4RWYH

Crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 8anc131 in complex with hiv-1 clade b yu2 gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
QGQLVQSGGGLKKPGTSVTISCLASEYTFNEFVIHWIRQAPGQGPLWLGLIKRSGRLMTAYNFQDRLSLRRDRSTGTVFMELRGLRPDDTAVYYCARDGLGEVAPDYRYGIDVWGQGSTVIVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords HIV-1 YU2 gp120
total genus 41
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2014-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rwyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rwyH01
1OT2A 3AM8C 1A1OB 3NFNA 4WI9A 2V2TA 4ZAKA 4TVSa 1BAFH 5C0GA 3TBWB 5HI3C 1F3DH 2XN9A 3BIKB 1F11A 1JPST 5C0AE 5AUMB 3TT3H 2EH7H 2GK0B 4WNQB 4ZXBB 3MNVA 4NFDA 1EAPB 4OLWH 4Y16D 3A6CH 5DURD 5BOZG 1NH6A 2I5YH 4PLKD 4Y4KB 4FNLH 5CIPB 4AMKH 1RJCA 4P3CL 2DLIA 5D93C 3MCKB 5KVFH 2RHEA 4X8XA 3SQOL 5CGMA 5FGCE 1LE9B 1MRFL 4JZJC 1A7RL 1SMOA 4DKFH 3QPQC 1YY8A 5DEZA 1EX0A 1H3PL 2H45A 5D2NB 4HEPG 1NBYB 2D03H 3NMEA 1HDMA 1ED3A 4KXZI 1J0JA 4OZHE 1CR9H 4HIHB 3SOBH 5DK3A 1KJ2L 4TVPE 3RIAF 4P2RE 5EFIB 2C3HA 4R96B 3TFKC 5C92A 3NCYP 5D1QD 5ESQA 2VH5L 1N59B 4KRPB 3T4YB 2AEQH 1DUZA 1GGTA 4IMLB 1M71A 2EEBA 3VFSB 3FFCE 2D31A 3FAXA 1E4XH 3QDAA 5E9DA 4U0QB 3HC4H 4JR9H 1GZPA 4FFZH 4S1RH 5EN2B 5CJ8A 5CWSA 4RFOL 3B5TA 3D85D 1I7RA 4HUMB 3KNBA 4XCNB 3N85L 3TBSB 3MRJA 4NKOA 3O6FA 4DFHA 5I16B 5DI8B 3BP6A 5CMAA 1D5IH 1KT2B 3IDIB 3KPNB 3EJZD 3FJTA 4JFPA 4KPHH 2D31B 5BV7C 2YRZA 3OPZH 1BIIB 5DK2B 4YBHA 1F4WH 4PJHA 3ILPA 3FOLB 2VABA 3S36X 1B4JH 3MRLA 3T0WA 4R8WL 2EDEA 3H3PL 1JZ5A 5DD0H 4PJ8D 2HWZH 1NMCC 2IAMD 3CLEH 1P4IL 3EAKA 4PBWD 4CU8A 1VADB 3T0XA 1TLKA 1SBBA 2NY3D 3N1GC 1TENA 5IVZB 1EO8H 1WBZB 4AIZB 4DKEL 1HKLH 4IMLA 4M7LT 2XI9A 3MTRA 1MPAH 1XF5A 3ULUF 4XMPH 3WO3B 5C7XH 4J7RA 1AQDA 2MCPL 3RVXD 2I07B 1HQ4A 4BYHA 5ISZD 1MHHA 4EUPH 5DRNA 4Y2DC 2XRAL 4HLZG 1JWUA 2ZCKL 2O61A 4QXUH 2XN9B 3ARRA 2CUMA 3S35H 4M6OL 3DMMD 3CXHJ 1T5XA 4EDXA 3PWVB 1CZ8L 4MQXC 4YUEH 4GLRH 5IM7A 1BD2D 4APQB 4N0YL 3WNKA 3PGCA 5F70A 3WFCL 1EPFA 5IKCA 1CT8B 1AY1H 1DN2A 5KW9H 4OZGE 3ZYIA 2CLZA 3BPCB 2OK0L 2X5PA 1SJHB 3A67H 3Q2CA 2ATPA 1AGEA 4ALAH 2YBRA 3LRGA 1JVKA 3L3HB 3NCCB 5E00A 1UKTA 1QRND 4AT6A 1R0AL 1YMMA 2XZQH 1RJZB 1LO2H 1KOAA 1TCMA 1JRHL 1NMAL 1MCOH 5FOBA 3KPRB 4WI6A 2FR4B 5F96L 2BHZA 1TTFA 2R29H 1SEBB 1IGYB 3TT3L 4WY7L 2V5YA 4OF8A 5GS0C 2GFBA 5E8OA 3FB7B 4KVNL 3CZJA 3MQIA 4KJWC 1LP9F 2H32H 4G42A 3I2CL 5JW4R 3TF7C 4LPWA 4Q6IC 5ICZA 3ARWA 4X5XB 3UJJL 1WT5A 4ODTL 5JHLH 2VDKH 4GXUM 1IJ9A 1FL6B 4D3CL 3K2UL 3BYYA 3MACH 3R06A 3QUMH 3R8QA 3Q3GB 4KUCF 4UUJA 3QHFL 1MHEA 3BKYH 4OQTH 2PXYC 2PW1A 4K23H 2F5BH 2OJEA 3QWQB 4DKEH 2PXYD 4TVPD 1C5CH 4JRYD 3RVVD 5J1AA 4WFHE 5DJCA 1KTKE 4O02H 3QO1A 1V05A 4M48H 5D1XC 1MY5A 1ZMYA 4KKCD 3TWCH 5MEOB 2HG5A 2CQVA 4MQSB 1EJ6A 3CX5K 1Z9OA 5F7EH 1RIHL 3HMXH 5FYJL 5HDQH 2ICWB 4S11A 1X5AA 2BOBA 3KYKL 3O41B 4LIQE 4YHKL 4ONGL 3CUPA 4DUVA 1WSST 1EEYA 4OI9A 2H26A 3QIBB 5C0CE 1MCJA 1CFBA 4M93B 3O3UN 2NTFA 4GFTB 1ZOXA 2OTUA 4HZLA 5I66A 4RDQF 1UA6L 4E0RB 3U7WH 3KYNA 2WBJD 4TULL 4B5EA 2AKRB 4I9WE 1D9KA 3BEVA 4S0TD 4XH2B 2CUHA 3C87A 4UTBH 3BQUC 5EZIL 5TDOB 4AM0B 4P23D 3FFCD 3ZSSA 1BECA 3BPCA 1I9RL 2CLZB 3IDYB 4Q97A 3L7FB 3S5LA 4KRMB 5F89B 5BVJA 3VWKA 4OT1L 3RL2A 4PJHF 2EE6A 3IFOA 1NC4B 5JPMB 15C8H 4HUWB 4YFLF 1NBZB 1KJ2B 1WWCA 1ES0A 3QPQD 3L3IB 4DUWA 1OGTB 5DMIL 3N1QC 2E9WA 1S9XB 5IVXF 4GKNB 2O61B 1R24B 4JN1H 4QTIL 1RZJC 3VGAB 3GMPA 4PJIE 4ORGA 3HG1E 1NFDB 4X4ZA 4X9IA 5IJKA 3DHMA 1CBVL 1R3HA 1RZKL 4K3DH 4HIJA 1NGWB 4X98B 1OARH 3BP4B 3WFCH 2NLJA 3U0TB 3HNVH 4K7FB 1GH7A 5AAMA 5IF0A 1MCCA 4ZFGH 5GRJH 5C0JA 4FABL 1A64A 4U2ZA 1BGXH 1X5FA 4OQTL 3A6BL 5D5MA 2XFXB 1EHLL 1T0MA 5C07B 2HTKD 5EUOA 4UNTA 1YNLL 3C2SA 2GKIA 4MSWA 3BPNB 5E5UB 2GTWB 3IXTB 3K2MC 4KQ3L 3H8NA 3JBG7 1G9ML 2CKBB 2JELH 1VKXA 1S9VB 3MRGA 1D5XB 1H15A 5CJOH 5LQBH 1OB1B 3O3AB 2P5WE 1CXIA 4DGVL 3IDIA 3FAWA 4I18A 2AEIT 2P5ED 1ERNA 2YZ1A 4G6JH 1QSEA 1Q9KB 3D39D 4QGTA 3FTGB 4ZXBC 5LCVL 5MEQA 3OR6A 4PGDA 2J8OA 4M9PA 4XCEB 1F5WA 5DJXA 3WIFA 4XBPA 3MJGX 2SEBA 2R0WL 1OCWL 1JV5B 1IGCH 1U3HC 3QFDB 3TN0D 1UKQA 2XXMB 4DZBA 1RY7B 4OBSA 2J8UF 4R7NA 1XF3B 3MRCA 5C70A 1K2DA 3B9VA 1UCBH 2Y72A 4X4ME 3WO4B 3QNYA 1CXFA 4ZUSB 1N3NA 1UH2A 3JTTB 2OL3H 2R2EA 4YO0A 6FABH 4BQBA 4GQPH 2VDQL 3I75B 4M4RA 4WUUB 4ZUWA 1DQMH 1FG9C 3MJ7A 1J1XH 5IEKA 4EN3A 4P23B 4O2CA 5IHBA 2ICWA 1G1CA 4YEEA 2Q7YB 4F15B 1G7LB 3RPKA 1K2DB 3SKMA 3A67L 1H3PH 3T2PA 3TWCL 5LGHH 1CD8A 1EFXB 4ZYKA 4N5EC 3HC3L 3QSKB 1QSFD 5FDYA 2R0ZH 5MEPA 1MVUB 3NCFB 2G5RA 3V4VL 4OGAD 4U6VH 4XVSL 2EE3A 3P40A 5I8KH 4M1DL 4NNYA 1KELH 5J6HA 1KIRB 1L7IL 2BCKA 1O0VA 4JGMA 5E99H 3T4AA 2AK4D 1WISA 1S8DB 3V6OA 5D7LE 2MJWA 2AJVH 3U4AA 3R06B 5DT1L 1OAZH 3IJSB 3U1SL 2ADFH 4WCYL 4EZMA 4TSBL 4OCXL 4YE4H 1WUNT 1FN4B 2MKLC 2YD4A 5BS0B 1G7MA 3W0WE 2OJEB 5EOTA 2FGWH 3EOAA 1W72H 4U4BA 1B4JL 2QKIB 1V3JA 2NXYD 4FQLL 1UM6L 2BX5A 4JPIA 1QSFE 1OW0C 2A6JB 3HR5B 5GGTA 4JFZL 1NFDF 1NFDA 5GQBA 3VDAA 2GJZB 3OGCB 2R69H 3D0LB 4OCYL 1EO5A 5HDLA 4G5ZL 3VXUB 2BCKB 3OJMB 4Y4FC 2YD9A 1XF2B 5HHOD 4K71B 3Q5OA 4PGCA 4ZFZB 1FZJA 1OPGL 4LBEA 3UEZA 1SEBA 4E0RA 4OLUH 2FEEI 3UYOD 3ZHLA 4HFUL 2AI0H 1N6VA 4G9FE 1ZT4B 3EBAA 4GUPA 2GSIB 1GXEA 1YMMB 1SQ2N 4PG2A 3QUZC 5E7FA 3I9GL 4YFLI 5L2KA 2EZ0C 5AG9A 1HINL 3DXAB 2W9DL 1KLGB 4HH9A 2AV1B 2MKWA 4XBEL 5E8PB 5KZCD 1DBML 3H0TA 4YO0B 4HIIB 3BMWA 5CILL 1J1PH 4QY8B 4DN3H 3TC9A 4P49A 4I18C 3UTSB 5CD3B 5DGQA 5E1HB 2HJKA 4KK5C 5DC0A 4WW2C 4Y4HB 4OB5H 4R26H 3TO2B 4KK9C 2WZPD 1V7ML 1IKFL 5E8PA 2DS4A 5LWYH 2XZQL 4FQHB 2XQBH 4OQTA 4WRLA 3SGEH 5EBWB 2XQYG 3ECBB 5CEZH 3DWTA 2J7LA 1A47A 1TIUA 1ZHBB 2NY7L 3T65B 4EN3C 3LKPA 1FDLL 2AK4B 3S36H 3DRTB 3QNXB 1NUNB 3IT8D 2YPLD 3FCTA 1C08A 3P9MB 3LPGA 1GGIL 4N9GB 2C3VA 4MCZA 3QI9B 4RGMB 1OAUH 3WEXB 3MOAH 4AENA 3L3JA 3KAAA 4DWHA 1YN7A 2BSSA 5HHVL 3W11C 4POYA 4FFZL 3QEUA 5J56B 4XHJC 3RDTD 2P7TA 1SJVA 3D3VE 2DQCL 5MI0C 3GSUB 4N5UA 1BGXL 3KLDA 4D0BB 2LTQC 3BUTA 1I1AA 2NYYD 3SKOA 2R39A 4QLRA 3DX9B 4LK4A 3O4LA 2FL5B 4LCCC 2YD8A 3E1F1 3I6KB 1TVHA 1QRNE 2YD1A 4G6FB 2AV7A 1KG0B 4WI3A 3FHAA 3LS4H 2XKNB 3ETBF 3HB3C 3LMJH 4NJ9L 1YNTB 3OKLB 4JFFD 4PP1C 5EU5B 1A6ZA 2DQUH 4U6XB 4Y5VC 4I3SH 3PNWB 4HWUA 1VB9A 3OHXA 3L3IA 5HHOB 2X2YA 3DVGA 5HDQL 4JANB 4KROC 3BKCL 5B22A 3L1OH 1I3UA 1D5ZA 5I9QC 3QEGH 1MPAL 1F90L 1KB5B 4WFEE 3MRNA 1BQHG 2BRRL 3TBVA 3GHEH 2ADIB 2I26N 2IQ9L 1ITCA 2H3NA 1R3IL 3JV6B 4Y4KC 3ARDC 4WNQA 4OJFH 1YEGL 5FYLH 1EHXA 2BSTA 4JPKL 2APXA 1CFSB 1FFRA 1I8LA 3LEVL 1RUPH 4NQXB 4U1GB 3MRRB 4WDIA 3RWDA 1LE9A 3RZCD 3T0EB 1MHCB 4AL8L 1S7TB 3MV8B 3V9FA 1IKFH 2DQTH 4C83B 4JY6B 2DQIL 5I6XC 4PLNC 1FFQA 2XZAL 3SQBA 2A0LD 2VLJD 4BUGA 5JHDA 1EMTL 1XF1A 4AM0A 3O2DA 3MO1A 1Z3GL 3G6JF 3NN8B 4PJDB 1BVLA 1M05B 1IAIH 1OHQA 3N1PC 3I84A 4DKAA 1AI1L 1V3KA 4EIZC 5T3XD 4AIZA 4U05A 2ADGB 4BH8A 3QULB 5J06A 1MCOL 3BZEB 3QWRA 4M7LL 4CU6A 5EBGA 2E7CA 2VXQL 3GSNL 1DBMH 2VWEE 4A6YL 1S9KC 1EJOL 3FQXA 4DK6A 3BT2H 3EFFA 5JW4M 2VLRE 3CAFA 4IOIA 3OKKA 4GRWE 2LU3A 2X9YA 5DTFA 1Q72L 1M71B 1EEZA 2BP3A 4EUPA 1TJIH 2PYED 2O93L 1GAFH 1W72L 1QPXA 4PREA 2VDKL 3U83A 2IWGA 1FZOA 1Q9LB 2YD2A 3KPMB 3MYZA 4NT6A 5D72H 5CJ5A 3WYRA 1H0DA 5FM4A 3QUML 4AH2A 4GW1A 4QOKB 2BVOB 4OUUA 1J10A 5HYQB 1T0MB 1I85C 3QHFH 1JTPA 3ZE1E 5HI5D 5BO1L 4JQVC 4NP4L 3FB7A 3NCJL 5JXAL 2EDJA 3QG7L 3KYMA 4UI2A 4NSKB 3LS5H 5D2LB 1I7ZB 1YEEL 1RUAH 5GGRA 4MCZB 5DRXA 2EDBA 4GT7A 1ED3B 2YHGA 4LSPH 2PUQT 2IALA 1MLBA 1KLGA 2OP4L 4M02A 4KUZH 4JB9L 4YHKH 3WFDL 3SDXB 5C0GB 1RUML 3TIDA 3TNNB 4Q9QH 3MXWH 4R4ND 4EDWL 4MA7H 3U7YH 5HYSG 3B9KB 1LO5A 1J8HE 3PUCA 4PJFE 3VFWA 3LD8B 4WFFD 2CLVA 4PIRF 2HJKB 5I30H 4NFBA 2E9IA 3DETC 3CK0L 4LIQH 1EAPA 4W68A 4PJGF 4KJYA 2AK1H 4FMFA 4IOFC 2MWCA 1FFNB 1ZHNA 4YC2C 1D5IL 3MREA 5D7IB 4ZDHA 2CDGA 1T2QH 4M5YH 2CRYA 1M7XA 5DSCB 5GS2D 2DMKA 1YEJH 3WXVL 1MCFA 2P5EA 3HE7D 4PTUB 5T3XL 3X14B 3MV7A 4ONFL 3EFDL 4F58H 2LAGB 3GI9L 4JDTH 4Y2DB 4N0UA 4NCDA 5ACMA 3O4OC 3KPSD 4X6EB 5I8CA 5TDPB 4G9FB 4LBEB 2B20A 3TIDB 5FB8A 5IESL 4H0GA 1MRCH 2E6JA 3QG6B 4LKCA 3CMOH 4Z7UA 4HWEL 1NGYB 1BX2A 3ARXA 4GW1B 5CP7A 3LRHA 3DV4A 4MJ6A 5LXGL 3KPLA 4UV4L 3O3EA 1SM3H 4JFDA 3VXMB 3QXUA 4DQOH 4GW5A 2K9UA 4GAGL 5J89A 3LEYL 4RFEB 2PW1B 4FABH 3T8XA 1IC5L 4G3YH 3STLA 4HXBH 1QRKA 5CSGA 5EIIB 1GGBL 5DMJB 3RNQA 4M00A 4J6RL 2CPCA 3VRIA 2COQA 3QUZD 1H5BC 5EU5A 4U6TA 5IMKB 1B6UA 5DRWB 5I1JL 1S7RA 5ALBL 3HAEH 2E7LA 2ED8A 2D4FA 4M4PA 5F7UA 3I3EA 4L3EA 4ISVB 1LP9E 1VACB 2OZ4L 2ZKHH 3DX8B 5F7FA 4Z7WE 3GMRA 2J12B 1MUJB 3D5OF 3MSPA 4KI5D 2WMPA 1YNKH 5TFSL 2YA0A 4RGNB 5ITBH 1SY6H 3BFOA 3O2VL 1A7PH 1UXWB 3C2AH 4M1DH 1I1YB 3H42L 1H3UA 3FMGH 3P4MA 5F7LB 4JRXE 1X5KA 1HINH 3B9KD 1DUZB 4HCRL 4YHNA 4PJFB 4XNYL 1AR1C 4K2UL 3IJHA 35C8H 3G5YA 4P4KC 4UNVA 1C08B 3BD4A 1KCUH 1U8JB 3GGWB 4V1DD 1INDL 3BKJH 2BNRB 4OFKA 3BE1L 3MRIB 1ORSB 3C6LD 3E2HB 1Q9KA 3T0DA 3OJVC 4GBXC 1WC7A 4F9LA 1ODAA 1HHKB 2IAMA 5D7KD 2CDFB 3STZA 3SDXF 1T2JA 4U1MA 4EDXB 2VDRH 4PRAA 3MRGB 1E4WH 3TBTB 3PWJA 4W4NA 4Y2DD 4N0UE 4JY5H 5DR5L 2XWJB 4OFPA 5HHXH 2X4RA 2I9TB 4HS8H 1MCDA 5JQ6H 2AJZB 1JGUL 5E4EB 4H8WC 4XVSH 4GAFB 4M93C 3M8OL 2R1XA 3FTGA 3L5WA 3MOAL 4OCWH 4L1DA 3Q6FB 1KJMA 1MF2L 4AIXA 4YHOH 5EBLB 3SGKA 4LSDA 4K7FA 1CD1A 4LLMB 3DETD 3QFJD 5GRZA 4NCC1 4Y4FA 4M7KH 3HHRB 4QRRB 1N7ML 4S2SB 4HK3N 2XY2A 2MHAB 1TJIL 3FRPG 1FZJB 3D69A 4Y16B 5FXCH 2DQFA 4JJHA 5DURB 3I6LE 3WL9A 1A21A 3O45A 3CXHK 4NWTH 2YWYA 4K8RH 3GUTA 4JDVA 1P6FA 4S1SH 3W81A 2XT1B 1NBZA 4P46C 3MROA 2NPLX 4LPXA 3IDGA 3M45A 1UGNA 4MD0A 4H8WL 5EOCH 4MAYA 4NPYA 2UWEF 1AHWC 5ITBL 5IEHB 2OLDA 4MVBC 2IANE 3KHQA 1WCBA 3SE8H 3ZTNL 2RB8A 4XP6H 3GUTB 5JA9A 3X12A 5A3ID 3L3HA 5M7QA 3TO4B 3TYFB 1GJIA 5SV4A 2OX5A 3W2DH 2X1WL 4QKXB 2XPGA 3KDMA 4ZUVA 5FECB 4YXLL 1T20B 3IAQA 4JPVH 1U0QA 2V2WB 1LVEA 3MV8E 2EDTA 5DMYA 2EIEA 5ABDE 2HT2D 4UT7H 1QBLL 5HDBE 4HIIA 3NCEB 4DK3A 1TNMA 5CGYD 3MGOA 3IF1B 4QRQA 5B4MD 1J8HA 4XVTL 4F7CA 3IDMA 4I8DA 3ZDZF 3P4NB 4GS7B 4Q58C 4P4KB 1K5NB 2K1MA 3CFEB 4NRZB 4XBEH 1AD0A 5BMFL 3HMXA 5DWUH 1RZ8B 3MODL 5ILTL 1FVEB 3K80A 5GGQL 3VXQA 4O4YL 2C26A 4LCYA 5A2IH 3K0WA 3BXNA 3ZHKA 3U82B 2ZJSH 5MHSD 5B8CA 4DVBA 4HT1H 1B6DA 4MYWB 2F54B 4WGVB 1FL5B 4LAJH 1I85A 3ARSA 4KV5F 2VXVL 1ZS8B 5IBTH 4X0KB 3JV5A 2IC2A 1NGXA 4M7LH 3MZTA 4G8EA 5E24E 5CSZA 1QNZH 3KWWA 4Q7DA 3QNYB 5TF1L 3QRFM 2W38A 4S10A 4S1DC 2BK8A 5FK9A 4GMSL 4P23C 2YWZA 4DFIA 1MHPL 2BNQE 2CXGA 5JUEL 5H8DA 3QQNA 3FQXB 5EOQH 4GRMA 1F4YH 2FX9L 4OGZA 1MCKA 1HHIA 1T66C 5F7DB 4WHCA 4XWGL 3ZKQD 3DO3A 1RHHA 3BHBA 5DFVC 3MLRL 5HHPA 1L9MA 2GAZA 1UB6B 3R0NA 2DQTL 1HNFA 4AT6B 3D6GA 3T08A 2XA8L 2HT4D 1UYWL 5DMGC 2IPKA 2VZTA 4XPBH 3ARGB 3LQZB 3EGSB 4DOHB 4D0CA 1CXEA 4R7DA 5KTEL 1DLFL 3IDNB 3KPOA 1U93A 2YSSA 4Y0GA 3GJFA 4PRIB 2R0ZL 2DKMA 3BKCH 3OF6A 4Q9RH 4H88H 4XNUL 1PGRB 1JZ2A 4S1QL 1H9VA 1CGXA 4KXZH 1F00I 4NM4L 5TE4L 1N5AA 1JZ8A 1QSFA 4PGEB 2H32B 3UZVB 4U1KA 1A1NA 5E99L 3KG5A 2IQ9H 4XNQA 3VGAC 1JNNH 4WO4D 3L5WB 2V7HB 3N85H 4DEPB 1RMFL 3JTSA 1KXTB 3SDDD 4ZDHB 1OLZA 2BERA 1YMME 3F6IA 5TDNA 1EA9C 1OGAD 4MNQD 3QUMB 3GSRA 4WWKC 4FZEH 4ODXB 5I1IL 2KKQA 3BEVB 4KY1L 1B0WA 4QHMA 4XNMB 2Z92B 5CJBA 2VMFA 2VLLA 1MLCB 2AJXH 3ABZA 4Y2DA 5E2UL 1G7HA 4TUJB 2IBZY 1P2CA 5TH2A 1BF2A 1I8IB 1L7TH 3SDDC 3MBXH 3E3QC 4C4KO 2N1KA 1JPGA 5F96H 5C9JB 4JO3H 5KVGL 4Y19E 4F57L 3SO3B 4JY4B 5F9OH 2ORBL 4KWUA 2FJHB 3DX9A 3ZDYE 1A0QH 3LIZL 3D9AL 4K94C 5C08E 1MAML 1DSFL 3KPNA 5FYKL 3P4MB 2XZZA 5SWZB 4CNIB 3OR6B 4PGDB 4MJ5A 5DFTA 2AABL 3TJEH 2OP4H 2H2SC 2VTFA 5BMFH 3U9PH 1PZ5A 3AU1B 3QUXC 4P2YA 1OVZA 4HIXL 3F7RA 5HPMB 3MLRH 3U0TA 4OUUB 4L29A 3L3JB 3THMH 4JFQB 3RAJL 1F97A 4MXWL 2AJUL 3PWLA 3N0PB 5DC9B 2GI7A 4U33A 1U8HA 2I27N 3K4AA 4I0PA 1UEMA 1DLHA 3HAEA 2OK0H 5I15L 1LO2L 3V52L 5J9PB 2G9HA 2R4RH 5LGKA 5EOCL 4M48L 3FO1B 1INEL 4JKMA 5D2LE 2XKSA 4FXLA 1T2QL 2VAAB 4AEIL 1B90A 1I1FB 3DMMA 3IB4A 2ZG2A 5TFSH 2YN5A 4KRPD 5CGTA 5I1AB 4S1QH 3CFKA 3CXDL 4HEME 4PRID 4QNPE 1W0YT 3PDOA 2ENSA 5BVJB 3OKNA 2ARJB 3FMGL 5HGHB 4JZJA 5DD1H 5FFLA 4XNXL 2IANA 1RMFH 3BAEL 3LB6D 4Z7UF 5T5FL 5JW5A 2XTJB 5TE6L 5FA3B 5DRZA 3O8XB 2CUIA 1BBJB 3K2UH 4MX7A 1UACH 1NAMH 5E56A 2BOCB 1UJTA 4X7CC 2JB6A 2PTTA 4HUUA 3UJJH 3DUUA 3HI5H 4D9RE 5TDPA 3W82A 3OAZK 4OKVB 1TZHB 1G6RL 4HZLB 2YUWA 2BFVH 3VFPA 4PJ8B 3WMSA 4QWWD 3WSQH 4GAGH 1AC0A 4LLYB 3SQOH 4QHMB 5DD5L 4HX1B 4OLVH 4OI8A 3QP3A 2BXZA 4L9LC 4WI8A 2VDRL 2YOCA 1AIFA 5E1AA 1OAYL 1Q9OB 5D96B 2D7MA 2W9EH 4UT6L 4MD4B 3EO1A 4X7SL 2ORBH 5CJXA 2P4AB 3JWOH 5FYJH 4HS8L 4ZUTA 1C1EL 4Z77A 4FQPA 3TBVB 3LIZH 1A0QL 1JRHH 1CLOL 1KN4L 5GHWL 4TYUA 2A6DB 3D39B 3UJTL 1XF5B 4TOYL 4P5MA 3FO0L 3QUKA 2ICWI 4NBZB 2DBLL 5FHAH 1ZLWH 4QRSB 3GB7A 4ZFOA 1CFQA 2DLGA 3MXVL 5F93C 3U9PL 4S1RL 2PTTB 3C60C 3VXRD 5KSBB 3PDDA 5JPNA 3IDNA 1HOCA 3GIZH 4PG2C 4F7MB 4HWEH 2Q20A 4W4OC 5AZEH 4MXVF 1Z5LB 1IAKA 3MCLL 4PLKC 5EIVA 1I75A 1UWEH 2HT3C 1ZWIB 4PP2A 3BIBX 5J12C 4HW6A 1CDUA 3CSBA 2BVQB 3LY6A 1T83A 3RWCB 5HD8C 4XP1H 2G75B 4HFWA 2B39A 5CMAB 1JPSH 1RD6A 3K8KA 4NNXB 2Z8SA 5IUSA 4ZOCA 3VWKD 3Q3GA 2HJLA 4OGXH 4ZO8A 4YDLB 1YNTA 4OT1H 2DLEA 1SJEA 2Y6SC 4OV5B 5BZWB 5IW6B 4KROD 5DJZB 3KPMA 2GK2A 1G9NC 2YUXA 3KPRD 1GC1H 2C1OB 3V5HB 2HFEB 3G04A 4YDKH 1PG7X 1Q0YH 4WHYG 1FZKA 1TJGH 2EEAA 1WZMA 4GRWF 3O4LB 4L29B 2WM0A 5ERWB 1CG9A 4LF3A 3OKKB 3LD8C 3HB3D 3GSNA 5I74B 2Q7NA 4P5TD 4JO2L 4XPHH 1DUYA 1XIWB 3GSOB 3RX5A 3BEWB 1XEDA 1QBLH 4G7YL 5EUKA 5DUPH 2KPNA 3SBWC 5HHMB 1VENA 1P1ZB 3BZ4A 1KPUB 5D1XB 3TPUB 1OL0A 3G6AB 3TO2A 3V6OC 4ODVL 2NY1B 4L5FL 3V7MA 4DVRH 3MRCB 4PG9B 1U3HA 4YDJA 5KS9E 5M95B 5CIPA 3O2DL 2JF1A 2WUCH 5C0CB 1XZ0B 3OTTA 1J0IA 1INDH 3BKJL 4FQ1L 1T7YA 5DVOA 2X4QB 3U2SB 5L7XH 1AD0B 1YEFH 5D2NA 2FWOA 2GCYA 2QQNH 5TQ0H 5I17B 1AQDB 4NC2B 2G2RB 1K8DA 5ADOL 1CGVA 1L7IH 5D96C 5EOCJ 2BDNH 1YC8A 2BNRE 3HS0A 3MV11 4JRWA 3N9GH 2YR3A 3UTSA 4CBPA 2C3WA 3FT3A 1YEHL 1OQOA 3VXRB 1IRAY 4YNYB 2R2BB 3EO0B 1CDYA 3RKPA 3ESVF 3VFTB 4J3XA 1A1NB 3VXUA 4WTZA 4X9GA 4D8PA 4NZJA 2BXYA 1ZT7B 3MV01 2H6PA 3OXSB 5I2IA 2M1KA 4HH8A 5J11C 3PGDB 1LK3L 5DC4B 1BVKB 5DJ0B 4LLQB 5BOPA 3GJFB 1OP3K 5IB4A 3UTTB 2JE8A 3KLHD 1JPTH 3MROB 1A6ZB 5C09E 3ZTJH 1AR1D 2QKIA 1B9ZA 4LSSL 3WKNA 2JJUA 3BKYL 4D0CB 1KTLA 3JWOL 1T1YB 3K4ZA 2HKHH 1W0WB 3HMWH 1A6AA 3VFSA 1F8TH 1JWMB 4HKBA 4XAKD 4HUWA 4FP8H 4Q9BA 1UB6A 3IJSA 4YDLC 3CVIL 3S4SG 4G6ML 4F7TB 1K8IA 2W1NA 1E28B 4A6YH 4ALAL 4UT9H 3X13B 2ITCA 4WHTA 4F7PB 4G8IA 3SJVE 1T5WB 4PFEA 3VH8B 4NQDA 4LRIA 2BVTA 4L9LA 4PRHD 2XOTA 3H9YA 4HD9A 5T3XH 3C6SB 2L0DA 4MAYD 1YECH 1WVZA 2EH8L 3TGXA 2H8PB 3ZKMC 4UTAH 3MUY1 3NA9L 1G0XA 4PGZA 4XGZB 1B2WL 3ARTA 4ZSOE 3VFOA 1L6XA 3C5SA 4MJIE 3BDYL 5CILH 1MRCL 2FGZA 4EI6A 3D0VA 4XPAH 4HWBA 4ZUUB 3SCMD 3S37H 1P4BL 4IM8A 5D7SH 2D7QA 3P11H 5GZOD 4KDTC 1BM3H 1JYNA 2H1PH 1A7QH 1CU4L 2OMBA 5JHLL 2DRUA 4HK0B 1IAOB 4OZFB 5EWIL 1DBAL 2EDHA 1IEBA 4UZGA 5IMLA 1MREH 4M5ZL 3D0VB 3KXFA 1NCUA 2YMXL 3HZVB 3BPNC 4GAYA 1GSMA 2WWKT 3B2VL 3MRKA 3TYGH 3U6RA 1HYSD 3IRZA 1IAIM 1A9BA 3FRUB 4P5TC 3F7YA 4JO2H 5JNYB 2RCSL 3C8HA 4K07A 3BESR 4OFIA 4JGJA 1I3GL 1M4KA 3GM8A 4MB4A 1TPXB 4P2OB 2Y5TB 3BO8B 3QDGA 2BMKB 5JDSB 3SGDH 3NH7H 2EXWC 5AWNH 2AABH 2VLRA 3GGWA 4KFZC 3RI5K 4CVXB 3QDMA 1YYLH 1RVFH 1OAZL 3TJHC 3X11A 5SX4I 1BVZA 1MJ8H 3KJ4C 2I25N 1G6RB 3OB0K 3O45B 1ND0B 4WU7A 3TEUA 1JNJA 1T7XA 4E41B 5AEAA 3MRHA 4GRLC 1ZA3B 1LDPL 4WWID 4LVOB 4BH7B 2KDGA 3QNZA 3G6JB 2GJZA 3VD7A 4JFYA 3TN0C 3QEHA 3ZDYF 1FNGB 35C8L 1RZJL 2UZYB 3KPRA 4RNRB 3DSNA 3MRFB 3IKKA 2VLJB 1QG3A 2DQHL 4ELKA 3LOWA 5E4EC 2D3VA 1NLBH 1NGZA 1OTSD 2GEEA 1IAMA 4RAUA 5F71A 4PLOB 4JFFA 2MFNA 1JNHB 3OJDA 3IFPA 2ARJQ 3VXPB 2BJML 1D5BB 1DN0B 4QHKJ 3LKNB 4PRHB 1ZANL 4NN7C 1OM3H 1XGRB 2LE9A 1X5IA 5DRWA 3ZDXE 4LLAA 4MWFB 2F53E 5E6ZA 4LEXL 4XHJD 3CH1B 1YN6B 4HFUH 1OTSC 4LQFL 4XXDA 5HHXL 3ULVD 3B6SB 3MUHL 2OM5A 3TFKD 5HI4C 1D9KC 3FL7A 1T04A 1GHFH 1U8NB 2APWA 3WNPA 4PP2B 1A1MB 4IRZL 3QHZH 4R6UA 3S37X 5DSCA 4IIQA 3U2SA 1QRNA 3MLZL 5CP7B 3SJVD 4LSVL 3RWFB 3MRIA 3WSQL 1G84A 5I18H 4RAVA 1LO3H 3B5GA 4K7PL 1QKZH 3DGGB 5DHYA 4K3GA 2KQMA 1KXQE 4LCWA 3FFCA 5INDB 2SEBB 5T3ZL 1XCQB 3VCLB 4Q2ZA 3BGFC 2OR9L 1G9MH 3VJ6A 4KJQD 2W0LA 2H26B 3QIBA 4BSVA 3VFUB 5ACZB 3HC4L 2G5BA 4JR9L 3MBXL 4EVNA 1CE6A 1N4XL 1UZ6F 2JB6B 4HUUB 5TE7L 4HCRH 4H8WH 5J12B 4U0RB 4WW2B 3ZTJG 5IBLC 4Z7WB 1TPXC 2QR0A 3S98A 4CVUA 1GGCH 1CDJA 3BE1H 5INCA 5CLWA 2X4NB 5IB3B 2CGRH 3F65A 5HYJB 4ELME 2VISB 1J0ZA 4CVWA 1MCNA 1KFAL 1U8IB 2QQKL 2DL2A 3WHE0 4YBQD 1EAJA 3PV7A 3MUZ1 1GPOH 4HQQH 2XFXA 4LGSB 3FB6B 3KJ4B 5HDOA 4MB3A 3C6LC 1XGUA 3WLBA 5CD5C 1NCWH 2FB4H 2VKXA 3GMRB 1QBML 4U1IB 4YXHH 3GHBL 4X9HA 5DUMH 3RX8A 4FQQB 1U2CA 3FQWB 3VWJC 2Q1EA 4BQ8A 1C5BL 1TCRA 3C08L 2IEPA 1WAAF 3DURB 2BJMH 3LS4L 1X6LA 2Q8AH 4RQQB 4ORGB 5ESVA 5F7WC 4JQXC 4Y1AE 1E6JL 5GRYA 5ITFB 4OCYH 4NQSA 4HIEB 4K7PX 2YD6A 5J3HC 5IVXA 4KRPC 1HE7A 3QJHB 2VDPH 1MCPL 4EBQH 3FB8B 1IARB 2MPAH 3VW3L 3PWUA 3QAZC 1YYLL 5ICYB 1S3KL 4JVUA 5EDXA 1N7MH 3PXJA 3RGVB 1KN4H 5GHWH 5I1EH 2OI9B 4Z18A 1KELL 3KPLB 3P0YL 4OFYD 3SJVA 3M1BB 5DHVA 3OX8B 4JO1H 3CU7A 1LO3L 4IRJB 1MFCH 4O58H 3RTQA 4L8SC 5DJ8B 4YAQA 1BQUA 4HX1A 1CLZH 4WUKL 4L4VB 5DGRA 2FO1A 5DJAA 3UTZA 3GMOB 1A6VH 4KZEL 1OGAE 3TM6A 3PV6A 3K46A 1DBAH 4P4RA 1Y0LB 3Q5TA 3FT4A 2V17H 2ADJB 1TVDA 3F8UB 1V7MH 3DGCR 4I3RL 4JVPA 4RCAA 3QQ9D 4KI5F 3ULUL 3BPOC 4F80A 5DJ8A 5CBEB 3MV9E 1MFDL 4OD3L 4OLXL 2ZCLH 3UTPE 25C8L 3CH8A 4IIQB 3D3VD 3VXSD 4OZGB 4XCFH 4Y5XB 5DQ9B 4RGND 4Y5YA 3O81A 2VSCA 2R69L 4JCLA 3ZSTA 4E42B 1RUMH 1JZ3A 4HV8A 3MRBB 5GGVL 3L7EB 4NBXB 3P30L 5HYFA 3NA4A 1WBZA 5DVMA 3V6ZB 5C09A 3NGBB 3T2NL 4JM4H 4HJGB 3L6FB 4X6BB 4HKJB 4M3KB 5JZ7C 4FQXD 4Y89A 4Z7VF 4YIQA 3SE4A 4MA7L 3QCTH 4AH2B 4PJGA 4IOFD 1EHNA 1C16B 1BIHA 3P2TA 4XNZC 3AXLB 3E8UL 4XNQB 3DVFA 3VXUE 2H9GA 9CGTA 2DLFH 2DTML 4KHXH 3C6LB 2NXYB 5EA0L 2Q8AL 3EHBC 3MLYH 1EEZB 5FHBH 2GAZB 2PXYB 5BVPL 5ETUB 1I1AB 1BFSA 4P59H 2FATH 4D0BA 4QYOA 4L4TD 5E8EA 3QA3A 3O6FB 2ERJC 2Z35A 4LAQL 1MCRA 4HIEA 2BVOA 2E8YA 4I3SL 3T2QA 3EZ8A 4RFNC 2EYRA 2HFFA 2I9LB 1F6FB 1D6VH 4JFOA 4QRTA 3ARUA 4GG6E 5IQ9B 4GMSH 4LRNL 1FNSH 1I8KA 3L1OL 5KOMC 5B39A 5KVEL 5FUOH 4HS3B 2CIKB 1WIUA 5DD6A 1FZMB 4U1IA 4YEFA 4MNHB 3RGVC 1U9KA 4PS4L 1JNLH 1P7QD 2ZCHL 4X4MA 4CVXA 1UH4A 2ICEA 4RNRA 1KIPB 1NLDH 5TJWK 3TZVD 3BUYB 3EFFB 4WTXA 1NL0H 1CFVL 1OOAA 4NQEE 4KMQA 5DEFB 1IGYA 3OKMB 1NCWL 3S96B 4QRRD 2CLRB 3OAYH 4N0YH 3DXAD 3I6GA 1VGEL 4UQ2B 5KZCB 4Z7VA 2PXYA 5JTWA 3FFCB 1D5MA 4NO5B 4XPBL 4X9BA 3G5ZB 1KJ3L 2LU7A 4JRXA 3OG4B 5GPRA 2APTA 1T2XA 3FONA 3BKML 1T4KB 4AEHL 2X10A 3MOBL 1FFOB 3CVHL 2DM2A 3OKEA 1E0OB 1QR1B 5H94B 2UYLB 3UTQB 1U42A 1S7XB 2E3VA 1LGVA 3RFZC 3HMWL 4S0SD 4UQ3A 1JGEB 2ENYA 1A1MA 3H9SE 2FCBA 4HDIB 4XP4H 3ET9F 3QUXA 4J1UA 5K93A 2XTJC 4K94L 3T1FB 1UZ8B 4Z76A 4KDWA 4XMLH 4NQXA 4RAHA 3H3KA 3G6DL 2VLMD 2EYSA 3W5MA 3H9SB 2VR4A 5JMOC 4B0MM 4FXGB 4YZFF 3W39B 4CVZA 5D6CB 4FQXB 2HTKC 3BIKA 4ZFFA 2HP4A 1OP3H 1A02N 3HG1A 1F2XK 1T5WA 4DTGH 4RISH 2BSRA 2MTPA 3OG6B 4S1SL 4PR5A 5EO9B 1LK3H 1KT2A 4C56D 4HGWA 4KJPC 4X6DA 3HUJA 1G7QB 1X5YA 1I1AD 2J8UB 3HNSL 1EERB 3SKJH 1YJDC 5B21A 1QFHA 4JDVB 4ODHL 1MFNA 4YAQB 5B38B 4NP4H 3RY6C 3OZ9H 5L0QB 4CRPA 5EOTB 4LASH 5I19H 5E2WH 4JAMA 1JCKA 3VXOA 4P57B 1FO0A 1VCAA 1IGTA 4XMPL 2VITA 5EC1A 1IQDB 3CFCL 1J1OH 5JORB 4I77L 1QYGL 1NL0L 3LKPB 1K3IA 5HHQA 4YFEA 2WP3T 4HHAA 1WAAA 4JVWA 1KB9J 1YDPB 1CFNA 3PHSA 1AI1H 1KB9K 5IVXE 1P4LB 4WTWA 4RMRA 4PJ7E 3O4OB 1JN6A 4LSTL 4HPOL 2D0FA 2R1YB 2VDQH 2DJ4A 1IQWL 3DSFL 5ITFA 1CXHA 4WFHD 2C4FT 2D0GA 1X5LA 1FO0L 5IG7A 1G7QA 5IWLC 1F4HA 4X6DB 1WWAX 1DR9A 3W11D 1BVKA 5DJ0A 1BFTA 4OLYH 3QUXB 3BJ91 4J1UB 5JDSA 4HKXB 2D7TL 2WBJA 4POUB 2WIMA 4MCYB 4FTVE 3UMTA 1CDCA 1F6AA 1V7NL 1BWWA 3RVWC 4CGTA 1ORSA 4P2QE 1QSZA 1A5FL 4ZUSA 1MVUA 4HMCA 1S7SB 2W9LA 4MJIB 3ZT5A 1T1XA 5JXAH 4EI5B 1A2YB 4XCFL 4XVUC 3SE8L 2DN7A 1ZGLA 3HNTH 3TNMA 3ARVA 2DQDH 5LJYH 2Q7YA 5KS9F 4WVRA 1MCWM 3TPUA 3EOBB 1NGPL 2FSEA 2R1YA 4OCXH 1T83C 2CRIA 2NY1C 3GMMA 1WJ3A 2FBJL 1A1OA 3RBGA 5J3HD 2P49B 4E5XB 1XR8A 4AK1A 4KQ4L 2VXSL 3UO1H 1FVDB 5MENE 1NCCL 3QRGL 3PWPE 4ZFGL 1A7NH 3LPWA 3EZJB 4LLWA 1Y6MR 5EUOF 3C5SB 1FV1B 2F74A 2CH8A 4JHZA 3QQ4B 5FGSA 5DDHB 4MB5A 3VXNB 3GIVB 1OGAB 1NCBL 4F3FB 1LD9B 2DQGH 1GGBH 1I3RB 3ME0A 3IVKA 5E7BA 1K4DB 4G5ZH 4PD4K 3DROB 5E2TH 4NQTA 1CFNB 2OI9C 4TOYH 1NFIA 4PJ8C 5H2BB 4LVHC 1OSZB 3GEWB 4GG8A 5CJXC 3MGTA 4HT1L 1FZMA 3V6FA 3BQUA 8CGTA 1B0RB 1YEFL 3O3EB 1ZA6A 1YN6A 3JUYA 4PJAB 2BNUA 4K71C 2ZUXA 4ONGH 5L88L 2P42B 1RFDL 2OJZL 1FNHA 3RIFF 4PBVC 4WFGE 1YMMD 4KTYA 5ACLA 5IROA 5FDWA 1J86A 3STLB 4W6XB 5C0JB 3U7WL 1CL7I 1DQJB 4PR5B 4QRSA 5IF0B 1JPSL 3SKMB 3C60B 2O26U 3GMLB 2CJUH 4ELKB 2VWEC 5E9DD 4XAWL 4MS8C 5TQ2H 3UTSD 1CZ8H 2VL5B 2ICCA 3AXLA 1YQVH 2GUOB 4ZUTB 2G60H 1Z5LA 4DAGH 3CC5B 4HC1A 2NW3A 5CEZL 3MNZA 2P47B 1NCAL 2B4CL 1ZTXH 4Y19D 3QJFA 4Z8FL 5A2KH 3S35X 3RKDD 2FB4L 1PYWA 3B9EA 5I76A 4TPRH 4Z7WF 2R2HB 3CDGA 5I1LA 4FQIL 4ELMB 4OGAC 2CXKA 1XF4A 5DMIH 2NTFB 1QP1A 2A9ML 4BFGA 4XT1C 2FBJH 4EN3B 3ARPA 3TP4A 5F3BB 5IEKB 2BMKA 2WBWB 4ODUA 2VJXA 5IV2B 3EDKA 3N50A 1TZGL 1KIPA 2DQCH 4MX7B 2NZIA 4H88L 3V0WL 3MA7B 4NM8H 5C0EB 3MRDB 3WNLA 4LRIC 4OZIB 3O9WA 4OZ4A 1RZIA 5KSUA 5BQ7A 2ITDB 4UDUB 1WFTA 4AIOA 3BOVA 3VFPB 3I6GB 4WHDA 4PJ7B 5IMLB 3CZFA 1I7ZA 5T1LA 3CC5A 1Z9MA 2E6PA 2O5ZH 3MLYL 1MNUH 2AGJL 5GS0L 3HRPA 3BGAA 3FQUB 1S7UA 3BSZL 3BUYA 4M61B 4PUBH 5I8EA 4J3UA 2X4OA 1NC2D 2DQJH 3OX8A 3CDFA 2WANA 3QDJD 4X7FC 4LASL 5I19L 2CKBA 5ICXA 3EDEA 3PIQB 1RFDH 2OJZH 1J7VR 2CRMA 2IH3A 2NMSA 1WBXB 1AP2A 4PV8B 5FIEA 4OCMC 1E6OL 3SDCD 1TVBB 3QXAB 3WKML 3PABB 1I1FA 4UOW1 2XICA 4YQXL 1A7OH 4OLXH 3F5WB 4J4PD 4RMWA 3LN5A 32C2B 1CIUA 1VFUA 4N0CC 3DLQR 5E6YA 3NCMA 1KJ2H 1T1ZB 3D2UB 1ZLSL 1X44A 1DLHB 2BVPA 1EUUA 2VZSA 3RZCC 3C60D 1UADC 1JBJA 2ZOKB 2W9DH 4PREB 3S34L 2VLJE 4MJ6B 1FO0B 4DAGL 5K9OA 3NFPB 1ETZB 1L6ZA 2YUZA 1XGTA 4LCIL 1DQLH 4J8RA 2HTLD 2IBGA 4NUJB 5CKGA 2A6KA 4V1DA 4QT5A 4MA1B 1FBIH 1BQHB 1F02I 2DLFL 4X7SH 1K6QH 5HD8D 5FYKE 1CN4A 2AVGA 5FYLE 4GMTL 5HYJA 5LAXA 4HF5L 2FIKB 4Y5XA 4XNMA 1PG7W 4KROB 4I5BA 1FFPB 1IGJB 3FO0H 3GZKA 1X6NA 1UKSA 4K9EL 5DVLA 4MXQC 4NM8L 4LHUD 4OJFL 2DLTA 5L2KD 2IBZX 3CX5J 5KVDH 4LFHD 3ARBB 3SE9L 4HPYL 5MENA 1R5WB 1TETL 2P24A 4XNXH 4JRXB 2FIRT 2MCG1 3IXAA 5F7NC 3T0EA 5D1XD 3VWJB 2PYEB 3WXWH 1NDMA 1MHPH 5JUEH 3MLWL 1G7IA 1CFTB 2Y07H 3RTQB 2W0FA 1DQDH 4PRHA 4MD5B 3I3DA 5K9QG 3PHQA 5A2FA 4B41A 2F58L 1GHFL 2HLAB 2X89A 1HQ4B 1J1XL 2WIIA 3LVEA 5D7LA 1AKJB 2OL3B 4IHOA 5GISH 1MCIA 4JG1L 1HHGA 3GSQB 4DN4H 5GJSH 1CGSH 3ZKNC 3JV4A 3RDTC 5DJYA 1A6TB 1WEJH 2VAJA 5AYUH 4XPFL 3V8CA 3WUZA 2DQUL 4FFYL 1IBGH 2ZSWA 5E6ID 5KSAB 3BH9B 3MFFA 3QFJA 4URTB 1BBDH 5JR1H 1PBYA 2FO4B 5EU3A 4BH7A 2G9HB 2YD7A 4A2MA 3CZFB 1IC4H 3EDFA 5DMKA 3EGSA 5EO0B 4L8SB 3JWNC 5ERWA 5SWZD 4PJBA 1UENA 5F9WC 1EZVX 2UUDH 4RAUB 4GKSA 5HGAB 2EIDA 4WEBL 3CCHB 5HHPB 1UWGH 4WGWB 1UACL 3OQ3B 2IFFH 3GM0A 2AK4A 2WWKO 1WAAE 3U4EB 1NGXB 4WCYH 3WUWA 1I7RB 1U3HD 3ROOA 1GC1C 3GJFH 3LAFA 1K6QL 3LEXA 4LCUA 1H3TA 3GKWL 4P9HH 1VHPA 3E6HB 3F7YB 4OB5L 3L3OA 4R26L 3MRBA 2ATKA 1KEGH 3AVEA 3CNKA 3QIBC 3GSRB 1ZWIA 2XN9E 1HH9B 5TDNB 1G7PA 1J05A 4TUOA 3MV9B 5BJTA 3HKFA 1S7WA 4IEFB 4YIQB 1KCKA 3QIUC 2I60L 5ACZA 4NO0D 3RZWA 4F57H 2CKNA 1CT8A 1X5HA 5EBWA 4PGEA 5MERA 5TH2B 2EDNA 1IAII 1GCFA 5JNYA 1DBKL 2WUBH 4JN2B 3U4BH 1KENL 4JHWL 1JI2A 4WO4C 1RJLB 4NO2A 3MLWH 2CKBL 1NEZG 2YRPA 4M43L 2VXSH 1P7KB 1E4JA 1RIUH 1OQXA 3WUWB 4YX2H 5DJAB 3CFJA 5C6TH 3TJEL 4LCYB 4LHJB 2BSTB 1JWUB 1U8LB 2UYLA 3UAJD 1JL8A 5CD5D 2PKDA 1XGQA 1A6WL 3B3IB 1FSKB 5ALBH 2R1WA 3O8XC 1I3VA 5DHVB 1L0YA 3O2DH 1R3LB 3DIFB 4FTVD 4DTGL 4L9DA 4Z7UE 2J5LC 4PJ8A 3BSZH 2B5IB 5AD0A 3ZHDA 3T3PF 2XYCA 3L9RA 4KK6D 3PL6C 4WJ5A 2R29L 1CIDA 4QHKI 2NY5L 5IOPB 4MWFA 4PJFF 4M1GH 3GSWA 3TT1L 5JXEA 3LN5B 4UNUA 1K4DA 2LQRA 3ZKMD 5KSAA 2XKNA 1U92B 4WU7B 1MJUH 3T77A 3QIWB 3GK8H 4PTTB 3G9AB 2JTDA 3UZEA 1RUQL 3LRSB 4IS6B 3I3BA 5D1QB 1F90H 2AXGA 4X6CE 1T1WB 1RZKC 5EIQA 4PRPA 2DAVA 4WHTB 1FV1A 2Y36H 5C3TA 4F7PA 4YPJA 3UJIL 1UWGL 1ULVA 3P9MA 1TJHH 5EO0A 3RVTC 1OP5H 2VLRB 1O5DT 2EH7L 4CJ0A 1KC5L 1HDMB 5I16A 1S8DA 1PSKL 1TITA 5F1IB 3B5HA 3B9DA 4PJXF 2HH0L 4X99A 2W65B 2IPTL 2BZDA 1A6AB 5KJRH 2ARWA 1LP9A 3C5JB 3WL9B 3MLVL 1NCCH 1G6RH 2DIBA 2VISA 4OD2A 4QWWC 5DK0B 5FKPA 1MCQA 3UCRA 1CYGA 5D70L 5D9SA 3G9VA 1I7TA 1IKNC 2OZ4H 3KPSE 4F7EA 2VR5A 1XR8B 1K3ZA 1SYVA 5C2BH 4GJTB 1DEEB 4WW2A 2IAMB 3WLBB 5EBLA 4OZFA 4XTRC 3FN9A 3DO7A 3TBWA 5HGDA 1JHTB 5K9KB 1RK0A 1PJ9A 3NZHH 2IQAB 3M07A 5ANMB 3O4LD 3L3DB 4P5KA 3T0EE 5I8OL 2OS7A 4EI6B 4XVUD 3UJTH 3FHQA 5BQ7B 2ZPKH 4OIIL 4RA3A 4UB0H 1H5BA 1XIWD 2X7LB 1T7VA 4UQ2A 3KPQA 1N8ZA 1QBBA 1OSPH 3CFEA 4XCEA 3MNZB 3EDJA 4MCYA 3P4NA 3DX6B 4WUUE 2J3SA 1KCVL 2R0WH 3WN5C 5T5FH 4H25A 3MV7E 2RAMA 3GRWL 4JPKH 4R8WH 5D72L 2NY0B 4N0CD 4PJCB 3FQTA 5JORA 4FRWA 1XF4B 1AD9B 1RUPL 2YRLA 2A38A 3MMEB 4PUBL 5E2JA 3N06B 1M6OA 4N9OB 1JWMA 4HKBB 3OAUL 1KTDB 4PRHE 5FDWB 5T3ZE 3GMQB 5GJSL 3PHOB 3U46B 2YD5A 4JDZA 5AYUL 4GSDL 4RGOL 4HBQA 1QRNB 4WW2F 3MOQA 5C71A 4OZIF 4J3TA 2GY5A 1I3GH 5FUCC 2H32A 3BKMH 4LLUB 1TTUA 3TO4D 4QXGH 3STBA 1YEKH 1QLEL 4LLMA 1PD6A 4Z78A 4PRNA 2VRAA 1X4XA 3C5ZA 3BW9B 5HYEA 4LKXA 3V5HA 4K7PY 4NNYB 5J6HB 4E41E 3DV4B 3H6JA 4M6OH 2R2BA 4WFGD 2XIDA 4MA8H 1R24A 2BSED 3A0OA 3BIAX 2WAHA 1MFBH 5E95B 3IFLH 5BW7A 4NWTL 2FH6A 5T1KB 2Z0BA 3EJYC 3G6DH 1J5OH 3PGDA 4JFEA 1TMCB 5DD0L 2NLJB 1P4BH 4Q9CA 2ZP0T 1KPVA 3CLEL 1M7IA 4HULB 3V7AE 5CCKH 1LDPH 1MI5E 4P99A 1V5JA 3EO0A 4NYLA 1ZT1A 3K74B 1WF5A 4G6KH 4RISL 1AFVL 4Y8DC 3RU8H 1MAKA 4FQLH 3MREB 5IHLB 1RZFL 4M6NH 2IG2H 5SWZE 3V0AC 1CE1H 2FHFA 3ARFB 2AS5M 1QD0A 3LS5L 1IEAA 3DNKA 4JFZH 1PVHA 3X3FL 4XCCL 3P9LA 1KPUA 4OGYL 1V8HA 4LARH 3KWWB 3RGVD 3WFBL 2WP3O 4NKIL 5GGSY 3RWGB 3FN0L 4UINH 2GUOA 2YPKA 4W81A 3ILQD 1S7QA 2AJYH 1J0YA 4YJZL 4XCYB 3V0VB 1J1OL 3HZMA 3NACH 2X4PA 5F9JB 1Y6KR 5C8JB 1BOGA 1S9VA 2R2HA 3CDGB 5KSAC 3B2UC 3WN5B 4YR6B 3F7QA 1VFAB 4GBXA 5C2BL 5JLZB 3DPBA 1FGNL 4PV9A 2B1HL 4Y5VB 3CFBA 5EU6A 1VPOL 3OJ2C 5MEQB 1P6AB 4X6FB 5GS0D 2PW2A 2NNAB 2YC1A 4HLZH 2Y4SA 1HI6B 1LEGA 3ARGD 4HUXA 3U30B 4UOJA 4QXTA 2DDQL 5D93B 3VXME 4F37K 1D5XA 4G7VH 4ZAKC 2E7HA 1KULA 4XHQA 1FZKB 4LLUA 4FG6D 3QO1B 3CH1A 2B2XL 2NCMA 1MELA 2P45B 5C0BA 4H26B 1X7QA 2HKFH 2BDNL 3DX7A 1JYWA 4K9EH 4LGPB 3TV3L 3ES6B 4HUVA 4J3VA 3QQ3A 2LABA 4K8RD 1LDSA 3IFPB 4X6DF 4KVNH 5EIIA 3C5ZB 2VN4A 3T0VA 1UM6H 1IL1A 4BUHA 4NQDB 5DDHA 4UT7L 5L8JB 3BQUB 2VE6A 3VXTA 3DRQA 4NOFA 1ONQB 4X9FA 5IEHA 5HHMD 1PQZA 1C5DB 4A6YA 4XVTH 3RGHA 1WLHA 3HG1D 5J4MA 2F53A 1BD2A 5IBLD 4E42A 5I1CL 1G0DA 2X9XA 2X89D 5D1QA 1QQDB 3MLZH 3VXRE 5E00B 3OKDA 4ZFFB 4N8CH 5D7IE 2RGSA 3NIDF 5T33H 3HCVB 4ZTPH 5CUSH 4HKJA 4X83A 3OKYA 4POZC 3UBXB 2AXJA 1NMBL 2G5BB 2EDYA 3HFMH 5IOPA 3X11B 3NPSC 4L4TB 4ZOEA 4P2QD 2ZCLL 3KPRE 3IFOB 3FB5B 5T3ZD 3HS0B 4JKPH 1X3DA 3ARFD 3RL2B 1K85A 3VRLE 4NN6B 4YHYB 4TQEL 2P8PA 3RJDA 4BA8A 3BH8B 3BYTA 4X8JA 4DZ8A 3K8LA 5ISZB 4XI5C 2AEQL 2BHYA 3WHE1 4PY7A 1RIHH 5BRZB 1KENH 2MOVA 4JHWH 3O0RH 1T03H 2XY1A 3AY4A 1ZHKB 4YNYA 5J57B 4F7EB 1KF9B 5H94A 3FO9B 5E2VH 5IW1B 2B5IC 3K4DA 2VB5A 2VLME 1PY9A 1JGVH 1FLRH 3G5VB 3FT4B 4WHYH 2X4SA 3HE6D 1R6VA 4PJXB 4BZ2H 3RGVA 3SKUD 1A6VL 4XC1L 4H1LH 2G2RA 3MACL 4DCQB 3DVGB 2XWTB 3WLWC 4TTGA 2VQ1B 5E08L 2DMCA 1IM3B 1A5FH 3PABA 3JUZA 1U8MA 4F2MB 3OAUH 2BNQA 1RZFH 3SGJA 4QOKE 5HHNB 3O4LE 3VE0B 4OZHF 3ZKSD 3MRLB 1TNNA 2VABB 3Q1SL 1MJUL 4L8BB 1D5MB 4NO5A 4V2CB 4GRWB 4L8SA 1CGYA 5FYKH 4ONOA 1OT1A 4K3DL 4G80B 4MJ5B 4NQSB 3ALPA 5IMOB 2F53D 3MRHB 3SE4C 3VG9C 4BKLA 4NQDD 5DD3L 7CGTA 4HUNB 5LBSH 1S78C 2IPUG 4NFCA 5DD6B 1NCTA 3T2NH 3WEXA 1FGNH 3HG1B 4QRUB 3QEQD 4KAQH 4JEGB 3QI9A 4ODWB 3WBDA 1YNLH 3JWDL 1RU9L 5F8RC 5C0DB 3Q6GH 3P0GB 5K9JH 3LDBB 2RR3A 4K3HA 2EDQA 3DI2B 4D0DB 1JGLL 1H3VA 3VE0A 2N4IA 4D9QD 4ESKA 4XP9L 2EYSB 4TVPL 1ZHBA 2J8UA 4M7JL 4WEUD 4NNXA 5I75B 2VZOA 3VA2C 3RNQB 5CWSB 2EO9A 3BP5B 1U91B 4PB0H 2X4TB 1YY9C 3WHXA 2CR3A 4NGHL 4ZFOB 5DEGB 4F8TA 1FHGA 4TQEH 5IB3A 4QHLB 1JZ4A 4QRPD 5D7IF 3GSQA 5I1LB 5C0AD 4KVCH 5MERB 3NPSB 3VXUD 3B3IA 4Y5YB 5FV1L 1EGJL 2P5WA 1IAKB 2GT9B 5ESAB 3HPLA 2HFGH 3RNKB 4XCCH 2W0FB 3TA3A 4KKAD 2W07A 1A4JA 4OF7A 3IYLW 2FBOJ 3VJ6B 2QHLA 2R9HD 3U1SH 4U6YB 1HKLL 4P2OD 1CFQB 4AYFA 5I1HH 2AJYL 2A74A 4WEMB 4N0UB 1R3JA 4PRBA 3UPCA 4JLRB 3P73B 2WW8A 1GYAA 4L4TA 4NHUA 1U93B 1UCBL 4Z77B 2OTWB 4HQQL 4Y5XC 5GGRY 4MA1C 2XTJE 1U2HA 1VEMA 3HI6L 2VYRE 3BDXA 2ICEB 2B1HH 3TVMC 1A6WH 3MRMB 3Q1SH 5DUML 4PP1D 5K9OB 1B0RA 4KHTL 4MJ2A 1Q9WB 1PX4A 5KSBF 1QFUL 1C5BH 2P5EE 3CVHH 3B8SA 4JKLA 3WIHL 5C0ND 4CKVX 4ONHB 1I9IH 1TXKA 2VXQH 3ARDA 3D3VB 3O0RL 1OAQL 1UT9A 3V4VH 3QH3B 1HCVA 4OLUL 1QTYT 1XGRA 1ZA3A 4MJID 3UBXA 3KDMB 3LKNA 4NC1E 3NIDE 1QACA 1DEDA 4LPUA 4MGXA 5C1MB 3EO9H 5A3IC 4P48A 3ZE0E 3HE6C 1F4XL 2V7NA 3EYVA 3ZYZA 4LLVB 3O3BA 4NM4H 5DK2A 4I0PB 1UM4L 2KL6A 4DVRL 1MWAH 5T3XE 1KXVC 1JRHI 1A22B 1JNLL 1JNNL 4I9WD 1RHHB 3BHBB 4JFOB 4LLQA 1UJ3B 4QRTB 5DQDH 2DYPB 3QZWB 1AO7A 4GG6A 1AE6L 4QXTB 2MQCA 4XP1L 1BJMA 3DMMB 2HH0H 4JZOA 4O58L 3BZFA 1UB5B 2RFXA 1XCTA 2FSEB 5L7XL 3WO4C 1RZGA 1FLTX 4LCCA 4FQ2L 3JV4B 4IMKA 4Y16A 5EZIH 1FORL 3HAEB 4KC3B 5GS2H 1JYVA 5DWUL 3UTPD 3HZYA 4YHLL 4X7DC 1Q0YL 3QXWA 4RWHA 1LEKA 3ARBA 1OLLA 2UUDK 4HWZB 5F1NA 3IU3B 4ZXBA 1FAKT 4B50A 3RHWF 1OAYH 1T22B 4R97C 4Z7VE 5C8JA 2EXYD 1YJDH 3MA9L 4RGMC 4N0RA 5HJ3A 4OD3H 1NAKL 4FQHA 1TFHA 4U31A 2V2TB 2R23B 3WIHA 1FNEB 3CFCH 5EPMB 5IROC 4LPCA 5I73B 1BHGA 2QADC 3CK0H 3G5YB 3UO1L 4Q74A 2VOTA 4XGZA 3HI1B 5INCB 3QXDA 1Q8MA 4OZGA 5CZXC 1HNGA 4O2EB 2O5XH 3PWNA 2QSCH 1UVQB 2Z91A 3O3DB 3D25B 4P46B 5BZDB 1UWEL 4E9LA 4LLDA 3UTTD 2NY3C 1YEIH 4M5YL 5D1ZA 3ZYOA 1EHLH 1DUYB 1XIWA 3RZCB 2QQNL 2NXZB 4XZUA 4Z7OE 2LAAA 4O5LL 4JQIH 3GBMH 1FCGA 3LMJL 4FS0A 1D6EA 2HRPL 4QRPA 4KZDH 3O3AA 1INQB 2F5AL 2X1XR 5FGRA 1HXYA 1HSBA 3VXTB 2Z92A 1DQJA 3SKJL 4P2CG 4L8CA 2V5RA 4DOHE 5IVXB 3RL1A 4JRYB 3ES6A 5DJXB 3CPLB 5BS0E 1KNOB 5E4IA 4J12A 4C54A 1U95B 3RU8L 4U3HA 2VDMH 4BFEA 1YECL 1H8SA 3PIQA 2ZOKA 2HKFL 4CN6A 1FDLH 3QPXL 5KTEH 5DQDL 2UZXB 4Y4FB 4MAYB 1PQZB 3V6FB 4RA0C 1OB1A 2Z4QA 4BK4A 2KH2B 2P48B 4G43B 4EQ3A 5E6IC 5JQ6L 4GAJH 3WS6A 3F7VA 1U8PA 3T1WA 1BM3L 3IXTA 5GGVH 3KLAB 4JFFE 4OLZL 4R2GB 2J5LB 5EU6E 5DMGD 4LSUL 2HN7B 5JA8B 5D71H 5F1KC 4L3AA 1DVFB 5GRVK 1CTOA 4P3DB 2DQEH 5DFVD 4JFQA 1NGZB 2YMXH 4GW5B 3MRDA 4OLYL 3QBTB 1DBJH 4M1CD 3N1FC 3VXMA 1AJ7H 4XMKL 4LLWB 4XAKE 2A6DA 1AGFB 1PEWA 1U36A 5D5MF 3HC3H 5GRUH 4OCLC 5FO8A 1BJ1J 5T1LB 3H42H 1E4XL 4Z5RB 1BX2B 4U6VL 5IWLA 4C59B 3EOBA 1UVQA 5JLZA 1IT9L 1YN7B 2BSSB 3N9GL 1ADQH 4IMKC 4ELMA 5T1DL 1D9KD 4FTVA 4JM2C 1DBBL 2M8XA 1YEHH 4X6EA 3MMEA 3ZDZE 4MVBD 4U2YA 1IGFH 4FQJL 2QSCL 3FFDB 3LQAC 4OGYH 3WS3B 1ZVHA 5EZJA 4LRNH 3LPFA 3L3DA 2FWOB 2GCYB 4KI5C 4L3ED 2DOCA 4P46D 5DJ2A 3UP1A 4XAWH 5F1OB 4JFXA 5I71C 2A73A 4MNQE 3UJIH 5C9KA 1AR2A 1CG9B 1MNUL 2PCPA 4LF3B 1Q1JH 1CICB 3O6MH 1VDGA 3KXFE 4JZJB 4XB7A 1VKXB 1X5JA 5D2NC 1V3MA 3AREC 3RAJH 4NQEB 5CIPH 2VIRA 2LFGA 4YHPA 3B9KA 1HIMH 1YA5A 1IC7H 1S7VA 1U6AH 3GO1L 5IMKA 1UG9A 1TQBB 5D5MB 4I0CC 3C6SA 1IEHA 4I18B 2BNUB 3P4OA 4XRCA 1ZA6B 3FN3A 3KJ6L 5FYJD 3OKOA 5GZND 4H1LG 4Y2OA 1UM5H 1KJVA 1SYVB 1KLUB 1Q0XL 2JIXA 4LMQE 1FPTH 4ISVA 4GG6B 4G9FD 1ZK9A 3VD5A 1HYSC 4I77H 4HS6B 2X4UB 5JO5A 3SBWA 4OBRA 2WBKA 4MZ3A 2VITB 5DD3H 3NZHL 4Z9KB 5EUOB 1AHWA 1EV2E 1LK2A 1ND0A 1B2WH 3RVWD 3OAYK 5B39G 2ZUWA 5TE6H 1P4LA 3ARDB 4Z78B 3AUVA 4X80L 4KZDL 4OI7A 1DBJL 1MIEH 4NRYA 4ZD3L 1ZVYA 4WUUD 2AW2A 1HXMA 3ARFC 1RJYA 2G60L 2APFA 4PPTA 4XTRD 4D8PB 3GMMB 5TQ0L 1UQSB 2F19H 2XZAH 1W0WA 4AY0A 5D6CA 2R1XB 3MBEC 1ZHNB 5C7XL 3MX0A 3MUGA 2XQBL 1FN4A 5GSRA 1CR9L 4R3SA 3SGKC 5C09D 3BWAB 1ZLVK 3HI1A 4LSPL 5IJKC 3PGCB 1KIQB 4GAJL 2HJFB 4NC1C 5CZKA 5A2JH 5CSZB 3S5LB 3UROR 2E9JA 2AK4E 1M1SA 1XGYL 2R1WB 4RFOH 5B38G 1AGEB 2DD8L 4F33B 1DLFH 1FGVH 4W6YB 5D1ZD 3W39A 4CVZB 3H9SD 3PP3H 3TNMB 1ZGLB 1WK0A 4WFFE 4JPWL 3O9WD 1FFOA 4FQCH 3T0ED 4LHQB 4L4TE 1P69B 2XG5A 5I71B 1P84K 1T80A 2HMID 4M8QA 1I4FA 3MCLH 1GZQA 2BNRD 1U3HB 4YDJB 4OKVA 4O5LH 3L3OB 3SO3C 1CICC 4NSKA 1U41A 3O6KH 3PWUB 2FECI 4EUPG 4QRPE 4GMTH 2LV4A 4NZRL 5IBTL 1ZVSA 3SN6N 1WEJL 2QHRH 3PNWA 1T21A 2CRZA 4U1GC 4I0PC 5CP3H 5DRZB 3DXAE 1XFPA 2JJSA 2YEZA 4R4BA 5F7EL 5D8JH 3MLSH 3RWHA 5A16A 4PB0L 2W0PA 3MC0A 5JZ7D 5D9SB 1IQDA 5DZNA 3V6OE 2AJXL 3MRNB 1JHKH 3RWIB 3C8KB 4OCRL 1AO7E 3QDME 1BIIA 3ZT7A 4TN9A 5IJVB 1A4KA 1RAMA 4ZSOB 5L88H 4Z0XA 3H9HA 2KZWA 5KG9B 3AU1A 1PEZA 4D3CH 4U6HB 3JSSA 4XCNA 1YY9D 1JHLL 5L8LB 2VR9A 2DWEA 2FR4A 1TETH 3GSXB 1CLZL 1WQVT 1NANI 4RIRA 4WUKH 3EJYD 4CADA 4Q9QL 3FKUS 5IR1B 1KB5L 3H7LA 4MA3A 4OLZH 4G7YH 5EC1B 3NZ8B 4TTDC 1A4KB 4LARL 2CJUL 1FL3A 3T2OA 2ILLA 4QEGA 4J6RH 5FK9B 2I5YL 1DSFH 1MAMH 3VI4E 4AL8H 1F2QA 3GO1H 1CK0L 1NUDA 4WU5A 1U3ZA 2ESVD 5CZXD 1FVCB 2NX5D 3RWHB 2DWEB 3QUXD 4YH6A 1CE6B 4LOUD 4NKOB 1KGCD 1AXSA 3CFJB 4U3CA 1QUNA 3QWOA 5I73C 3CSYB 2Z35B 3SDYL 5KSBA 3AMKA 1G7IB 3VD3A 1I8IA 3IJYB 4C83A 5C09B 4G9FA 2ID5A 4JE4B 3IU4L 3BRGC 3SDCB 4KJQC 4XPFH 1R3LA 3DIFA 4BQ9A 1EK3A 3AS1A 5DQJA 4U6YA 5D7LB 5IBUB 1OARL 5DUBA 1T7WA 3SY0A 4CN4A 1FH5H 1CCZA 4PRDA 4FQJH 1KEMH 3U48A 1WFOA 4G7VL 5C6TL 5JQHC 4XNYH 4NHUB 2CGRL 4JY6A 4IRJC 2CK0L 1J8HB 4F7CB 1KYOK 4ZODA 4NQUA 2GSIA 4YDIL 5LGJA 1PFCA 4V1DE 1P1ZA 3BZ4B 5D1XA 1PG7H 1EVUA 5HY9A 3L7FA 4LCWD 3CSYA 3OR7B 3OF6D 4YXKH 2O5ZL 1JMXA 1S7XA 2YPLA 4ZNEE 5ANME 3VXPA 3BPOB 1MQKH 2Q76A 2A1WH 3HE7B 4UIKL 1JHKL 1QQDA 4DZ8B 1Z2KA 2Z8RA 3TCLB 4F8QA 4QHLA 4YBQC 1JK8A 3S8WA 5EORH 3KPSB 1F8TL 1KIQA 4KI1A 5JXED 2CLVB 1KGCE 1VA9A 4CADB 3P30H 5CLTA 3V7AG 4G80A 3I50L 4D9RD 3RA7H 4HKZA 1R3KB 5CHNB 3H9HB 2ZSWB 5IFJA 4Z0XB 1OY3B 3TZVB 2AQ3A 1TVBA 3QXAA 4MNHA 4L8BA 5JW5B 1CLOH 1FJ1A 3WIIH 4NT6B 2FL5A 1EFQA 2X1PA 1FYHB 3LHPH 2IGFL 4YFDB 4M6MH 4Y1AD 5EU4A 3S34H 4R4FH 5IR1A 5J13C 1CVSC 2RIKA 4OZHB 4J2XA 1HSAB 3BP6B 4K2UH 1AE6H 3V8OA 2PN5A 3BN3B 5D2LA 3O11A 5D2NE 3WFHA 1QKZL 3BPLB 3BDBA 5EN2A 1SYSB 1YPZF 1WICA 4LP4A 5F9WB 4BSWA 1JIBA 3IDJA 3S3JA 2EEDA 2VLKD 4XB8A 1OWWA 2O5YH 4JQIL 4MAUL 1U8IA 2ERJB 4RQQA 5ESVB 1ZGLM 2OR7A 4OCRH 4DKDC 4GBXB 1LO0H 2LU4A 15C8L 5EFIA 1G9EA 3BWUC 2NY2B 3V6BR 4PJDE 1K4CB 1CI5A 3S88H 3BP7B 1CICA 2K7PA 4PBXA 1V3LA 4JY5L 4Z7NF 1KJVB 4OAWA 4GLRI 2CDFA 3TZVA 2X4PB 2DMBA 1LEGB 2DBJA 4LPVA 3SCMC 3U30C 4KKBD 5JHDB 3ZZ1A 4U1NB 1ZANH 1OM3L 2IPTH 3KPPB 2ZZUT 3O2WH 4M8QB 43C9B 4OD1H 2PO6D 4IBLT 3G5VA 4FFWD 5I0ZA 4QT5B 4JPWH 4V1DB 4KV5E 3L3KB 4UIMA 3C5ZC 2AXFA 4ZUVB 3RDTA 3QUMA 2CDGB 5FECA 1G7LA 1IVLA 4G8GD 2XZCH 4YLQT 2C1PA 2IADA 3VA6A 4F15C 1MWAA 1D3CA 1QLRA 1YMHB 1FFPA 1IGJA 1C12A 1UXWA 4NYLB 2VL5A 5DZLA 2FNBA 4N1CA 2CMRH 3B83A 2APVA 1QBAA 3AGVA 4LSRH 1NC2B 5D8JL 5HHOE 4XBGB 4B53A 1ZHLA 2UZIH 3QEQA 2V5MA 4JFEB 3ARFA 1T6WA 4M1GL 3TT1H 1IBGL 2D9CA 1AQKL 3RVUD 4OIIH 1KTLB 1FC2D 1AHWB 1FLRL 1ZT1B 5T1MA 2JKXA 3GI9H 4JDTL 1KBGL 7FABL 4I2XE 1VERA 1CS6A 4LPTA 2DICA 2R4SH 4P9HC 1DBBH 1T04B 1U8NA 4HJ0C 2JJVA 2HAZA 5DZOA 3MBEB 3DOSA 5FUCE 5T5NF 3ZL4L 1AXSB 2OSLA 2DQFB 3GMPB 1HH6B 1GGUA 1X7QB 4H26A 5E2UH 1IMHC 5CJQL 4E41A 3OWEA 2VLKB 4G6KL 1PZUB 4C55A 5GGQH 1RSFA 1RURH 1IC5H 1BZ9B 2ZJSL 3RUGB 1WWWX 2NY2D 2CDEA 3QDMB 5HPMA 2D7PA 2E7BA 2YN3A 4PJCA 4W6WB 5KSVA 3IU4H 5B8CC 5DI8A 3FB6A 1C7TA 1OF2A 1VGKA 2OR9H 3TLRA 2R2CA 4GXVL 5D7JD 2XTLA 3S3SA 1IFHL 3JXAA 1A3QA 1MCPH 1T89A 4OCWL 1XGYH 2X4NA 4F3FA 1IEAB 2AP2A 2FJHA 3QWRD 3U6RB 5C08B 1HSBB 1IC4L 43C9A 4OIBA 1Y18B 4MLIA 4BZ1L 5F89A 1S7QB 4G8GB 1F4XH 4WUUA 4ODUB 3MV7D 3JVGC 4NRZA 2EDLA 4J3SA 1ZS8A 1A3LH 2IADB 1N8ZB 3U36A 5GS1B 3RVVC 4XC3H 2WQRA 4X80H 5KS9B 4KQ3H 4P2RA 2OYPA 3EKCA 4G8FA 4P3DA 1MQ8A 2E7LC 5HHME 4JHBA 4NRXB 3B9KC 1AKJD 1S7SA 1WIOA 4MAYC 4TUKH 1MFAH 5A2LH 3TH2T 1CL7L 2QSTA 3PL6A 1WZLA 1HIML 5ANMA 4M7ZB 3CIQA 1RK0B 5E6IB 1B88A 4I13B 4P4KA 5BV7B 1Z0NA 3BZFB 4UAOC 1N5AB 3MLUH 5HHVH 1E4WL 2D4DA 4NNPL 1YYMH 3HC0A 4GRLB 1TJHL 4IDJL 3L3GA 5C0NC 1MJJA 2M2DA 5CZVH 3UC0H 3KPOB 2AXGB 1H8OA 4MXQD 3W0WB 1EBPA 3O6LH 4YHOL 3PF2A 1O7VA 3CFIC 1KN2H 4LGRB 1FYTD 5IHZB 3VU2A 2EYTA 2VC2H 5L9DH 3VH8A 1RURL 3P77B 4DEPC 1KJ3H 3GBNL 4DGYH 3CVIH 1BFOB 3NOIA 1JMZA 5GZOC 5JW3H 2QLVB 3HR5A 1L4IA 3QULA 2CR6A 5CCKL 5FCUL 4OF6A 2X6MA 1J12A 4PRPB 3OPZL 3WJLC 4JM2B 2FZ3A 5FYKD 4U1JB 4IS6A 4ODSL 1LO0L 5FHBL 5KSBE 4PJ5B 3TIEB 3U46A 1YQ2A 3QUYB 2E9BA 2PYEE 3VFTA 3MV9D 2HRPH 1OD9A 2VXVH 1A9BB 3FRUA 2FD6L 4APQC 2EDXA 4GRWH 3D39E 1QOKA 4MLSA 4DVBB 1IGMH 4HLJA 3HNTL 4PJIF 1CXLA 4KTDH 1RJLA 4NO2B 4HS6A 5TF1H 3QYCA 2BRQA 4U1MB 1LO5B 1ITBB 5EU6D 2DI8A 1URLA 2AXHA 4P2RB 3WFBH 1DJSA 1RZ8A 2CK0H 3BAEH 2H1PL 3LB6C 2MSPA 4X4XB 4RDQG 3RBSA 8FABA 1DFBH 1QFOA 2NY6B 4HMDA 2YPVL 4FA8A 4J4PC 1F58H 2AKRA 2ZUSA 1RHFA 3ZKXB 3VGFA 1DZBA 3JV6A 2W0KA 1YJDL 5CD3A 5C0CD 1EXUA 3U9UA 4G8FB 3GNMH 3FZUC 1TQCC 1Z0MA 4U7KA 3OZ9L 3GMNB 3QHZL 8FABB 3DXAA 5K59E 1XR9B 1MRDH 4WI4A 5DYOA 1NKOA 3V95A 2YA1A 5C0AB 1YDPA 5I74C 2ZUQC 3EYQD 1KYOJ 1S9YA 5F88B 2DYPA 1XIWC 2X41A 4HG4J 4CU7A 1FRGH 3TCXA 3QIWD 2I07A 4MHHG 3FZUD 3VFOB 2Z93B 1X5ZA 4UAOB 1P9MC 4R7NB 4X6CF 4BJLA 2F8XC 1QR4A 2XN9D 4KPHL 3SKNA 3F62A 1U8OB 3U7AA 2P8LB 2Q86A 4LCUB 4HZAA 5E2VL 3NABL 5GJTH 1CQKA 4UUJB 3RP1A 2VXTH 4CDHA 2F5AH 2ED9A 2NYYC 4DGYL 3HE6A 4HAFA 3UTTA 5IB4B 3UPRA 2VXUL 1H0DB 2C4FU 1AO7B 4NN5B 4XP9H 4QTHA 1KPRA 2P1YA 4L3EE 4NZTL 3NCYS 3VH8G 1J5OL 1PKQA 2VNCA 1BQSA 1BZ9A 3RUGA 3P77A 4NGHH 4BSJA 1VGEH 4PLJC 1CF8H 2V7NB 3RWIA 2CIIB 4PJBE 4ZO6A 2BNQD 4OKDA 2FX9H 1RULH 4RWYH 1NUGA 1QFWI 5C0RL 3K1KC 3LN4B 2NXZC 4PY8J 5GRXG 4ZTOH 1NGYA 1NEZA 1NMBH 2OTWA 1Z3GH 1AGBB 2BVEA 3CVHB 4FXKB 4C56E 5LGHL 2M26A 4YHML 2QL1A 3PWPD 3GB7B 1C1EH 5KN5A 3RY4A 4WI7A 1N0XL 1GZQB 1HHKA 3C8KA 3U7YL 3PJSA 2Q76B 4I4WB 3VXRA 1UM5L 5D71L 2HT4C 2Z8VC 1RU9H 3OAZH 2NXYC 4BQ6A 1FPTL 3VWJD 4IJ3B 4PYGA 4Q9RL 1AC6A 3W9DB 2XWTA 3ZE0F 3HI6H 3FQRB 4PRBB 3L5JA 1S7TA 2ADJA 3E6HA 4RX4A 1T5XB 5L6YH 4PRIA 2HKHL 1A14L 2FGWL 4O2CB 4L3CB 3VRLF 5BXFB 3BRFA 3LSOA 1M7DB 2DL9A 1F6LL 4MQ7A 5J0BA 5FUZL 4P2QB 3SY0B 3CD4A 5BJTB 5BV7L 1Q9OA 4M62H 1BBDL 3OKEB 4TUKL 3WJJA 3PWNB 5F6IB 1HQRA 5C0CA 1KG0A 4GKSB 4MAUH 3M17B 1S5IH 4HWBL 4AZ8A 3RQ3A 5HGHA 3ZT6A 2P8PB 1FL3B 4HG4K 1J18A 3TN0A 1FYTE 2D2OA 4YZFE 4Z7VB 2WWMD 3ISWA 5L8KB 3CXDH 4QTHB 4BKLB 2E6QA 5F8QC 1KBGH 5FYLD 3VGDA 1EEYB 3BWAA 5ADPH 2EYTB 4R9HA 1PW3A 4BQCA 4YK4C 4EJ1C 5C0DA 5DJYB 4G3YL 3HUJF 1AO7D 4NKIH 1N59A 4HXAL 5MI0B 2IH3B 1JFQL 4L8DA 2R9HC 1PKQB 2Y23A 4NRYB 2C7UA 2WUCL 4QHUA 4N8PA 2YEZB 4MQXD 2ICES 4R4BB 3JWDC 1R5VA 2BNQB 5I1AA 4LCCB 3HNVL 4HIXH 2CO7B 3UYRH 5I8EB 1FBIL 3QCTL 1FG2A 5IIEA 2MPAL 5JW4N 3VW3H 2VERN 4H5SB 4ODSH 1FRGL 1N0XH 4P5MB 1NGWA 4X98A 1EXUB 1AP2B 4PJXA 4PV8A 3U9UB 1UJ3A 3S9DB 3PWPB 3LDBC 2IF7A 5MENB 4ETYA 2GHWB 4MD4A 1JPFA 1RIUL 4F7MA 3VFGH 4YBLC 5GS1C 2J6EH 4GW4B 3DARA 3AC0A 1RVFL 3VFRA 4XCYA 2IH1B 3ZE2E 4H1LA 4ZUWB 1F3DJ 3QEQB 3ALXA 2YKLL 1H3GA 1ZLWK 3H9ZA 1I9RH 3WS3A 3ZDXF 5JIHA 3VFWB 4G6AD 1VFAA 2P44B 4UBDD 4OF0A 4KQ4H 5DJDA 1NMCB 4M7ZC 1EUTA 3M17A 5IVOA 4FTVB 1NAML 3EO1B 2JCCB 1M05A 2XXCB 4NUJA 3TO4A 3TYFA 1CD0A 3IGAA 4N0FA 3SDCC 4XH2A 4U1JA 2ESVE 1EO8L 2FIKA 4HAGA 1OW0A 3M8OH 3PV6B 2WLZA 1MCSA 1A8JH 3CFKB 1I9IL 4TPRL 1MHCA 4CMMB 3HMXL 2UZIL 2BY3A 3FQRA 3KYMB 2GYSA 2IH1A 1UC6A 3VFRB 1MEXH 1EEUA 1NBVL 3GFUA 4I3GA 3J8F7 4IRJA 2GQHA 2EE9A 3LQMA 3MYJA 3WE6B 4LL9A 4MXVE 3W9EB 3MNWA 3HLAB 1WFUA 5FF6B 2XTJD 1GGYA 4KK8C 3KS0J 2V9RA 5E5RB 5IGXL 5KOVC 1CWVA 2KQNA 3NZ8A 4ODVH 3AB0C 3RUGF 2PETA 1A3RH 3LKQB 1XGUB 3ILQC 4KMTL 5CJOL 2DWDB 4K3EL 1PZ5B 3MRPB 4WW1A 4LAQH 3CSPA 4U6HA 1G7MB 2JJSC 1AXTL 2FYYA 2I9TA 5EU4B 4XP5H 3RWJB 2DJUA 1G6RA 3T4YA 3L3GB 1ACYL 5IQ7L 4MS8D 2X70A 2Q6WB 3OV6A 1OD7A 3SOBL 1D6EB 4PJCF 3HZMB 2QQLH 1N6UA 5F88A 4P2QA 4P23A 2CSPA 4RMTA 3TBSA 1TDQA 3WUWG 4LEOB 3VFUA 1QLRB 1YMHA 1PAMA 3U4BL 4MNQA 4HPYH 1R5IB 4JRYA 3D25A 1HZHL 5BZDA 1PLGH 1U8OA 4ODBD 4Y4HC 2ITDA 5BS0D 5IJVA 1KTDA 2EKSA 4IDLA 3RVTD 1WITA 4KUZL 4NKDB 4ODXA 3ZMRA 5GGTL 4RRPG 1JI1A 1XMWA 1CFSA 4Y4KD 2ZUQB 3I85A 5HDBF 4H25B 5EG6C 4HXBL 4XPTL 2Y5EA 1DQQB 4LSUH 4XX1G 4KAQL 3UDWC 2XA3A 2R2EB 4K8RL 1A7BA 3ECBA 3CDYA 4YC2B 1A3LL 1KB5A 3I6LD 1FO0H 5KANG 3ZE1F 2NW2B 1WTLA 5FHAL 4K94H 4AG4L 1ZEAH 4I48A 1RK1B 3VDBA 3QZWG 3ULVL 3IU3A 1NC4D 1P4IH 4KUCD 3KLSA 4JO4L 4G6JL 3NCJH 4HJJL 5EZLA 2V2WA 1XH3A 4WY7H 5L2KE 4QCIB 5SWSA 4JJ5B 4R7DB 3JTSB 5DRNB 4ELMF 2GTZB 2OSLB 4FN0A 2VDML 2H2SD 1AGCB 3VXSB 4Y19A 3IRPX 4HK0A 3BGMA 4RZCB 3QPXH 4MMZC 2Q8BH 2DF3A 3IFLL 4NNPH 5C2UB 5IESH 4P5TB 3PL6D 3KHOA 1SMAA 4ZG1A 4C58B 3EUUA 4XPGL 4XI5D 2HRLA 2VZ3A 4MDJB 5I1IH 4MZ2A 3QWOB 1IGTB 1DQML 2NY0C 3IDYC 2FEDC 2FJFA 2H8PA 2J2ZA 2NY1D 3AB0B 3LN4A 3PQYE 3LQAL 3MODH 2Z31D 2ZUUA 4LIQL 1ES0B 2EKJA 4JZOB 2JK5B 1KEGL 4M6AA 2Z93A 2IG2L 2NY3B 3KJ6H 1E4XI 3SKOB 4RIRB 1MFDH 3RA7L 1G7JA 1YPZB 1NGQL 4LVOC 3Q48A 1HWHB 4LLVA 3BO8A 2P7TB 5E94B 1QHPA 3D9AH 3WIIL 3OGOE 5I1EL 2JIXD 1IQWH 1XGPB 2MQ3A 2VKWA 5BW7C 4AENB 2J6EL 4NDMB<