4RWYH

Crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 8anc131 in complex with hiv-1 clade b yu2 gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
QGQLVQSGGGLKKPGTSVTISCLASEYTFNEFVIHWIRQAPGQGPLWLGLIKRSGRLMTAYNFQDRLSLRRDRSTGTVFMELRGLRPDDTAVYYCARDGLGEVAPDYRYGIDVWGQGSTVIVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords HIV-1 YU2 gp120
total genus 41
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2014-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rwyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rwyH01
1T66C 2VC2H 3OJDB 1CZ8L 2DQIH 3L3JB 2AV7B 1B0RB 4EDWH 4APQC 1E4KA 4EZMA 4U1LB 3QDME 5ITBL 1IM9D 4PJBE 3QIWC 4OGXL 1FAKT 1XFPA 2P5WA 4XI5D 4F58H 5E7FA 3OG6B 2OYPA 1FO0B 4R0LC 1PFCA 2LU4A 5C0NC 1YZZA 5FGCE 4BFIA 4IMKC 4WWKC 4Q74A 1HXMA 3NH7H 1MHPL 5I17A 3RX7A 1WIUA 4JKLA 4HIXL 5C07D 2C5DC 5KZCB 1Z6JT 3EOTH 2BMKB 3WJLA 3WN5B 1E6JH 4ODSL 3NZHL 1A6AB 2P5WE 4OD3H 4PJ9D 1JYNA 4HW6A 3TGXA 1TQCB 2XT1B 5C6WH 4XC1L 3GK8L 1DBAH 3TJEL 4L3ED 1A6ZA 4KKCD 2ZCHH 1KN4L 2DKMA 4IBLT 4MNHA 4PP2B 1I4FB 2QQKL 3T0VA 1M7IA 4P4RB 4D9LL 2YPLE 1VB9A 4OZGA 4O2FB 3T0AA 1MJ8H 4OLVL 3RX5A 2X4UB 3RUGE 4GOSA 2PYFB 4Y5YB 2Y23A 3SJVA 4D0BB 1FFPA 4MD5A 4S1DC 5HHXH 4MZ3A 3JBG7 5DJZA 4AM0A 3M07A 4OQTH 1IQDB 3SGEH 3LD8B 1BBJA 2ICWI 2IG2L 3QXWA 1BAFH 4GBXA 2Y06H 4FFWD 3UTTE 4G9DB 4JE4B 4LSVH 1KBGH 4D2NA 3OZ9L 5EC2A 5IMMB 2VZUA 3L5JA 1MFAH 1A7OL 5IVXE 1II4E 2R4SL 2X9YA 3NPSB 5A16B 3UYRL 5GRWA 5FO7A 2AQ2A 5I0DA 1IAOA 5LBSL 4AIXA 3IGAB 4X5LA 1U8PB 4NOBA 4N1CA 4W68A 5F1KC 4P9ML 1CQYA 3P77B 5IHUL 5IJVA 4LHUG 1FC2D 5CZXD 2VQUA 2Z93B 3IDGA 1M7IB 3FN0H 4MSWA 3ZE0F 3QDMD 5DRZA 4IIQB 1KIRB 4U1SB 2JJSC 2NY4C 2HMIC 1PY9A 4G8GE 4MCZA 4XP5L 3IDNA 5GSVB 1X4YA 2X41A 4G3YL 4WU5B 4BZ2H 2C3WA 1FRGL 1C5DA 5E8OB 3BD4A 1DVFB 3ULVH 1I7ZA 3IVKA 2HFEB 4NP4L 4P23B 5F21B 3BZ4B 5DWUL 4P3DB 3STLB 4MNGE 2W9EH 5D7JD 4J3VA 5A3IC 2OS7A 3QULB 4TN9A 3E6FA 4KAQH 1SBSH 1B0GB 2XWBB 3VU2A 3NGBB 1IVLA 4FZEH 4ODTL 5F93C 4PRIA 3OJ2C 1S5IH 3LQMA 3WNOA 4DOHB 3G08B 3MJ8A 2HT3C 4ZSOA 3OKLB 3FT2B 5F44A 3CCHA 4WUUD 1NCWL 1NCTA 5GRUL 2AXHA 3L3OA 5T5NG 5KOVC 5IFJB 2NY0C 3VXSD 4U2YA 1NSNL 2JK5A 5IJVB 1SYVA 5I73B 4CRPA 2NX5D 2X44D 1A9EB 4P46B 4N0UA 3V7MA 1IZKA 4I77L 5CD3B 4K23L 4GLRH 4YZFF 1AXSA 1BM3H 5D2NB 5E2UL 4CMMB 1UKQA 1YJDL 5CSBA 3BH9B 3MV7E 2NLJB 3TPUA 3CX5J 4ZFGL 1PD6A 4QXUH 1DN2A 3B9VA 3VWJB 1PG7H 1VA9A 3G6JB 3MUGB 5L7XL 3GDBA 4PFEA 1Q94A 4UV7H 1G6RA 3TESA 1FGNH 3UJJL 1MCNA 2ITCB 2VUOA 4U6VH 3MO1A 5IMLA 4RWHA 3DSFL 4Z9KB 2HFEA 4P23A 5CINL 3CFEA 4NWTH 1KB5L 3TV3H 5KSUB 3LKPA 5I1CL 3GEWB 2E7HA 3JTSA 2X4SB 1QFWI 5JPMB 5CZVH 3GSXA 4M7LT 5LGHH 3MLTB 5MENB 4MYWB 1MCSA 2YPLB 3ULSA 2R1XA 3PHQB 1KGCD 3LQZA 1OM3L 1H3PH 5EA0L 4QXGH 2NY1D 5JDSB 4PJHE 4OSUH 3IETB 3HE6A 5ESVB 5H8DA 5CEXA 4WCYH 2FX9H 3CLEL 4JJHA 2FJHB 4XNXH 2OZ4A 5E1AA 3LS4H 4JO4H 3OXSB 5EBLA 3LV3B 1RHHA 2YN5A 5I8OL 2WBJC 5GS2D 5GS0C 3QIBB 5M94B 1J9CT 4GUPA 5DUPL 3Q6FB 1ZT1B 1P84J 1T7VA 4FQ1H 3EFFB 1EBAA 2DLEA 2Z91A 3C5JA 1MCJA 3I6KA 5KVGH 3V5KB 3TPUB 5T3ZD 1TCRA 5F7KC 3VFWB 1YY8B 3L3HB 3SDDC 1TJHH 2D7NA 3M1BA 1RZ7H 4EUPB 4XCFH 4Q7DA 3RI5F 1G6RB 4MJ5B 1NBVL 3WFHB 5F1NA 3GRWA 1QA9B 5GGRY 5KG9B 1RZ8A 3O6ML 4GKZB 2JF1A 3STZB 4LP4A 2G60H 5DURB 2P7TA 5BV7L 3K74B 5JHDB 1RZFL 3JV4A 1GGIH 5I9QC 4YR6A 1QBLH 3V52H 4ZOAA 5C0AA 1WQVT 2DMBA 1CQKA 4KHXH 1MAMH 3FRPA 1WGOA 4TSAH 3REVB 1NPUA 2LE9A 1UWXH 4PG9A 4WFHD 3G6DH 4ZAKC 4F3FB 1IBGH 4KGLA 4LEOA 1KACB 5JOPE 3DETD 3PWPD 3GSXB 4HV8A 3WO4B 4ELME 4OLVH 4PTTB 2C1PA 3PDDA 3VH8G 3V0VA 3DWTA 4PRPE 1CDGA 3WN5C 5CEXB 2QQNH 1J05B 2QQKH 4UBDD 5FYKL 2WIIB 3ROOB 2C3VA 4PJ7A 2ADGA 4DW2L 4FXLA 1A6WH 4N0FA 4HK3J 3LV3A 4JKMA 1U91A 5K9JL 2X4TB 5E2TH 3PGDB 4JM4L 2IF7A 2ZCLL 3O4LE 1NGZB 4JG0L 2DYPB 3K2UL 2GTWB 1G0XA 3DUUB 3QUYC 3DX6A 1TJGL 3HB3C 3HG1E 3MA9L 4LSQH 3KS0J 1BWWA 4JFXB 1EHXA 4F7MB 5D5MF 4X6BB 2SEBB 3CSPA 2D0HA 1F8TH 1RK1B 3ZMRA 4KUCD 4PB0H 1N0XH 3SKNA 1BQHG 1YY8A 5I1AB 1JHTB 5IBLC 4WI6A 4MXWL 4P59L 4XB8A 1JNJA 5E00A 3ZL4H 3GIVA 4QRUA 4KMTL 1S9WB 3HMWL 4H26A 1RPQA 4CADA 1IQDA 2X4RB 3STZA 1XH3A 4PR5A 1CDBA 1OAUL 4KQ4L 5E0QA 5JORA 2HT4C 3GMMA 1N5AA 5ISZE 5TF1H 3IFNL 3AS1A 2FECL 5IB2B 3DBXB 4Z18A 2NZIA 3CH8A 1F5WA 3QFJE 2W9DL 2WIIA 3L3JA 4PG2A 5FDWA 1MCQA 4DTGH 1JGLL 3BPOB 2B4CC 3HUJF 2BNQA 4RFOH 3NIFF 4M3KB 2AJXH 1FZOB 3PNWA 2DWDB 3UTOA 2IADB 3PDGA 4FXKB 5HGDB 2X1QA 4P2RB 3VXQB 3OKLA 1ZXQA 4OFDA 4JRYB 1I9JL 3K0WA 4NQCE 2H32B 3LS5L 4WWKA 4GMTH 2IANB 1BQUA 3QRGL 1VGEL 2DF3A 5C7XH 1KCUL 3LZFH 4P2CG 4AG4L 4ALAL 4U7KA 3FO1B 1U95A 3VGAB 4H1LA 4XPGL 4FNLL 1HKFA 5J1AA 3MA7A 3EIFA 4HS3B 5AYUH 1EEZA 3IJYA 1AHWC 5K9OB 4P2RD 3QNXB 3C9NB 4I3SH 4P99A 5SV3A 2GEEA 3CSYB 5LAXA 4MS8D 5DJCB 1T3FB 3TYFB 2D7QA 4QRTB 4IRSB 2X4PA 1DL7L 1S9YB 1LE9B 3SJVD 4ENED 4D9QE 1HSAA 5FDWB 5ESQB 3FRUA 2F5BL 3MLUL 3WSQH 4G7VL 1A7NL 1HZHL 4ZODA 1WBXA 1JWSB 4HIXH 3STBA 3DX8A 4GRMA 2IAMD 4L9LA 4GLRI 1X5FA 3WKNA 2XTJE 3A6CH 5FM4A 3ARVA 5I1CH 4LEXH 3WIHH 3KYNA 3VA6A 2A9NH 1QFWM 2CGRH 5D93C 4OCYL 4CGTA 3BZFB 3MLVL 4OZFH 4ODWA 1LO4L 1RUPL 3UJJH 5GZOD 2V2WA 2EYTB 5KVEH 4NM4H 4PGZA 4LASL 1CT8B 5FKAB 3MLRH 4RMUA 4N90E 4JRXD 1CGUA 3I6LE 4YDKH 4G8GD 3ARDA 2OJZL 1T1ZA 5DVOA 3HUJA 4DCQB 4J3SA 1I3GL 3IF1A 1F4HA 1JNLH 1BVLB 3AU1B 4IOSD 3C9NA 4WTZA 5EU4B 1NMAH 1FE8L 2A1WH 4CMHC 3RPIA 1NCNA 4X7SL 3UJIH 3RWIA 3BN9C 5SX5K 1QQDA 3G5VA 3TJHD 3U4BL 1NBZA 3QDGA 4KDVA 5H94A 1FL5A 3MBXL 1B88A 1CFQB 1BZ9A 4HK0A 4Z7VA 1R6VA 4OGAC 5E5RB 1EJOH 4OZGF 3VW3H 1XGUB 1WTGT 4MAYB 4WY7H 1JWSA 2OMBA 5IW1B 4FQCL 5FGSA 4W4OA 3BD3A 4RGOL 2J5LB 1JPTH 4PP1C 1LO5B 5IEHB 4QY8A 3BRGC 4M6ML 1H3UA 1I1FA 4CVXA 4XHQA 5CGTA 5C2BL 1K8DA 1YNKH 3CDYA 1Q38A 4OIIH 1IAOB 1LO3H 2GK0B 1BFSA 4P23D 1S7WB 2QSCL 1KTKE 5GJTL 3O0RL 2D4DA 1MEXH 2Y72A 5EZJB 3T0EE 5CJQH 3DARA 4G42A 1ZT4B 4MVBD 2L7UA 5GS1A 2I60L 4LU5H 4HUXB 4JFEB 4QRRE 1EMTH 5BJTA 2HJFB 4XC3H 4HF5L 1Q9LA 4M1CC 1X5XA 4EDXB 3U0WH 4LPCA 1X7QA 5LGJA 5I9QB 2BDNL 4DKAA 5C92A 6CGTA 4WNQB 3NFNB 4BZ1L 2DQCL 1QSEB 1QBBA 3MGOB 4P2QE 1A1OB 5GSRB 3SE8L 3L3IB 4WUUA 4DKEL 5BO1H 4DZBB 4WEUD 4J4PC 1T7WA 1P69B 3UMTA 3MOAL 4JPWL 3LIZL 2XZAH 1NBZB 1DFBL 3CGTA 3RY6A 3UAJD 5HHQA 2DYPD 2Y5TA 1JV5A 2C1PB 5E08H 4GAGH 5C71A 3FHAA 2AGJH 4JHAH 1BAFL 3KNBA 3S36L 1DJSA 3VXUE 1UWGH 1XGPA 3C6LA 3LQZB 1XGQB 4PJDB 4GRLB 3K8LA 1LD9A 4PRHB 1G9NC 3CDCA 5CBAA 1I1FB 4CVXB 4JFHE 1QO3A 4FQIH 1JTOA 3EYSL 4N5EC 2HTKD 3T8XB 3SO3B 5B38A 1JRHL 1MVUA 2DMKA 2AEIT 3S4SG 4OJFH 5TPWH 1AGFB 3MOQA 3C08H 3N1QC 3C6SA 4EDXA 1KLUB 5KSVB 1CDUA 1K2DB 5DA4A 4KC3B 1MI5B 2DDQL 3FONA 1U42A 3L3KA 1QTYT 4MA3B 1B0WA 4HAFA 2Z91B 1VEOA 3QXAA 2CUMA 2EDBA 5CJOL 1YYLL 3PXHA 3B9EA 1GC1H 4LQFL 5E4EC 3PQYE 2XOTA 3VGEA 1LEKB 3BPCA 1N26A 2UYLB 4YPGB 3M17B 4OCMC 1S9WA 4LRIC 1CS6A 5BRZA 5F3BA 3GSUB 5C0DA 1CLCA 4MJID 4XMLH 5JW4R 1BP3B 4OF7A 5CMAA 4GQPH 5T1LD 4RISL 1P4LB 5JHDA 4HWZB 3CSYA 4NM4L 3WIFA 4X6DA 3SDDB 1BGXL 1F4XL 1KB9K 2YPVH 4X7CC 5E6IB 4QTHA 1CGXA 5B4MD 4Y2DA 4EQ3A 2X5PA 4WI9A 3TN0B 5C8JA 1KENH 2X1PA 4UT7L 2B1HH 4U1IB 1KV3A 1VPOL 1Y6MR 2ESVA 3PWPA 2YD2A 1EJOL 5INCB 4WFEE 1CDHA 4MJ2A 5CJXA 5E4IA 1T20A 2Z31D 3QDGE 5BW7A 2ARWA 5CIPA 3GMLB 3U0TB 4JKWA 1MELA 1H5BC 4Y4FB 4RIRA 5C0AD 2AQ1A 3ZYZA 1CGTA 1XR8B 3FN9A 4HEPG 2FSEA 1DBBL 1ZHLA 1WEJL 2VXQH 1R5WB 2RIKA 1RUQL 1S3KH 2ZSVB 3EJYD 1V3KA 4PJ9C 1A64A 1HHHA 1A1MA 5HI5D 3ARDB 3IJYB 3L3KB 3AXLB 3Q3GA 2HRPH 3UPRB 5JHLH 4L4JA 1PSKH 1HCVA 4UILH 1QFHA 2E27L 3AC0A 1F4WL 4IDJH 4ORGB 4PJ5E 1FV1A 4YDIH 3RWGB 3EYQD 2A9NL 4DOHE 1S3KL 4CADB 3QFDA 1A1NB 4WTXA 1D5MB 4AT6A 1U93A 4PJGB 3Q2CA 3FRUB 1P4LA 1PKOA 4KZDL 5B8CB 3C09B 4QRQA 1KCSL 3N1FC 4XBPA 3SDAB 1FN4B 4U1GB 4HBCH 2RFXB 1LGVA 2EIZB 5D2LB 1MLBA 5I16B 5FO9B 4EVNA 2VXVH 3PGFH 2G75B 4U1GC 4FQQA 1YECH 1W72L 2BSTB 1NMAL 2A1WL 4RX4A 5IHZB 1LQSR 3BQUB 2W9DH 4HH9A 4OKDA 1KELH 5GS3A 3WN5A 1ZGLB 4YLQT 3T77A 1CXKA 4U1MB 3VMOA 2OQJA 2DYPA 4TRPH 2R29L 4N90D 5HYSA 1BVKB 4WFHE 4GS7C 5E8NB 4LK4A 4GRWE 5I73C 4O9HL 3BGFB 5AG9A 1UZ6F 1K6QH 4LLWA 2PR4L 5BS0B 4IS6B 4XNZC 4TPRH 1ZHKA 4PJ8D 2DAVA 2YD4A 3W2DL 5F9JA 4G43B 3C60B 3NAAL 5HHMB 5GS0D 1AY1L 3BXNA 3SDXB 4ZS6C 3VFMB 5BW7C 3GJEA 1ZSDA 1TJIL 4ETQA 5IGXH 4Y5XB 1BQHB 1YMMA 5EIIB 4MS8C 4FN0A 5CJ5A 4OV6F 4LFHG 3MV8E 3VXSA 3SDYH 3CFBA 5DJYA 2DQGL 1H5BB 4Y4FC 2VR5A 1FH5H 3PWLB 2UY7A 4FFYL 4X7TA 2OXGA 1DBKH 2FHCA 4YXKH 4GMSL 1FVCB 5EC1A 4CNIB 2K7QA 3ROLA 5IOPB 4AYFA 5ISZA 1OP9A 4X80L 5L2KA 3T77B 5HDQH 1YYLH 1BLNA 3O6FC 4M93B 4MA1B 4X8JA 3O6KL 2AXGB 5FHAL 2I60H 3LEVH 3F7YA 4CU6A 2BSTA 5E8NA 5D9SB 1U8MA 5C7XL 2J8UE 2DI9A 3BKML 2COQA 5EZIL 3V9FA 4HIEA 3VRLE 3LKNA 3JWOL 1FIGH 1TVDA 3CFKA 2HG5B 4FQJL 2R39A 1FGVH 3P4NB 4K94C 4G8GA 5F9JB 1X7QB 5LGJB 4XWOD 1JF5A 5IVZB 3VI4F 1B4JL 1DSFH 1IQWL 3MA7B 4NNYB 4RZCA 2EDOA 4X9GA 4R2GB 4FABL 4LEXL 1FJ1A 3AB0B 5BZWB 4QHLB 5SWQB 3VFVA 4E42B 3RQ3A 2X4QA 2P46B 1EEYB 4Y4HC 1LEKA 3PQYD 2FB4L 3O9WB 3SY0A 5C1MB 2XICA 3IDJA 4NZJA 5KVGL 5J13B 1KN4H 3W11C 2FEEI 4LLUB 1ZT7A 3GKWH 5KN5B 1LE9A 3QQ4A 3O6KH 4PRBB 3VDAA 5DSCB 5C08D 1BZ9B 4OLUH 4S1QH 1X4ZA 5I0ZA 4NUJA 4PRPA 3KNBB 3HNTL 1YN7B 3NA9L 4RRPA 4X6DB 2JKXA 2ZOKB 3MV9B 1IBGL 3VCLB 1N6QH 3QEQD 1XGTB 3DMMB 3D0LB 2YPKA 3BGMA 3LKRA 4NKIH 4OZFB 3CVHL 1HH9A 5JIIA 5DEGA 2ZNWA 1GAFH 3BRFA 5E8DL 4Q6IC 3WO3B 5TDOA 5L8KB 2PYEB 1TPXC 5INDA 4K3JL 3VJ6B 3KLHC 3RUGA 3SKOB 1YMHA 1W0WB 4JZJB 5MEQB 5IB1A 1GOGA 4FP8L 4KY1H 1UCTA 4MA3A 4HMCA 2H26A 1WCBA 2A6IA 1GPOL 1X5LA 1KB5H 1QSVA 4JZJC 3RWHB 4UIKL 5EC2B 4NZTL 3KYKL 1GHFH 5LXGH 1Y0LA 2H9GB 1K9TA 5DEFB 5HVHB 4Y1AE 4Z7WA 4PJCF 5C2BH 5F1IA 2YC1A 1PG7L 3BGAA 2V2XB 4W6YB 3FQUA 3IDXH 4E5XA 3IDJB 5EO1B 3OMZA 1T4KA 1NAML 1RIUL 3E2HB 3BZEA 3QIWD 4I5BA 3KLAA 3BYTA 4QOKE 4HWZA 1HH6A 4PJXB 4IMLB 1U2HA 4U0QB 4NQSA 4YNYA 4OSUL 1FV1B 5HVWA 2BXYA 4NUGH 1BIIA 1TZIB 2F9BT 4FQLH 4GRLD 5DS8A 3RX8A 1SEBA 1I1AB 1ACYH 1BWMA 1FBIL 1OGAB 2C26A 3H8NA 2X42A 3ZHLA 3LB6C 2Y5TB 4R97B 4PGDB 2X9XA 4S2SA 3VD9A 1VCAA 5I18H 3MRIB 1QHOA 2HVKB 1WZLA 3BE1H 2Y1VA 4O02H 1JZ3A 4PJAB 5F89B 1BEYL 1JGEA 3GBLA 3CSGA 2XZCL 3PWUB 3VRLF 4PRHA 1G7IB 2ADIA 2APWA 4Z78A 4K3JH 1CFSA 3QIWB 4YDIL 3LHPL 1IAII 3QUZB 4U6VL 4R7DB 2E27H 4D8PB 4P5TB 1FNLA 4UV7L 3NCFB 5DYOB 4L4VD 2EH7L 4APQB 3HTLX 4B7IA 5KVEL 3IFOA 5E5MB 5L9DL 4LOUD 4NZDA 1XCQA 2HH0L 5DHYA 5F1IB 4E41D 2EE6A 3OB0H 2W0LA 5J6GB 3P9LA 5J89A 3IFPA 3EO1B 4JFOB 3NCYP 5GJSL 4BQ6A 1QR1A 1FG2B 3WUWB 3NCCB 3S35X 2BSED 1UB5B 2MQ0A 3LPFA 3PP3H 1U3HD 5C0FB 4PJXA 5B4MC 4MXVE 1Q9OB 3UTPD 2P8MB 5FKPB 2VDRL 2MQCA 1L9MA 5IP4A 2EEDA 5IBLD 4PTUB 3HR5B 4KK9C 1YUHB 3IS1X 4LRIA 1LO0H 3GMRA 4HKBA 3MRFB 4IMLA 2ZUXA 3MOBH 4NQDE 1WBXB 4UT7H 3PXJA 2P24B 4N0RA 3DV6B 2EDNA 2NQCA 2EIZA 4U2ZA 4P4RA 5HYJB 1RZFH 3QH3B 2X4OB 1EZVY 1UXWB 5AYUL 5I8EB 3MRBB 5I15H 4Z8FH 1KNOA 5DRNA 4NC0B 4IMKA 1MI5E 1T03H 1ZE3C 3C2SA 1F2QA 2OM5A 1IAKB 2DTML 3H7BB 4UAOC 3WHE0 3MRLA 4JDVA 1NC2B 1RZ7L 3N9GL 4JFDD 4P5TA 3BOVA 4J23A 4RISH 2X89A 1EK3A 3TT3L 2G9HA 1BBJB 4JM2F 4K23H 1TENA 3P4OB 2FCBA 4R90H 2R4RL 4M6OL 5HGBB 4RQQA 2J6EL 2YZ1A 4HXAH 4PJFA 2Y7QB 1QZ1A 4FQHB 4DZ8B 1A6VH 1ADQH 1OSPH 2ZPKL 4LPVA 1INQB 4JPVL 1HILA 5AEAA 4XHJC 4HKXB 1NGPH 1MCWW 1IT9L 5IVZA 4QRPE 3BP6A 3MV8B 1F58H 1IM9A 3ULVE 4GUPB 2HLAB 2XNAB 2X4QB 1NDGA 1MAKA 2DJ4A 2CJUH 5IQ7H 1WBYA 3GHEL 4JY4A 5F7DB 3W11D 3JUZA 5C0EA 3HI5H 5D1XA 4WHTA 1JZ4A 3CUPA 2A6JA 3ZDZF 1T6WA 4OD3L 4TUOA 3IU4L 1CD8A 4Y16D 1KF9B 2FZ3B 3L7EA 4WW2C 1V5JA 1KTDA 2YEZA 5ILTH 5JIHA 4MJ4A 3ULVL 3DHJA 2VAJA 3IDUA 1I8LA 5A1AA 3ARBD 2WP3O 4U6HA 4JFEE 2EDHA 4PB9H 3A67H 3E8UL 4IHOA 1A6WL 4OGXH 3DYPA 1S8DB 5F6HJ 3LAFA 2G9HB 4PV8B 1WFOA 4U05A 3DX7B 1S7TB 5I18L 3O4LB 3KPSB 3HNVL 4FQCH 1TVBA 3K2UH 4J3XA 2BVQA 4I18B 1PLGL 2AK4E 4LRNH 2NY7H 5GGSA 3CU7A 4XH2A 1IFHL 4YDLC 2R9HD 4NQDD 5DMGD 2HLFC 2XKSA 5CD5D 3MYJA 4HDIA 3U46A 2Y7QA 3GSRA 1KN2H 4PJGE 4FQPA 2YBRB 3GK8H 4I4WA 1KXVC 5H37G 4HJJH 4K9EC 4ODVH 4Y19B 1RZIA 1EJ6A 4UB0H 3SGDH 2J12B 4L4TD 2R1WA 5DJ6B 4WHTB 3AUVA 4L8CB 2X4PB 4HZAA 1NDMA 1IGTB 2IMNA 3VXTA 3W39A 3C60C 3HCVA 2XZCH 4DK6A 2ZG2A 3H9HA 3RDTD 3AFLA 2J1KA 3UBXI 3VG9C 3CUPB 3FB6A 4NRYB 1H15B 5FO9A 2E9WA 3OKMA 3O4LD 2BVTA 3SGJC 4RX4D 5IBUB 4FTVB 3T1FA 3PWLA 5JMRA 2EH8H 2NY6C 3D2UA 4OZFA 2F54D 1R3IL 3O2DL 3I9GL 5EB9A 1ZGLM 2VB5A 2YRPA 1CL7H 3JTSB 3QDAA 3ZE2E 4RMVA 2XACC 3RNQB 1SVZA 4HSQA 3ORJA 5CEYB 3MGAA 1M6OA 4PJBA 1G7IA 2ADIB 1VDGA 2DICA 4JFQA 4J7RA 4Z78B 3QDMA 4Y1AB 3E1F1 1D5IL 1T1YB 2Y6SC 4XPAL 1J0IA 5A2IH 2OL3B 3NZHH 5DMIL 1KJVA 3C60A 1LP9F 3ZYJA 3W5MA 4O51B 2JCCE 5DQDH 5IJKC 4BFEA 4Z5RB 4YX2L 3D85D 4Q97A 2BVOB 3CVHA 3OXRB 3QCUL 4KJYB 1W8NA 3MLPA 2R9HC 1SVCP 1D5BB 1OTUC 2FIRT 3IFPB 2HLFD 2JB5H 3W0WB 2EO9A 5D1XC 1MCHA 5FM5M 3SE9H 4Z77A 2EH8L 2F8VA 2NW2A 4X4XB 2FGWH 3TIEA 4HJGA 4K7PY 1A14L 4DN4H 4HG4J 1R3LA 1HNGA 1OGAE 5D8JL 2IG2H 2CGRL 2JJVA 3R0NA 1CDCA 1FVDB 3VXNA 1IGTA 4APQD 2IH3B 2OZ4L 3S6CA 4Y5YA 4D0BA 1GZQB 5JLZB 1GC1L 2LAGB 3FN0L 3SCMD 2AJXL 4KK6D 3SKJH 2WAHA 4OF8A 1EPFA 3OKMB 2AXGA 1P4BL 3WE6A 1DL7H 1N3NB 2CSPA 1DVFA 4K8RC 4NM8H 5FEBA 4NQEA 2JCCF 2ATKB 1JTPA 3KGRA 4L8DA 1IGIL 4P5KA 3BISA 4RNRB 1G7HB 1PDKA 4HUXA 4JM2D 4LL9A 4ZO6A 2EXWD 4E0RA 3B8YA 2HA1A 3UTTA 2LAAA 3QWOB 1QNZH 4MJIE 2HFFB 3VRIB 2NR6C 5ANME 3H42H 1J1PL 4GRMB 3DX8B 2YUZA 4N68A 5DWUH 5T3XE 1O7SA 3WFBH 3GM8A 3EUUA 4KJYA 3RGVD 3WLWD 2CRMA 2CK2A 4MA8L 3QG7H 1H0DB 1JIBA 3QUXD 4ZDHB 3SPVA 3JXAA 3NAAH 2GJ6E 2P8PA 2Q6WA 3ZHKA 5D8JH 3CVIL 3N9GH 4K3EL 3ULVC 1U93B 4PJGA 2DTMH 3G5YA 3IDIA 4WTZG 1D9KA 3WFBL 3KR3L 4UTBL 2VXTL 1DVFC 2JB5L 2P5WD 2P24A 5F8RC 3S7GA 2H3NB 1ZHNB 3JV0A 5C0AE 1QSZA 1TNNA 2FWOB 3C6LC 4AQ1B 1CI5A 5MI0B 1AD9B 2ZOKA 3MV9A 4DVRH 3D48R 1XGQA 4RGNB 1UH3A 2YD1A 3KAAA 5GGSY 4JHBA 4Y5VA 4O2EB 2JLLA 3BQUA 4LPWA 4QTIL 4IRZH 2XZZA 5IB3A 5EZLA 1Q9WA 4U3XA 2E7BA 5F7HA 2O5ZL 4HUWB 1LK2A 1VENA 4XVJH 5HVGB 1J11A 5D70H 3QFJD 3D39D 1OGAD 3L6FB 3IS0X 5EZOL 2CUHA 2VZVA 4HFUH 5DK2B 3GB7A 3QUYA 1T1XB 3RFZC 2GJZB 5J6HB 4UQ2B 3WFZA 4YGVB 5BS0A 1CG9A 3QXAB 1CFVH 4C55A 4HKXA 5HXMA 1F8TL 3UC0H 1L7IH 1RK0A 1Y6KR 4LSUL 2F5AL 1J8HE 5HPMA 4QOKB 1N64H 3DGCR 1T03L 2MNUA 4HUUB 3VFGL 1CD1B 5DD1L 1JI2A 5TQ0L 3QWQB 3TCLA 3G5YB 3VXSB 3UAJC 4I2XA 3MV7A 4LGSB 4R96B 5T33H 1S7SA 1MQ8A 1CDIA 3OF6D 3CFDA 1CICD 1FORH 4M7ZC 1N8ZA 1WEJH 5DUPH 5F1OB 5IW6B 43CAA 3MO1B 5IMLB 3JVGC 4RA3A 4Y2DB 2HWZL 1X5YA 1BZQK 1Z9MA 5AZ2H 4TULH 2IANE 4X4ME 4DVBA 4KVCL 2OI9B 1RJYA 4BSWA 4NQCB 1F3DH 4RMTA 3BZDA 1SEQH 5IM7B 4GW4B 3G5ZA 1OQOA 3NACH 4LVHC 4LCUA 1N64L 4UNTA 1SJHA 1QBLL 3BWAA 5HYJD 3MROA 5AAWA 5BXFB 2VDQL 2HYMA 3ILQD 1H8OA 1E4XH 5CEYA 3GSWB 3Q1SH 1CFVL 3WDHA 5JOFA 3K81A 3WIHL 1K85A 1IGYA 3C6LB 1WICA 1YYMH 5SWZA 3BP7B 5L6YH 2JCCB 4I4WB 5ADOH 5EZOH 4ZUWB 2DM3A 3FB8A 5I30H 4ZOCA 1AXTH 4Q2ZA 1UZ6E 1KB9J 1NMBL 4M6NH 4XWGL 2DQUH 5CP3H 1LO2H 4NHUB 1R3JB 43C9B 2BRRL 1D5IH 4UOW1 1UVQB 5D7LE 4XVUD 5LWYL 4A6YL 2ZUUA 3BIKA 5BQ7B 4ODXB 5J13C 5HI4C 1G7MB 2NY7L 4JVPA 4LDLB 5DHVH 2XTJB 3KYOA 4JLRA 2D31B 4L4VB 1NGYA 1MCEA 4JY5L 5AZ2L 3S3PA 1UWXK 2BP3A 5I66B 4Q0XH 1BOGB 3SOBH 4NKOB 3LZFL 1GXEA 4FQQB 3OAZH 5I1LA 4JFYB 1AGEA 2LABA 5LCVH 1AHWB 5JPNA 2P47B 4DEPB 3E3QC 5CCKL 2ICWJ 3VDBA 4EI6A 1PYWB 4KTEH 3LEYH 4HPOL 3QO1B 2DD8H 3WS3B 1HYRC 4PJ5A 2XG4A 3NCEB 4URTB 4PBVC 3DX7A 1FGNL 1GCFA 1JE6A 1HXMB 1G1YA 5L7XH 3KWWA 3DSNA 1KJVB 2O5ZH 1V05A 4L5FL 4IDLA 5FOBB 3FB8B 2A6DB 4Z7WB 4PJIA 4NO0D 3ZKQD 1SMAA 4PGEA 3BKYH 3E2HC 4YFEA 2GJ6B 4XWOC 3DRTA 1L9NA 3C5ZD 1XEDA 2BMKA 4FQ2H 3K8KA 4JFXA 2PTTA 4Y4FA 4OZHB 2ENYA 3FT4B 4K3HA 4MX7A 2M2DA 5T3XH 1S7UB 1WBYB 5F7DA 4P2RE 1MWAB 2OTPA 1IC7H 1JHKH 1LWRA 2VDRH 5KZCD 4OZIF 4L8SB 1KULA 1MAJA 2Q20A 2RCSH 3SDCA 4L8BB 4Y8DC 1FSKC 3I3BA 4X7TB 5AZEH 1FNEA 5A43C 1OPGL 4R3SB 3QI9D 4EUPA 3SJVE 3ZKSD 5A2FA 2Z8VC 1IAMA 1N0XL 3KXFA 2C4XA 3RU8L 1DBMH 3QG7L 4PS4L 3PABB 4L5FH 4X6DE 1BMGA 3ISWA 3T1WA 4QKXB 4H8WC 3KG5A 2XRAH 1K6QL 4UTBH 1LE5B 2ATPA 3TA3A 2XRAL 4LCYA 4MD5B 3AM8C 3DMMC 1TVBB 3NIGE 4XNZB 3NN8B 1MVFA 2BFVL 4MDJA 3GMQB 1QSEE 2QADB 4P2QB 5EU3B 3SE4C 1UWEL 1MNUL 2EC8A 4NN6C 3ZT6A 2AJVL 1YEKL 1KJ2B 1YNTB 3I6GA 1KEGH 2VZ1A 3QISA 3SDAA 4Q9QL 2FJHA 3L95B 4GXVL 4MAUL 1T1XA 2ERJC 3OR7B 5EU6D 2PR4H 3MRGB 3WO4C 3KYNB 2W92A 2O5XL 3L9RA 1O7VA 2CDFB 3ARTA 1KCSH 3WFEL 2IQAB 1NCCH 4OUUB 3U9UB 4DQOH 3BP5A 3V5KA 1CIDA 1A47A 4JDTL 3L7FB 1K2DA 1DBAL 3MRFA 3O45A 5C9JA 1KIQA 8FABA 3INUL 4YE4H 4YXHH 4TUJA 2KBGA 1AD9A 4XHJD 3RZCD 1RI8A 1RJZB 2GCYB 3TO4D 4XNYL 4NO3B 4JM2A 3OR6A 2DKUA 5F71A 5F88A 5IMOB 3DX9B 2PYED 1XGTA 3TJHC 5EU6B 5DC4B 4HG4K 1MCPL 1A5FH 4YDVA 1RVFL 2I26N 2IBZY 5CJBA 4HCRL 3H9SE 3F7QA 3O3DA 5H94B 1YEEH 3DGGB 3SKUD 5E2WH 2Z31A 4OQTL 1DANU 5T1KB 2OR7A 3SCMA 1AGBA 4XPAH 5JORB 3MRDB 1AKJB 3D3VD 4EI5D 3OAUL 5E8DH 3QUXC 3HZYB 3MBXH 4I0PB 1KB5A 3OJDA 4PLOB 4GW5B 1BPVA 2YKLH 4P2QA 4U6TA 2MPAL 2DN7A 2EIEA 4ESKA 1K5NA 4DZ8A 3E6FB 1F90L 2BXZA 4ZSOE 4FFWC 3U36A 4Y5XC 3BIBX 3QAZB 2FJFB 1NLDL 4QOKA 4F15B 3WFDH 4G9FB 3RY4A 1MIMH 1WWAX 4YDKL 4F15C 4QNPE 1IGJB 1XCTA 1I1AD 3EOAB 3V0WH 2OK0L 3MR9A 3U7WH 4D94A 3IDXL 3C5SA 4D9RE 4N8VG 4UQ3B 1OTTC 3EOTL 4MD4A 2I9TA 1BIIB 4Z7WE 4OGZA 3ABZA 1M71A 5CINH 5FA3B 4M1GH 2IH3A 1RIVL 2AK4B 4NN6B 1MCWM 4M43H 4RZCB 3ILPA 4NZUH 4F9PC 4XZUA 4LSUH 1F6AA 2XIDA 1UENA 4HHAA 4UT9L 4N8CL 3AREB 4WUUB 1U58A 2LTQC 5A3ID 4AEHL 5DJCA 3TYFA 1TZHA 4F80A 1F11A 3V6FA 1EGJH 3BEWB 2NTFB 4JGMA 1KB5B 3VA2C 5ANMA 2I5YL 5EUOB 3TBSA 1VADB 2VISB 4ZOEA 3SCMB 1Z0NA 3V4PH 2K9UA 2HT3D 1EA9C 3GNML 3LEXA 3U6RB 5JR1L 1DBBH 3EYSH 5DUMH 1NEZA 4PJ5B 1AR2A 3WNPA 1K4CA 1RMFH 5EU7E 3VI3E 1ZOXA 4F8TA 1MFBH 3LN4B 3GJFA 3S3JA 1KJMA 1KYOK 5IFAL 2NTSP 4YDLB 5IMMA 5IHZA 1RZIB 1OAKH 4MD0B 2FB4H 4KKNA 1MF2H 4GW1B 1DR9A 5HPOA 1R5VB 2EDYA 3D0VB 4PYHA 2AABH 4Q9QH 3C5JB 3I6KB 3T3PF 2FL5A 3V95A 2OR9H 1S9XB 3QA3A 3F58L 4UAOB 3QIBA 4XP1H 3VXRB 5DJ2B 4NQDA 3WLBA 5I15L 3ME0A 2HJLA 1R0AH 2B0SH 4MHHI 2XG5A 2VDPH 3ZSTA 1KGCE 5ABDE 3FB6B 4NRYA 5DI8B 3EFDH 2A38A 3CMGA 1HIMH 1OD7A 1NAKL 4EJ1C 4R3SA 4YHNA 1E4WL 3AMKA 3QUZD 5FA4A 4WHYG 3EO9L 3WD5H 3VXRE 4YHKH 4K71C 4P5TC 3U83A 5DFVC 4QGTA 2F74B 3QYCA 5C0BE 2IGFH 1UKTA 3RNQA 3MC0A 4GH7B 5DJDA 2CIIA 3P4OA 3NPZB 3V4PL 1TFHA 1L6XA 4HKZB 3GBNH 1QPPA 1QSED 5ERWB 4RFEB 4F7PA 3BKCH 2HVKA 1GGTA 5C0BB 5D6CA 2Q7NA 1N59A 5ACLA 5FB8A 5KSBF 4X4YB 1EBPA 3OKDA 3L95A 3MV8A 3VXSE 4K3EH 3AVEA 3UTSA 4RMSA 1IZJA 4P4KD 1YEHH 3RA7L 4P46A 1T2QL 4MAYD 4KK9D 5DJ2A 1N7ML 2WM0A 3QG6A 5I1HH 1KLGB 5BRZE 3FAWA 1D7FA 3EZJB 4WY7L 2WUCL 1MCDA 4J12A 3B9KA 5E9DD 4B7LA 4JB9H 5FECA 1N8ZB 4TPRL 2FBJL 4YGAB 4NQDB 5FYKE 5E00B 2NZ9D 4RAHA 2QL1A 2VLKB 4JRXA 1AJ7L 3J7HA 5E56A 5I8OH 5IF0B 3CX2A 2UVFA 4DN3L 2JTDA 4J3UA 4O2FA 1N5YH 3LKQA 4PJAF 4JFZL 2A2QT 3SE8H 1FFRA 3PL6A 3QPXH 2VRAA 4HGWB 4RBPK 2G5RA 1QBML 1FH5L 5HD8C 3BWAB 4KTYA 1IMHC 1S7QA 4CVWA 2AK1L 1JWUA 1I85C 5FGCB 3MUHL 5ERWA 3Q6GL 4UU9B 3PWPB 2OL3H 5C0CA 2R1XB 3PHQA 4OGYL 3THMH 2Z4QA 4Q6YA 1NGXB 4R9HA 1GPOH 2EDDA 3BP7A 4JEGB 4KTDH 1LO2L 4JZOA 1YEFL 3UX9B 3GMLA 2M1KA 3D1MC 3U0TA 3DO3A 4DGYH 1OD9A 4JKPH 3OJMB 2AXFA 1RIVH 4JRYA 3P4LA 3C2AL 5TGBB 5A2JH 3GI9H 5F1SA 4OZ4B 1XR8A 3VXMD 3OXSA 4TNVF 5DMYA 5EULV 1GIGH 3OX8A 1TPXB 2YSSB 1RURH 4XMKL 4KZEH 3IDIB 1MREL 5C08E 2IPTL 2XV6B 4TSCL 2R29H 1YQ2A 2GI7A 5SX4H 1S7UA 4KMLB 4ZO8A 4J2XA 3CFIC 5TDNA 3CXHK 4ODUB 5DFWH 5T3ZH 1NFIB 4RCAA 4J3WA 4CU7A 5I66A 4EKXA 3FFDA 3KPPB 3RUGF 3CLFH 2O5XH 4LCCC 2E5EA 4ELMA 2HJKB 2KQNA 4ZUUA 2IPKB 1I3UA 1D5MA 5LQBH 3BN3B 3T0DA 4RGNC 4KKCC 1L0QA 4QRQB 4M7KH 2CO6B 2PCPA 3SGKA 4RFNC 1FNFA 4UU9A 4QRTA 4OBSA 2P49B 2PXYB 2UZYB 5JO5B 5IK3A 5CD5C 4GRLA 3R1GH 4LP5A 1WC7A 1JL8A 1CL7I 3M8OL 1RURL 2E8ZA 2XTJC 4XMKH 5IBTL 1BGXH 1JWUB 1F4XH 1PJ9A 2YPVL 5ICXB 3D9AH 2VH5L 3BESR 2XFXB 4RNRA 4RFOL 3RVXD 2A73B 3WS6C 3HMXA 3HPLB 4MLIA 5HI3C 5ISZB 5TFSH 4ZFGH 4GAFB 1S5HB 4K8RL 2X1OA 2CKBB 3UBXB 3MR9B 3B5TA 1E4KC 3L3DA 3FO2B 1ROWA 3CDGA 4HWEH 5I8KH 3TVMB 5J3HC 1S7SB 2V2WB 3FFCA 1A3QA 2UUDK 3BP5B 5DQ9A 1FNGA 5DVNA 2ZOLB 1EVUA 2AI0L 3HLAA 1RUAH 2NY1C 4YEFA 1ZWIA 1KPVA 1MFDH 1OAXL 2W65B 3VD7A 4PYGA 3MGTB 3RVUD 2VL4A 1Z0MA 3ULVD 3W82A 4Y1AD 2JE8A 2OJEB 3B4NA 5TDNB 4ONHA 4FZEL 1U8KA 4ODTH 1WWCA 2DM4A 4M62L 4PJCA 4JREB 4NQCA 4YXLH 3HNTH 1U3JA 1CWVA 2X05A 3E0GA 5IB2A 3VG0L 5IGXL 2F53B 3L3GB 4YH6A 4KDTC 3VXTB 2AS5M 5ADPL 4FZ8L 5I8CA 1V3JA 4G8IA 3REWB 4FA8A 3CXHJ 4ZNEA 3VE0A 5FGBA 2FX7H 3LPWA 4Z0BL 4JFHD 4PJHF 5E2JA 3AREC 2PCPB 3RY5A 5GIRB 1FFQA 5DJDB 3NFPA 4WV1B 5F9AC 2LTQB 1IGYB 4BUGA 5HTSA 1OL0A 4I0PA 3F5WA 2EXYC 3RWJB 5CKAA 2H6PB 1MLBB 4PRPD 2FHBA 4PY7A 5B8CC 5T1DL 5C08A 1IAIL 3TNNB 4JQXA 4F7PB 4JFPA 4WW2F 5KVMC 3UYPA 1BD2D 3EYUL 3DUSA 5HHOA 5SX4I 3EYOA 1C1EL 3F58H 3H9YA 3OKDB 4OZIA 1P6FA 2HJFA 2VAAA 1KELL 5I74B 2UZIL 2JIXA 3H42L 5HYSB 4OLXH 1QBMH 1YA5A 2WBKA 2F53D 3RUGB 3SKOA 2H32A 4HD9A 2MHAA 5E2TL 1RUMH 4MNHB 1ADQL 1OSPL 4A6YH 4HBCL 4ONGL 5IVXA 4LVOB 4KKLC 3MGTA 1JYVA 2BNRA 2VR4A 1I9IH 4M1DH 4OZGB 2JELL 1UH2A 2ITCA 1O0VA 1PZ5B 2VDMH 3O3BB 4YHML 4OFYD 1QRKA 5I30L 4Z7QF 1SY6A 5CWSA 1T21B 1OQXA 3X17A 2AW2A 1T1WB 4G6ML 4PD4K 1OTUD 4CU8A 1CBVH 3CD4A 3TIDA 3H9SA 1FG9C 2EDLA 3VXUA 3OAZK 1LO4H 3HI1B 2VLJB 1FYTB 2DL9A 2AJYH 2BOCB 2VLMD 2RR3A 3BZ4A 3D87B 4PBWD 2YPLD 5ANMB 3MRMB 2E9JA 5K59E 4LSQL 4PLKC 4HC1A 3T0EC 3QPQC 3T0BA 5JNYA 4NQUA 2VISA 1G1CA 3LKOB 3JWDC 4KQ3H 3V0VB 1HH9B 4ZQKB 3MRNB 4KDWA 3FTGA 4AL8H 1QLFB 4L1DA 5FM8A 2DM7A 5TE7H 3ROOA 3BI9X 3MRJB 4I0PD 2AK1H 3UJTL 5TGBA 3EFFA 4CW1B 1MFCH 5D1QD 5DGQA 1QEWB 3QIBD 2K1MA 2KPNA 2Z93A 5FECB 3B9KC 4NRXB 4LKXB 3ZDXF 3OG4B 2GTWA 3SE3A 1JGVL 3MJ9A 4XXCC 32C2B 3QEUB 3R4DA 3ZLQC 5DXWA 4NQEE 1XCQB 3UPCA 1JWMA 4YPGA 5HGAA 2FEDC 1N4XL 1MCKA 5EOTA 4ORZC 4AEHH 3R0MA 5DD1H 2FECI 3FZUC 2W60B 4RDQG 1BVLA 1EO8L 2MKLC 1CTNA 1U58B 5JXAH 1PZ5A 3QRGH 4MWFA 5EUOE 3PWNB 3TA3B 1DEEB 3PL6C 1UADC 5I1GL 1NCUA 4ELMB 4GSDH 2OR9L 1P2CA 2Q86A 3TNMA 2GHWB 3VXMB 3LKPB 4F57H 5CUSL 1I9JH 3BE1L 3EHBD 4PRBA 3THML 3GMMB 3WFCH 2R15A 3S9DB 1GZPB 4CVUA 4OD2A 4JZOB 1FYTA 3F62A 4LVOC 5AWNH 3O2DA 1EHLL 1DDHB 1A7QL 5KVFL 5IHLB 5ALBH 4EIZC 5GS0L 3FCTA 1DLHB 4WU7B 2DM2A 4MAUH 4MQSB 4DKFH 5T1LB 1AC0A 1KEGL 3QEGH 3BIAX 1TMCB 1UB6B 4I0KA 2XWJA 5DO2D 1QEWA 5H35A 3P4MA 4IRJD 4U6YB 2GJJA 4LARH 3GUTA 3VXQA 3X14A 2BNRD 2ZSVA 5FYKU 3L6FA 2HJLB 1A6ZB 2YKLL 1G9ML 5GRUH 1YDPA 1KTRL 3I02A 2HN7B 2Y07H 1NFDA 5HBBA 3RWHA 4P59H 4QRRA 4ZO7A 4TVPE 3VRJA 4OV5B 1AIFB 3QIBC 1NCAH 5C0FA 3L3IA 4GAGL 2D0GA 2W38A 2B1AH 2XWTA 4M7LL 4AEEA 3KJ4C 4S1DD 4LMQI 1KOAA 2HJKA 3FO0H 1J5OL 4PJBF 5HHOE 2WQRA 4OZFG 5BV7C 1B6DA 5KG9A 1I1CA 2Z8SA 4LNRA 5ILTL 4PPTA 3TH3T 1M05B 1PYWA 3FMGH 3RKPA 4OF6A 1HH6B 1F4YL 1T3FA 5T3XL 1D5XA 2EE3A 3TBWA 4JCMA 1ZMYA 4WO4C 4YNYB 5K9KB 3PL6B 3EDJA 4A6YA 1QHPA 1GGCL 1KPUA 3C08L 5EO9A 3VXMA 3U7YH 1ZA3B 4QXTB 4Y2DD 4HWBL 5HGHA 4CKVX 4XP9L 3B9AA 4NYLB 4ZG1A 4R4FL 3QCVH 4RFNB 2JELH 1X5HA 2EDJA 3NPSC 5DEGB 1HEZA 3WS6A 4JY6A 5D71H 5EN2B 3RAJH 5CJOH 4JR9H 4XCNA 4PGJA 4PJAA 2G75A 2ADGB 5F96H 4R8WH 1W72B 5T1LA 4TUKL 2LFGA 3VDCA 1T5XA 3BJ91 2W0FA 2CRIA 3RTQD 2I9TB 4C56A 1NGZA 5KAQG 2EE2A 5I75B 2V7NA 3GO1H 5CCKH 2EO1A 1KLUA 1A4KB 1CLZL 1A6PA 1U8OB 4P2YA 4WI8A 2ZNXA 2GT9B 4MCZB 2P8LA 4RDQF 4YAQB 3SO5A 2J5LC 3QJHA 4UOJA 1KT2B 4N0UE 4XCYB 1U36A 4PGCA 5KS9F 1FG2A 3RGVC 3WUWA 5IVOA 2UWEB 4MCYA 3AU1A 3B5GA 3MLWL 4ZPTB 5KTEL 2VWEE 4NHUA 4BZ2L 4IRSA 1ZLVK 4TUOB 2C1OB 3QB7C 1J8KA 5I76B 1V7NH 4YDJB 2IPKA 3ZDZE 5FV2A 3T2OA 5FHBL 5FYKH 5HDBE 5C07E 1H5BA 4X4MA 3LVEA 3OB8A 1F3JB 3NCBB 4RGMC 1E6JL 4ODSH 4G6FB 1E28B 3K2MC 1QRNB 4P5MA 2C3GA 5JO5A 1GH7A 2GSIA 3G6DL 5CIPB 3GRWH 2Q8AH 4QRSB 5K93A 5I1LB 5GRJL 1H3PL 2H8PB 2JB6B 5EA0H 2ZCHL 3EO0B 2KH2B 5EZLB 4UZGA 5BCAA 3IKCA 3P0YH 4AIZB 5BOPA 2P5EB 3H3KA 3ZDYE 1MJ7L 5ITBH 4HPYH 1ZHLB 2DI7A 1QVOA 4MMXC 4GAJL 3HAEG 3QRFM 2HT2D 3ZTJG 5CJ8A 4M6AA 2DQDH 3JV6B 1DQJA 4RA0C 3X11B 3OWEA 3WCYA 1CVRA 1LO3L 1JPGB 1G7PA 3K46A 3I3EA 3G6JA 3SDCD 3G6AB 1MUJB 4NO0A 2ARJQ 4JO3L 2VLRA 4ZFZB 3RWIB 4NN5C 1KFAH 4G80A 2GT9A 4H1LB 3QNZB 4M7JH 4LARL 1FL5B 3ARBC 1FJ1B 2DQFB 3RIAF 2VJXA 3NACL 4GJTB 5JQ6L 3CAFA 5MENA 3MFGB 4YQXH 5FCSH 3GBMH 5ETUA 3S35H 3BT2H 5E8PA 4YHIB 5F7NC 3H0TB 1A0QH 5DSCA 5ICXA 5EBMB 2GITB 3IFLH 3TWCH 2VE6A 4H88H 3O6FB 4M93C 4CN6A 3IETA 3UO1L 3IDMA 3QI9C 3X13A 4Q6IB 1I9EA 2XXCB 5FO7B 4CVZB 4M1GL 2XN9A 2BFVH 1MJJA 3O9WD 1MCCA 1T1YA 1YEDA 3O11B 4U3CA 4ETYA 2V5TA 4PJEA 3RL2A 5B3NA 2F5AH 4XPTH 1QVOB 5E9DA 4W4NA 4N8VB 3VI3F 1VFAB 3V79C 5AD0A 5I1KH 2L0DA 2DQIL 3IDNB 5GSVA 1QA9A 3MYJB 1T5WA 4XP5H 4ONHB 1BQHA 1FO0L 4WTWA 4HJGB 2X4NA 4QWWD 1T22B 4G43A 3IJHA 3EYVB 4MB4A 4HC1L 4F7CA 4BZYA 4XPHL 2LVEA 3REVA 4WFGE 2DDQH 4KRNA 5ESAA 1ORQA 4G9FD 3GSNH 5HHQB 1EXUB 2EDQA 4OI9A 1J0YA 2PXYC 4M7JL 3DROB 3AAZB 4A2LA 4IRJB 1JFQH 4N5ED 4NO2A 5GIRA 2PTVA 1YEKH 1A6UL 4X5XA 1U8NB 5C6TL 3HG1A 2I9LA 3O6FA 2VOTA 3MXVH 2AEWA 5DVLA 4XVSL 3FO9A 3DYMA 4ZSOB 3P40A 1Q1JH 1ZA3A 1AQKL 2AEPH 4HKJA 4L8DB 4P5KB 1AQKH 3ROLB 3ZKXB 5CILH 3EOYG 4ZFOL 1K8DB 4TTGA 3P9MA 5H35B 1FIEA 1XGRB 1OT1A 4L3CA 4Y8AA 3QHZL 3MRQB 3MQIA 4OLZH 1AE6H 3MRJA 4JG1L 4I48B 3OF6A 4MQ7B 5DJ8B 3MNZB 3HRZA 5IBUG 4JVUA 1IGIH 1RFDH 1JGUL 1MJJB 2E9IA 5DHYB 1ED3A 3VWKC 5CAYB 3DVGB 4H25B 5HHXL 4H0IA 3OHXA 4JFQB 5AZEL 1IC5H 5I1EL 1JUFA 5IROC 3GSNL 2RCSL 4MQXC 5DUBA 2B2XL 4NRXA 1T04A 3VFVB 2VLRD 4LCWE 3EYVA 1YN6A 7FABH 3KPPA 1EDQA 3WIHA 1KJ2H 3Q0HA 4I8DA 4FQ2L 5DJ6A 1M7XA 3VXOA 2DWEA 5C0DB 5EO0B 5ELIA 5E99L 4XP9H 1IGJA 2X4RA 5H37H 4XXDA 1T1WA 4PGCB 3BPLC 1JRHH 5LWYH 2MMXA 3P0VL 4OZHA 5BVPH 3IU3B 3RZCA 2RGSA 3T3MF 1LP9B 1A21A 1A7OH 2CLRB 5B39G 1I8IA 3QDJB 1QBAA 4XCCL 1A02N 4PLJC 3ZTJH 1I8KB 2DOCA 2OTUB 4OM1H 3MLSL 4Z7NE 2R0KL 4KPHL 5KAQF 1E4WH 4IRJA 2BJML 1T7ZA 3CH1A 1JK8A 4UUJA 3KHQA 3GO1L 3TP4A 1G0DA 5ESVA 1N2RA 4JN1L 3K1KC 2D3VA 1A6UH 2Y4SA 1T83A 5I16A 2BHYA 3HI6H 1WZ1L 1NH6A 1ZLUH 4V1DE 4UINL 5DRNB 3D3VE 4HJ0C 3TZVC 1UJ3C 3P9WB 1YNLH 3UBXG 4KKAD 4P3DA 3SDDD 2IANA 2R69L 1FAIL 4LSRH 4XPBL 2W91A 5B38B 3TF7C 3QAZC 2QJDA 4BZ1H 1RZGB 5KVDH 3GSWA 1K4DA 5JXEC 3QUML 4H25A 3DVGA 4GO6B 5IFAH 2X9WA 3GJFB 3MRPB 5EOTB 3OKEB 3W0WA 1G9NH 5I17B 1DQJB 4XC1H 1KJ2L 3VMPA 3B6SA 1K3ZA 1RJCA 2NW2B 4X4XA 2VERN 3RGVA 4LMQE 2BK8A 1Z9LA 4HWEL 5I19L 3OKKB 5C0AB 1LP9A 4QOKD 3NABH 1EO5A 3VXNB 2I5YH 4KHTH 5KJRL 2ITDA 1SEBB 2Z0BA 1TJHL 3W9DA 1KJ3H 5D7KD 5JUEL 2I25N 2X1WL 1J5OH 1A7RL 5KANG 2YN3A 1P5UA 4JFFE 3OPZH 5D1XB 3HE6C 1I8KA 3ARWA 3NIGF 5FYJE 4MA8H 2Z92A 3B2UD 3TFKC 1KPUB 5IM7A 1NMCC 1CZ8H 1S9VB 4EN3A 1W8OA 4GKSB 1FBIH 1S7TA 1P9MC 3JWNC 3S88H 1GVIA 1KJ3L 5D7SH 1IKNC 2NXYC 1DVFD 2A77L 4KVCH 2XXMB 5CS7A 3P4MB 4XCNB 5F9DC 2EICA 5DT1H 1OM3H 2YPLA 4XAKD 2VLKD 3QPQD 4PRHE 5J9PA 4ODVL 4R7DA 1UCBH 3VXUD 3OGOE 5IEKB 5BRZD 1CLYH 3WFDL 1FP5A 3BHBA 5E5MA 3X3FL 5TE7L 4OLYH 4FQXD 3M17A 2Q1EA 1YYML 3WNNA 2R1WB 3GIVB 1NGWA 4YHZH 2P8MA 5FKPA 5FYKD 1QLRB 3QJHB 1G9MC 4LIQL 2GJ6A 2NPLX 3CFJB 5AAMA 3KJ6H 1RUPH 4CN4A 3D39B 1V3MA 2O5YH 2FNBA 1REIA 4P4KA 5EPMB 1JNNL 3WUWG 1LDPL 3KPMA 3MMEB 4TVSa 4UIMA 3HI1A 3NTCH 4W81A 4QEGA 1CBVL 4TVPH 4LLUA 1PX3A 3HAEH 5IB5A 3AAZA 3GGWB 3MV9E 5CBEA 2BSRB 1IGCL 1MWAH 4MNGA 4YHMH 5DMKA 1KUMA 1PW3A 2EEAA 2VABB 1VACB 5IT2L 3RWEB 2CDEA 2CLZA 2YD3A 4XNMA 5IR1B 1S7WA 5JMOC 3GHEH 4PD4J 5GS1C 1TETH 4Z7UA 5EBGA 4NFCA 1NUFA 5KVFH 4HWBH 4M5ZH 3QEHA 3DXAE 1UT9A 1ZLVH 4D9RD 4OQ1A 3MODL 3ECBB 4AENB 1ITCA 5GGTA 1CXHA 1VADA 4WI5A 5E03A 5EBWB 5D7SL 1HHKB 4RSVA 3VJ6A 1FPTL 4PJIB 1A4KA 2QHRL 1YMHB 1NEZB 2F8XC 4JRWA 3O6LH 1FO0A 2D9QB 1KCUH 2Y06L 1DUYA 3C5ZA 1A9BA 3KPSE 1FCGA 1U91B 3EOBB 4UNUA 3F6LA 3CNKA 3QNXA 2W0PA 1A3LL 4KKLD 4MWFB 4NJ9H 1ZLUK 1NEUA 1NCAL 2C1OA 4G5ZL 4OUUA 4YFLF 1CE1L 3FQUB 2BC4B 3OX8B 5C07B 1FL6B 4W4OC 1ZANL 2OTWA 1P2CB 3LN5A 4R4BA 4NRZB 4JKKA 1F4AA 2IBZX 4L3EE 4PRPB 3BP4A 1ZHBB 3FB5B 1GZQA 3QCUH 1HE7A 5CLTA 3RTQB 1U92A 4JZNA 2V2TB 4LNVA 1U6AL 3KYOB 4JLRB 3LQAL 3V6BR 3BMWA 1T0MB 4MAYC 4LHJB 1EERB 1GGCH 4AY0A 1EFXB 5D7JA 1TETL 3F7VA 4X6CB 4U6HB 1KYOJ 1EHLH 1BX2A 1QFWH 5JPMA 2YRLA 4KK8C 3LKSB 2J8UA 4DEPC 2PF6A 5CUSH 1AFVL 1OB1B 1V8HA 5IJKA 5GGTH 2HN7A 3I02B 5LBSH 4UOW0 2VLRE 3KPLB 4LVNB 2BHUA 1QR4A 3PV6A 2VDPL 4UDUA 5KS9A 3CFKB 1YN6B 5I2IA 2IJ0C 5FUZL 4LLQB 5C0GB 4I5BB 4JFOA 4QCIA 1KG0B 3D69B 4XNQB 4L3AA 5T1MB 4JANA 4NT6B 3LD8C 1QLEH 4PP1D 5F97E 1NCDL 5F3HA 4JFFB 2QQLL 2E7CA 3OR6B 5F88B 4C4KT 4H5SA 1QG3A 2VZOA 1YECL 1WWBX 3EJZD 4NKOA 3HE7A 2VXSH 2EYRB 3ALPA 3TCXA 2VIRA 3FQWB 4G6AD 1I9RL 1MRCL 1A6VL 1YN7A 2DQEL 4NN5B 3RTQA 1U8JB 1ZS8A 2P7TB 2VNCA 1QLFA 2X2YA 4IOIB 3S35L 4LDOB 4ONOA 3O2DH 4JM2C 2HTLD 5HHVH 4GAYA 1UXWA 4OF3A 3ZKND 5GJSH 1KENL 2PW2A 4WRLA 1JN6A 4HH8A 5I1IH 4DFHA 4G7YL 5EUOF 4MDIB 3KWWB 2WINA 4NJAH 4HUKB 3IRZA 2DQJL 4MDJB 5EU3A 3O2WL 3KJ6L 4HV8B 5CILL 4UDUB 1NMBH 4M6NL 2R8SL 2P5WB 5IV2B 4Y1AA 2BVOA 3CVHB 3OXRA 5M95B 1OB1A 2C3VB 1ES0A 3EOAA 4PLJD 4PUBL 2DMCA 3CCHB 1FLRL 4OCXH 3WEXA 3TCLB 4Z7OE 5KS9B 4C56E 1SY6L 2R56H 2QSQA 3MV7B 1CYGA 1HILB 1MCLA 3SY0B 5C9KA 2AJUH 4OFVA 5E24E 3ARFA 1PAMA 4PJIF 3PWNA 1AH1A 2VAAB 3VXOB 4ZUSB 3HR5A 2QHLA 5K9QI 4PY8J 1KIRA 5GGVY 3ZTNL 2FX8H 2R0WH 4KU1A 2AJ3B 1IC4H 4F7MA 5C0BD 4HC1H 4F8QA 1QACA 5D1QB 5DI8A 4H5SB 3DI3B 4QHKI 2BNQD 1IM3A 3T65B 2FHFA 1U8QA 5I1AA 3RVTD 2A6KA 1F11B 1OCWL 2CRZA 1GOHA 2GY5A 1VACA 3TA3D 2NY4D 2YHGA 3DI2B 5FXCH 5TH2A 3CFCL 4WI3A 3ES6B 5GHWH 4CDGC 3U0PA 4HUVB 2EKSA 3HNSH 4X5WB 1PG7W 2AGJL 4JHAL 4Z7UB 1TNMA 4PRIB 5GGQH 1AC6A 3BX7C 5E6ID 1A4JA 2NCMA 4BFIB 1FYTD 2VMFA 4FABH 1KTLA 1XF5A 2VDNH 4QY8B 2P43B 4XGZB 5F9WC 4QGYA 4PBXA 3RTQC 5FUCE 1FGVL 4I77H 4X4YA 1QSFD 3O9WC 3U4EB 3GSUA 5D72H 3T2NH 4G6JL 2VUYA 3FB7A 5L2JB 2EDFA 3RY6C 4LSSH 4Y4FD 2HVJA 1IC1A 3CMOH 4P4KB 4XCEA 1OAYH 2VDOL 2Z8RA 4NKDA 3TFKD 2O93L 4R4ND 2UWEE 1JGVH 3B2VH 4PP2A 3MFFB 2PO6C 2AI0H 3LRHA 5FF6B 3U0WL 3MRHB 5JXEA 5D71L 1PQZA 1X9QA 1CR9H 1U8IA 3GGWA 5IB4B 5EBMA 1KFAL 5GGVH 3FB5A 1T89C 2DBJA 1JK8B 4UUJB 4Y4KA 1P5VA 4PJEF 5CIPH 3WFHA 2VABA 1BF2A 1EEZB 3C8KA 1MFEL 1A1OA 4MMZC 5D6DA 5GSRA 3DGGA 5JIPA 2VLME 2ZJSH 1NANI 3JV4B 1SJVA 2FX7L 1WCQA 3SDYL 3MRBA 1I7ZB 4O4YL 5J57B 2HFGH 4K2UL 5GISL 3TN0D 1UM4L 5B3JF 5IQ7L 3IDYB 3S5LG 1INEL 4EXKA 5DZLA 1GGUA 3U36B 4YPJA 3JWOH 1BZ7B 5EWIH 1SM3L 4K55A 4LOUC 1LEIA 3BDYL 5FIEA 3CPLB 3G9AB 2Y07L 4ZUTA 4DUWA 3SCMC 4JPIB 1UYWH 2VXVL 2X40A 1T7XA 3LEVL 3WJJC 1IC7L 1OTSC 1R3KB 2GSGB 4NKDB 2LU3A 3NVQA 5HHOB 2QKIB 5C0CE 4NUGL 1H3GA 2YD5A 4RAVB 2F53E 1EX0A 4OFYA 1RFDL 1D5BA 1OAQH 2JIXB 3QQ4B 3P0GB 5C09D 1KIPB 3X14B 2OJZH 4AEFA 3PUCA 3WYRA 1W72H 1D9KC 1AXSB 2MWCA 1EGJL 1S7RB 4XPTL 2NY6B 3MJ6A 4R4NC 1RJLA 1AIFA 1GJIA 3BPOC 3ARGB 4NCC1 4ZPVB 5CFHA 2J4WH 2A0LC 5HI4D 3RIFK 4BUHA 5CSGA 1CGWA 2F54A 4IOFD 3HZMB 1Q8MA 1QKZL 3EW3B 1JTTA 1U8HA 3ZSSA 1I3RA 4EXPX 5HYJE 1X5ZA 1MFEH 2C3XA 2ATPB 1GAFL 4EDWL 5LQBL 4M03A 2IWGA 4QXWA 3SE9L 4S1RL 2JJUA 2Y9RT 4HK3N 4FMKA 4U33A 5IEKA 4U1LA 1DQLL 1YMMD 3HAEB 1CFNB 2NY6D 2GFBB 4O51A 1BQLL 4CJ0A 3HZKA 3NMEA 5SWSD 3LRGA 1UH4A 3BH8A 3CC5A 2IPTH 1HKLH 2IPUK 2HH0H 3QHFL 4I18C 1FZMA 2NY2D 1MHHB 4KUZH 3KPOA 3L7FA 3MLRL 5I1DA 3HS0A 4UNVA 5FYJH 1JPSH 5F3HB 5KSBB 3N85H 2RB8A 1MCFA 3B9KB 1JHTA 4HIHA 4OCSL 1U8OA 1CE6B 5C2UB 4NRZA 2X4UA 3ARUA 4G8EB 3VFOB 5FA4B 3UXFA 2ZZUT 1G7MA 2P5ED 4Z95H 2AABL 1JGDA 3DRQA 3F12A 1ADQA 3QUYD 4XNUH 3AROA 4IDJL 4CAGA 3D6GA 2WW8A 4O58L 4F37F 5HY9B 1SJEB 4G7VH 5FYJL 1E4XI 1S8DA 4W6XB 4NQEB 1X4XA 3RDTB 5DGRA 5JUEH 4NJAL 1UCBL 1I1YB 5EG6C 1YJDH 1BFOA 3BUYA 2DQTL 1D6EA 1Q9WB 3G9VA 1JI1A 2HFFA 3VRIA 3ZT7A 4PJEB 4OJFL 2IALB 2MOVA 5TPWL 4LPTA 5JA9A 5GGSB 5EIVA 4DKFL 2A6DA 2PYEE 1CF8H 2PKDA 4LF3A 5I6XC 1BJ8A 3T0WA 2R23B 4C4KO 3QEQB 2EDKA 15C8L 2ICWB 1MRCH 1K5NB 1J8HB 3QUMH 4GRLC 3KPLA 4O5LL 2K7PA 3BKJL 4XGZA 4E42A 4LRNL 1VERA 1DQML 3FFCE 5IFHH 1INDL 3GHBH 5A16A 5EWIL 4Z95L 4G6AC 1FAIH 1SQ2N 1FNAA 5KSBA 4KXZI 5ECJE 4PJ9B 5HI5C 5E94A 5DO2C 3H2WA 4B53A 3HMXL 1U95B 5EFIB 5DJAA 1UM4H 4S11A 1I7TA 1CE6A 2CRYA 1BBDH 4WENB 5KJRH 3ILPB 4XNQA 4Y19E 2VLKA 4JRXB 3MFFA 3E8UH 3T04D 4U6XA 1Z3GH 2XWTB 2ZCLH 3BKMH 4GT7A 3V5HA 1U8LB 5IMKB 1XF3A 4EN3D 1DEDA 3KLHD 4UTAL 4JR9L 5LVEA 5SWSA 5HDQL 5T5FL 2G2RA 3QULA 3MRQA 2R2EA 4F33A 1MHCA 3TN0C 4GW4A 4KJWC 5HGGS 1A4JB 3TBWB 4F2MA 4NHCL 4YXKL 4GMSH 2DKSA 3D3VB 3RZWA 3TLRA 1UXSA 5C0CD 2VLJD 2XKUA 2RBLA 4PY7B 3B5HA 4YWGL 1UA6L 3SQOL 3MRGA 4GXVH 1URLA 3JZ7A 4M5YL 5EC1B 3O41A 2MFNA 1X3DA 3MUJA 2ESVB 3U48A 5DHVA 4ODWB 1MCBA 3LDBC 5HVFB 3UZVB 4JO1L 4NFBA 2YRZA 3S36X 2ZSWB 4HXAL 5SWZB 3PNWB 3OKOB 4XBEL 2B0SL 1CT8A 4U0RB 2PW1B 3QDHA 4JGUA 1X6LA 5J1TC 3HFMH 5T1MA 1NC4B 4HMDA 5FUOH 3ZKMD 4M02A 3RRQA 4X98B 1K8IB 4PJ9A 2WWMC 4Z0BH 1TZIA 5DS8B 1TCMA 3L7EB 4NJ9L 5LJYH 3VXRA 2VH5H 1P4IH 2QR0B 1L4IA 4WI4A 3LIZH 3MREA 1J10A 4X80H 3K4DA 4KV5E 5D5MA 4NC2B 5CGMA 3NFNA 5DUML 3I2CL 4NO3A 3JVGA 4GAYB 1RUKL 3H9SB 4ORGA 2M8XA 2FLBT 3KLSA 3BYYA 3PWUA 4X6FA 4TNWK 4JGJA 3B2UC 4KXZH 3V2AR 1JPST 3V7AE 2FX8L 4POYA 4WHYH 2NY5C 4OLZL 3HC4L 4NGHL 3WXWH 3OQ3B 1F2XK 2Q8BH 3VFTA 3HPLA 4POZD 3QBTB 3Q48A 4XP4L 1PGRB 4PJ7F 1JYXA 2ZUVA 3RWFB 4B41A 4Z7OF 2R2HB 3WXVH 4IEFB 3QXDB 5GGQL 3B6SB 1AP2A 4ZD3H 5DQJA 2FH8A 4KROC 4GQ9H 1OGTB 3ZHDA 4NN7B 5DQ9B 4FZ8H 3OTTA 4O9HH 1MCOL 1YC7A 3H3PL 3MLVH 1N4XH 4MSWB 2FYYB 3VI4E 3UTSE 3VFNA 1ZHBA 1CD9B 1BEYH 3ULUH 1DQDL 1GGBH 3DXAD 1M7DB 2DL2A 4LGRB 4M7KL 2XPGA 1MPAL 3G6AA 2J8UF 1MF2L 5CZXC 3MJ9H 3RVXC 1NSNH 4JDZB 2WWMD 4MQXD 3ARRA 2FJGB 2R0WL 2VL5B 3CSBA 4J3TA 3LSOB 4TSBL 5E95B 3RBGA 2HKFH 1LEGB 4NQVB 2C9AA 3F12B 4EI6B 4Z7VE 4QLRA 1WIOA 4PJ8A 4I1NB 5EUOA 3BAEL 3TBSB 4F37K 3JV5A 4XB7A 4QF1A 2PO6B 5EOQH 3SBWA 1VPOH 4ERSL 2Y6SD 4KI5E 4DKDC 3GJFH 1OTSD 1J05A 4RGND 1L0XA 1AJ7H 1HQRA 1H3WM 2VO5A 1D6EB 3MLXH 1KJMB 1ZVYA 2Q3AA 4LASH 3RVUC 3U79A 4XNYH 3MPCA 4LVHB 5FYLL 4LCCB 3EYFB 1LDPH 5GRYA 3T0XA 5HPMB 4WJ5B 2VDQH 2YUVA 1MH5A 4XMLL 4J1UB 2QLVB 5MEPB 4K94L 2D2OA 1EAJA 1OAZL 2NXZB 4MX7B 5D9SA 3QDJE 3U2SA 5DQJB 4ZS6D 4HS8L 1R3LB 1HYSC 4CW1A 3PGCB 3MMEA 4YHOL 2NLJA 3EDKA 3P0YL 2YWYA 3SKNB 5DHXB 5IW6A 1D9KD 4TULL 4ZUVA 5EDXA 2RHEA 4LPYA 3BPCB 5IB4A 4EUPG 3AB0C 3IXTA 1R0AL 5FGRA 1BD2A 1TITA 3WL9A 3MJ9L 4IRZL 3BDXA 4I3GA 2VYRE 3CU1A 4R2GC 1UB5A 1ULVA 5DRWB 4NCDA 2N7BA 4IHOB 1C1EH 1WIPA 1EMTL 1MFAL 5FYJD 1L7TH 1ZEAH 3VXUB 1T83C 4A6YB 2V17L 2UVEA 2B8OT 1J1XL 1WZMA 3HZMA 3U9PH 3QFDB 3FOLA 4X6CE 4HLZG 1LILA 1QFUH 2PO6A 4UT6H 1L7IL 1UFUA 2PTUA 4NKMB 2MCPH 2QADD 4P2QD 5JOFB 2I9LB 1XMWA 3DXAA 3QQ3B 2DWDA 4JPKH 2H2SC 5ALCL 1J8HA 4LCWD 3NOIA 1RY7B 1S9VA 1IQWH 5HHVL 1RHHB 3MOAH 4JPWH 1UQSA 1R3KA 4NGHH 3WXWL 5J11C 4G6FD 4ZXBC 2IQAA 5BS0E 3EYFA 4FQJH 1ZT1A 3DVIA 5D70L 2P8PB 4I9WE 2IADA 1H8NA 1NKOA 2OQJB 3VW3L 4HWBA 3L3DB 4KKBD 1FNGB 4P3WA 1OAXH 1MFDL 5FHBH 3GUTB 3E6HB 5KSAB 2FO4A 5SWSE 1KLGA 4HX1A 3BKYL 1BD2B 4MJ5A 2W65A 1F45A 2P1YA 1MWAA 1GGYA 1K8IA 5DUBB 3FOMB 5DFVD 4LBEA 2VITA 3O6MH 1P1ZB 5T3XD 2PYFA 2IQ9H 3GSNB 3ELAT 5J1AB 5JZ7C 5ENWA 1NGWB 5L8JB 3U82B 3VFOA 4RWYL 3C09C 1MWAL 1MEXL 3D85A 3GJEB 4I0PC 5SWSB 4ELKA 1I85A 4M8QA 5CP3A 5TFSL 1MJUL 1I3RB 4HUWA 3RGHA 1FQ9C 3QO0B 5ICZB 8CGTA 3O4OC 4S10A 3Q1SL 1MNUH 2APVA 4LCWB 4FFVD 4GS7B 4WV1A 3QHZH 4O58H 3UROR 1GGIL 1LE5A 3FKUS 1BBDL 2OTUA 1DE4A 4KJQC 4TOYH 1BFOB 3BUYB 3G5XB 3VE0B 2HFGL 4K2UH 4YGVA 5GISH 1EGJA 3FO0L 1B3JA 1TJGH 2PN5A 1ETZB 1TZGH 3QSKB 4V2CB 2ZJSL 5F7EL 2FGZA 2BY1A 1QOKA 5HYQB 1A7PH 1JPSL 4K7PX 5E6YA 2Q7YB 3QXDA 2HRLA 3FT2A 2ID5A 1NBYB 2X4TA 2HVJB 4P57A 1HINL 5D1ZC 3W9EA 4XPFH 3GM0A 1RMFL 4LLVA 3DV4A 4Y19D 4TRPL 5EOCJ 3SKJL 1MUJA 2B2XH 9CGTA 3LOWA 1NFIA 1EVTC 2ZUSA 3CMOL 4DGIL 3SGDI 4KK6C 3ZE0E 2QQQA 5D2NA 5FK9A 5IWLA 4OZHE 5JLZA 3PGFL 1T1ZB 1DUYB 3C5ZB 4JFED 1A3LH 1IKNA 4PJXE 1C5DB 4IOIA 4F7EB 1DTUA 2BSSB 3MJ7B 3OKNA 4EOWH 1UGNA 5ETUB 2OX5A 1J8HD 4LCWA 1KCVL 3BEVB 1X5AA 3D18B 1D3CA 3SJVB 3ULUC 1CN4A 2EXYD 1B0GA 2XWBA 1CFTB 1NMCB 1H15A 2DQEH 4P23C 4UILL 3MRNA 5EN2A 2R23A 3QJFA 4I3RL 4Z7UE 3ZKMC 2B39A 4QXUL 3EHBC 1HQRB 2Z92B 1AO7A 3FQNA 3OJVC 1FNHA 4K9EH 3WV0A 1C5CL 2ED9A 4KJQD 3T09A 2HKHH 4RFEA 1HNFA 3O6FD 5E6IC 3WEXB 2IC2A 5KANI 2NNAA 3U9UA 2XQBL 5JW4M 4U31A 2DQHL 1T80A 5HGDA 3ESUF 4Y88A 3PQYA 1YJDC 4QRRD 3IGAA 3NA4A 5EFIA 4I48A 4MQ7A 5DJ8A 2FEEL 1GGBL 2YA2A 4HLZH 3HLAB 4WUKL 2X7LA 5D96B 2P8LB 4JFFD 4NQXA 4YAQA 1NFDF 4NNXB 3UZEA 2OP4H 2GUOB 2VTFA 4KVNH 3GI9L 1S5IL 2R56L 3AS0A 3A6BH 3RWCA 3TVMD 4NDMA 1ZAGA 3DPBA 1N7MH 1XIWB 5C0JA 4B50A 4OCSH 1FFPB 1P53A 4QYOB 2ILLA 3L5HA 3RDTC 1QSEA 2IEPA 1XIWC 3MGOA 4KHTL 3TZVB 5D5MB 4IIQC 4X6CF 3VGDA 1J87A 3PWVA 4X99A 1OF2B 4GAJH 4DZBA 1ZVSA 1QPXA 1C7SA 4G6MH 1AKJA 3WIIH 5KW9L 4PS4H 3SN6N 2Q8BL 3BRDA 2AKRA 1NCBL 2F53A 3GBNL 3L3GA 3P0VH 1XF4B 1S7QB 1UG9A 4YHLH 5GRVK 2YEZB 3FOLB 4Y2OA 5GRVL 4B5EA 4WU7A 3R8BB 1Q0YH 3NA9H 3PE9A 1IFHH 1YEGH 3HE6B 4HH9B 1NCCL 3MRCA 4AL8L 4RAUB 1IC4L 3FAXA 1G9EA 2IAMC 3WKML 3O3AB 4HJ0D 3TZVD 5DJXA 3VFPA 4HZLB 3UCRA 3HNVH 1CD1A 3HMWH 2NY0D 4K7PH 1CTOA 1ED3B 3WBDA 3ZL4L 2W9LA 3IAQA 3QIUC 4OLXL 4ODHL 2EYSA 4BYHA 3PDOB 1P4IL 1WITA 3O11A 1TCRB 3VFWA 4H0HB 4IS6A 4U49A 3MRHA 1NUDA 3KPQA 3IF1B 2JJTC 4IIQA 4U1SA 5KTEH 3W5NA 4HBQA 1P7QB 2BJMH 3CK0H 2X7LB 3DO7B 4HWUA 3OKEA 1DQTA 3MRKA 1A9BB 4GG6E 4UB0L 4F7TA 5CWSB 4LFHD 1J1PH 3HI5L 4LHUD 2NY0B 25C8L 2DBLL 1G6VK 4P9HC 1NLBL 2ADJB 5D2LF 3JTTA 1D5XB 4GBXC 1Z9OA 3BEWA 3C8HA 4A2MA 5E8PB 2H32H 5CJXC 1UJ3B 4ZUUB 5A40E 2I07B 5J3HD 1ORQB 3UDWC 3TBVA 4XMPH 5C8JB 3MZGB 1UKSA 4FS0A 3J8F7 2E6QA 4Z76B 1OAYL 2VDOH 1KC5H 2N4IA 2X6MA 4KRLB 3FTGB 3TEUA 5E6IA 3VWKD 5H2BA 4PRHD 4CN1A 4QTIH 2R2BA 3FO9B 1UQSB 1SM3H 1X5GA 5DK0A 3PP3K 2BDNH 2NR6D 2E3VA 4RIRB 2CLVA 1SBSL 2YUXA 3DHMA 3V52L 2DB8A 2R4SH 3P2TA 1UM6H 5C0RL 3LB6D 5GGRB 2A74A 5LGKA 5C70A 4Z7UF 4X6EA 2NW3B 1W72A 3KR3H 1WWWX 1VFBB 4KK8D 3D25A 3O0RH 4QHUB 3VG0H 4U1NB 3PDOA 3ARFD 2MKWA 4HIIA 1C8PA 3HN3A 3Q3GB 1F3RB 3PGCA 1G7JA 3NCJH 3ARSA 3PV6B 2I24N 3IDYC 4H8WH 1LP9E 4KTEL 3U4AA 2H9GA 2V9RA 1MOEA 4U1KB 4H1LG 1HK6A 1INDH 3JTTB 2XZQH 5TF0A 1ZT7B 1N0LA 4PJ8B 1YC8A 4M4PA 4NUJB 4X5XB 1DP0A 3VH8B 2X89D 3HZYA 2QTEA 4NQCD 1E28A 2NXZD 1ZA6B 3V6OE 4HGWA 4AQOA 5D93B 3U7YL 3BJLA 4KHXL 4Y4KD 3T2PA 1WF5A 3BSZL 1FYHB 3OAYH 3B3IB 1Q9KA 3KPRA 5GS0H 1VKXA 4PREB 3C8KB 4Y4HB 4WJ5A 1XF2B 5JXED 1FORL 3EBAA 3QJFB 4HCRH 1DDHA 4C59B 3RWEA 2MCG1 1DQQA 4NQED 4CBPA 1DANT 4Z8FL 5F89A 2O61B 2Q3ZA 4N1HB 4WWKB 5E2VH 5HGBA 1AD0B 2ATKA 2PTTB 4JHWH 1ZGLA 3F7RA 1WCBB 2A6IB 2H26B 4ZNCD 1CGYA 3SGJA 1QSFA 3CDFA 2WINB 1ZHKB 3RVTC 2NX5B 5BZDB 4Z0XA 5DEFA 1VESA 3V0WL 2OK0H 3HE7D 1X6NA 1U3HA 1BM3L 2AERT 5E2UH 1AQDB 4TSBH 2FO4B 5BS0D 1MIML 1MQKL 4NNXA 2F19L 3CLFL 3LH2L 4L29A 1FPTH 4OIAA 4BM7A 1LK3L 1F6AB 5E1HB 4BQ9A 3D39A 5J1SC 3EOBA 3GBML 4TVPD 1T89A 1CXEA 5LAXB 4OCNC 1Q0YL 3UTZB 4XPBH 3IVKB 1HDMB 3FFDB 3ALXA 4M5ZL 3N0PB 1A7BA 2VDKL 1S9YA 3MLYL 1RZKC 2HKHL 2VXSL 4Y5XA 1NAMB 3TYGL 1G7QA 4P9MH 4XPFL 4F3FA 2OTWB 3TYGH 1AI1L 4KZEL 1WZ1H 4XT1C 3HPJB 4BFBD 2IALA 3TBYB 5IT2H 3CFBB 1N5YL 3U6RA 1ONQB 1MRDH 4MAYA 5IESL 1NGYB 2XN9E 2W1NA 3MLWH 2W9EL 4LHQB 4N9GA 5C08B 3TNNA 1WAAE 5IKCA 4NP4H 3QIWA 4EN3B 2NNAB 3SBWC 4KRMB 3O2WH 2JK5B 4OGYH 2HT2C 4S0TD 4YE4L 1WVZA 2ENSA 5JXAL 1CE1H 1YPZA 3IFOB 3V8OA 5CP7A 4ZOBA 1LK2B 3ES6A 4HUVA 3L5IA 4JAMB 1LMKA 5CLWA 1EAPA 2W0KA 5FV1L 3GI8L 2HFTA 4OZGE 3ULVF 4AMKH 1AQDA 4HIEB 1RK1A 1CU4L 4R8WL 5HDLA 5EU7C 4BH7B 4Z0XB 4G8GB 2QHRH 2KQMA 4WHDA 2DLFH 4QHNB 2UUDH 2XA3A 3O3BA 3OKKA 1OP5H 3MV01 2NMSA 3C87A 5B3JE 1V7MH 5EORL 2YOCA 5ESAB 3D85B 4LLQA 5E6ZA 2VR9A 1CFQA 4R90L 2F74A 4YDJA 2B7DT 3MCLH 3TJEH 4R7NB 4J4PD 2ARJB 1NCBH 3UTZA 4JB9L 4FQIL 1ORSB 5EPMA 4E41E 2PUQT 4V1DB 1TZGL 2BOCA 4FQXC 1T0MA 4JJ5B 3B9DA 5FFLA 1NJ9A 4LVEA 2BVEA 5J4MA 3G04B 3V5DB 1NAKH 3UZQA 3RU8H 1AKJD 4EI5B 4M48L 4WW1B 5FYLD 3MRLB 4X4ZA 2ICES 4XBPB 4M7LH 1QRNA 5KBNC 3NCJL 3JSSA 5TDOB 3F5WB 3RWJA 2CLZB 4ODHH 1Y18B 4WFED 3NZ8A 2VKWA 1PEWA 4LHUB 2ZCKL 5IB1B 3TVMA 4WUKH 3ARXA 3BQUC 1JHKL 4UQ3A 4MQTB 4R26H 4AENA 2BCKA 3UTTB 3HRZB 4YZFE 1LHZA 4QT5B 4M62H 1HHIB 1VFBA 2JJSA 1VGKA 5I1KL 1EHAA 1PZUB 2DBLH 1V7ML 4FQXA 5EORH 3T4YA 4K9EL 5EOCL 5K9OA 4G6JH 3SDXE 4OD1H 5ALBL 4QRRB 2BRRH 2VZTA 5AG8A 4GG6A 5DT1L 2IFGA 3QNYA 1BJ1J 1KBGL 4KKBC 3QUXB 2GJ6D 4RAVA 1ORSA 5CJQL 2DWEB 1CL7L 4X6FB 5GXBB 1AO7D 4KJWD 5DTFA 3S4SB 5I1JH 3VD3A 2ZUYA 4G5ZH 4M6OH 5MENE 4TSAL 1JYWA 2BSRA 1RZKH 4K3DH 4F58L 3MRIA 3TT3H 4M3JA 5C0CB 1CLOL 2WUBL 2GCYA 4MVBC 3ALWA 3SKMB 4UT6L 2ZUQC 2AKRB 2R0KH 4KPHH 4PJDA 3S34H 4RWYH 1XF4A 3IAGC 1JGEB 1Q1JL 1FC1A 4WW2B 2QSVA 4N0CD 3QUZA 4P0DA 5CZKA 2Z31C 1WBZA 5IB3B 4G8FA 1IGML 3X3FH 3QQ9C 3O3EA 2EIDA 1CLYL 4ZTPH 1HWGB 1VSCA 1C7TA 3TPKA 5EOQL 1IARB 1R24B 3U7WL 3VMNA 3N1MC 1U8MB 1K4DB 3D3VA 5J6GA 4PJBB 1OY3B 2UZXB 1R3HB 4MJ6A 2GUOA 3BH9A 5I71B 3GKWL 2DQUL 4BQCA 3JWDH 4ZYKB 1NLDH 2D7TH 5DJ0B 5BJTB 4Y19A 4LBEB 3KPQB 3LPGA 5FOBA 1R5WA 1Z9SA 1CGVA 3PHOA 3I9GH 1XF1A 4XNUL 4PJFE 5I2IB 3NGBC 3QUMB 1HI6A 1X5KA 3AY4C 4N1EA 4B0MM 4GSDL 4PUBH 2H1PL 5C0GA 3QXUA 1EH9A 2J2ZA 3FB7B 4CDHA 5L2JA 4Q9RL 2X4NB 4AIOA 2YD7A 4EOWL 4ZTOL 3ZDYF 3TIDB 2HTLC 4FXGB 1SHMA<