4RWYH

Crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 8anc131 in complex with hiv-1 clade b yu2 gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
QGQLVQSGGGLKKPGTSVTISCLASEYTFNEFVIHWIRQAPGQGPLWLGLIKRSGRLMTAYNFQDRLSLRRDRSTGTVFMELRGLRPDDTAVYYCARDGLGEVAPDYRYGIDVWGQGSTVIVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 YU2 gp120
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2014-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rwyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rwyH01
3BE1L 4GKNB 5TPWL 4QEGA 5CLTA 1ZA3A 4WO4D 4FTVB 4Z7OF 3VFMB 4KK9C 1RZ7H 4OKDA 2CLRA 1VKXA 1JWUB 4Y16D 1J7VR 4M6ML 3V5KB 2B2XH 4NQDA 5KSVA 1LEGB 1A7OL 4QRPA 4TNWF 4Z78A 4CW1B 2ZKHH 1AO7A 5I1HL 3O3EA 2IAMB 4WHTB 2V5RA 4M8QA 2LTQC 3M07A 1FG9C 5IVZB 3KYAA 5DQJB 3DTXA 1U8MA 3OR6A 3VXMA 3GM8A 3D9AL 5EOQH 5E00B 1FFOB 1I75A 2D7TH 1FAIH 4OCLC 1CVSC 2DTSA 4U7KA 4POZC 3EYUL 1MVFA 4BZ2L 1IC1A 4EEEA 1UM5L 4XPTH 4L8CB 2AVGA 4G8GD 1T6WA 4FXKB 1KLGB 2HMID 1N2RB 1KLUA 4U1JB 2DQJH 2WSKA 4IM8A 5D7KE 2RFXA 1J0IA 5DHYB 3SOBH 1UH3A 4KJYB 2X4PA 5DJZA 3QCVL 3G5VB 5EPMA 1MI5E 5MERA 1FV1B 3RZCC 4LPUA 4K23H 2ZG1A 5M7QA 5HYEA 3VXRA 3RHWF 5JW5A 3MNZB 2OK0H 4EKXA 2LAGB 1UB6A 1Z0MA 4XCCL 4LKCA 4UIKL 5ABDE 1FVEB 3UTSB 4PRBB 3OKNA 4Z0BL 2VL5A 5KBNC 1CG9B 2Z31C 1OW0A 3MJGX 4JO4L 1W72L 4OCYL 3OAYH 1BZ9A 1T03H 3LB6C 3MLVL 5GGRA 32C2B 4MNGB 3VMNA 4HC1A 2YD6A 1CS6A 4HC1H 4M6OL 4GMSH 2EYTA 3VFVB 1PQZA 3QXTA 3MV01 3VRJB 2WK2A 2HKFH 2YBRB 3DX7A 3O2VH 3RY5A 4OI9A 3O3DA 1LE5B 2NX5A 3QUMA 1SJEB 4PJ5D 3WHXA 1KPUB 2YPLD 3D0VA 5BS0E 1BREA 5TGBA 2J5LB 2XA3A 2VLRB 3FFCA 5EZIL 1JHKL 2A83B 5DMGD 1PGRB 2VDLL 1T7ZA 5DWUH 3ZLQC 4HAGA 4R96A 5D2LA 2FO4B 2N56A 4Y4KA 2AJSL 2IQAA 5FO8B 1S9YA 3O6FA 3U6RA 4R0LB 2D7MA 2YPKA 5CZVL 3MR9B 3NVQA 2BY3A 4KK5D 1KOAA 5C6PB 2NY0C 4G8FB 3MV7B 3TBTA 2FH6A 2IH3A 4P2CG 3N1FC 1KN4L 3QYCA 1UQSB 1JUFB 4JAMB 5A2LH 4J3XA 2COQA 1LEIB 4DKEH 1MJUL 1T83C 2AKRA 1RUML 3QIBA 4YDLC 4OUUA 3RVTD 2PXYA 4Y4HA 3SY0B 3W0WD 4ODUB 4H0IA 4QRUB 4GS7C 2JELH 5K9OA 4YWGH 2ITCA 1WBYA 4RA0C 3OJDB 5C08D 3SBWC 2I9TA 2X1OA 4JKWA 5F6HJ 3QIUB 3CU7A 4PJIB 1KELH 3PNWA 5DSCB 1I9IH 4HJJL 1HYSD 3GJFH 1NGZB 3MCG1 1KXVC 1JGVH 1KJ2H 4OFYA 3VXSA 3U7YH 3OB0K 5I15L 5IG7B 1JNHA 4PRAB 3IU4L 4X7FC 1PD6A 3WIIL 4GLRH 1UXSB 2GITB 1MFAL 3KYKL 4JFXB 2OMNA 5HDQH 3NCCB 2VITA 1S9XA 3V0WH 4XCNB 2HFGL 5JR1L 4X7SL 1ZGLB 5IFJA 2F19H 2F53D 3BSZL 3T4YB 2AABH 4GG6B 3RVXC 3OKLA 3ECBA 3E2HB 5KSUB 1JPGA 2IADA 4MX7B 4YZFF 3T0VA 5C9KA 1SEBB 3HAEA 5L6YL 1IT9H 5TQ2L 3HAEH 1HH9A 2E7MA 2CGRH 2X4UA 3EDFA 3AS1A 1WBXA 4YHZH 1NLBH 3MRDA 3MLZL 4XVJH 3VWJB 4M7ZC 2Y23A 4E5XA 1N26A 3M8OL 1XF1A 3KPRA 4HUWB 5IJKA 1NJ9A 3I3BA 1U2CA 2HG5A 3KJ6H 4ZOBA 4U4BA 2X70B 2AJ3A 2UY6A 3HRPA 4LLWA 1FNGA 4MB4A 4OM1L 5IESL 3QHZL 5I1DA 3RPKA 1MHCA 3VD4A 1G7PB 5C0AA 3IDJA 1ORSA 4EVNA 1QLEL 1NAMH 5DJ6A 5IK3B 4JO2H 2H41A 5C07B 3HNSL 3KAAA 4HIIA 5DUMH 3SKMA 2ICWB 4CVZB 1NGPH 1BFTA 5F96L 2EYSA 1IILE 2PKDA 1RIHL 4JRXA 3VGEA 2JJUA 2XQBH 4Y5VB 4CMMA 4ZXBB 2FECL 4KI5D 4O2FA 4X7CC 1NBVL 3BZFB 4F8QA 4I77L 5L2KD 3MJ8B 4X4MA 5HHVH 3TO4C 3H9HB 1XIWC 1KCKA 4Q7DA 3OKEA 3RWFB 3LSOB 1E4XI 5F7EL 1ORQA 1G0YR 1GGTA 4DGIH 2X7LB 5GGUB 5D6CB 3MNWB 4HBCH 4WTXA 2P24A 4MXWH 1SYSA 4PJ8B 3MO1A 5IB5A 1TIUA 4Z5RB 3HUJB 3AFLA 2KQMA 5ITBL 5E70A 3BKCH 4WFGE 3C60D 3VFOB 1FL3A 2PYEB 3GMOA 3IB4A 4WTZA 4BFBD 3V6ZB 4R97C 4U3XA 2QHRH 2FSEA 4X5WA 3UJTH 1QD0A 5F9DC 4XTRC 2ZCLL 4JPWH 4TPRH 5EA0L 3IFPA 5KVEL 1D5MB 3K8MA 1TTFA 2YMXL 5TFSH 2J88H 4QRQA 5E4EB 3GIVB 3EHBC 4QNPE 5JW4R 3SDDC 1CT8A 2VE6B 4U3HA 1R3LA 3IDMA 1ACYL 2DL2A 4JFQA 1DL7H 4K3DH 1G7MA 5FGRA 2IH1B 3RU8H 4HIJA 3MV9A 4KQ3L 4J8RB 5IR1A 5D5ME 3S96A 5FYLL 4M6AA 3J7HA 4HFWB 3S3PA 2P1YA 1Z2KA 4FABH 1E4JA 2HT2C 5KVFL 1ZAGA 2VR5A 4JPVL 1NGXA 1DFBH 1FC2D 3RX7A 4F33B 5JW3L 5ILTH 4JO1L 1TJHL 2C1PB 3TT3H 3CUPB 2JF1A 3KYMA 1VA9A 2CLVA 1GGYA 2FBOJ 4Y4FA 1DSFH 1I1AB 5GIRB 4X6BA 4ZFFB 2RQ8A 4NKIH 3GUTB 1FCCA 1K5NA 3TCLA 4PGCB 5HGBB 3G04B 5GGSY 1AP2B 1HHGA 3B5TA 2W92A 4MJ6B 4XNMA 1LD9B 4NYLA 5CAYB 2DQEH 2EC9T 4LSVL 1JWSB 3JWOL 2N4IA 1HXMA 1MI5B 2CKBL 5HYSB 4KKBD 4U1IB 1T0PB 1BF8A 1CFQB 1RUAH 2VAAA 1ZOXA 5C9JA 1WTGT 3PWVB 1PVHA 3I6LD 5AAMA 1UWXK 1KIUA 4YUEL 2R1YA 4PUBH 5GGTL 1MRCH 3HZYB 4JM2A 5D1QC 5DJXB 2BC4B 5DK0A 5EO0B 1D6EB 4HPOH 1AGEA 4NQEA 4FTVD 4JDZA 3NZHH 5ERWA 2BNUA 2DF3A 2ITDA 1KENH 3ETBF 1J1XH 5HJ3A 4PP2A 4S1DD 1QSZA 2DTMH 2NY0B 5KW9L 1NPUA 3B3IB 4Y2DC 2BNQA 4HS3B 5IKCA 1MRFH 3ZDYF 4ZUTA 1T7VA 3A6BH 2IAMD 3LEYL 1LO4L 4M5YL 4XAKD 3RWGA 4FN0A 5GJTH 4N68A 1R3HA 5C7XH 1IMHC 3VXUA 2BCKB 2P42B 1NMCB 2EDYA 2R56H 3X12A 4NRXB 2EDTA 2P5EE 5BS0B 5MEOB 1WEJL 4R4BA 5F3BB 1SJXA 4OIBA 1N6VA 1R3JA 4PGJA 1IGCH 3OQ3B 3GSVB 4RWYH 4XH2A 1BOGA 4OM0H 3C9NB 5E8OA 3CX5J 4G6ML 5TDOB 1HKLH 3UDWA 4JVWA 3JV4B 4Q0XH 2A6KB 1UWGH 5DFVD 1XMWA 2HTKC 1GC1H 3MOBH 3D85A 4HGMA 4K8RL 3CX5K 3P3YA 3EJJX 1KPVB 4BSVB 4TSCH 5GGVH 1F3JB 4XNXL 2D7PA 4EQ3A 4NZJA 3ES6B 3PHOB 1FGVH 4NUGL 1ETZB 1FFQA 1U3YA 5B21A 4PJCE 1ED3B 5E6IB 5CSBA 3DX8A 2C4FT 4MVBD 2XG5A 4KHTH 3DSNA 4Z7WE 3BH8B 3VE0B 4PLKD 1DQDL 2WUBH 3EYVB 4PP1C 5EIQA 1S5IH 2VXVL 1NBYA 2FGWL 4X0KA 2DIJA 4ETYA 3UTSD 1JGUH 3KGRA 4AIXA 5JOFA 1YYML 1A4KB 3KWWB 2AV1A 1UJ3C 2RB8A 3P4OA 3TN0C 1TVBB 3BOVA 4NCDA 3QCTL 5C09E 3BZEB 4F37K 1ZSDA 2F58H 2DIAA 5D4QA 4K7PH 4WHDA 3PV6A 3SHSA 2EXYC 4IRZL 5F6HI 1JK8A 1DJSA 5JNYB 5IIEB 1N5AB 3T2NH 1BBJA 2FX7H 1WBZA 1OY3B 4JZJA 4XRCB 4M7ZB 5AD0B 5KSBE 5HDOA 3CFIC 1YEFH 1IGYB 2OX5A 3VFPB 4OJFH 3FTGB 1LO3H 2VXTL 4AM0A 4WFEE 3MRKB 4NBYB 5DRZA 4L4VD 4OFVA 1UXWA 3JWDL 1C5BL 4WFHD 2PUQT 2VLRD 2QEJA 1DVFA 4KZDH 4RZCB 4CMHC 2DM2A 5LGHL 2R4SH 1A6WL 3QJHB 2V17L 2BVPB 3I84A 3VD5A 5F9OH 1C5DB 3ROOA 1KTKE 3KYOA 1KTDB 4NKOB 1SY6L 3GSQB 3OTTA 1G9NC 2ENYA 1JNLL 1EDQA 3TH4T 3MV7D 3OB0H 5C6TL 3WSQH 3I85A 5EN2A 3QDGA 3RDTC 5ITFB 4M1GH 1BQSA 4Q9RL 1MFCH 4WWKA 4D9RE 5I17A 3ARDA 4NJAL 4KRPD 1ZHKB 1XGUA 1XIWB 2XWBA 3QFJA 1A7QL 3DURA 3RX8A 1IGML 5F9JB 1WISA 4K07A 2QL1A 4H5SA 1HSAA 3CX2A 2FYYA 4DQOH 2J8OA 4N0RA 4JFEE 2VZTA 3OKKA 1YEHL 1A1MB 5SWZA 4XPFL 2YD4A 3NA9L 4J4PA 1RJYB 3QIUD 2FBJH 3AY4A 4ZFOB 2PCPB 4NQVA 2GJ6E 5FDYA 5CZXC 2YKLL 2G75A 3VWKC 3GBNL 5D71H 3QJFB 5IMLA 1S7WA 2IQ9H 5IB4B 3SDDB 4LLQB 1RZKC 1MFDL 3X3GL 1K6QH 2FJHA 4RMRA 2BNRA 2HT4D 4HT1H 5BVPH 1K2DB 3BYYA 4MAUL 4P9HH 2IBZX 3EJZD 5FYLD 4G42B 4XCEB 2A77H 3RI5F 3REVB 1YEKL 3BGMB 4UT6L 5IJVA 4BQBA 3LN5B 3G6DH 5E8NB 1B0GA 2QQNL 4JGMA 4PJDE 5DJ8A 1CGVA 4OIIH 1H5BA 1DLFH 3E6HA 4AQOA 4DAGH 2FIKA 2I07B 4Q2ZA 1GGIL 1L0QA 1UCTA 1CK0L 3SE9H 4GW5A 1SYVB 1DZBA 3WXWH 4MSWA 1KCVH 5E2UH 3VWJD 1AKJB 1CZ8L 1ES0A 1Y6KR 4GAGL 3L3KB 4YDVA 2DQTL 5IP4A 4HS8L 3GHEH 3RNKA 3QPQD 1KB9J 5AUMA 5FA4B 1K4CB 1KB5A 4IMLA 1KB5H 1W0VA 4ONFH 5DD3H 1JPFA 1NGWA 4U2ZA 4ELMB 1P84J 1IAIL 1AXTL 5D5MB 4DKFH 2J8UF 5A2JH 1KB9K 3ALPA 3C87A 3AU1B 2DLFH 5C07D 1KC5L 3BHBA 1K8IB 1P84K 3LMJL 3FQWA 5EORL 5D6DC 5D93C 2P8PA 3ROLB 3QEHB 2VSCA 5FB8A 1LQSR 1F6FB 3QSKB 3R06B 5IWLC 3BKML 1TTGA 3FAWA 4NM8L 5DS8B 3OAUL 4IIQA 2AGJH 4P49A 3KXFA 4QCIA 1P7KB 4PGDA 4PJ9C 4XC3L 1QA9B 4RMSA 1KIPA 2AJXL 4NZUH 2O61A 1S7TA 2EH8H 4Q9QH 1BAFH 4K7PY 1YDPB 2DQHH 1G7LA 3C09B 4TOYL 5J89A 1RMFH 5L8KB 1FCGA 4QHNB 4OKVB 4U6YB 4PJ8D 4MXQD 1AD9B 5DC9B 2PYED 5I8KL 4LIQE 4HHAA 1U93A 3QQ3B 1FGNL 4D8PB 4XCYA 4OLXL 3KPNA 1GZQA 1LNUB 5IV2B 4LP4A 3GSNH 4YHKH 4YXLH 1XF4A 1BFVL 1MLCA 1CDGA 4O5LH 3B5GA 4DW2H 1MHHA 5I9QC 4K8RD 5T33L 1EJOH 4TNVK 4NPYB 5HPMB 1I7UA 3RWIA 3CLFH 4W81A 4PB9L 3QQ4A 3RUGA 2MWCA 1SM3L 1NKRA 1UWXH 4OD3L 1UENA 3BMWA 2QTEA 2Z4QA 3M1BB 1QNZL 2Y36H 1VACA 4V2BA 1ZVHA 3ULVC 3WFBL 3GIZL 1MIML 1EGJA 1Z9SA 2P5EB 3OHXB 3IJSA 3VFGL 1J8KA 3NFSL 4XP6L 3BO8B 4GBXC 4NQSB 5INCB 4LCCB 2H2SC 3RWJA 3EAKA 3Q3GB 4JR9H 1RZ8B 2Q3AA 4IEFB 4ZDHA 3TBSB 4IOSD 4Q9BA 4FRWA 5MI0C 4PGEB 2FL5B 5D7LE 5EC2A 4JDVA 1I1AD 3WL9B 1OAUH 1ZA6B 5EC1B 1RUQH 3DXAA 1T1WA 2P8MB 5DJYA 2OSLB 1ZT4B 4M5ZH 5D7KD 2GY7B 5DK3A 3W2DH 5SWSA 5I71C 4XMLH 3FB6A 4NO2B 3DX9B 1MI5D 4PJCB 1QSEA 5A2IH 5FO7B 3GI8L 5IB2B 1A6ZA 4BQ6A 4FZ8L 1WQVT 2WIIA 1MCKA 3C5ZA 5ICZA 3CFEB 2RHEA 4PJEF 4NZRL 2B1HL 1N5YH 1U91A 4CMHB 5BW7A 3GMPA 5T5NF 5DRNA 2Z35A 5DD0L 5CEZE 4MQTB 1RJLA 5I0ZA 3IS1X 1NBZA 4LSSH 1YPZA 2O5XH 3QG6B 1V8HA 4UZGA 2LABA 3BKYL 4YBLC 5JHLL 3MFGB 5ADOH 5C09B 4GRWE 4UI2A 4IMKA 5J9PB 2IPTH 1OSZA 2NY0D 3SCMC 3CH1A 5EU7C 1FO0B 1CR9H 2E7LA 4H25B 3P77B 1NUDA 2X4SA 5H35B 2Q6WB 1YEEH 3SGKA 3QEUB 2WWKO 3KPTA 4MLSA 1KPRA 3EDJA 4K9EL 5KSBB 1ZT1A 1R5IA 2DQCH 3VXOA 4OT1H 2OL3A 2OL3H 3FT4A 2HWZH 5DHVH 4U6VH 5EZOL 1XFPA 5BS0D 2YA1A 2H32A 5TE4L 2H32H 5D8JH 2A6IA 3QZWG 1WIPA 1OTUD 3BPNC 3X14B 3UTPE 3OZ9L 3U4BH 3LDBB 1EBPA 4YK4C 4GRLC 2W9EH 4H1LH 3RTQC 3CLEH 1ZXQA 3O3BB 1CE1L 1QLRB 4YHYC 3MGOB 3DMMC 4NN7B 1T1ZB 3MBXL 4EUPG 5EU4B 1GGBL 4FFWC 5IF0B 5I16B 1JRHH 5E6ID 3NIGE 2GSIB 2QR0A 1IQWH 5DGRA 4I4WA 1MJ7H 4Y19E 2ADFH 2HJFA 4X98A 4HKZA 1B6DA 1A6TA 4Z76B 3UAJC 3IJHB 2CLZB 5M94B 4GKSA 1K8DB 4MD4A 2AJUH 1XGTA 1KIQA 3MODL 4N9OB 2PTTB 3OF6D 3U7WH 5HVHB 4DJMA 4JFEB 3I6KB 4HLJA 3QDME 4WRLA 4MA1B 4PY7A 2IWGA 4N9GA 3BPOB 1QSFA 4PJBA 2Y9RT 2Y7QB 3SQBA 4LRNH 3U9UB 2GJ6B 3QUZA 5IT2H 1X9QA 5MHSE 1ZHNA 1FLRL 5FV2A 5MEQA 4Q6IC 4XZUA 5ESQA 4HJ0C 2M26A 3O4LE 1LILA 4BKLB 5HHOE 4MJ5B 4MAYC 1KNOB 2B4CC 5IQ7L 2NY3B 5FYJE 2GFBA 3QIWC 2ZUXA 2IPUG 3PP3H 1U9KA 5K59F 2Z93B 4J6RH 2YK1H 3MXVH 4DZBA 1Q1JH 5BQ7A 4WEUD 1P4LA 1QVOB 5GS2H 4P0DA 1I1RA 1QFUL 1AE6L 4MCYB 4P9MH 1DQML 1E27A 2XZAH 4IRJA 1OPGH 4JFFA 1RURH 3KPOA 5TDNA 4UT9L 5C0ND 4PJDB 1A4JB 3L1OL 1BD2E 2WWKT 4XC1L 1MREH 1FO0L 3CSBA 3DBXA 2VABA 5TE7H 1EEYB 4MNQE 5DUPL 5IBTH 2W0LA 1ZTXH 4X5XA 4TRPL 4PLJD 2CQVA 3MBEA 5CJOL 4PJ9B 5SWQB 5EOCL 4P5TA 4BZYA 3ARGC 3SKOA 4ZMAT 1XIWD 2NY5L 2A6DB 2XWTB 4QKXB 3O45A 3GSRA 1BGXH 4WW2A 4UQ3B 3S5LA 4KI5F 5DJAB 4EZMA 4N0FA 1EHLL 4RFEB 3HB3D 3STZA 4ONGL 1EX0A 5DRXA 1XF5B 3GI9L 1NMBL 3L7EA 4KY1L 4WU5B 1HSBB 5KG9B 3B9KC 4XTRD 4ZSOA 1XR8B 1N64L 3TWCH 3O9WB 2OJEB 2AERT 4GUPA 4JRYE 4YNYB 2VDNL 3RGVB 2W0KA 25C8L 1GYAA 3IRPX 1TDQA 2EC9U 3L7FA 4LAQH 5J6GB 5I30L 3OGCA 3SDDD 4QXUL 4EN3C 3FO2A 1JPSL 2F5BH 1TITA 1VFBA 4EXPX 1D5IH 3IDXL 1XF3A 1D7FA 4MJIE 2SEBB 2XY2A 3U30B 3HR5A 4HV8B 4P2OC 3WO4B 3TO2A 5DD6B 4XNQA 1JHLH 2NNAA 5DHXB 1NQBA 1KIRA 1YMHA 1A7NL 2VZ3A 4LAJH 5EOTB 4UMGA 5FEBA 1P69B 1LEKA 3VGGA 1Q0XH 2K3TA 2JB5H 3JZ7A 2B39A 4WFGD 5HHXL 3BEVB 1S7UA 5IVNA 4M8VA 4PJGF 2GSGB 3MRNB 4R8WL 3AREA 5FHAH 1A3RL 2DWEB 3QO0A 4MQ7A 1OTTD 4D0BB 3RRQA 3I75B 4NQUA 4HKJB 3BDBA 2C26A 2AK4A 2PO6A 5CJXA 1AKJD 3WN5B 3SDCC 5CMAA 4JLRB 3KPLA 1IC7H 2Q87A 2FD6L 5JPNB 1L7IL 5I76B 1JGDB 1M71A 1ZHBA 2A6JB 2WINA 4ISVB 4CN6A 3EFDH 3VW3L 5FYJU 4I0CC 5FECA 3VXTA 4GAJH 2GJJA 1PZ5A 3QPXL 5E8PB 4PJAF 4LOUD 1JN6A 2VDPH 4XWOD 4N8CH 2LVEA 4HJGB 2YD7A 5HSFA 2YD3A 5CWSB 3BD4A 4MD0A 5JW4Q 1YNTB 2IANA 5D7LB 5IFHH 4R4FL 4YDJA 4PD4J 4H26B 1JZ6A 4Y2DD 4AYFA 3U36A 2C4FU 1IAMA 3HI1B 3BN9D 4WJ5B 1GZPA 1SEQL 3BE1H 4PD4K 5TPWH 3SE8L 1HI6A 3MFFB 3L3DA 4MJ4A 4HZLB 4HIHA 1CICC 1H3WM 4UV7L 2D2OA 3SJVA 2AS5M 4KMLB 4KK6D 4M6MH 4QHKI 2PW2A 1A7OH 3BIAX 3ILPA 4NQDE 1KJMB 4QRPE 5I1HH 1S5HB 5F7WC 3DO7A 1EFXA 3HAEG 4ZNCD 1AO7E 3BX7C 4KI1A 2IMMA 1FIGL 5D96B 4E9LA 4NN5C 4GRLB 2UVEA 4AIZB 2HTKD 1BEYL 4GRWB 5GRJL 1HHIB 4P48A 5D1XC 4L29B 1P2CA 3KLHC 2AXGB 3SDAC 1P7QB 3IRZA 3T2QA 4YHYB 5IW1B 3D9AH 4KROB 5HGDB 3O8XB 4K55A 3ZDXF 3VXME 3G5XB 5ACMA 2ZUUA 3MRMA 4NWTL 3QWOB 3C8DA 3EYUH 4BZ2H 4YR6B 4D0DB 5I1IL 5HDLA 4APQB 1UM5H 5A3IC 1IEHA 1JI1A 1YEGL 1MJJA 2P5ED 3VJ6A 4PP1D 5FUZL 3UEZA 3EDEA 2BMKB 4WUUA 5FA3A 5FGCE 2VERN 1QEWB 2OMBA 4HMCA 3DSFL 4S11A 1UJTA 5C0GA 5D1ZC 1HZHL 4DZ8A 3QCVH 1MHPL 3BEWB 3VXQB 1DQLL 1INEL 5DEFB 1FL6A 4KZEL 5T1DL 5LVEA 3O2WL 5CIPA 5CIPH 2JJWA 4EI5B 3VXRE 4QXTB 3CMOL 4XCCH 4UIKH 4MAYB 1B0RB 5ANMA 2JCCA 4PY8I 3GNML 5GZOC 3EYQC 4Z0BH 3T0EC 1G9ML 3QIWB 4Y19B 4HCRL 1FYTB 4PG2A 4JO4H 1W72H 4OCYH 4AEIL 1DEEA 1HINL 3MLVH 4GKZA 1U58B 2EDQA 4C83A 4O9HL 4WTZG 3CD4A 3ARXA 4M6OH 4PJAA 3QXUA 4OCRL 2X2YA 5IFAH 4YIQA 4RIRA 4F3FB 5TE6L 3QDMB 1AFVL 4E41E 4UUJA 3HNTL 5C09D 3B9DA 3O41B 2VTFA 3GGWA 1KULA 5CBEB 5DJ2A 2NX5E 3SGEH 3ZE2E 5GGSA 5CEXB 5C0CA 5DVMA 5J1TC 1MCFA 4G8IB 3DRTB 5EZIH 5E03A 1JNNL 1VGEL 1ZHLA 3DVFA 1JHKH 3LQZB 4XP5L 3O4LB 2VDLH 4HH9B 5HHOB 1DUZB 1ZT7B 2GCYA 3ZKXC 4ENED 4X6CF 2AJSH 4WFED 5D2LE 3TH2T 4HLZH 1X5GA 4JN2A 1MPAL 3MX0A 1BIIA 5CZVH 1JGLL 2VIRB 4RGMC 5ENWA 1U3HA 4F9PA 4Z7OE 2WANA 3UTZA 5CEZL 4LNVA 1VEOA 3U48A 2YPVL 3HE6A 5JUEH 4ZAKC 3OKOB 5GSVB 5D2NC 4OZGA 5FCUL 5I8EA 4HBQA 1BD2B 1MJUH 3CZJA 2V2XA 1RUMH 2NR6D 3QA3A 3C6LA 4HKBA 3FN9A 3BUTA 1QR4A 7FABL 3TIDA 4MNQB 3QAZB 4LSRL 1CFNB 4L8BB 2AEIT 2QLVB 4L8SA 1G6RB 5M95B 3FFDB 4PJIF 4J1UB 1IGJB 2KBGA 2XXCB 1T21B 3D0LA 3EOBB 3AM8A 3LZFL 3KYNB 3STLB 5JXEA 3BQUC 3FB7A 1M7IA 1TXKA 3WNPA 1WFUA 2HFTA 2DLGA 1TPXC 4UU9A 4QHLB 1YNKL 2R1WA 4HJJH 1MF2L 3K46A 3MOAL 2MQCA 5IBLC 2XPGA 3H0TA 4JFED 3VCLA 2VDKL 3G6AB 3U4AA 1ZKAA 2ZJSL 2D0GA 3KDMA 3VXSE 5ICXB 5I15H 1T22A 3IU4H 5F7UA 1P6FA 3WIIH 4A6YB 2GJ6D 3LKSA 2HJLB 4O02L 2Y72A 4PV9A 1MFAH 1U8QA 2X4OA 3KYKH 3SKNB 4F7CA 4JRYB 3O3AB 4LRIA 3TH3T 2OTWA 3ZMRA 1IFHL 5JR1H 2HFGH 3HE7A 3O6KL 4X7SH 5L8JB 4Y4HC 1GGCL 3IT8D 4QT5B 3BSZH 5DJ0B 1E6JL 4PRDA 2NY3D 4ZUVB 1XGPA 1RJZB 1NDMA 4I0PB 1ZV5A 4IJ3C 4L9LB 5FOBB 1PFCA 4O4YL 4PREA 5MENA 4MJIB 1T1YA 3S98A 1X5IA 1V5JA 3CZFA 3SGJA 1E6OL 4JO3L 5L6YH 1RK0A 5ALCL 3OR7A 4RAVB 3BJLA 3QUKB 5TQ2H 4Z9KB 4ZNEE 2VMFA 1IAOB 3WCYA 3MLZH 3BDYL 1TQBB 4WNQA 2E6JA 2FEDC 1YUHA 4JN1L 1XF2B 4LF3B 3B8SA 3W9DB 4JQVA 1U6AL 3M8OH 2ATPB 4PTTA 5IB3B 1HWGB 4HK0A 4QTHA 3KPRE 1CF8L 4PGBA 2GTZB 5I1LA 2YHGA 4HS6B 3W11C 4FQQA 4OM1H 5IESH 3QHZH 4ODBD 3IKKA 1QLEH 4PJ9D 2VH5L 3H3KA 5C0AE 1J0HA 5JMRA 1HOCB 1S7XA 1VGKB 1SJHA 1HDMB 1IKNC 2IFGA 3HNSH 2B20A 1SJVA 3QZWB 4NKQB 4RMWA 5GS1B 3GMMA 5F96H 1FHGA 4X6CA 2VOTA 3FO1A 1WWAX 5E2TL 1TCRA 2IPKB 4P2RA 1RIHH 4FG6D 3WFHB 1OTSC 4WCYL 4XNUL 1PYWA 5CZKA 1H0DB 4JRXE 2NXYC 1S7RA 1XGQA 1NBVH 1OD7A 4FQCL 4O2EA 3UTQB 2GY5A 4I77H 4CJ0A 5E94B 1BQUA 1I3GL 1K4DB 3O9WD 4X4ME 4YHPB 3RVWC 2MHAB 3S88L 3RGVD 2J6EL 4EUPB 4FHBD 3UXFA 4QLRA 4NN5B 5F7EH 5JQ6L 1IZJA 5LBSL 5EZLA 1QR1A 1QYGL 4AMKL 1B2WL 3SO5A 2YZ1A 3DGGA 4CVUA 3FONA 4NO0B 5ITBH 1CIDA 2IGFL 1MCLA 3MNVB 2LQRA 1A9EA 2JIXB 5BZDA 4IRSB 4OGYL 2ZCLH 3WJLA 5SX4I 1A47A 2AJZA 1PAMA 5EA0H 5KVEH 3FO9A 1ZA3B 2YMXH 4KMTL 2CLRB 5GRZA 1VKXB 4EIZC 3U83A 2XWJA 4NQDB 5KSVB 1ACYH 4QRPB 4Z78B 1U8NA 1AO7B 8FABA 2R2EA 2WM0A 4XXCA 3O3EB 1HH6A 4KQ3H 1NANH 4KUCD 1U41A 3MV9E 4KV5F 5FYLH 4M8QB 1JVKA 1KT2A 4I18C 5CUSL 3DTXB 1U8MB 3OR6B 4KC3B 3VXMB 5KVFH 4FQXA 1BBDL 2IMNA 5JW3H 4JO1H 1TJHH 4Y2OA 1EA9C 5C6WH 1SBSL 5KJRL 2AXHA 4ZFZA 2J2ZA 4YZFE 3VFUA 1RU9L 3MLWL 1KLUB 3ARBC 1CD0A 2HH0L 4LSVH 3JWOH 2NQCA 4Z7UA 1XAUA 2CKBA 5D7LD 2CKBH 2X4PB 5DJZB 3ZT7A 5EPMB 5MERB 4Y5YC 5CD5C 1IRAY 3N50A 4KKLC 2ICEA 3PDDA 4YFLI 4YUEH 5GGTA 4TTDC 3VXRB 5GGTH 5JW5B 5DEGA 1UB6B 1QHOA 3ZKXB 2WBKA 4LKCB 5LG1A 4NP4L 3ZL4L 4Z77A 4NQEE 5SV4A 3OKNB 4UINL 5GRUL 3RPIA 2VL5B 1X5AA 4LPXA 3LD8B 5KW9H 1CD1A 3U2SA 3OMZA 1BZ9B 4Z18A 4ETQA 5EBLA 4NO5A 5GGRB 5CEZD 1DN2A 3D3VA 3LEYH 2BNQE 1LO4H 4M5YH 5EIIA 3WFDL 5HDBE 3RVUD 4ZAKB 4E41B 2EYTB 2UZYB 2E27L 5I73C 1PQZB 4GRLD 1QACA 4PRNA 3DETC 1FYHB 3DX7B 3O3DB 4IS6A 5FDWA 3VXUE 2VZUA 1P7QD 3LS4L 2NX5B 3JXAA 3QUMB 4FQIL 2LE9A 1FLTX 3WHXB 4K3HA 1WEJH 4KROD 3O8XD 5TGBB 1MCPL 4XPHL 4G6MH 4TTGA 4YHLL 3UTOA 1KXQE 3S36L 4APQD 4KTYA 4R96B 5D2LB 1S7VA 5KSAA 4HFUL 4Y4KB 2IQAB 1S7QA 1S9YB 3O6FB 4K8RH 3RAJL 3U0WL 5C8JA 2YPKB 5DA4A 4E42A 5IMOA 2AEPL 2Q7NA 4XNXH 1KEGL 3MUGA 1WK0A 3D25A 3O81A 5FGSA 3UTPD 5IHZA 3HTLX 4OGAD 5C0JA 3TBTB 5GZNC 2IH3B 4CGTA 1T0NA 4HZAA 4NUGH 2CUHA 1M7DA 5T1LA 5J1SC 4UT7L 5AZEL 3IVKA 4HX1A 2X9XA 1WZLA 1HKFA 4YDIL 2W1NA 2YWZA 1U92A 2AKRB 1DQDH 3QIBB 5FUCE 4OUUB 4EI5D 2PXYB 2VDQL 4Y4HB 2VXVH 2LFGA 2FGWH 2WBJA 4MAYD 5TDPA 3HI5L 3WNOA 3WLWD 2ITCB 1WBYB 2W59A 2IEPA 1B4JL 1YYMH 4H0GA 3TIEA 4D9QE 3QIWD 5ID1A 3QUXC 4Y19D 4G6JL 3QCTH 3UDWC 2I9TB 5D7SL 2APBA 1BECA 4TVPD 2XOTA 4Z8FH 4IRZH 1GC1C 1HQ4A 4R7NA 2QSVA 3PNWB 4U6HA 4HXBL 3ALXA 4NKDA 1MELA 3QDMD 1VFMA 1Z0NA 3ESUF 3RIFF 1Z3GL 2MCPL 3VXSB 2B0SL 2VXTH 1U0QA 4PRIA 2KZWA 1XGYL 1JNHB 4KKAD 1VEMA 2BHYA 1MNUL 3BGFB 3JWDH 3ULUL 1C5BH 1CFSA 4TUJA 5MHSD 3TBWA 1L6ZA 2VLJA 3QHTC 3F62A 5FUCC 1FIEA 1JIBA 5LGHH 1A6WH 1WCQA 3O4LD 4YDKL 4OCNC 2VITB 1S9XB 5HHOD 3SO3C 3LRSA 5AZ2L 3CSPA 4B50A 5IFJB 5FYJD 2QJDA 5HY9A 3GZKA 3OKLB 1SY6H 3ECBB 1DBAL 2H2PC 2CO6B 1JPGB 2IADB 1JNLH 5C6TH 3HAEB 2MTPA 3VDBA 1HH9B 4RAUA 3L5IA 1NH6A 3LEXA 2X4UB 4HUXA 1S78D 1WBXB 4OZHA 4Q9RH 2NXYB 4XHQA 3CGTA 1L9MA 3MRDB 5A2FA 4NJAH 1BD2D 1OM3L 1A1OA 4E5XB 2VQTA 3Q48A 3ZDYE 1A7QH 3KPRB 5DMKA 3QUML 1JFQL 5L7XL 1IGMH 5DO2D 4FOMA 4MNQD 1NJ9B 3QFJE 2ZCHL 2HG5B 4NOFA 2AJ3B 4MD5A 3DUSA 1FNGB 2GQHA 4LLWB 4EN3D 1YEJL 1DVFC 3PWPA 5FGBA 1MHCB 1YEHH 5C0AB 1B88A 3IDJB 4EVNB 4XPFH 4W4OC 3NA9H 5DJ6B 4S1SL 4P2OD 1TJIH 5SWZE 4HIIB 5CS7A 4G9DA 2YKLH 3R8BB 3SKMB 4N0YL 3MRFA 4GW4A 2EYSB 3GBNH 2J3SA 3FT2A 4QY8B 2CD0A 3RKPA 5BVJA 4JRXB 4HIXH 3RBGA 1G7QA 4CMMB 5EOCJ 3OXSA 1MFDH 4O2FB 3X3GH 2YSSA 3PHQA 3RP1A 5IEKA 2NTSP 3FAXA 1MQ8A 4JRYD 2EKSA 4TVSa 2BNRE 4MAUH 2OCFD 2Y5TA 1NUFA 3OKEB 2H45A 2YRPA 3CXHJ 3IETA 1ORQB 3TBVA 1YEKH 1CDBA 4UT6H 5TJWK 2P24B 1SYSB 1P9MC 3MO1B 5IB5B 1EHNA 4I0PD 2QQNH 5E0QA 4MJID 4W6XB 3CXHK 1FL3B 3GMOB 2CXGA 2FSEB 3EZJB 4X5WB 4XPBL 5JDSA 2V5YA 3NZ8A 4HKXA 1CK0H 2V7HA 2X1XR 4Z8FL 2EIEA 3IFPB 1J1OL 3IXTA 1CZ8H 1WITA 1P7HL 4GAGH 4ELMF 4QRQB 2DQTH 5LXGL 4HS8H 3I02A 4Z7NE 1CT8B 1R3LB 2ZNXA 3IDMB 1JTPA 4JFQB 1RZFL 3VA2C 1G7MB 1IAIH 1AXTH 1I1FA 3MV9B 4HIJB 4P9HC 2VXUL 2VDRL 4I48A 5IB1A 5IR1B 3S96B 1YMMA 4C55A 4OUOA 1AGCA 3ZHLA 1KC5H 3BUYA 4RWHA 3LMJH 2BSTA 3T3ME 3TYFA 1NGXB 4FMKA 4X6DF 1JZ3A 3BKMH 4GQPH 3KYMB 1N7ML 4NM8H 2M1KA 3OAUH 2HT3D 2CLVB 1CN4A 3SKUD 4G6AD 4Y4FB 4X6BB 4XC3H 1CWVA 1K5NB 1VHPA 3KXFE 2AJXH 3TCLB 3QWQB 1AQKL 4F57H 3MCKA 1RK1A 3P30L 5I73B 4XNMB 4TOYH 3G9AB 4NYLB 3FHAA 1DCLA 2CJUL 5D1XD 3MRGA 3ARYA 1HXMB 4NO0D 2APFA 2VAAB 4BH7A 2LVCA 1QFWI 3NGBB 5I8KH 2JIXD 4IRSD 1ZVSA 3MUHL 1H3VA 3S4SA 1FGNH 4CU6A 2R1YB 4OLXH 3GMLA 3U0TA 4RMQA 3KPPA 4JM2B 1T0MA 1AJ7L 1GH7A 2XKNA 5DK0B 1C12B 5A3ID 4NQEB 1AGEB 1BFVH 2NY2C 4JDZB 4QWWC 5ERWB 3RA7L 2BNUB 2ITDB 3IKCA 4AIOA 5T33H 1CGTA 3UJJL 1RZGA 3P40A 5HJ3B 4NQDD 4WI3A 3TT1L 4QRPD 3PL6C 4PB9H 5IKCB 2BNQB 3GDBA 3ARFA 1AO7D 4ZUTB 1SM3H 1J18A 1FZMA 4LQFL 3RWGB 3M45A 4OD3H 1R3HB 1IKFL 5C2BL 1QNZH 3VXUB 3WFBH 3GIZH 5D7JC 1MIMH 2EDLA 3NBNA 3VFGH 3X12B 3NFSH 1KTLA 4XP6H 3B2UC 3VXMD 5DI8A 1BX2A 1BIHA 4J12A 4H88L 1EAJA 1R3JB 4ZPTA 4UNVA 1FSKB 4NNYA 3S5LG 4XH2B 1BOGB 4JKKA 5E8OB 1OAQL 3CFJA 3BJ91 1KUMA 2WP3T 3DXAE 3D85B 4PJCF 3QRGL 4I3SL 4TSBL 4Y16A 4JY5L 3T0AA 4NBXB 1ZMYA 3AS3A 5L0QC 1JZ7A 2G2RA 1E4XL 5SWSE 5T1MA 4X9GA 3GI8H 2GW5A 3SGDI 1QSEE 1CLZL 4I13B 3DX8B 4KK8C 3RL1A 1C16A 1OHQA 4NZRH 2B1HH 5KN5A 3VXRD 4YXHL 2I24N 2BVOA 1WWBX 5DD0H 3N1MC 2J8UE 4I3RL 4YEFA 2GHWB 3V79C 1NBYB 5IW3A 4X0KB 4HWEL 4OV5A 5JHLH 3BKYH 4GO6B 5JOFB 1T1XA 2BOBA 2GYSA 4LCWA 1YPZE 2AV1B 4K3JL 1NDGA 3P4OB 1GOGA 5HVWA 5FF6A 3OKYA 4HF5L 1AGFA 3L5WA 5DXWA 3V52L 1ZSDB 1JWMA 4X6DA 4KTDL 3PV6B 1QFWM 5ECJE 3V2AR 1JK8B 5F7DA 5F7NC 3T77A 4ZAKD 4E41D 1BBJB 4K9EH 4DOHB 4YH6A 1WBZB 4JZJB 4Z0XA 2NY4C 1TJGL 4UOW0 4P3DA 3BPLC 2NX5D 4M3JA 5EZOH 3I2CL 4L3AA 2HYMA 3ARWA 3N1QC 5DRZB 3QI9A 3C5ZC 5TE4H 1CD8A 1UXWB 3PP4L 3BPCA 4HWNA 1DVFB 4R3SA 2ATKA 1UEYA 2X1PA 3OZ9H 1H15A 1S3KL 1HXYA 1J0YA 2OR7A 3C5JA 1FORL 1P5VA 1JZ4A 1XCTA 3K4DA 3C08L 1DBBL 4JANA 4Y4KD 4POUB 3CFDA 3O6FD 1UG9A 3ROOB 1RUKL 1WV7T 3KYOB 1A9BA 2JK5A 5KS9A 5IBLD 5LAXB 4IMKC 2C7UA 3MLYL 5DT1L 1CE1H 3MBXH 2E7LC 2ZSWA 1GGBH 4UIMA 1R5WA 5EN2B 3EOYG 3FZUC 3V8CA 2OI9C 4WWKB 4JG0L 5I17B 3ARDB 4J23A 1NSNL 2VZSA 4WO4C 4G9FA 3ILQC 4DVBA 3QIBD 3BGAA 3QFJB 2PXYD 1J0JA 3DURB 4Y4HD 3HA0A 3MODH 4H5SB 1HSAB 4UB0L 2YPLA 1MCJA 1HEZA 4JFOA 1B3JA 3VD3A 2EXWD 1FG2A 3H2WA 2YUVA 4WGWB 3BFOA 3OKKB 1YZZA 5SWZB 1QSFE 4R9HA 3HMXA 2NXZC 1WVZA 4NQVB 3U79A 4OF8A 1FLRH 1MCQA 4UILL 5J3HD 1NFDA 2G75B 1Q94A 2ADJA 1IARB 5EFIA 1S7WB 4LSUL 4X9IA 3CSYA 5IQ7H 3S36X 1MCBA 3LQMA 5HGHA 2FHFA 3BDXA 4AEFA 1AIFA 3BP7A 2FJHB 2GT9A 2BNRB 3Q6GL 3W11D 5A16A 4PJDF 1VSCA 3S3SA 2HMIC 3JWNC 3OWEA 1QFUH 5E1HB 1AE6H 1DQMH 5EU5A 3DJ9A 1A1NB 3SQOL 5IJVB 3P0VL 4NWUL 2DN7A 4JFFE 2OTUA 3L1OH 2DMKA 1MHEA 1O7VA 1B0GB 2XQYK 1YA5A 4XC1H 5DJ8B 1FO0H 3LV3B 1H5BB 5C08A 3E6HB 3QUZC 5DUPH 2FIKB 1OTSD 4K3GA 4Q2ZB 1D9KC 1TENA 2EDBA 3SE3C 3MUY1 4TRPH 4U6XA 2NXYD 4GW5B 1EV2E 2DOCA 5CJOH 5HTSA 4MSWB 4J3UA 5EOCH 1DQJA 4NHCL 2XN9E 1BZ7B 1ES0B 1F02I 2NY5H 5EWIL 4YDVB 3KPRD 1UWEL 1U95A 1OL0A 5DLML 1QBAA 3RNKB 3DARA 5AUMB 1KB5B 4IMLB 1W0VB 1EHLH 1YY9C 1JPFB 1NGWB 2X44D 4ONGH 1CGWA 4PR5A 5C0AD 1WAAF 3V95A 3GI9H 1NMBH 4KY1H 1TQCC 4NUJA 4GXUN 4Y88A 3BHBB 4I3GA 4OD2A 2F53A 1N64H 4KGJA 4OAWA 1OARL 3CDFA 4ZSOE 2H1PL 3MREA 2VDNH 3C8HA 5ISZA 2P8PB 2WNGA 5CGYC 25C8H 3VFWA 5FB8B 2BY1A 4JRXD 4D2NA 5I30H 3F7YA 3FN0L 4QXUH 1IL1A 4IIQB 5HI3D 1JPSH 3UMTA 5DMGC 3V4VL 5I1KL 3KXFB 4R2GB 4QCIB 3IDXH 4PGDB 4PB0L 2YA0A 4Y89A 3QDJA 1KIPB 1PKQE 2O61B 4KJPD 1S7TB 4TULL 3UBXI 5EUOF 5E2VL 1M05A 3B2VL 1LE9B 1G7LB 1A7NH 4KK5C 3OX8B 2H3NA 43C9A 1E28A 1TNNA 5HHXH 3BESR 2CK2A 1YNLL 4KUCF 1UA6L 4R8WH 1A3RH 1ZLWH 2JLLA 4HHAB 1U93B 1BLNA 4XCYB 3KPNB 2DBLL 4P3CL 1GZQB 3QT2A 4P2QA 4PGZA 3RVTC 3PDGA 1QRNA 3S7GA 1JPTL 1XF4B 2AK4E 1MLCB 1ZLUK 1MHHB 1P4BL 1CL7I 4QHUA 2NYYD 2FD6H 4F9LC 3SKJL 1L7IH 5DMJB 3K8LA 3UBXA 4RSVA 4OQTA 1I7UB 1FNLA 5EUKA 3RWIB 2CDEA 3W5MA 4NZTL 3HZKA 3QQ4B 3RUGB 5L2KA 2APVA 3MV9D 2Y5EA 2BJML 1LK3L 4RMUA 1JHTB 1BHGA 4UBDC 5HVFB 1VACB 5K33A 2P49B 5K59E 3IJSB 1KLFA 4DGVL 1RIUL 1AXSA 1CGSL 3RWJB 3AREC 1GOFA 2WAHA 5B8CC 3LKPA 4ZDHB 4C4KT 2B8OT 3QR2A 4MCZA 4R4FH 5KVMC 2YR3A 2IANE 5EC2B 2Q76A 4JDVB 4Y4FD 3U9PH 3VFSB 3G6JF 4PRPA 3DXAB 1BQLL 2BRRL 1WC7A 1T1WB 4P23A 5DJYB 2VISA 3ULVL 3N0PB 3WNMA 1SEQH 1JL8A 1EVUA 3SE8H 3PJSA 4ACPA 5SWSB 2NY4B 3TA3A 3FB6B 4UDUA 3T0BA 3WYRA 1TVHA 1G1CA 1I8LA 2P44B 3KS0J 1QSEB 4UV7H 1A6ZB 4X6FA 1N3NA 2WIIB 3C5ZB 3SJVE 3BN3B 5FM5M 5HYJA 3TZVA 5ICZB 3ZZ1A 1MWAL 2EO9A 2J8UB 1RPQA 1U91B 4QRSA 3GMPB 5DRNB 2Z35B 4JM2D 5H2BA 1FIGH 2DBJA 1RJLB 5KVDL 2BOCA 4NQED 1NBZB 1C1EL 4M7KL 2F5AL 1YPZB 3CCHA 1BEYH 5JIIA 5GRJH 1DBKL 2BSSA 1E4KC 3BVNA 1OSZB 3IDYB 3CH1B 1RJCA 5GZND 1FZOA 2X4SB 2Z8WC 4NWTH 3OSKA 1MCIA 3WIFA 4F7MA 2D0HA 5I1IH 1KPRB 2XY1A 4NBZB 1ZT1B 1R5IB 4ZO8A 1UC6A 3VXOB 1L4IA 3VXUD 2OL3B 5DHVB 3FT4B 1YEGH 5F6IC 5EUOA 5FUZH 1F42A 2H9GA 5FHBL 5BRZE 4KI5C 2Q86A 4OZIF 2H32B 4PJXA 1T20A 3DUUA 1I9RL 2A6IB 3B4NA 3DSFH 3BP6A 1EEQA 2BSRA 1HZHH 1NC2A 1MHPH 2O26U 1MAMH 4FFVD 2EDEA 3AB0C 4FQ2L 1CLOL 2NXZB 2XIDA 1DQLH 4PJGE 4KZEH 4ZODA 5T1DH 1C5CL 3O2WH 3NIGF 3WD5L 1LO2L 3O2DA 4YEEA 4F2MA 1BOYA 3WJJA 2ORBL 3C60C 3CMOH 1OWWA 4N0UA 4HWBA 3DOSA 3GNMH 1DBJL 4XB7A 2Y1VA 3R4DA 5F1IA 1F6AA 5ANME 2JCCE 1G9MH 5DVLA 4HCRA 2QR0B 4HCRH 4G6KL 5IROA 1DANT 1F45A 5CEYA 4AEIH 1HINH 2HJFB 5IVZA 4X98B 4HKZB 1A6TB 1EGJL 4O9HH 5DQJA 3TBYA 4GKSB 4OCRH 4MD4B 2A74A 1OAZL 1XGTB 5EO1A 1KIQB 5TE6H 4D9QD 1AFVH 4PJAE 1X7QB 2D7OA 3RZWA 4KRNA 3HNTH 4PY7B 2H2PD 4N9GB 1QSFB 4PJBB 2VYRE 3WFZA 1X5KA 3GJEB 3QUZB 4RBPK 1VERA 4OGXL 2XTJE 3GMQA 5HPOA 5C0CE 1JNNH 1VGEH 1UM4L 1ZHNB 4XP5H 5CSZB 5MEQB 1N2RA 4XZUB 3I9GL 3GSWA 5ESQB 3G6JA 2XTLA 2MJWA 5ID0A 4LU5L 1PY4A 2KH2B 1X4YA 2QV2A 2YD2A 1MPAH 3E3QC 5DD5L 2GFBB 1JGLH 4OTXL 5JW4M 4Q97A 1F11A 4OCSL 4DZBB 1DVFD 3N1GC 5BO1L 5CEZH 5BQ7B 2V9RA 2YPVH 4KAQL 1P4LB 3NIDE 4WHYH 5INDA 5DDHA 4IRJB 4JFFB 4FXGA 5FCUH 4OFIA 3KPOB 5TDNB 1RZJL 2ZOKA 1MCEA 4OZGE 3J8F7 2VSDA 4GAFB 2B4CL 2DL9A 4KKBC 7FABH 5DVNA 4LSRH 4CADA 3DBXB 2HAZA 1HK6A 3MLTA 4X5XB 5E8DL 3LZFH 3MBEB 1N0XL 2XN9B 2V5TA 2DD8L 3ARDD 1DLHA 4LKXA 4P5TB 4HK3J 3SKOB 2YBRA 4HEME 2ESVA 3QFJD 1PX3A 1GOHA 3O45B 1YNKH 3GSRB 4WW2B 4IDLA 1MF2H 3MOAH 3S5LB 4S1DC 4N0FB 4L4VA 1X6LA 3STZB 3DIFB 2VDKH 1FQ9C 2OTPA 1X44A 4B5EA 2OBGA 4JQXA 2ZJSH 3MRJA 1OSPL 4OZIA 5SWZD 2IFFL 3L7EB 4LMQI 4J4PD 4O02H 4ZSOB 4M6NL 2JJSC 1OT1A 3L95A 2ZCKL 1IFHH 4GUPB 2IG2L 3C6LC 3O6KH 1GGCH 3BMVA 3MRQA 4S0SD 3MV7A 5HGGS 1E6JH 4L8SC 3L7FB 5F44A 3KPSA 3QULA 3OGCB 3FO2B 4O4YH 1F90L 3AM8C 1VFBB 2G5BA 1UKQA 2BNRD 1E6OH 3DYMA 4JO3H 3UZEA 5ALCH 3WS6A 5IHUL 1XF3B 4XT1C 5DFVC 3HR5B 2JB6A 1TLKA 3TO2B 3K0WA 1RULL 1AY1L 4OV6F 2NNAB 4XPAL 3ZSTA 1KIRB 1YMHB 3BXNA 5C0RL 3BDYH 1LEKB 1LK2A 3RY4A 2NZ9C 2HLAA 4JN1H 4LSTL 1U6AH 3WNKA 1S7UB 2VR9A 2YA2A 3RKDC 4G3YL 1CI5A 1WF5A 4JEGB 1CF8H 3AREB 2Z8RA 3QO0B 4MVBC 4MQ7B 3MTRA 1AXIB 4U0QB 4PJHA 4L4JA 4WV1A 2X4RA 2C4XA 2AK4B 2ZUWA 2BFVL 2VH5H 1S7SA 2X10A 4RQQA 1SMOA 4LVOB 5CMAB 4XBGA 4WUKL 5B3JF 3KPLB 4K71B 5B39A 1MSPA 3BD5A 4DK6A 3MXWL 1M71B 1ZHBB 3NAAL 5IG7A 3DYPA 2WINB 3TFKD 1BFOA 1JF1A 5E2TH 2A1WL 3ZTNL 1DQTA 4X6CE 4WCYH 4XNUH 1FVDA 4L4TA 5FECB 3VXTB 1CE6A 4LPTA 3DVGA 4P2RE 3HCVB 3NFPA 4ZS7L 4FQCH 4S1QL 1F4AA 1FNFA 3QUYA 3S34L 3DRQA 1JN6B 1QO3B 2O5YL 3T1WA 1I3GH 1MCHA 2Q3ZA 3FQRA 1ZLUH 3S88H 5EBMA 2EDHA 2J6EH 3Q2CA 3GSUA 5JQ6H 5LBSH 4RFNB 3AS2A 1MOEA 4AMKH 2R2HA 4MD0B 1B2WH 2IANB 2R2BA 1NGQL 4YDJB 2ICWI 2H6PA 2IGFH 4OFKA 3BH9A 3HI6L 1WJ3A 5IOPA 3EBAA 4DTGL 2PYFA 5JPMB 2UVFA 4OGYH 1I8KA 2Z91A 1GZPB 2EDFA 4JCLA 1WT5A 4R0LC 1HI6B 1L0XA 3V7MA 5D7JD 5I1AA 3L3DB 3ARPA 4HIHB 4ORGA 4KMTH 3WLBA 3B2UD 5F8RC 3SJVB 1AQDA 1TZIA 1NGYA 2PW2B 3FB5A 3U4EA 5E1AA 2E5EA 3ILPB 4JVPA 3TVMA 5IK3A 1HHJA 3DO7B 1EFXB 4KKCC 3PQYA 2ICWA 2WQRA 4FZEL 5D9SA 3I3EA 4Q58C 2W60A 3F8UB 4JGJA 5CUSH 2ZSVA 1V3JA 3U46A 2V9QA 1P2CB 5TQ0L 1X5LA 5CSGA 1BJ1J 1A6UL 2DMBA 3MLSL 2AJVL 2YD8A 1ZGLM 1AR1D 3MRMB 1YECL 1SBSH 5KJRH 4KK8D 4Y8DC 4BFIA 3WJLC 3ULSA 3KS0H 2R0ZL 4WEMB 4XPGL 2E7BA 2GJZA 1EH9A 1MJJB 5BRZB 1MAJA 3LH2L 4LHUA 4LLVA 3VJ6B 4HUMB 1RU9H 3RNQA 3HUJA 4WUUB 4M48L 5FA3B 2EC8A 2XYCA 2HH0H 1NUGA 3ULUF 1FE8L 2ZPKL 4KXZH 3IS0X 5E2WL 5C0GB 4XXCC 4DZ8B 3OAZK 4Z7UE 4HUKB 3EJZC 4L5FL 3HMWL 5CKAA 4XB8A 3DXAD 1FL6B 2EDKA 1OWRM 3JTTA 1X4ZA 2Y07L 1F4XL 5CIPB 3LPFA 5SWSD 3FRPA 2NY4D 1P5UA 3D87B 5I1GL 3U1SL 4NP4H 1HHKA 2C3HA 3ZL4H 5ANMB 2JCCB 2YC1A 1QSED 1YQ2A 1Q72L 4UINH 5GRUH 2EYRA 3C5ZD 3L6FA 3HZMA 3RZCA 3VWJC 3WXVL 1DEEB 4GKZB 1OQOA 4OCWL 1U8PA 2WBWB 4C83B 1KG0A 1OGAA 2EKJA 2VUOA 3WFDH 5CINL 4PYGA 3D3VE 3QEGL 4PJAB 4EUPH 2E27H 4YIQB 4RIRB 3JWOC 4ODVL 4UUJB 4OLWL 3LS4H 3RWHA 3GGWB 1NCUA 1NFIA 2XTJB 2Z31A 5DJ2B 5C0CB 1XZ0A 5D2LF 4P5KA 1MCPH 1KCUL 1T7YA 3CJJA 4XPHH 3GFUA 1ZHLB 4YHLH 3S36H 5FM5O 3QNYA 3FQUA 4PJ7F 2GCYB 3ILQD 4NRZA 3GSOA 4HFUH 5KVGL 1FPTL 4BQ8A 5ESVA 4Y5VC 4F7TA 4JN2B 4ZXBC 3RAJH 3U0WH 3O11A 1BIIB 1FRGL 1IZKA 2AEPH 1KEGH 2UYLA 4LARL 3IFOA 3GRWL 3S3JA 5ENWB 1U3HB 4KFZC 4NRYB 4GXVL 1N0LA 1N6UA 5DJCA 2GEEA 4TSAL 3ZE0F 3UTZB 4UT7H 1CXKA 3HE6B 5AZEH 3A0OA 3P4LA 2NXZD 3HHRB 5GHWL 4OZGB 4ALAL 4RISL 1KFAL 5I8EB 4YDIH 1FN4A 3KJ4C 2V2XB 4MXQC 4PJ8C 3QA3B 1TCMA 4ODXA 1GIGL 3C6LB 2HJKA 4HKBB 2VDQH 3TIDB 3KLDA 4KV5E 2P43B 1U8IA 3HI5H 4L8SB 4XXDA 5IVXA 1CQYA 2VN7A 1CDCA 1KCLA 3IDIA 4G6JH 3D0LB 5D7SH 1QTYT 3FB7B 1M7IB 4MA7L 3V0VA 3HC4L 4NGHL 3FCTA 2BCKA 5KSAC 5E5UB 4UU9B 5E4EC 4K8RC 1PEWA 3MJ7A 4KVNL 3S4SG 4HXBH 2R1WB 3E6FA 3THML 1RHFA 2XPGB 5EH1A 3H0TB 3ZKND 2EICA 3VCLB 1Z3GH 3MV8A 2MCPH 2B0SH 3ABZA 1QSFD 2QQQA 1XGYH 3KDMB 5E6ZA 2Q7YA 1T22B 3MUJA 3SBWA 1ZLVH 1MNUH 1PG7L 3JV4A 4XWGL 3QUZD 2N7BA 3LKSB 5F1NA 3ULUH 1D9KD 2X4OB 1U8QB 5AAWA 5JHDA 4F7CB 2OTWB 3MJ9A 3P2TA 4YDKH 1JPST 3DX6A 3NIFF 5AG8A 3SE4C 2GUOA 3HE7B 4LLUA 1F3JA 5AZ2H 2FZ3A 2ICCA 3L3IA 4M1CD 5A43C 4PRDB 1FNSL 3PHOA 1XGPB 3P9LA 4O58L 1NDMB 2XA8H 1ETZA 1DBAH 4D0CA 5L88L 5MENB 1YY9D 1T1YB 1I1AC 3CZFB 1RK0B 3OR7B 2CR6A 4HIEA 1A3QA 2VO5A 5GS2D 5D7IF 4U1NA 4D3CL 2CO7B 4JFFD 4OZHE 4WNQB 4P99A 1EO8L 1OM3H 1YUHB 1FFRA 5LJYH 5JIKA 1OP5K 3WKNA 4PTTB 3QUMH 1JFQH 5L7XH 2GTWA 1F8TL 4HK0B 5CGYD 4QTHB 2PW1A 1L9NA 2ZCHH 5FKAA 3OG6B 3JWDC 1HYRC 4PGBB 5I1LB 3MRLA 3LCYA 2FLBT 1BMGA 4FQQB 5JDJA 1YEJH 4NFBA 5FIEA 3NMEA 5EBWA 2XN9D 3PWPE 3QFDA 3RWCA 2FEEI 4P5TD 1S7XB 4S1SH 5JOEA 1SJHB 3D39A 5CJBA 5TF1L 4JFHE 4OFPA 3E1F1 4N0YH 1DE4A 4ONHA 2UUDK 3GMMB 3MRKA 4PJ7A 4X6CB 3HZVA 3FO1B 3R8QA 1TCRB 4P2RB 3ZYZA 4AT6A 1PYWB 1CLYL 2L4OA 3QJHA 1S7RB 4CVXB 1XGQB 4O2EB 3IYLW 4U1KA 3VI4E 1NMCC 2EIBA 4P59L 4ZS6D 4KDTA 3TLRA 4PTUA 5EZLB 1QR1B 3CVIL 4JY6A 5IMKA 1N6QL 3WFCL 1OTUC 4RGNE 3DGGB 4PJFF 4UNUA 3FONB 1JCKA 1JI2A 1DUYA 3FQNA 1A9EB 2XFXA 5BZDB 1ZWIA 4Y1AA 4C54A 4CKVX 4H20H 4XPBH 4YHIA 3TO4A 5LKNA 2BVQA 4W6WB 4FS0A 5JIHA 5F9AC 4UBDD 2AJZB 5KANG 1J1OH 3FO9B 1Q9OA 3VGAB 1YEDA 3MQIA 2Y25A 4X4YA 4B53A 3MOQA 5LXGH 2XWJB 2Y06L 5E6IC 1G84A 3ARED 2YZ8A 1RZFH 1U8NB 2R2EB 5KZCB 1HH6B 3HC0A 2CKNA 1D5ZA 2VXUH 3L3JA 2VDRH 1Q9WA 4AEHL 4HGWA 2AK4D 3AC0A 6FABH 3DVNA 5GRWA 1ITBB 1YMME 3O4OB 4RGNC 3DROB 4KHXL 1G6VK 4DK3A 1MCOH 3ELAT 3SDDA 3RIAK 2PTUA 4FQXB 4JHAL 2VL4A 1N7MH 1ZEAL 2YOCA 2O5ZL 1LP9A 4XBEL 2P5WA 4HG4J 4ZFZB 5TH2A 5HI5D 2DLIA 5GQBA 1OGTA 2VZVA 1D5XA 1AQKH 5D7IA 4NDMA 4R4ND 4OD1L 3P30H 4HG4K 1FNAA 1B6UA 1UCBL 4NC0B 2DJUA 2CJUH 2IAND 4Z7UB 1AGDA 2CKBB 3FMGL 1R5VA 2VDML 3O6ML 4JM2F 2K7QA 5AWNL 4X80L 4I2XA 1BJ1H 4NO3A 5CILL 1DANU 2ICEB 4C56E 2A9ML 5C0NC 3FQXA 1BM3L 2CDGA 3BKJL 5DEGB 3OV6A 2ADGA 4N5EC 1AJ7H 1GJIA 3VXPA 4R90L 4Z77B 3RA7H 4K3DL 5HDBF 3RPIB 3UJJH 5D5MA 3SJVD 4PLJC 3TT1H 3MA9L 1CD1B 3U2SB 2AI0L 1ZGLP 5EBLB 3FOMA 1U2HA 4NO5B 1RIVL 2VC2L 3D3VB 3MRRA 4LQFH 1EFXD 5EIIB 1CXLA 3DWTA 5D1QA 1IKFH 1QOKA 2X4TA 5GGRY 5C2BH 4PRNB 3HB3C 3KJ4B 1Q9KA 4IS6B 5FDWB 3IDUA 2DQUL 3VFTA 4NNPL 3EW3B 3VXNA 4H88H 4Y2DA 4N0CC 4PJFA 2XT1B 3EZ8A 1EMTL 1K9TA 1OAQH 5GPRA 3VU2A 5C70A 3CXDL 1EFQA 1S7VB 3JTSA 4PS4L 5BRZD 5KSAB 3OBAA 5CCKL 4MS8C 1DEDA 3QRGH 3MYJA 1EPFA 4I3SH 4TSBH 3EUUA 4JY5H 4DN3L 1WSST 4E42B 5C8JB 5IMOB 4GAYA 3MUGB 3D25B 3EO1A 5IHZB 3BZ4A 4GRMB 5C0JB 1QHPA 1E4XH 3ARFC 3QQ3A 1T0NB 1IGFH 4G43A 5E5MA 3P4NA 4ELME 1M7DB 3FT3A 3IVKB 1CLZH 4AL8L 1U8LA 1NCAL 4P4KC 1DN0A 1Q0YL 2NY1C 1XGRA 2L7JA 3FRUA 5DGQA 1C7SA 4M7JL 4YXHH 1U92B 1I3UA 4MDIA 2BX5A 4I3RH 1J05B 1YN7A 3BRDA 2EH7L 2WBJB 4HWEH 5TDPB 1OTTC 1PDKA 5T5FL 4K3JH 3TIEB 4OF7A 5ID1B 1WICA 4EDXA 4LCWE 5DTFA 4HF5H 3REWA 3V52H 2LV4A 5HYFA 4KTDH 2JJTC 1HQ4B 4X6DE 5ETUA 4R7NB 4U6HB 4Z95L 2DQFA 2C3GA 4RRPA 1F97A 3VD9A 4NKDB 1PY9A 1TJGH 4G6FB 2H8PA 2W9DL 1UJ3A 3HPJA 2JTDA 3I2CH 4PRIB 3TN0A 2Y6SD 4JJ5A 2EEDA 3E8UL 1F2QA 2XTJD 3CDGA 1G7IB 1T2QL 3PP4H 5C0CD 1CFSB 4LOUC 4TUJB 3TBWB 3HR6A 2VLJB 5CBAA 3TEUA 3UBXG 1I9JL 2VAJA 1S3KH 4XWOC 1FORH 4JKMA 3LRSB 3C08H 3IJYA 1CIUA 1DBBH 4L8DA 5HY9B 5DMIL 1RUKH 3MRHB 4LNRA 3MJ6A 1MCSA 3H9YA 5F7MC 2YWYA 3MLYH 5DT1H 1U3HD 5KS9E 1FH5L 4Z7WA 3LRGA 2X42A 4BSWA 4KJWC 3LEXB 3BN9C 1V7ML 4HUXB 4OZHB 5JO5A 4M61A 4K9EC 3C09C 4JG0H 4YFEA 3VRLE 1NSNH 4WI6A 1A1OB 4MWFA 3V6BR 3UYRL 4ZTOL 3H7LA 4G9FE 3C6LD 4UTBL 3LRHA 5DMKB 4FMFA 4KK6C 5C3LD 4UB0H 3QI9C 4M3KB 1IEAA 3AAZA 3OJ2C 3RDTA 4MD5B 3DUSB 4KDWA 4ZO7A 3B9VA 3PWPB 4BH8A 3LEVL 5JXED 4M43L 2CR3A 1AGBA 5JOPE 1QLFA 1T66D 2BRQA 4XHJD 1ND0A 3CPLA 4WI2A 3F5WA 4G9DB 3IDGB 4UILH 3MRFB 3IDNA 2NZ9D 4GW4B 1NFDE 3FT2B 4U1HA 4LSUH 5BVJB 3RKDD 4ZUSA 2YSSB 5IEKB 2W65A 1I7TA 3Q6GH 5BOZG 1EUTA 1RFDL 2EKSB 1NC4A 2LU7A 1UB5A 4IOFC 2Y5TB 3HE7D 4LCCC 3IETB 3VWKA 4RGNB 3SQOH 3TBVB 2VDOL 3P0VH 2FHBA 1KACB 4NWUH 5B22A 5I2IB 3EJYC 3L9RA 4ELKA 4HUNB 5FO9A 2CDFA 2XKSA 4LSQL 5C08E 4Z7NF 5JDSB 4LLAA 3NZ8B 4HKXB 5DC0A 2V7HB 2VQUA 1EIBA 2X89A 3NPSB 3MRPA 1N4XL 3IXTB 4NHCH 3INUL 2ARJA 1YN6A 3GBML 4X7TB 5EWIH 3S35L 1UWEH 2NMSA 3KR3L 3CVHL 5DLMH 1F5WA 3I02B 1JZ8A 4U7SA 1WZMA 2Y7QA 5BOPA 4HMDA 1WZ1L 4DEPB 2GJ6A 3T3MF 3K2UL 1I1FB 4LSPL 5IQ9A 3H9SA 4I48B 2DJSA 5IB1B 3BWAA 4JFZL 1YMMB 4HPYL 1AGCB 3VH8A 4U1LA 3BUYB 1HN1A 3IXAA 4UOJA 2BSTB 1P4IL 2BP3A 1PG7X 1OARH 2F53E 2H1PH 4FQJL 3TYFB 4R7DA 4H8WL 5H94A 4BYHA 1VENA 2Z93A 5ISZE 4P2RD 3VRIB 4FFZL 3QXDA 3FN0H 1Q8MA 3RBSA 1BQHA 2G9HA 4M9PA 5I1KH 1JBJA 4J3SA 1PX4A 4PB0H 4XVSL 4QOKA 1I1CA 4ENEC 1E4WH 2NY5C 3V4UL 4TULH 4KKCD 3CFCL 3MCKB 5E2VH 3QDJE 1RK1B 5D6DA 1FNEA 3B2VH 4X5LA 4MA3A 5DFWH 3MLRL 3LQAL 5ICYB 5IWLA 1GGUA 4LK4A 1MFEL 2AEWA 1YNLH 5HHNA 4IDJL 1UA6H 3LDBC 4BH7B 3HKFA 4PJ9A 5CJQL 4C56B 1ZVSB 4DKDC 3S4SB 3PWNA 1LGVA 3HRZB 3GMLB 4LQ1A 2DBLH 4P3CH 3U0TB 1GXEA 2NR6C 3KPPB 4JKLA 1EEZA 1T0MB 2XKNB 2BHUA 1JPTH 4P2QE 4WHYG 4NN7C 2XZCL 1QRNE 2E7CA 3RUGF 1P4BH 3IKCB 3KLAA 3SKJH 1RZGB 3MRCA 5FKPB 1BWMA 3DLQR 1YC7A 4YHNA 4NZTH 1IM3A 4HWZA 3ARFB 1MCRA 5KZCD 2BJMH 2QSCL 1FZMB 2UWEA 1Z5LA 1LK3H 3ZT6A 5L2KE 1OAKL 5EU3A 4P4KB 2F8VA 2NY1B 4RA3A 3FL7A 2X6MA 5HVHC 1FDLL 4IBLT 4MA1C 4U7MA 1KTLB 3BPOC 4DGVH 1RIUH 5DI8B 1BX2B 1CGSH 4FQXD 4KKNA 3LHPL 4ZPTB 4NNYB 1IBGL 5GXBB 5HYQA 1I7RB 3GKZA 4HH8A 2XQYG 5AYUL 3EGSA 4OB5L 3EOTL 2W0FA 3CFJB 2NY7L 4BZ1L 4RMVA 5C86A 1LWRA 1BQLH 2BRRH 4X6EA 3ULVH 2OM5A 3WNNA 4PRPE 1CGXA 2NY3C 2OP4L 4Z7VF 4GBXA 4Y16B 4HK3N 2G2RB 5GGVY 5T1MB 1H3TA 1IEBA 1VFAA 3FQTA 1S9VA 4I9WE 2ED8A 3RL1B 1C16B 1EAPA 1MWAA 1OLZA 1MWAH 3VFRA 1YPZF 5KN5B 1OLLA 5HYJE 4D9LL 5I18L 2BVOB 5SX5K 3T65A 1WAAE 3ALWA 2L7UA 2Q1EA 5KVDH 1C1EH 4M7KH 4OV5B 1JJUA 2B5IB 2F5AH 2Z8VC 1DBKH 1T1XB 2BOBB 4ZXBD 4LCWB 1NDGB 5FUOL 2X9WA 5FF6B 2WZPD 1IM9A 1AGFB 3L5WB 1JWMB 4X6DB 2OJZL 3EDDA 2Q8AL 3D3VD 4FP8L 5IM7A 5F7DB 4QYOA 4KH2A 3T77B 1OD9A 3FB8A 2FCBA 2I26N 5HHPA 4RNRA 4Z0XB 4P3DB 4F37F 1XT5A 5MP6L 1I8LC 4MNHA 4FG6C 2GK0A 4MJ2A 5FHBH 5EUOE 5B39G 3SCMA 3QI9B 4I5BA 1I9RH 1RUQL 2P7TA 4PJXE 3QXAA 3BPCB 1M6OA 2ATKB 1HE7A 4WJ5A 3GB7A 5T3XL 4M5ZL 1H15B 3O9WC 3C5JB 1HXYB 4FQ2H 3RGVC 3V7AG 4XP4H 3HG1A 1CLOH 1XCTB 1T5XA 5KSAD 1EO5A 4G7VL 4JANB 3UPRA 1C5CH 3CFDB 1V3LA 5BZWA 3WD5H 4O2CA 1A9BB 1LO2H 2JK5B 4DUWA 5KS9B 2C7UB 2ORBH 3VGFA 2FNBA 5DD1L 2BK8A 4UIMB 1MY7A 1R5WB 1DBJH 3U30C 4M93B 4N0UE 1LDPL 3WO4C 3K1KC 1CXFA 1G7HA 4G6KH 4PRHA 1QFWL 4G9FB 3LVEA 4RMTA 3TCXA 1EGJH 4DVBB 3RTQA 1JGEA 2ADIA 1CTOA 4PJBF 4OBRA 1OAZH 2WBJD 3N9GL 3DMMA 4M62L 2YPLB 1HEZB 4JFOB 3JV5A 1I8MA 1FG2B 4HXAL 4M7LL 2F54A 4NQCA 3RWDA 3B5HA 1AHWA 3WN5C 4LCUA 4OGXH 5JXAL 1UM4H 1L0YA 3I9GH 2BMKA 5J12B 1NFDB 4PFEA 1Q94B 1U8JA 2ADJB 1X5HA 4G6FD 2D03L 4LU5H 3G6JE 4NC1E 3T0DA 3CSYB 3I6GA 4Z7VA 4GG8A 5DD5H 1G9MC 4QHKJ 5LWYL 5HGHB 4PV8A 1AIFB 3BP7B 1OAXL 4OTXH 2GT9B 4OCSH 1H3PL 5BO1H 5A16B 2VNCA 1YY8A 4JQIL 3EYOA 4KAQH 4HD9A 4Q6IA 4L3CA 5EU5B 3EYFA 1DBML 1HILA 3NCYP 1RZJH 4PLNC 2NTFA 2B4CH 2OTUB 1MHEB 3ARVA 5HGAA 2VKWA 1TZGL 5CJ5A 1N8ZA 4LHUG 5C08B 1MH5A 4ERSL 4BJLA 4ZUWA 5E8DH 1MCCA 4U6XB 2ENSA 4WW2F 1N0XH 3RY6C 1W0YT 2DD8H 3KHQA 1DQJB 5I1JL 3CFKA 1V3MA 1U95B 2ESVE 2H26A 3O41A 4FQ1L 1L7TL 1T89C 4PR5B 2EEBA 2NW2A 3PWPD 1OSPH 4P46A 5D96C 2IFFH 3O4LA 3RVUC 4NUJB 4JFHD 4OZIE 1XH3A 3ARGA 5HBBA 1J11A 4OD2B 2F53B 2Z92A 4M6NH 2FWOA 4ZYKB 2ZCKH 3H42L 3MREB 2IG2H 2CK0L 3QCUL 1T6VN 5ISZB 5E6YA 1UH4A 4KROC 3O8XC 3T09A 3VFWB 3K2MC 4PY8J 4XNZB 2OYPA 3F7YB 2EIZB 1IL1B 2FX8L 4LFHG 3UCRA 2RAMA 1F90H 3KPSE 4AH2A 3VMPA 4APQC 4ZTPL 4ODHL 3AMLA 1CFTA 4WI9A 5IHUH 1FYTE 4NJ9L 3QDJB 3B9KA 3DO3A 1ONQB 1RULH 1AY1H 3GJFK 1HCFX 4OLZL 1IQDB 1M05B 4XPAH 3G08B 4GMTL 4S1RL 5E8EA 3Q5YA 5C0RH 4RGND 5C0FA 1J1PL 2H3NB 4LSTH 4OGAC 43C9B 1E28B 5F97E 1G6RA 2KKQA 4G3YH 4EN3A 4MDJA 4CRPA 5MEPB 4XX1G 3HMXL 1A21A 1BLNB 4P2OA 2JJVA 4XNYL 4JFDA 4X9HA 2UZIL 3MA7A 2OLDA 4PJHE 4P2QB 4EI5C 2BFVH 3JUZA 4PBXA 1TVDA 1QRNB 1QBMH 8CGTA 4JRWA 4WUKH 2UZXB 3WLWC 2E9JA 2E9IA 3MXWH 3NAAH 4L3EA 3UBXB 2CDEB 1MCWW 3HZKB 1R3KA 2A1WH 1JYWA 3ZTNH 5L2KB 2BERA 1EK3A 5EZJA 1NLDL 35C8L 1NUNB 1YMMD 3V7AE 5I1EL 4TNVF 2CH8A 4ZS7H 4L4TE 4S1QH 4NFCA 3SDCA 3AGVA 2HTLD 5F7FA 3TPKA 3S34H 2O5YH 2MOVA 1H8OA 1U8KA 1TMCB 4N5ED 1OQXA 4GKOA 4UQ2A 2DM3A 5FOBA 3EKCA 1AXSB 4KKAC 3NCFB 3LKPB 4HUUA 1NGQH 1RZIA 5F8QC 4MCZB 3CC5A 4WV1C 2Q76B 4PRPB 4DTGH 3S97C 1WC7B 4P23B 4LF3A 5F7HA 1YJDL 1VFOA 2ATPA 1REIA 2E9BA 4XP9L 1FL5B 5ACZA 3PJSB 4P5MA 3TA3B 4UDUB 4X7EC 1TVHB 5GISL 1F3RB 3PGCA 3PG2A 4X6FB 1S78C 1N3NB 4N0CD 4C56D 5HYJB 3TZVB 3S35X 5FV1L 2NLJA 3QUYC 2FJGA 1A6PA 4QRSB 2AK1L 2D0FA 5H2BB 1A6AA 2X4QA 5DO2C 3JV6A 4FZEH 2BOCB 3QAZC 3PQYE 5L9DL 4KRLB 3CCHB 1Y0LA 4MS8D 4WDIA 1CICA 1J8HA 3NCBB 4OIAA 3TM6A 5TQ0H 2BSSB 3BP5A 4LVNB 3BVNB 1ZANL 1A6UH 3MLSH 2AJVH 2W0PA 1K3IA 3ARFD 3PABA 1FZOB 3ARZA 4FNLL 43CAA 4XVUD 2XNAA 1YECH 1K4DA 3WIFB 4F7MB 4P4KD 2NY1D 2R0ZH 5SX5H 4XPGH 2WUCL 4LBEA 1FFPB 4JY4A 5GS0L 2CXKA 3LH2H 5D1XA 5EUOB 3WFEL 2H9GB 3SDAA 4M48H 2Q86B 4PJXB 1MJ8L 1FE8H 2ZPKH 3DUUB 5BV7L 5E2WH 2BSRB 2PNDA 1NC2B 3PWLA 2V5MA 4JPIA 3VI3E 4L5FH 3JVGC 4NFDA 3HMWH 4YGVA 1EEUA 1OVZA 3UPCA 3D69A 4LLMB 5K9JL 2EDRA 1V7NL 5L2JA 2JCCF 3B43A 2Y07H 1F4XH 1V3KA 4GJTB 1WUNT 5TF0A 4I0PC 4L9LC 4F2MB 4YPGA 4OQTL 3BRGC 3DV6A 5I1GH 2HFFA 2GK2A 3U1SH 4N0UB 3F6IA 4WW1A 5B3JE 3ARRA 1Q72H 5D1ZA 5DRWB 5F1IB 1CQKA 1F6AB 4TQEL 2CMRL 4QXGL 4QRRA 4QHMA 3CH8A 4PG9A 1TQBC 4EXKA 5CEYB 5F7LB 3WXVH 3WIHL 4OCWH 3MLPA 3UTTA 1EXUA 3TBYB 5CINH 5IMMA 3QEGH 4NN6B 4V2CB 1OGAE 2A74B 5EO1B 4ODVH 2HLFD 2F74A 3RL2A 4F58L 4LCWD 4OLWH 4ESKA 3T0EA 3C6SA 4BFGA 1CL7L 5CLWA 3PXHA 5I1CL 4KJWD 3G5YA 3GMQB 1I7ZA 4OCXL 1KCUH 1TTUA 4XP1L 4U0RB 3GMNA 1FZJA 12E8L 1ODAA 1N59A 3GSWB 5H8DA 5GS1C 3G6JB 4WVRA 2R23A 5ID0B 3QNZA 5KVGH 1FPTH 1KV3A 3NIDF 4K7FA 1FRGH 3GRWA 1U8OB 2APTA 2HT3C 3P11L 3QI9D 3GRWH 4LARH 4XX1E 3D2UA 4G6AC 4GXVH 1ERNA 1F11B 4OZGF 5HHME 4TSAH 1MVUA 1H8SA 5INDB 2YEZA 1CDJA 4OLVL 4RX4A 5DDHB 5GHWH 4ALAH 4FXGB 4RISH 1KFAH 1JF6A 2MQ3A 2DMCA 4CNIA 2ZOKB 2YD9A 5GJSL 1GIGH 1MUJA 1UKTA 1UZ8A 4AENA 4CADB 1KJVA 1WGOA 2CIKA 3P9WB 4BQ9A 5LGJA 4IRSC 1DTUA 4S2SA 3MUZ1 3MLTB 2P8LA 4R6UA 5IVXE 5J13B 1QKZL 3MYZA 4JG1L 4ZAKA 4E41A 1DLHB 4LKXB 4MA7H 5IFAL 3HC4H 5D2NA 4G9FD 3QWRA 4NGHH 5C0DA 3CK0L 3IAQA 2ESVB 4CJ1A 4IOFD 3NN8A 4KVNH 4WEBL 1LO5A 2E9WA 4OLUL 3THMH 2V9TA 5EU6A 5J0BA 3KPQA 4L4VB 3EYSL 4YO0A 3EJYD 5DUBA 2WWMD 1ITCA 2KL6A 3MRJB 3MV8E 3MZGB 5JOPD 4MA8L 3NCJL 4OZIB 3F6LA 3BQUA 1NAKL 4WHCA 1CBVL 1PG7H 4XWGH 1UZ6F 2NCMA 1CXHA 2J7LA 3ULUE 2R1XA 4TUOA 3L95B 5C71A 1Y18A 5JHDE 3V6FB 3O2DL 4YAQA 3MRQB 4HWBL 1FNSH 3KPSB 4O58H 3LKNA 3QULB 2R4RL 3ZKMD 2MNUA 5L88H 3QEQA 2G5BB 5JUEL 4NQTA 2VLKA 3MGTA 3F65A 2JB6B 4KRPB 4V1DA 4U6TA 1S9WA 1VB9A 1W8OA 1JYVA 4GLRI 4D3CH 2FIRT 3BXNB 1EO7A 1W0WA 1LK2B 3ZYJA 1EO8H 2HLAB 4WGVB 1F8TH 5C0EA 1S8DA 3ULUC 3VD7A 1T4KA 4HQQL 1GRWA 5J6HA 4PJHB 3GM0A 2OZ4L 4WV1B 2X4RB 3FFCE 1S7SB 1X3DA 3GJFA 1VPOL 3PWJA 1U3ZA 3H7BA 4RQQB 1G9EA 4XBGB 1KJ2A 3W9EA 1NCCL 1BF2A 5B39B 5TF1H 3D39E 1KCRL 3QRFM 4AK1A 3LD8C 1OW0C 3R0MA 1BFOB 1JF1B 4U31A 2R0KL 3G5ZA 4PJ7E 4X99B 1KN4H 3RVVC 3VA6A 1FVDB 2I5YL 4L4TB 4U1GB 1CE6B 1CLYH 1EVTC 3DVGB 3NFPB 4GFTB 1NCDL 3QUYB 1IKNA 3DRQB 3V8OA 1CLCA 3FQRB 4P59H 3ZE0E 5EBMB 5ISZD 2AXFA 3GSUB 2RCSL 2HN7A 1I9EA 3CVIH 3KNBA 3FN3A 4RRPG 2R2HB 3WFCH 1N6QH 4ZNEA 3LKOA 2R2BB 4D9RD 3BIBX 2A0LD 4B7LA 5JORA 2H6PB 3MCLL 3BH9B 4P4RA 5IOPB 2PYFB 3QDJD 4Y4KC 1I8KB 1RY7B 3O6FC 2Z91B 4Y1AE 2D7NA 2AV7A 4PLOB 1DQQA 5IGXL 4J3TA 5JA9A 5GS0D 5I1AB 1O7SA 4ORGB 3WLBB 5I75B 5CP7A 1QQDA 1JTOA 2DYPA 2J8HA 4ZQKA 1AQDB 1TZIB 2DQGL 1NGYB 2Y06H 3L5JA 5CD3A 2FATL 3FB5B 5CKGA 3U4EB 1NAMA 5E1AB 2OR9L 3TVMB 3CDYA 1RVFL 4AEHH 1HHJB 1KJ3L 3QIBC 4P2QD 4JFPA 3PQYB 2PXYC 1QRND 1WFNA 3PWUA 4KDTC 5D9SB 5KAQG 3ZKQD 5C1MB 2W60B 1NMAL 2ZSVB 3LKQA 4KHXH 2DQIL 4G80A 4QY8A 2EXWC 3U46B 4U05A 2A73A 3BYTA 4P3WA 3NIFE 3JBG7 1GHFL 4OQ1A 3AXLA 1T7WA 4JHAH 2ZUQC 3RGHA 4NNXA 4XAWL 4LHJB 1ZEAH 1ZS8A 2O5ZH 4BFIB 3ULSB 4XBEH 5J3HC 2LTQB 5HHQA 5F3HA 1HWHB 1LP9E 2HKHL 4I18A 2GJZB 2P5WE 3DHMA 4M4PA 4Z7UF 4LLVB 4LHUB 1WCBA 3RNQB 3HPLA 4KUZL 5F1OB 4OD1H 2CIIA 5D7IE 3BGFC 3ZYIA 1UCBH 4YC2C 4JDTL 4NT6A 4KMQA 3Q0HA 3FMGH 5DJDA 4FQLL 3VG9C 1PEZA 3CFBA 2VDMH 3O6MH 1K85A 5AWNH 4PRPD 4X80H 5FYKE 4P23D 5LGKA 5CILH 3DUHA 3JTTB 4NCC1 1DDHA 2A9MH 1BM3H 4I2XE 3PUCA 3BKJH 1D3CA 1NEUA 3ARBA 3TA3D 2ICES 1T5WA 2XKUA 2APWA 1HHKB 2IC2A 4R90H 3G9VA 4I9WD 2YC1B 4JPKL 1TFHA 3ZHKA 4LEOA 1ACZA 2EYRB 2P46B 1C08A 3L6FB 4Y5YA 3MA9H 5HYJD 3TZVD 3HZMB 2AI0H 3RZCB 2FR4A 1RIVH 1U8PB 2VC2H 4K94L 4F80A 4QGTA 1KG0B 3L5XL 1OGAB 2MFNA 4YFLF 2N1KA 3K8KA 2E7HA 4ZFGL 5IJKC 3EO0A 2E6PA 4IHOA 4G5ZL 1QSVA 5C2UB 3WEXA 2DQUH 3RWHB 1URLA 1NFIB 1QUNA 4HEPG 2Z31B 4NNPH 5IHLB 3PV7A 1XZ0B 2EDOA 3QXVA 4P5KB 4YBQC 4UTAL 1I3RA 2V2TA 1CYGA 1EMTH 2D31A 3HN3A 4PJFE 1NCNA 3L3GA 2ZOLA 4EOWL 3QNYB 3FQUB 3CXDH 5DYOA 4PS4H 4NRZB 4LLYA 3GSOB 2VLLA 5CCKH 3AROA 1CU4L 5ESVB 5SV3A 4F7TB 3VH8G 1NL0L 3O11B 4DN3H 5HI3C 2AQ1A 1IE5A 2UYLB 3IFOB 5HHMB 1JZ2A 3H8NA 5DJCB 5GS3A 2IBZY 4X8JA 1NC2D 5F89A 4KJPC 5D72L 4AL8H 1NCAH 1Q0YH 1C12A 3KLSA 4UV4L 1BQHG 1FN4B 1PBYA 3LY6A 4M7JH 3WS3A 5AYQA 1EHXA 3H6JA 3RI5K 4ODXB 2HJKB 4JPVH 4YBHA 2EH7H 3ZTJG 5SX4H 1U8IB 4XXDB 3TV3L 5IVXB 5T5FH 1KSRA 3IDIB 1FNHA 2B1AL 1FZKA 5T3ZE 4X9FA 4NHUA 3V0VB 5E9DA 1A7PL 1LO0L 3TJEL 3FCTB 1W8NA 2NYYC 4YDLB 3MJ7B 4Z95H 3OPZL