFHA 9ATCB 1HWIA 3J7YP 8RUCA 1RP5A 2HGNA 4RNFA 5CD4A 2A40A 4UUWA 4CFDA 3NNCA 1FJ7A 3SQ0A 3SEOA 5GADI 2PDAA 3BDEA 4RW7B 1FRMA 3PKMA 4BR0A 4IOBA 1FE4A 1QTNB 4P2XA 3T1HF 1TUYA 2D0PA 1CS4B 5F8IA 5BPMA 4GKKK 1VRQC 2WC9A 1B64A 1N56A 4MIAA 4QU6A 3UCZP 3DJCA 2F96A 3MCNA 4C7QA 3CDUA 4DCHA 1IQZA 5ITHA 3CQYA 3GLJA 4DTNA 3K5OA 1IBKK 3MPDA 1R3NA 1HKCA 4CTAB 4ZVRB 2DFFA 3VF2A 1WKKA 2HLUA 4X4OA 3N6MA 1P6TA 4YHHJ 2I5JB 4KIAA 4HH1A 3AO4A 1CJUA 1MWYA 3PY8A 2YKQA 2P9LB 1UCNA 3PHTA 2OUGA 1ASWA 2BM0A 2RRBA 1WHYA 1W7WA 4WYWA 4YOUA 1WEYA 2X51A 4RO0A 2GVDB 3EPIA 1KVKA 4DTOA 3KJVB 4IG3A 2Q31A 4QZVB 4KHUA 1J6ZA 1QDUB 2R7OA 1VSIA 1RBTA 1HQUA 3EDRB 3FZFA 2GQ2A 3K5LA 2QTWA 4ZVHA 3QNWB 1KVCA 2CGKA 3RAMA 1ZM9A 3U1NA 3CCJS 2LA6A 5AFUA 1D9FA 2JJ4D 2EFPA 2VPWB 3BBBA 1PAUB 3QIPA 2AIRB 2XYHB 3BR9A 1UEVA 4PYDA 3TQEA 3RVCA 3W8PA 4F50A 3PIOL 2CQ3A 1RGIA 1H7WA 1Z26A 4USUA 3PR4A 2Q6BA 4NLRA 4M94A 4U6PA 3UDVA 5C24A 1NK7A 3UD4P 2GUPA 4X84A 4JV0A 4H54A 2QW9A 2Z56B 4TY8A 6FD1A 2JFKA 3MAAA 4DL2A 1S1XB 4RW4A 5KGXA 3DC2A 1AYEA 3CCRN 2DNRA 2MEWA 1WACA 4QQBA 1Z6RA 2DR8A 2V51B 1ITGA 3T1HK 4CJTA 4PKIA 4JUZA 5FDLA 3JB9k 4ED2A 4FWLA 5BRFA 3U9DA 1KCFA 4YN3B 3PVXA 4LF8K 2FJXA 3TSPA 4M63A 5L9NA 1R0BG 2HBJA 1F0XA 3SQ4A 4GW6A 1BOTO 3O9RA 3WEEB 2PD1A 1YT3A 1S9FA 2MHEA 3KD1E 1SCJB 2BDPA 2ZBPA 3NGDA 1L3TA 3IBWA 3I55S 1GEHA 2GC8A 4OZLA 2D3O1 3AA2A 5CR4A 2PMHA 1RHMB 2D9OA 3JTOA 3TA2A 3BGRA 2KQ2A 1ITPA 2MXYA 2O8DA 4BC9A 3ENQA 2UXDJ 4CF8A 2F1FA 3IN5A 3CO0P 2JC1A 3N6NA 4LRBA 4ECRA 3RBXA 4BRQA 1NMEB 1SPBP 3SBMA 2G2YA 3EZUA 3TAQA 3TJ8A 5KGWA 3K5NA 3VAGA 2B8PA 2HVDA 1GMUA 2OPRA 3H4BA 2BKPA 3NCRA 3HZ6A 4O5BA 1NGDA 2ZHBA 2BMBA 4I6MB 2KFNA 4WZMA 2IFXA 3ZETB 2PFDA 4I67A 1T9XA 3TAEA 1OY9A 2DITA 4FBUA 2DXFA 3GE1A 1U1NA 3MOZA 2YY3A 4M5LA 5IWAF 3RZAA 3M8PB 1X9MA 3NAEA 4DU4A 1VS3A 2V9KA 1PYSB 2RUGA 1QY7A 3C6TA 4DX7A 4ZCMA 3DNCA 2Z1HA 2UUCJ 4HHHA 1H2UX 1F1BB 2HIQA 5KFOA 4I6YA 4QIVA 4USKA 5IM0B 1WC0A 4DF4A 2HBZB 3EN9A 1RDRA 3IXQA 4LR8A 1Q5YA 3GR0A 2AD9A 1LEOA 4QYRA 1T3VA 2DHXA 4ZJOA 2O8EA 3SUNA 5ETKA 4YR0A 2J7WA 4TYAA 4KTWA 4U8YA 1SL0A 3DOLA 2QYGA 4WFYA 3WNHA 2VASA 5KPRA 5DM7L 1KXPA 2V2ZA 4DTPA 1LW0B 1CJKB 4EI2A 4RU2A 2BXJA 4DR4F 5ETPA 2MB0B 3BQ1A 1RT4A 1RISA 2YNGA 4PXDA 3KK2B 1IJEB 3BSCA 1S9GA 3V4IB 3D1OA 5IQQA 3DLKA 3OT9A 3V9SA 4WP9A 2OEMA 3I5AA 1HYSB 3WXKA 2CQ1A 2YNFB 2PC6A 1ZA1B 3VEOA 4ZVUB 1WSGA 3NEKA 1BQMA 1YJRA 1U09A 1CJVA 3IKMA 4DV1F 1UL3A 4X4NA 3TX0A 5DZ7A 2ATLA 2QX0A 3M8QA 3V6JA 2YWHA 1KHVA 1VBXA 2HZVA 3CMES 5AQTA 3CJ0A 4KBIA 3TQ1A 3SJJA 4DPWA 3GYNA 4FLYA 2W2PP 1NOZA 3CJBA 5IWAK 3CM6A 5HMXA 3PYEA 1R8PA 2FSJA 1NPRA 2MJNA 1WOPA 1H6KX 2NNWA 3CT9A 1GLCG 2IMWP 2R8IA 2KJWA 5C10A 1XERA 4USHA 1RGVA 3A4TA 4NLBA 1QE1A 2BZ2A 1S0VA 4F4WA 3JYTB 4QWDA 2J6UA 3QGGA 4OIXA 3DI6A 1O0PA 2HAIA 2O8CA 5I3PA 1KC8T 2HNZA 1N34F 1VLOA 1ZM4A 1HL6A 1RAOA 2Z2YB 2OZSA 3CDEA 1YI2N 4NLSA 1E3MA 4V19J 1S6PA 4M3ZA 3KDOA 1I51B 2X3DA 2MMYA 1VQ7S 3OLAA 1RDAA 4DU7A 1NSKL 1Q78A 4I0WA 4NLUA 2RE2A 3NOGA 1SKWA 1RT2B 3QT6A 2D1CA 2P9NB 2Q6CA 2FLLA 1ZETA 4E1MA 1SH3A 3OXFA 3VGKA 1RCHA 4KR0B 4FF2A 1TU0B 2W9BA 3CPWR 1S1UB 1NHVA 2HMIA 4OZ2A 1EWQA 1RTIB 3T1YF 1B92A 3ULDA 4ZVPB 5HVGA 4OX8A 1SKSA 1GQEA 3W8GA 4OLAA 2KW4A 3MPVA 1Q95G 3QLHB 3DHXA 1NRKA 3VAHA 4DS4A 3MD3A 3AOCA 2FDNA 1FKOA 2EFNA 3NGRA 5AQQA 3VQ4A 4DV1K 3H5XA 4DPXA 2HVEA 2HRTA 4HVJA 4N8NA 4FVCA 3UNYA 3Q2TC 5A8KA 2DNOA 1R8AA 3CWJA 2MZQA 2OD4A 3ZZPA 1UPMB 1VHXA 3OYCA 1R8BA 3TARA 1IBMF 2HQDA 4BGAA 3A12A 3H5SA 5AQYA 2RRNA 3TAMB 5ETOA 2OPPA 2GWKA 3J7ZO 1KAXA 2OTJN 4B1VA 1X0PA 1JLBA 1C0TB 2JZ5A 1FXDA 2BJ8A 2KKHA 4ZVTB 5IT0A 4PQUA 4DTXA 5A2QY 1GLFO 3I9ZA 4K4ZA 2CPHA 3U27A 5HVHA 1E4FT 2P9PA 1P27B 2Q3PA 2H5JB 1BQNB 1Y11A 3H8YA 1S3XA 2NYIA 5T7LA 3ZSOA 1N34K 3R6MA 3KVGA 4J9PA 1Y3JA 5IOLA 4G1QB 4ZVQB 5M1QA 3HOSA 1V4TA 3PX0A 2RPIA 3MMBA 3N4WA 2QN6B 4MO4A 4LBHA 3VVTA 3QEIA 2W9AA 2XS2A 5DETA 4AM6A 1HR0F 2RU9A 1WUAA 3BJYA 3HVAA 2W8KA 2I6WA 4MYTA 3T1YK 5C25B 4QPXA 4J9VA 1F9HA 2CQBA 3TSUA 1RT7B 4YOTA 4DCOB 4CEZA 2D3UA 1U1PA 2RQ4A 3JAMY 4KJIA 2DJWA 3I56N 3JS6A 4RJVA 1Q8LA 4K5RA 2K3KA 3M5RA 3MFHA 3MXJA 2RDJA 2D3ZA 5E7OB 4J9OA 4H5RA 1Q81T 5G0RB 4X62J 3TO8A 1NEEA 1C6VA 3P4IA 2OYQA 1Q4RA 1CS4A 3LANA 3NMUA 1HI0P 1C1AA 2QLXA 2E6LA 2QWQA 2LYVA 3DLLQ 3GV7B 1IBMK 2F4VF 3PFEA 2H9ZA 3HCXA 1OH5A 2AGQA 1UAWA 4UZBA 2IDEA 2J0WA 3BP8A 4DV7K 4CF1A 4CHPA 4QR2A 4LF6F 1K8AT 2BOPA 4PXBA 3L4IA 1U4BA 4M5MA 1T02A 4FZVA 5ADXA 2KYZA 3ZTOA 3GIRA 4B3MJ 4P2FA 2JLFA 1FJEB 1WHWA 4WBFA 3M8YA 3W0LA 3HYFA 2MLXA 4H4KC 1V9OA 1C1BB 2APOA 2JEJA 4LFBF 2W40A 3VEWA 4MYUA 2CPDA 2ILYA 4BY9C 2MSSA 2V52B 4DR6F 2H3EB 3E01B 2V68A 3MECB 4K7QA 4QIEA 1LWFB 1S7IA 2IAJB 4YEAA 3G4SN 3I0RA 2HHVA 2HLTA 2GIQA 5K8NA 2C2KB 1D9AA 1HR0K 1HBOB 4Y28C 3H20A 1ATSA 3FEZA 1KOOA 4ED0A 1H2VZ 4DLGA 4NXMF 3RUBL 1KQSM 1HBNB 1WC6A 4URSA 3MPYA 3C94A 3AVMA 2A42A 1N33J 1NJWA 4CJWA 1ZA2B 1FWLA 3CCRS 1H98A 5AT1B 4DXLA 2AJ0A 3IFRA 5KFRA 5TKYA 4LF7J 3WC0A 1O51A 2XS7A 3HHLB 1S1XA 3BH6B 2V8HA 3RBDA 1VC0A 2QT7A 4HEA9 3MMAB 4IR9A 3HHKA 1R43A 1O5JA 4XH4A 4KGXB 2HHPA 3EXCX 2QJ3A 4YOEA 4BRAA 1BLUA 4NLYA 5FD1A 1M90T 1ILYA 2F4VK 3WEEA 3EMTA 4JI7J 2XHBA 1BDGA 3IAS9 1HKAA 1MROB 4FJMA 2VWKA 4M41A 3H90A 2VODA 4LF6K 4RL1A 3JSBA 3VVUA 1CQNA 3MAQA 2Q43A 2DPNA 3NG8A 4AT1B 1F3FA 4JI5J 2PI4A 1JLAA 4OVLA 1QVGM 1GXLA 1BO5O 1RAFB 2ZH6A 3PHEA 4Y2CA 2ZVSA 3L09A 2FXUA 3O8MA 2A3ZA 4NOHA 1U8WA 3NBPB 3Q86A 2ASDA 2QWLA 4DR6K 3LPTA 1B9FA 3T9ZA 4YB7A 2GUIA 3OR1B 3TTCA 1DBDA 5KRTA 3GCXP 2WVDA 3S7RA 1V6HA 2CVEA 4ILJA 4NXMK 3CD6N 3ZETA 1SH2A 1QS4A 2JVOA 1EKEA 1QHTA 1TR0A 2ZM6J 4J5OA 3CERA 1FEEA 4J9UE 2V8DA 3I31A 2HOEA 3IDHA 1C1CB 1LKZA 4FYYB 2NXNA 5KRSA 4EUVA 3DMJB 3T1AA 2WZ1A 3J81j 3M8PA 4PWUA 3TAFA 3SDEA 5A8RB 4ZKAA 1XHZA 2PO4A 3QB0A 3SMZA 3G10A 1VQLN 3KNAA 1HRHA 1UVMA 2JSXA 2ZVIA 4IO9Q 1JL1A 1B0TA 4DSEA 5JMNA 1IV0A 1FRJA 4GKJK 3HBTA 2DO4A 2ASLA 2NLXA 4FZXC 3DRRB 2EWHA 3VCDA 3Q22A 3VERA 1MMLA 4QR1A 5I4MA 1N32F 4O0IA 5AZIB 3ZEUB 4DDFA 4OPJA 3SNNA 2DTUA 2LU1A 2XRIA 3SYZA 2MQMA 3BF4A 3ETMA 3F56A 2UU9F 2H4WB 2ZBCA 2NRZA 3LP2A 3KFWX 3S8SA 3CD7A 3ZO7A 1CJKA 3G2XA 1EB0A 2FYXA 1UJ4A 4X4SA 2EFQA 3O8WA 1RB0A 5LSOA 2CJQA 3D4JA 4Z94A 3CJ1A 2CJAA 2VGMA 5GIOA 2AT1B 3J7A1 3QFWA 1YDLA 2VDHA 2ZWPA 4C97A 4KKOB 3B4MA 1VQON 5B0FA 3KK2A 3V4IA 1KVAA 1XR6A 4UZCA 4C23A 1HYSA 3QEXA 2YNFA 3ENOA 4FM0A 1VR6A 2BE7D 1ZTTA 2M8DB 1GH8A 3IR5B 2AF6A 3ZTPA 2Q0RA 1E6VB 1LQ9A 1Q8BA 1RWUA 4FYVB 2L41A 1UEUA 5KG5A 3ID6A 3A2FA 3T9NA 4FLWA 2VG6B 2DGWA 4DV3J 4USJC 2Q1NA 3IG1B 3MUVP 1U1QA 1Y7PA 3S6EA 4R0EA 4URQU 1UZHA 3OYJA 5F0UA 3UN2A 1VDHA 2AEFA 4E1NA 3UDCA 3SMSA 2MKSA 2XM3A 4NMXA 4DSLA 4BRKA 2DGSA 4X66J 3IWXA 2VCPA 3PM9A 2N4DA 5EOYA 2W4PA 3FR0A 5DS7A 4LRDA 3CB4A 4A8SA 3JYTA 1YI2S 4N41A 1OYDA 2VV5A 2KB2A 1T05A 3RGIA 4CYUB 3V1RA 2ZBQA 1KHWA 4F4KA 2U1AA 1VAZA 1N32K 4RW6B 4OX9F 1UFWA 2DT9A 4G3IA 5AQMA 1CVJA 1RAIB 5F3TA 1RTHB 4W5RA 2E9ZA 3RRGA 2YQ1A 1WTFA 2UU9K 4NB4A 2DNLA 4CLSA 2IBKA 3TR5A 1RT2A 3ZZ0A 1AW0A 4CM2A 5EWGA 3KUEA 2YHWA 3UDLA 2B56A 3D6TB 4CRJA 1S1UA 2FTRA 5JVHL 2GHVC 3VQ5A 3V9UA 1NU0A 4YQWA 2CAJA 1BUXA 3Q8VA 3QLHA 2J76E 3MX2A 1OMSA 2RKIB 4E3SA 2AV5A 4GVLA 5K20B 4CD3A 5KFPA 5K14A 3LAMA 3MTJA 3PKYA 4FW2A 2JNJA 1U26A 3Q8SB 4FLTA 3KWIA 2VBZA 3NNHA 1MG7A 3N01A 2OTJS 1R59O 1JJ4A 2ZWHA 5F2RA 3P5JA 1RHQB 3CJ4A 3NKYA 5LJ3Y 3DDIA 1B0PA 1F3VA 3GYGA 3CSKA 5D4LA 1UEKA 5J1NA 1BU6O 3TAMA 1WTBA 4GO7X 3T5HA 4KH0B 3MM7B 4OZ5A 2P9SA 3ATUA 2B51A 2FSNA 2PIIA 2M7SA 1C0TA 4KHPF 4FJ7A 3CJ7A 1N0UA 2HS0A 5HRPA 4ATNA 3LDSA 2HFOA 2PA3A 3RG6A 1U2VB 5CYQA 1FD2A 4OX9K 4RWWA 1X7VA 1U47A 3NF6A 3ETOA 4G1QA 3BEXA 1DEJA 2HURA 2ASMA 2OP5A 3BGFA 4BVOA 1SJFA 4A57A 4JI0F 3SQGB 4B9QA 3DRSA 4CI0B 4LH5A 3JTPA 4J2BA 4K25A 4A8FA 3D6MB 4B9LA 2LCWA 3MCAB 3I56S 3MPWA 1DQ9A 5C25A 3O3LA 4XEIA 1RU1A 3HMJG 3TSQA 4FSVA 5JXSA 1RT7A 1X4DA 5BPNA 2UYTA 4WE1B 4RR5A 2FBTA 4PPZA 1NU4A 3CCSN 2QGFB 1JL2A 3ZX2A 2ZDOA 2KXNB 2O3DA 4X4PA 2YPYA 2DCUB 2W24A 1KAYA 3R7NB 1W9HA 2MKCA 3BR8A 4DV5F 3FSIA 4BC2A 3SAHA 1M1KO 5B7WA 1W26A 4MJKA 3IMQJ 1KSPA 1BGXT 3A5MC 3OYFA 5M2UA 2P9UB 3GILA 3NWGA 1Q7YT 2XMWA 4O3NA 5H9EK 1NHUA 1URRA 4ILRA 4FLVA 2NUBA 1S1VB 4KPYA 2JEIA 7AT1B 1O13A 5B09A 4Q5VA 2W9CB 3HL8A 3ENWA 2JL9A 5D8HB 4KHPK 4HDHA 2Q0UA 2ZFHA 5IXUA 3WC2A 3W64A 3J7YU 1S72N 3LPYA 4O44A 3CCUN 1ZM3A 1NSQA 5T7BA 1N5QA 3A8YA 4R5PB 4ENOA 2EC0A 3CJTA 2NUUG 1O6XA 3G4SS 3CQ8A 3N5FA 1F9EB 3ILLA 1XR7A 3MK6A 2LQ8A 1GAOA 3R7SB 5HLFB 1WUUA 4AILC 3E01A 3H46O 3MECA 1WSIA 3H2LA 1NGAA 4M7YA 1PO6A 2HZAA 4JI0K 5LJVA 1YQHA 1AUDA 1W2BM 1HBOA 3C95A 1IKWB 2KG1A 3D28A 5E3CA 3N0VA 3TA0A 2A1RA 2JC0A 3Q24A 5FJ4A 4NLOA 4FF3A 2OH2A 3AD7C 2XULA 1V3SA 1QAJA 2HNDB 2FY8A 3HHLA 5SUHA 1SUQB 2G2ZA 1ZTWA 5M1FA 1C4CA 1XMQJ 2FSKA 1FHTA 2E1YA 3U9ZA 2V8PA 1CULA 1NDPA 1R0AB 3E8OA 3TVZA 5MLCV 3MN5A 4DR3K 2XHCA 2QMWA 3E51A 5IV4A 1ZZFA 3BUZB 5CXTA 1FVSA 2F7VA 4CLLA 1APSA 4NPOA 4JLHA 1PJ5A 1DTQA 4IFEA 2BEFA 2QRRA 3Q0AA 5AQNA 5TKWA 2MSTA 4DR2F 3MEEA 1BA1A 4Z4CA 2W2QP 3AVNA 3I32A 4LF8J 1IG9A 2GJIA 4DX8H 3RW7A 1F5CA 4J37A 2LU2A 2J6SA 1AXQA 3A8IA 5JS1A 1U1OA 4ILHA 1CZAN 1TFYA 3NBPA 4V19X 3BKUA 1UTAA 2Y1RI 3BGUA 4CNZA 8AT1B 4BREA 2B4PA 1S1WA 3OR1A 1A9NB 2P1JA 3R8EA 3FLCO 1C0GA 3M6XA 3CNQP 3WZ0A 3AGKA 2J6TA 1TVRA 4IEIA 2BANB 2DEJA 4KO0B 3AB4B 2WVEA 5B0AA 3VZIA 1V3RA 1YGYA 2DIUA 2CQDA 3M1FA 4ETXA 4DJBA 2JWNA 3SV3A 2LP4A 1GOCA 1JXLA 2X6NA 2ZZNA 1RTDB 4UT4A 3T7ZA 5FIIA 3NWRA 1VQLS 4CIEA 4C98A 2HNYB 1A5WA 5F8HA 5A8RA 4WZQA 4QW8A 4HDGA 1BD6A 3CO9A 2A2DA 2V94A 1VRTB 3VEXA 2BV3A 3MZIA 4BRPA 4LFAJ 5HROB 4DU8A 4YHHF 2I1RA 7FD1A 4HUEA 4FWSA 4GY2B 2MY8A 3DRRA 4Y0FA 4EO8A 5KG1A 5ETTA 3QDKA 4BS2A 2J9DE 5AQVA 1X5OA 5AZIA 4M1KA 3VN5A 1WOQA 4CIOA 4USVA 4XDCA 3BBFA 5J2NB 3FCWA 3C6HA 5LMUJ 1VQ4N 2AP1A 4Y2IA 3B82A 2I7NA 4K8ZA 5CY4A 1TUGB 5FRNA 3KMSA 4W5NA 1OPZA 2EFVA 4DN0A 4X4TA 1MWKA 3D6HB 2O66A 3THXB 3N5BA 1CC7A 3NF8A 5KQ8A 4KKOA 5IT9O 5AQRA 2F9WA 5D0EA 4V19S 2RU3A 1NMDA 3WNEA 2W6LA 1B70B 1M5SA 1RAHB 4F36A 2DFHA 5GVQA 5CAAA 1FXXA 4ECWA 3H98A 2AEMA 1E6VA 1J5EK 2DISA 1S0OA 2M88A 1FNOA 2R2SA 4DQSA 1JLCB 1LWCB 2CVIA 1R6YA 1KN6A 1S5ZA 2CJBA 4JB8B 1BISA 4I9LA 4W5OA 2DCLA 2B8QA 1B9DA 1X4EA 3KHGA 5HP1B 3FVYA 5GINA 4LIWA 4DTUA 5F8NA 1LOTB 3EYZA 4ANCA 3BZQA 4BC7A 1F9FA 2J9CA 4X4RA 4OKJA 3L9ZA 4YHHK 2MKYA 2RAQA 2VIHA 1VBZA 1MU2B 4HTJA 3IUCA 3DYAB 2UVVA 3ZSQA 1HBUB 1GLLO 4RW6A 2R8JA 4N7TA 3GFHA 4KI6A 3EY1A 1RTHA 1GK8A 1WOSA 3QEVA 4KI4A 2KYXA 3AVJA 3H0PA 2E1AA 5DG7A 2DPJA 3ZSYA 1DT9A 3QGPA 2E4LA 1H72C 1HA1A 3BY5A 1XC3A 1J2VA 3R5JB 2HW3A 2RT3A 3FZ2A 4USTA 2WTUA 1HNIA 4RWTA 4YOXA 3W66A 3DGPB 4Z4HA 1JLGB 2OAUA 2AZ3A 2Z30B 1IR1A 1XNRJ 4AFFA 3D0PA 1YJUA 2QTDA 1RT5B 3CMQA 1X9SA 4J9NA 4NLQA 4FF4A 3FFIB 2RKIA 1FJGJ 2P6SA 2J8SA 2XLKA 4DUTA 3OHBA 4WYBA 4CO4A 2UZAA 1HQEA 4NI2A 4F2RA 2ASYA 5LSLA 4O3RA 1UJ6A 1VI7A 1QAXA 1IBLJ 3QAUA 4ZOSA 2BJDA 4C8NA 1Y97A 3KKSA 4OYIA 2ALZA 5AE2A 3CFRA 1T03B 2OFGX 2R9LA 2BUPA 1VRUB 3M6UA 3ISND 3OUYA 1X0FA 1J54A 2C3OA 4I69A 3HHLD 1K9MO 4U8VA 3H1QA 2QMUB 4WU3A 2IVMA 2MKHA 2D69A 1YZ6A 3AVHA 3G9CA 3EE9A 2AEJA 3CJSA 3M7VA 3AH6A 2OELA 1DURA 3PRDA 1HHQA 2KT3A 5EHHA 2B9YA 1C4AA 6FDRA 2XLJA 1HWUA 1TKZB 4LF4F 2EW9A 1U2VA 5HO4A 2PI5A 5HAOA 3J80Y 1NGJA 5B0DA 3O08A 5L46A 1EIYB 3IR7B 2V4JA 3EXYA 4XTTA 3QIOA 4IXCA 2L3MA 4KHSA 4PUOB 2DNZA 1YF5L 4E19A 1VJWA 4HYKA 4O4RA 3PYDA 2CNLB 2E1PA 2A10A 2GQCA 5C7PA 4A4JA 4C8KA 2EKYA 3CMAN 4NYFA 3SQGA 3KLEB 5FPEA 2JVRA 1UW9A 3CCSS 2RJZA 3G6YA 1VQKN 4PA1A 4AHRA 5HBMA 1N34J 2NZTA 1U7LA 3QMQA 2PY5A 2QG9B 1PYTA 3UKRA 1WF2A 1RT3A 2YKOA 3LP0A 2DNPA 3MN7A 3HI9A 4WFAL 4AF1A 3KLIB 4J9KA 4N77A 3OBWA 3A5LC 4K2XA 3NHGA 3OYLA 4FJKA 3ENHA 4B3RJ 1UMJA 4Z4IA 1X60A 4CBXA 1URNA 5KFQA 2RUSA 1IWGA 5D3GB 4MLEA 1OPIA 1S1VA 2WW8A 1SL2A 1S72S 3RW6A 2W9CA 2Q79A 4CJ4A 3CXCM 5F0WA 4KREA 1HFEL 2UXBJ 1FFSB 3EGWB 3CCUS 1VGYA 3QBXA 3M6VA 4DR1F 2ZF5O 3RWUA 1RTJB 2JRSA 2IOCA 5CH7B 3X3UA 4NEYA 3HZEA 3IAM9 4LF4K 2DH8A 1VQ9N 4R5PA 3QERA 1IBMJ 2QWOA 4MQ3A 5HOOA 5KFUA 4BDZA 2K2PA 3AA8A 2DB1A 3RTVA 5KFSA 5HLFA 3QIDA 3LPUA 4DV7J 2R7TA 3HKWA 4FM1A 4XO0A 4FOIA 4Y1CA 3M9OB 5KFTA 2KRBA 3C8YA 3QFPA 1SVDA 4ZPDA 3TNVA 3D7EO 2NRHA 1IKWA 4JI6J 4TQRA 1SZ2A 4CO1A 4ZPVR 4USWA 4NWBA 2I38A 4PQAA 5ETSA 5HQ8A 3OS1A 4P7TA 2JFDA 2YBVA 4CZKA 3R97A 4CBWA 2DYAA 3NH1A 3LDNA 1W0HA 4WIIA 2HNDA 3JSMB 1SUQA 5DQIA 3TI0A 5BN9A 3EVOA 2AJ4A 3OTCA 4WQ5A 1Y0HA 3ZZTA 1WNEA 3A0IX 2YKMB 1WSVA 1R0AA 5E3AA 2Z57B 3A1YG 3JXOA 1HI1A 4YDUA 2VJUA 3KK3B 4UQTA 4K4WA 1LAVA 3CW2C 4RUBA 4DWIA 4DV2J 1PYOB 4USIA 4RW8A 4JI3J 2AMCB 1FNXH 2BJEA 3QGHA 3PFOA 2IVYA 2JHEA 4DR1K 1TZ0A 3OS0A 4H4OB 3KHRA 2DNKA 1VC5A 3M6WA 2WBNA 3OYGA 2OGUA 3OVAA 2XBPA 1I5OB 4R8UB 3FZLA 3O9SA 4C0HA 1NLKL 3EGVA 4JKHA 3OL8A 4A5BA 1S59A 4IDKB 4FL9A 4L3NA 2N7CA 2DRAA 1HBMB 2CQPA 3AJDA 2AKWB 3CF5Q 2WBMA 4KH5A 2XHWA 3CM5A 5KAKA 1VQPN 3Q23A 1UVIA 2IYGA 1IR2A 3NCPA 1OY6A 2VZ9A 2MZJA 1YJNS 2RIJA 2HRUA 4AXIA 4GNIA 1EX4A 3MX5A 2RILA 1Z2LA 3L7OA 2UUAJ 1QVFM 1KLMB 3VAIA 3M1VB 2HF4A 2LLZA 1M1GA 4DPTA 5MLCQ 1MLAA 2BANA 1HI8A 3PRBA 4NLWA 4ZJQA 3HP9A 4HI2A 2LMIA 2R7UA 5AZJA 3VQ6A 2BE9B 4FXDA 2CZVC 4MIWA 2HHHJ 4Y1DA 2UXCK 2BABA 2WB1D 2E5JA 3J7YI 2HNYA 3OL9A 1FA0A 2V67A 1PG5B 4UW2A 1BE4A 1V5IB 4IDHA 3G6VA 1BY9A 4DTMA 4K4UA 1XUPO 4NO7A 2E8AA 1SAZA 1S0NA 5HROA 2YV0X 1S9EB 2CNOB 2GJFA 3ZT0A 5HL7L 2VBXA 4JV5F 3EZWA 2G13A 4YP3A 2CKWA 4CK3A 2W7PA 2ZOGA 2RRAA 4DHYA 3FZHA 3V9ZA 3K59A 3W5XA 3O4QA 3W3SA 2DNNA 3KLHB 3SLCA 3DOKB 5J2NA 3EZ5A 1KVIA 5HMYA 3WBZA 1T0TV 3IP0A 2HF3A 3KZBA 2VH7A 1SH0A 4P6QA 3LL3A 4CHZA 1HARA 3CCLN 4GKJJ 4L6V3 4MDAA 3OW2R 3THXA 1VQ8N 4AL7A 1ACMB 4CT9A 4HHJA 3LPEA 5LL6Z 1Z1ZA 3RMBA 3LA0A 3CDWA 1UVLA 1N33F 5KFJA 1X5SA 3AGRA 4MO5A 3HHEA 4FKXA 1W7AA 3PCOB 4LF7F 1CLFA 4WK1A 4F7VA 3CJAA 2VG7B 1VQNN 1IM4A 3L3CA 4MH8A 3T6BA 3ELHA 2A5XA 2FLNA 1CC8A 2WSEC 1LWCA 4K5SA 3HSDA 3DXKB 2OHDA 3B6OA 2VF3A 1BQXA 2NLWA 3FSXA 3R5CA 4ZPBA 1UOCA 3DLJA 5HP1A 2DD8S 1HLUA 2R8GA 5EWFA 4LF5K 4DPOA 3O1BA 2WOMB 2GO9A 3QJLA 2PA8D 3VF4A 5MAOA 1L3UA 1BWEA 2CPIA 1NOYA 3AVCA 4GMJB 2EK1A 1MU2A 4C3LA 3DYAA 1ATRA 4JV5K 1JXBA 1LCUA 1HBUA 3I0SB 3EM1A 4JI5F 2GHPA 4RBVA 2QL7B 4NCAA 4FWKA 3B8AX 3OL6A 3P45B 3H45C 1JKHB 4IOAQ 3U3YA 5LT5A 1ZC6A 5F8LA 4CZJA 4RUHA 2G1HA 1NLVA 2J7KA 2CPZA 1ZH5A 2IRUA 4OYZA 4QW9A 3BPDA 3MF5A 4FW1A 1NAQA 1R8CA 3DGPA 4JD2B 2DNMA 1JLGA 3M9NB 4ECTA 3GFXA 1FRHA 1RACB 4CLYA 1VCTA 3NGTA 2VHGA 4JI2K 1N33K 1RT5A 1OY8A 2ZM6F 1NWKA 2JDJA 1DY3A 3FFIA 4LF7K 1NDKA 4KHYA 2ZC3A 4J2AA 3WXLA 4OI4A 3MGJA 2IIHA 3AA9A 3Q2SC 4LVOP 2DPIA 2KXFA 3LGNA 1U2CA 2V69A 3SUOA 2NRVA 2M52A 2HBMA 3TAGA 3J7ZT 3THPA 1XTZA 1K73T 1G3OA 4F0HA 1X4AA 4R79A 1U48A 2M8HA 3NL0A 1T03A 3ENBA 3LALA 1VRUA 3P4UB 1WKLA 4OHZA 4JRQA 4EU0A 4U67Q 3HI0A 4ZCKA 3AO3A 2IM2A 1O1WA 3B8HA 2N3LA 4Z2XA 2WONA 1YRUA 3ZLJA 4JHDB 3VGVA 2A1SA 1RBUA 5HRNA 1VHFA 5HQLA 1DAXA 3PR5B 5EY4A 4GV3A 3P96A 2D4WA 1XQSC 1IVZA 1TKZA 5C2DA 5KFXA 2Z4PA 4JK9A 1U0HB 2LXUA 4N5SA 2R7SA 1UA1A 2FF3B 2GWJA 3GJSB 5L1IA 3S3NA 1GX5A 4IFYB 2NZCA 4DTRA 1R6VA 3GL1A 4PPDA 2FLPA 1T9WA 4B3OB 1YWXA 1ZBTA 2KKZA 1JJ2R 3KLEA 1UAXA 4F0KA 4P75A 1I94J 3V6DA 2W4CA 1Q0NA 1EQ0A 4FYXB 1NMNA 1KDNA 3U7JA 2VQEJ 4WQ4C 3RB3A 2V8GA 5GAGU 3R5AA 5KFIA 4LRAA 1U1KA 3S1TA 2X7IA 3KLIA 3DFEA 5A6PA 4C0BA 2GNKA 4KAZA 4MFBB 1NB7A 5D0RA 3CC2S 4EIAA 1C2PA 2CJYB 3T6JA 3LWMA 2XWXA 2GIFA 3NGKA 3CTRA 3EEQA 3QATA 2W41A 3OYEA 2FY1A 2K3IA 2AJFE 4OKEA 4ISFA 2V7ZA 1RWKB 5C42B 5D3GA 1NB2A 4CM0A 1WNSA 1TUWA 5DM6L 2WAQD 4FPBA 4M45A 4EMDA 2KFZA 2ZNZA 1VQ9S 4PG4A 5KG6A 3ZTRA 1SB6A 5T14A 1RTJA 3OS2A 1WAJA 1HKGA 4PRFA 5G4DA 1HNXK 3L2QA 4WFBL 2QL9B 1NNDA 1CBKA 4EWTA 5KFHA 1Q9YA 2ZH9A 3FMWA 3TW0A 1F5BA 4YB1P 3POTB 2RNEA 3X1LB 3BGOP 3OFEA 2IHR1 2LXIA 3ZSZA 1Q5VA 4MKVA 4CGFA 4IR1A 1R27B 2PSZA 3OPKA 1I3AA 3PSIA 2ZKUA 4OPKA 2AX1A 3DN9A 2B5JB 4B3TF 2Q2RA 2WB4A 3AO2A 4YOYA 3PZPA 4OJGA 1HD0A 4FJ8A 3S9HA 1FFGB 4C3MA 4ED3A 3OYBA 2DGOA 3GG4A 1S6QB 2E2OA 4DKWA 5DG8A 3EGZA 1NJIO 1NKCA 2VG5B 3EKSA 5BN8A 3MCSA 1FK9A 3C2PA 3EDQB 2G8VA 1RT1B 3JSMA 1RLCL 3DCAA 4FLUA 4JI0J 2F7TA 1HMVA 3IC1A 2IM1A 4X2BA 3U1MA 2YKMA 2N82B 1PIEA 3EO3A 3TRGA 5EUHA 2LVWA 2PEHA 3KK3A 3OXGA 1TELA 3THVA 4QJVA 2F8SA 5FLXO 2A3JA 3A5NC 3QPIA 2FJBB 1HIYA 1RJJA 2QYCA 2BOAA 4NX9A 1REVA 1WG1A 2JLGA 4WJBA 1SQGA 4R8UA 4B1UB 4H0YB 4UOGA 2O67A 3QSIA 4ICLB 4ES3A 4PWWA 4CJPA 2OTLN 1VQPS 1RKIA 2XO7A 2MZ1A 5BR9A 3L95X 5DMRA 4DR3J 1FT8A 2RN2A 3TU5A 3EUNA 3QZ8A 4NA3A 1HBMA 1NK6A 3C3LA 1HNVB 3EL2A 4IO8A 2P5VA 2IGIA 2W2MP 4RW9B 2R7QA 3DLHA 1EETA 4OX6A 3AA5X 4J9LA 2VPZB 4M5JA 4R0JA 1TKXB 4B3TK 3I82A 4C1NI 3W65A 5DDRC 3M1VA 2RMLA 2MHNA 2MQ8A 2AQ4A 3MD1A 3O9TA 3NRBA 2ZJRL 5IC4B 1HJRA 1SJQA 4K8RA 4MK9A 4I6WA 4JKEA 4RNNA 3BQ2A 1NM1A 2VA3A 1HPMA 4AM7A 4F2SA 4FPIA 4P72A 4PG5A 3GP9A 4I2QB 2VJVA 3LDOA 4JI8K 3ILIA 4B8AB 4TXSA 1U04A 3KG0A 1GLBG 1P9YA 1WF1A 4OJ3A 3BSOA 5D6GA 5AQUA 1YK9A 1TL7B 4CW7B 5LY3A 4PKHA 2GGPA 1HPZB 4DG1B 4CJQA 2Y0BB 1RKJA 5A2QO 1T8EA 2M0GB 1S9EA 1G99A 2V2KA 1H74A 1TMJA 4P71A 2N7YA 2ACYA 3DDNA 1I1GA 2DGQA 3W63A 1CJTB 3D3BJ 4L76A 3MMJA 1ZOTA 2KT5A 5LOQA 4KHQA 4CH1A 4NZ0A 1TKTB 3CCLS 1X8DA 3U3GA 3KLHA 2E6MA 2P9CA 1B99A 4OMFG 1TL3B 2RF2B 3DOKA 2O1PA 3I8BA 4CLUA 2DRDA 2BR0A 1BI4B 4J9RA 1VOMA 3R5DA 2OEJA 4N8OA 4BRDA 3FCVA 2OPSA 2G8WA 1ZS6A 3MM8B 4JYAJ 2P9IA 2HRYA 2ROPA 3HD2A 3GCWP 2AJQA 3SSRA 3KJFB 1JLQB 5DK5A 1ESVA 1VQNS 3JAMO 4KV8B 3VQ8A 4H4KA 4ED7A 4ELTA 2NCKL 1J5OB 3CC4S 4HVZA 3GTYX 3P6YC 4DTJA 2P2CB 2L9WA 2HBKA 3VV2B 1ICEB 3TEHB 2R42A 3L3VA 1BMQB 3KG4A 4JKAA 2ZJQL 3M2VB 2VOOA 1XMQF 1B3TA 4F9OA 4A5AA 3DXKA 4CJKA 1ZYQA 4H0XB 5AQJA 2Z2MA 3UFCX 1E4GT 3HOTA 2BUNA 3GB0A 4FPAA 2G0CA 4OI6A 4E7JA 2WOMA 3MXMA 3MEGA 3RU0A 3CCVN 3OBIA 1J5EJ 2R2TA 4NLPA 4QPTA 3R8YA 1SJ3P 5AR0A 3VQBA 4EHUA 4CO3A 3K58A 1WLJA 2KZZA 1HHTP 3HPOA 1MWMA 4JKFA 5J1EB 3B54A 4QYZK 4BRGA 3A5OC 4F3MA 2HIYA 4NZ7A 3MUTP 1WWHA 2XQCA 4K4VA 4LF8F 2CXEA 2XI2A 3E9OA 2IIRA 1QM9A 5E84A 2XMKA 2FF6A 2IPOB 3GV5B 3AB2B 1NK8A 4EHTA 4KFBB 4B9TA 2CJKA 3C6UB 2ETJA 2KHDA 4A8QA 5I3QA 3CC7S 1IG8A 3HT0A 2DY1A 2DHSA 3W9JA 3A13A 1VSFA 2ZHAA 4B9NA 1REGX 4FO0A 4IG0B 4JD2A 2ZH3A 1S10A 5C2FA 3QT7A 5HANA 2OLWA 5HJYA 2PMZD 2XMVA 2F3JA 3TZYA 2KT2A 3FGVA 3ZZUA 1B7YB 3S3MA 2E29A 3WXIA 4DFJA 3NOCA 2V2QA 3I96A 2ZHOA 2F4FA 4GO5X 5EXWA 2BRLA 3E2EA 1XMQK 1HNWK 1V5VA 1MDUB 3D0IE 1ZBUA 2C3YA 3R5GA 4TLRA 3UE2A 4ZPWR 3ET6B 1NH8A 1ZAXA 1FDBA 2V0NA 4W90B 1YJVA 4LFAF 5A6WA 3GQCA 1PCAA 3K17A 2KHCA 4ISEA 2ZGZA 3V9WA 1NG9A 4DFMA 3M9MB 3OVNA 4OHVA 2YKPA 2BQUA 3O3HA 4OHXA 3AOBA 2I8EA 3KJNB 1FERA 2CZ4A 2NUHA 1EP4B 4CHQA 3SV4A 2JWKA 3OYDA 1IUJA 2DGVA 3V4MA 1PBAA 3R2DJ 1JMTA 2COLA 2NS1B 4CQ1A 1VSMA 5EX0A 2KHOA 4BRIA 5LMUF 4PG7A 4CZHA 3CD5A 4ALZA 2UUBJ 2RSQA 1U0HA 4KGMA 1WSEA 2B4JA 2C2RA 2R7VA 4LSLB 1QQOA 2KM8B 3UR3C 2GAHC 4CESA 2FVCA 2IBOA 1YUWA 4IFYA 4H03B 4WF9Q 1F5AA 1M5VC 5I3UB 2QEXN 4FS2A 4B3OA 4Q2MA 2CNKB 3LDQA 3HDSA 3TZWA 2YCHA 4TKTA 3J7Z5 2GX8A 4CERA 1D4XA 4WFNL 4BE0A 2HQFA 5KPTA 4BRHA 2BBEA 2PT0A 2R8KA 4X4VA 3AFGA 3H3OB 3HLUA 4JNEA 4ECSA 1M1HA 3MEDB 1DQ8A 1M1KT 4KHNA 4CLTA 3FUYA 1S5JA 4A8MP 2KI2A 3SQ1A 3ILJA 4RUAA 3I4HX 3IS9B 1I39A 3LP1A 4NMLA 4LSNA 4FJGA 3ID8A 1CEZA 4MFBA 4IBNA 1ROFA 2VFTA 4QIWD 3HHDA 3M2RB 1WBDA 4Y2MA 3MMCB 1GT8A 3KIOA 2QWNA 5A0YB 4LFAK 5C42A 4C8ZA 3D2FB 5LJWA 1FD8A 1UA0A 3UDEA 2R7WA 3ZTQA 1XHXA 4KH4A 1SC6A 2UVRA 1TV6A 2IC3B 4MKAA 2ASPA 3OSNA 4YUDA 3VQPA 4BRMA 1RWMB 4DR5J 4KB1A 3M2UA 2QFIA 4DUZJ 3FQLA 4CK1A 2CGLA 3P1GA 3DXBA 1NGBA 4W5QA 2MGZB 3W5ZA 5GMDA 4F4YA 2JH3A 2RVJA 3FBCA 4OQJA 5LMUK 5CE3A 1LXJA 2Y8WA 4WIQA 3POTA 3R1LA 4FP9A 5IT9U 5LXRA 4A62A 4QIFA 2GIRA 1S6UA 3HJVA 1RLDA 2EHGA 2IMOA 2R7YA 3PX6A 3G6ES 3RJMB 3VWSA 1YAGA 5C0YA 1XNRF 4M7XA 2BKOA 4QS9A 2HBRB 3DOMB 2HGMA 4LT6A 4KB7A 3KLGB 4LQ3A 5D4NA 2B5JA 2BGGA 5DO2A 3IR6B 4LF4J 1FJGF 4FOEA 4RG8A 3T19A 3VOVA 5B8HA 4ZLJA 3A8EA 3GIIA 2AYGA 1H0HB 4M5DB 2ZITA 2RDIA 2PMWA 1S6QA 5KG4A 2Y0SD 1IBLF 4CF2A 4NA1A 4YR3A 2B4OA 2DNYA 3W62A 2PE8A 1G15A 2XEXA 4Y3CA 4OJ1A 4I7FA 1AB8A 3N79A 4FDFA 3CJQA 4JS4A 4HCBA 4DB3A 4AH9A 2W25A 1NBEB 5L38A 3JS9A 2XGQA 3IBFB 1XMOF 1SQEA 2N4CA 2AU0A 4LF9J 4I64A 1ZPVA 4DTSA 1U6ZA 2YWWA 4DQPA 4JKBA 2QE5A 4CEDA 5F41A 4CLPA 1KQGB 3HM8A 1R89A 4LBIA 4PCQA 1IBCB 4LIRA 3UCUP 2PYLA 3KK1B 1RWXB 4EFAC 2FHKA 4CO2A 4F8RA 5J2PB 5DDOC 1S77D 3MM6B 4ICLA 4OYPA 3CJ3A 4CWBA 1JLEB 2M2BA 5GAGI 3THYB 3U1LA 6AT1B 1F21A 4Z7CA 5A76A 4LD0A 4IOCQ 4FK2A 4B1ZA 3HKZD 4DV4K 1GLEG 4HHTA 5K9FA 2E44A 2HWHA 3LP3A 1NGCA 3CFOA 3AD9C 3F9KA 2DH7A 2GCFA 3FNNA 2V2VA 3B6PA 4FWRA 1HNVA 2G8UA 2UUWA 5IC6B 1QTMA 2ROEA 3DLEB 4RW9A 1XNRK 4DR1J 5AQPA 3MUMP 1BCOA 4FK0A 1KBRA 1GOBA 1TKXA 3HT3A 1MW7A 4FNHA 3ZTSA 1YHQN 2DKOB 3D2EB 1FJGK 1JQGA 5GAEI 1KQKA 1IKVB 2YQ0A 3MWTA 5DZ6A 4H5NA 3MM9B 1XR5A 1FEHA 4FYWB 3FGUA 1KQSR 3O9QA 1FTCA 3FMBA 4P2MA 4ER8A 3HK2A 2YHYA 2EK6A 1KVJA 1IBLK 1FCAA 1N6QA 3BN4A 4C0OC 1WI6A 4WP8A 2HQIA 1JLFA 4B3RF 4I2QA 1KNZA 1RBOB 3HO1A 3F2KA 1U0SA 4X65K 1K8KB 1VSDA 3TVKA 1IJFB 1TL7A 4XPEA 5AQZA 3G71N 1SV5A 1HPZA 4DG1A 5AQHA 1XMOK 1ULRA 3H5UA 3CIZA 2UXBF 1DFDA 3AVAA 3W5YA 4ED1A 3UW1A 4Q2LA 5IT9Y 3WXJA 1CJTA 1NK9A 2FJWA 2UXCJ 4LR9A 3FEYB 1KAZA 3BREA 2CPJA 1RDDA 3ADAC 1YKWA 1SXLA 3L7UA 1TL3A 2RF2A 3W9HA 4IRKA 3VTIA 3FE1A 3UD5A 3NS7B 2K7JA 3TJAA 1ZZNA 1SBRA 2Z2LA 3V1OA 1Q9XA 4TSXA 3OYAA 1K73O 4G1IA 4DV7F 1NHKL 2QA2A 3OHRA 1WDTA 3VQAA 2NPIA 2MJUA 1QVGR 1G6BA 5KFWA 3VAJA 1ZAVA 3O1LA 3O3GA 2FC9A 1WJ9A 1OH6A 4JI6F 4KPCA 4EFHA 1B4SA 2J4RA 3VALA 5HN0A 4LBPA 4CFBA 1JLQA 2W4DA 2G8FA 3O80A 1O8BA 3UR0A 3K9KA 1HD1A 4J2DA 4YR2A 1UKUA 3R5BA 3V1QA 4JP8A 3P49B 3VGMA 4CF0A 2PYJA 1YRTA 2KLAA 3L4QA 3M2VA 2XMUA 3MFIA 5AQLA 1N52B 3PTWA 4OO1J 1HW8A 4B17A 5EVZA 4FVUA 3OTBA 2XMJA 1PSDA 4B3RK 4NLTA 4EEYA 3MXHP 1Q86O 1WC3A 4M3XA 2B3TB 3OL7A 3VQCA 1HQUB 2XB2D 2XO6A 4DU1A 3TABA 1T44A 4WYLA 2BA9A 1D1UA 4DV2F 3TR8A 1D5AA 2CIMA 3ZC4A 2IY5B 3QIPB 4OZJA 3PW4A 4JI3F 3UN5A 4O0NA 4BR7A 2UXBK 1G2EA 2DEIA 5F8JA 1RYSA 1LWXA 5EN1A 4FKYA 5HVFA 1SKUB 2FC8A 4MMOA 4RW7A 4W98A 1N54B 3PIPQ 3QEPA 1CQMA 4A47A 5J1EA 2KVQE 4TU7A 2D9PA 4BLGA 2D7SA 4GV6A 2CPEA 1DQAA 2XMTA 5C24B 5C15A 4Y2KA 4YORA 3ILOA 4M5HA 2M4MA 3DU6A 3DRPB 2KN4A 4TY8B 2ZH5A 3AVIA 4B1XB 1OQ6A 4FCYA 4OLBA 3MAAB 3WQPA 4LF5J 1RDUA 3K5MA 4DEZA 4CP5A 5BYQA 4IJAA 2DVIA 2DY4A 4CJ5A 3C6UA 1PBUA 5KPZA 5FDLB 1MWQA 3TTDA 4CTAA 1AZSB 3ITHB 2BE2B 1Y10A 4J91A 4YDXA 2I5JA 4IG0A 2DGTA 3PV8A 3NGSA 2UUAF 4HT7A 4JV5J 4JI6K 2FJVA 4ZVOB 4NXNF 2LEPA 3UIQA 2P9LA 1J27A 3L0QA 2QO3A 3BH7B 1YTAA 3HSJA 2NRXA 3KJQB 2GVDA 4ZVGA 2HBQB 2MZSA 3H08A 3KJVA 4NCGB 3WIUA 3LZJA 3FRYA 2HHHF 2HKEA 1H73A 3IGVA 3I55N 3M8SA 2LSNA 1K9MT 1A5XA 4JKGB 5AXLA 2P5GA 3CUNA 2WUSA 2W7AA 2IVNA 3VQ7A 3L8BA 3OR2B 1ZM2A 1LK5A 3ET6A 3MR5A 1TL1B 3QBCA 1M5HA 4DMNA 2E5HA 3E9LA 3BZKA 4JI2J 1YVFA 2ITGA 2VWJA 1IH7A 1VQ6N 4XDDA 4DV2K 3US5A 2HHQA 3RMDA 3Q7CA 5AQWA 4YFUA 4JI3K 1M5KC 2BVZA 3BB5A 3ZXWA 4IEEA 3RAQA 2DNGA 1Q7LB 1D09B 4TY9A 3L3UA 5KT6A 1XWLA 2IA0A 3H25A 1A6LA 1WSRA 4G9ZA 3HM9A 3NVKA 4ZPTR 2VUGA 3QT5A 3V6KA 5D0GA 3MXIA 4E7LA 3SAGA 4GKJF 2OA8A 1NDLA 4LSLA 2LQ5A 3ZT4A 3DLLL 2A1BA 2DH9A 2V50A 2LXFA 4ZCLA 3I9V9 4B1YB 4NLGA 4AL6A 2D1KA 2HQCA 1YITN 3U6FA 2GTDA 5I3UA 1RI7A 2XCAA 2BJ1A 3BEGB 5AJ3J 1XI1A 1JJCB 2IJRA 4X4UA 2UUAK 4OYBA 4NXNK 2FQQB 1RE1B 4PY5A 4Q8FA 1RABB 3MEDA 5E26A 4DL7A 4ZJLA 4JS5A 3HFKA 5H1SV 4AXJA 3ZNJ1 3AVFA 4EZ6A 1NNEA 2EG1A 3TOQA 2AX0A 2Q66A 4KHRA 4ZMMA 2HHHK 4K2JA 4B9UA 3LUYA 2ZJRQ 3HRGA 2YWEA 5DGAA 2VOPA 2IVOA 1RFQA 3THTA 3D0GE 5LSRA 3SUPA 4F67A 3UNGC 4DV6J 1RT4B 2YKNB 3MMCA 4I6MA 1N5YB 1RQ0A 1KLNA 5A0YA 4CBUA 4HKQA 2VBWA 2GAGC 3A3OB 3JQMA 1S9GB 3WQUA 3CEDA 4BROA 3NGUA 1LWEB 3D2FA 3NS5A 1HWKA 3EE3A 1XBWA 1R7IA 3RB4A 3CJ5A 4ED8A 4A59A 2IC3A 1VQYA 1SL1A 3P8BB 2IS3A 4FJJA 5E41A 5D78A 3BKFA 1HX1A 4EBDA 5DDQC 3G8SA 3CJCA 5L9XA 1UW4A 3D0HE 2YX6A 2MGZA 2XY7A 5DQGA 3GIKA 3H3NO 1V4SA 4FJXA 3SMPA 2AZ1A 2ZZMA 5IM0A 3H2VE 4ELVA 5F8MA 1VK0A 3FKBA 3CMEN 3P3DA 4OZ0A 5L8RC 1P1TA 2CQIA 3MURP 2MLYA 4P10A 2VICA 3DOMA 1CXQA 2WSCC 3J7AP 3KLGA 2PZSA 2WW4A