4RX2A

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
255
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 255
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rx2A00
3GRJA 2J9PA 2ZC7A 3N8SA 1Q2QA 2A3UA 2ZQ8A 3SH9A 3SOIA 2WKIA 5DF7A 3VP3A 2G2WA 1PYYA 3UE1A 5DF8A 1J9MA 1NRFA 2Y59A 1ESIA 4IVIA 4OP5A 1W79A 4KZ5A 4EBPA 1ONHA 1DJBA 5M18A 2JCHA 5EVIC 3FWLA 2J9OA 4EQIA 3DTMA 1QMEA 4X55A 5AQ7A 1KVLA 5FI7A 1OMEA 2C5WB 4GDBA 2ZC3B 5GL9A 3HL9A 5CHJA 4OPRA 2Z2MB 3NC8A 3ZNTA 1ALQA 1EI5A 3C7VA 4KZ9A 2WGVA 3W4QA 1MY8A 5HX9A 3UO9A 4MEZA 1XGJA 4R1GA 4OVDA 3TOIA 4PMAA 1XA7A 2VGJA 1K25A 2Q9MA 5F1GA 4ID4A 4PM6A 4HEFA 4LV2A 1BTLA 5JYPA 4MLLA 3NCKA 3M2KA 2XH9A 2EX8A 3Q82A 1FQGA 4GOGA 3FZCA 1LL5A 1MWRA 3IF6B 3LY3A 3PBRA 4Q8IA 3UPOA 1MKIA 3LO7A 1WE4A 3I7JA 2Y2JA 5A92A 5FQ9A 1TVFA 1DY6A 3ITBA 1PIOA 4DE3A 1W7FA 2P74A 3N4IA 1N4OA 2WGIA 3HLEA 3PBQA 3NI9A 4GD8A 1IELA 1L0EA 5EVIA 4GZBA 1Q2PA 5U47A 2Y2MA 4XUXA 1BUEA 1FR6A 1O7EA 3V3SA 3RJUA 3FKVA 2C6WB 3VP1A 4R4RA 5DVAA 1XKZA 5EOEA 5F82A 5IHVA 3Q1FA 5E2FA 3VP4A 2J8YA 1NYYA 4OOMA 1O07A 3BECA 3MXSA 4Y7PA 1PZOA 3D4FA 1PWCA 1FSYA 1ESUA 1LI9A 1NYMA 4PM7A 1S6RA 4JXVA 3JYIA 1L0FA 1SDEA 1U60A 4JF6A 2R9WA 5FATA 1JVJA 5FA7A 5M1AA 2H0YA 3MKEA 4GDNA 4UAAA 4N1HA 2XDMA 4JXWA 2XFTA 3NDGA 3MZFA 5DF9A 1K4EA 1CK3A 1Z6FA 3ZGAB 5GLAA 1GHMA 2OV5A 1K55C 4NETA 3IXGA 4R23A 4X69A 3BFEA 2HDUA 4OONA 3WRZA 3UNWA 4P87A 3Q81A 3V50A 4EWFA 1MWUA 1YQSA 3O88A 3FV7A 4C75A 3VSKA 5HAIA 1HD8A 4OQGA 2BG1A 3G2ZA 3MXRA 2ZQCA 3N6IA 1XXMA 4CJNA 3OCNA 1NXYA 4X53A 4P6BA 2H10A 4OQ0A 4KZ4A 5FQQA 1ZKJA 3LCEA 5JYOA 4N9LA 3HLWA 5E2EA 3PBNA 3BFFA 5EECA 3HLDA 3AGDA 3NY4A 5A91A 1YLTA 5J8XA 1NJ4A 1FCOA 2Y91A 3HUMA 4N9KA 2Y2HA 4WELA 5FI6A 3SS4A 2X01A 3TG9A 3HLGA 3UE0A 4B4ZA 2PBYA 4QJGA 2Y4AA 4S2KA 4OPYA 5HW3A 3ZG8B 5FAOA 5EOOA 3IH9A 4KG6A 4QY6A 4KZ3A 1MXOA 4OPQA 3A3EA 3B3XA 3CG5A 4Y0TA 3ZHHA 3ZNYA 4FH4A 4A5RA 5CTNA 2JE5A 4PM9A 4WBGA 2OSUA 4S2MA 4Z9QA 4LCLA 5FQIA 5EE8A 3ZCZA 3OCLA 1K55A 1EWZA 4FSFA 4P85A 3WS5A 4WEJA 1H8YA 1H5XA 1MBLA 1TDGA 2QZ6A 2XD5A 4JXSA 4KZ6A 4S2JA 2OLVA 1YT4A 4QY5A 1I2SA 4X68A 5D3OA 1NY0A 1L0DA 3V3RA 2XK1A 2H0TA 5EVID 2ZQDA 5EPHA 4GKUA 5HARA 1IEMA 4DF6A 3OPLA 1PW8A 4R3JA 3UDXA 1KVMA 3A3FA 3O87A 4E6XA 3GSGA 3HVFA 3ZG7B 1IYOA 3TSGA 2Y2OA 4QU3A 3LY4A 4XUZA 4FCFA 1BLPA 4U0XA 4GN2A 2IWCA 4X56A 5FI2A 3IQAA 3S4XA 4LV3A 4C3QA 4ZJ2A 2PU4A 3PTEA 4WEKA 1BLSA 3G35A 4KZBA 4B88A 1FR1A 5DTSA 2IWBA 2Y2IA 1KGEA 2ZC6B 5HL1A 4X6TA 2XLNA 4ZAMA 1PW1A 3VOYA 1W8YA 1VM1A 4BD0A 1GA9A 2E8IA 5CGWA 2WGWA 2XFSA 3HUNA 3BM6A 4S2OA 1GHIA 4LV1A 1SKFA 2Y55A 2CC1A 1FOFA 1LI0A 2JC7A 4GNUA 1JWVA 4BL3A 5A93A 3FYZA 3NBLA 4WM9A 1BZAA 1YLJA 3G32A 3N7WA 5CXWA 2X02A 3SH7A 2HP5A 3IWOA 4UA9A 4ZDXA 3S1YA 3EQUA 1PI5A 1IKIA 3P09A 4R0QA 3PAGA 1ES5A 3O3VA 4KG5A 5KMWA 1I2WA 1PWDA 1KDSA 3VOZA 1S0WA 3RXWA 1BLHA 4OQIA 3OC2A 1NZOA 5EVIB 1YLWA 4WZ4A 3GMWA 4E3NA 4H8RA 4QHCA 2JBFA 2ZMAA 4RYEA 2P9VA 2IWDA 3BYDA 4E6WA 5CECA 4MBHA 3W4OA 2WUQA 5CHUA 4R3BA 1ZG4A 4WMCA 4B4XA 3SS5A 2Y2LA 2ZM0A 3PBOA 2BLSA 3MKFA 2QMIA 4EUZA 1K56D 4DKIA 1FCMA 4IBXA 2J7VA 4KQOA 3C7UA 4BD1A 1XPBA 4EBNA 4JKTA 3N8LA 4E3JA 5GHYA 3BFDA 3WWXA 1N9BA 2OLUA 3E2LA 4RX2A 3PBTA 3CMZA 5FAQA 5A90A 4FD8A 3UPNA 2EX2A 5HAPA 2A49A 1E4DA 2PU2A 5FAPA 3UDFA 2G2UA 4XXRA 3Q7VA 4LCMA 4S2IA 5CGSA 1E3UD 5F83A 4OOLA 1ERMA 1YMSA 4GD6A 4EBLA 2Q9NA 4LENA 2DCFA 3DW0A 3G34A 4WZ5C 4OQHA 3WS2A 1BT5A 1CI9A 2QPNA 1PZPA 2ZLYA 3OPPA 5EVLA 2UWXA 5CHMA 4U0TA 3IF5A 1TEMA 3VFHA 5F1FA 2GDNA 1CEGA 2HP9A 4IBRA 4KG2A 4JXGA 5GLCA 2EXAA 3BLSA 1K38A 3ZG5A 4HBTA 4UHUA 3GQZA 4ZJ1A 4OKPA 3HLBA 3MFDA 1K6SA 3M6HA 2ZM2A 1KDWA 2R9XA 3QNBA 3HUOA 3C5AA 4YFMA 1M6KA 1GCEA 1H8ZA 2HDRA 1HZOA 4PPRA 1ES2A 1JTGA 4ZBEA 4S2NC 3A3DA 5TFQA 3OPRA 1HVBA 4D2OA 4KZ8A 1BSGA 3WS1A 1HTZA 4P0MA 3ZDJA 2Y2KA 5FDHA 4UA6A 2EXBA 2HDQA 3VP2A 4CPKA 4WYYA 4N1XA 2WAEA 1ES3A 4E3MA 4YINA 3M6BA 1JWZA 3WS4A 3VSLA 3ZG0A 2XEPA 5CTMA 4IVKA 3FKWA 2WYXA 3UPPA 4DDYA 5L2FA 3BEBA 3EQVA 3IH8A 4WZ5A 3NDEA 2XGNA 4HBUA 3MBZA 3QHYA 2XQZA 3M2JA 4O7DA 3UE3A 5E2HA 5FQKA 3G31A 1M40A 1SCWA 3G2YA 1K57C 1GA0A 3ZG9B 1TDLA 4MBFA 2DRWA 2FFFB 5KSCA 3DWZA 3S22A 2WAFA 3HBRA 5FASA 1XA1A 5M19A 1ONGA 4WMCD 5FQMA 1SDNA 3BFCA 1RCJA 3IF6C 4S2NA 4KQRA 1RGZA 3SS3A 4OPZA 3UN7A 5BOHA 3GR2A 5TR7A 4DRTA 1W5DA 2RCXA 4FH2A 3HREA 1YLZA 1SHVA 4R4SA 2ZC4B 3ZVWA 2WGWB 4ZJ3A 4KZ7A 4OH0A 5CRFA 5CEBA 2XD1A 5AQAA 3MZDA 4BJPA 3AGEA 3OPHA 1WYBA 2ZD8A 3NIAA 4KZAA 4RVAA 2WZXA 4NK3A 4JLFA 2WKHA 1EROA 5GLDA 1LLBA 2Y2PA 4OP8A 2V1ZA 2DNSA 3GV9A 4E3IA 1K54C 1Y54A 4F94A 1ES4A 1K57A 2HP6A 2ZC5B 1G6AA 2Y2NA 3C4PA 4PM8A 4K0XA 1PWGA 1XGIA 2P9VB 2ZQ9A 1L0GA 4BQMA 5KSHA 3C4OA 5FSRA 3V5MA 4OOYA 1WYCA 4JBFA 1RGYA 4E3KA 2Z2LB 4DE1A 1YLPA 2VGKA 4JPMA 5HFOA 1QMFA 3IF6A 5DTTA 3W4PA 4KQQA 4MNRA 5GHXA 1L2SA 4S2PA 5HAQA 4QB8A 4JF5A 1KE4A 3CJMA 4C6YA 1DJCA 2B5RA 1LL9A 2EFUA 2WK0A 1FSWA 4KENB 2Y2GA 3Q7ZA 2X71A 5GLBA 2ZJ9A 4ZTKA 3IWIA 4BENA 1XP4A 5FQJA 3VP0A 1XX2A 3UDIA 1DJAA 1ZG6A 3P98A 5CGXA 4E3LA 4S2LA 3ISGA 1YM1A 2EX6A 3ITAA 3BLMA 3Q7VB 4IEDA 3A3IA 4DE2A 5E43A 3G4PA 1K6RA 3IXBA 3N8RA 3VMAA 4EV4A 1KE3A 2HPBA 1FCNA 5DTKA 1YMXA 3GTCA 3OZHA 3ZVTA 4BL2A 2H5SA 5GHZA 1IYPA 3G30A 1PI4A 3IHBA 1KE0A 1K54A 2EFXA 2EX9A 2XF3A 3PAEA 4OLGA 4Y0OA 4Y0UA 1NZUA 3IHAA 5CERA 3VFFA 3PBSA 2RL3A 3RXXA 5E2GA 4K0WA 3W8KA 1CEFA 3AGFA 4RA7A 3HLFA 3BFGA 1K4FA 5AQBA 1E25A 1IYSA 1MPLA 1BULA 4GB7A 4DDSA 4DXBA 4N92A 3IXDA 5I94A 3E2KA 1IKGA 1YLYA 4BLMA 1KGGA 4OLDA 5TGFA 1AXBA 1LHYA 3DWKA 5AQ9A 5G18A 4MBKA 4UA7A 1C3BA 3WRTA 3WS0A 1MWTA 1MWSA 3BRMA 3MZEA 1JTDA 1I5QA 3O86A 4L0LA 5KZHA 3SH8A 2WADA 2I72A 3IT9A 4HESA 3ZFZA 4DE0A 1JWPA 5EUAA 1VQQA 2ZQAA 3LEZA 1ZC2A 3HLCA 3UY6A 2ZQ7A 1RP5A 1KGFA 1G68A 2V20A 4QD4A 2V2FF 3IWQA 1K56A 1BLCA 3A3JA 4E3OA 5CEDA 2FFYA 2WZZA 2ZM8A 4PM5A 3Q07A 2WKEA 2XR0A 1GHPA 3IXHA 1CI8A 1W8QA 3CZDA 4M3KA 3GVBA 4JF4A 4K91A 4DXCA 3V39A 1ERQA 3QNCA 4RX3A 1E3UA 1IYQA 2Y2QA 2HDSA 4LV0A 4U3TA
chains in the Genus database with same CATH superfamily
3UB5P 1Q2QA 2G2WA 2B95A 2G7UA 4MDZA 3R7WB 3H9WA 2JCHA 2O9CA 5EVIC 5AQ7A 5FI7A 2C5WB 1MZUA 2Z2MB 3ZNTA 1ALQA 1EI5A 5HX9A 1XGJA 3LYXA 2QJ7A 3PR6A 5L8MA 4ID4A 4HEFA 3NCKA 4GLQA 2EX8A 3FZCA 3LY3A 3PBRA 1VETB 1MKIA 2W27A 2PAVP 3N4IA 1OPXA 4LRXC 4I3JA 4GZBA 5U47A 4GHIB 3E4PA 4Y17A 2VV7A 2V0UA 5DVAA 4NXFA 5EOEA 3VP4A 2J8YA 4Y7PA 1PWCA 1LI9A 5FATA 2V9AA 1JVJA 3MKEA 3BJNA 4GDNA 4UAAA 1G5UA 3MZFA 5DF9A 1K55C 3T12B 4X69A 3WRZA 1MKMA 1YQSA 1HD8A 2UV0E 4CJNA 3OCNA 4L9EA 1LSXA 3FG8A 4I3AA 3BFFA 3HLDA 3AGDA 1YLTA 3IS2B 1NJ4A 2Y91A 4N9KA 3O5YA 2Y2HA 1TS6A 3HLGA 2Y4AA 5FAOA 1CJFA 5L07A 3IH9A 4R3AA 4KZ3A 3A3EA 1S67L 3ZHHA 5EM0A 3E4QA 2FZ0A 4FSFA 3WS5A 4WEJA 1H8YA 2QZ6A 4BBUA 2NUTC 4QY5A 3LIDA 2V1AA 1I2SA 1DP6A 5EVID 5EPHA 3QP8A 4GKUA 5HARA 3T4QA 2VV8A 1H0MA 1PW8A 4FOFA 4I3IA 3LY4A 3CUEC 1BLPA 4GN2A 2IWCA 3B47A 4X56A 4P6ZS 2PU4A 4WEKA 1FR1A 5DTSA 5F6AA 3VE4A 2GJ3A 1PW1A 1W8YA 3RFBA 4O8GA 2INWA 1GHIA 4EU0A 3C2WA 4ZRRA 1OT6A 1JWVA 4BL3A 3N7WA 3UB8A 1UGUA 4L9GA 2B18A 5L10A 1I2WA 2VGLS 1TS0A 4DJ3A 1F5MA 1LL8A 3RXWA 1YLWA 3A0SA 5HDCA 3BYDA 4E6WA 3FPVA 5CHUA 1ZG4A 3SS5A 2D02A 2ZM0A 1JNUA 3CWFA 3D3OA 4KQOA 4IBXA 1XPBA 4EBNA 4JKTA 4RX2A 4HNBA 3PBTA 5A90A 4HY8A 3UPNA 5F68A 2A49A 1E4DA 2PU2A 3Q7VA 5F5YA 1ODVA 3OPPA 4U0TA 3LEQA 5TBMB 3T4TA 5GLCA 4IBRA 2NUPC 4ME4A 1K6SA 4EETB 2ZM2A 2W3DA 2XROA 1M6KA 2Y79A 4EQ1A 2EWWA 1ES2A 3MQQA 4S2NC 3EEAA 3DTKA 2VEAA 1HTZA 3ZDJA 5FDHA 2HDQA 4HH3A 3NOTC 2WAEA 3MXQA 4LGWA 4E3MA 1JWZA 5FDSA 5IS1A 2XEPA 4R38A 3JVVA 5L09A 4IVKA 2VX8A 5L2FA 3EQVA 3IH8A 1H3QA 2ZL1A 1AWIA 3UE3A 4O7DA 5FQKA 3G31A 1M40A 1GA0A 1TDLA 2CMNA 3S22A 5M19A 5FQMA 3BFCA 2JKRI 3UN7A 3IBRA 5BOHA 2RCXA 1P9RA 1SHVA 3KSIA 4OH0A 2XD1A 3AGEA 3OPHA 5MC7A 1NWZA 1WYBA 4KZAA 1P97A 2ZBBA 2WZXA 2OAP1 4NK3A 5J7EA 4O01A 1T1CA 2LB5A 4F94A 1ES4A 1G6AA 2Y2NA 1PWGA 1A0KA 4WL9A 1RGYA 2Z2LB 4LRYC 4DE1A 5HFOA 3U2AA 3BWLA 3W4PA 4KQQA 5GHXA 3T4LA 2EWVA 5HAQA 2BTFP 4C6YA 2WK0A 1FSWA 2QYBA 3Q7ZA 4KENB 2ZJ9A 4BENA 1T1BA 1VEUB 1ZG6A 5CGXA 1V9YA 3LIEA 4S2LA 2VA0A 3Q7VB 4IEDA 4DMZA 4DE2A 1K6RA 3IXBA 4EV4A 1KE3A 3HJKA 5DFYA 3ZVTA 4BL2A 2H5SA 5GHZA 3S7PA 1IYPA 3PAEA 4Y0UA 1NZUA 3IHAA 1OTBA 4ARZA 4HOIA 4RA7A 3HLFA 3BFGA 5AQBA 1IYSA 1BULA 3KYQA 5TGFA 1AXBA 1LHYA 1XFNA 2EA9A 1C3BA 3T1SA 3ICYA 1MWTA 1JTDA 1I5QA 4XT2A 3O86A 5KZHA 3IT9A 2I72A 3KO6A 3MF0A 3NULA 3LEZA 2ZL1B 1RP5A 1KGFA 2JKTM 1G68A 2O9BA 4RQ9A 2ZM8A 2XR0A 1XJ2A 5HSQA 1OT9A 1CI8A 1W8QA 3CZDA 4M3KA 4DXCA 3GRJA 2J9PA 3N8SA 2A3UA 4D60A 4Y2FA 2WKIA 3UE1A 1J9MA 1W79A 3MS6A 4EBPA 3DTMA 2QJ5A 3P01A 5GL9A 5CHJA 4KZ9A 2JKGA 4PMAA 4I39A 2VGJA 1K25A 5F1GA 5JYPA 2P7JA 3M2KA 1FQGA 3LR3A 3CPTB 3UPOA 5HD5A 3LO7A 5FQ9A 1TVFA 4Y5FA 1NRJA 3ITBA 5HD3A 5C5KA 5IT5A 2J80A 2PDRA 4CLCC 3NI9A 2PR6A 1SKOA 3FKVA 2C6WB 4UQIS 3VP1A 4R4RA 2E8JA 5IHVA 3MXSA 1SDEA 4ARZB 4JF6A 2R9WA 1XJ4A 2WKQA 4HIAA 2H0YA 3BY9A 3NDGA 4WUJA 1K4EA 4NXEA 4ESPA 3IXGA 4R23A 3MSHA 3NJAA 3UNWA 2PBDP 3PXPA 4XT2B 3LIAA 2W1TA 3FV7A 2Y8HA 3MXRA 4HP4A 3LIBA 4ETZA 1NXYA 4HP9A 4X53A 4OQ0A 4KZ4A 5FQQA 1YKDA 4N9LA 2PYPA 4MN7A 5A91A 3R4KA 4B4ZA 4S2KA 4OPYA 3H7WB 5EOOA 4Y0TA 3CG5A 1KOUA 5HL6A 2JE5A 4WBGA 4LCLA 5FQIA 2W0NA 5EE8A 1EWZA 4JXSA 4EEUA 2XK1A 2KDKA 2PT7A 4PHTA 4R3JA 3O87A 4E6XA 4BBTA 3HVFA 1OTEA 3ZG7B 4YWZA 4FCFA 2VK3A 3S4XA 3IQAA 4ZJ2A 2V0WA 3PTEA 5HDDA 3VE3A 3EEHA 4ZAMA 3VOYA 2WGWA 1MC0A 1SKFA 2Y55A 2CC1A 1FOFA 1LI0A 4GNUA 4WM9A 1BZAA 3MFXA 1YLJA 3F1PA 3T4OA 2X02A 4UA9A 4ZDXA 1IKIA 3P09A 3DTIA 5F69A 1S4RA 1PWDA 4CLCD 5DJUA 2J3TD 4OQIA 3G6OA 4HQAA 2JBFA 4M4XA 2P9VA 2QHKA 4EW7A 4MBHA 3W4OA 2WUQA 4WMCA 4FUWA 1K56D 4JGQA 4L9FA 4DKIA 1FCMA 2VV6A 4BD1A 3N8LA 4E3JA 5GHYA 3BFDA 5FAPA 3C30A 5DJTA 2G2UA 5CGSA 4OOLA 1ERMA 4EBLA 2Q9NA 1X0OA 2QPNA 2ZLYA 3IX3A 1TEMA 3VFHA 3BLSA 2W1TB 4UHUA 1P0ZA 1YSQA 3OBFA 1KDWA 2R9XA 2PD8A 3QNBA 3C5AA 2M7VA 1GCEA 2PR5A 4PPRA 2PHYA 5TFQA 3OPRA 4WN5A 3CI6A 4KZ8A 1BSGA 2Y2KA 3BY8A 3ZYTA 2EXBA 4CPKA 3DTEA 4N1XA 1ES3A 4YINA 1IFQA 3FPWA 3FKWA 2WYXA 4KQDA 4AFIA 5G4YA 4WZ5A 3S7NA 3QHYA 5E2HA 1K57C 2GX5A 2V8CA 2FFFB 3HBRA 5FASA 3FC7A 1F98A 3ZQ5A 3S7QA 4OPZA 3F1OA 1TF1A 1V9ZA 1S1ZA 3HREA 4DN0A 2OOLA 2QKPA 2WGWB 3K2NA 4HJ4A 2ZD8A 3NIAA 3T4KA 4JLFA 2WKHA 5GLDA 3UE6A 3GV9A 4E3IA 2K2NA 4PKYA 1K54C 1Y54A 4DJ2A 2K7SA 1XGIA 2P9VB 2ZQ9A 4BQMA 5KSHA 3C4OA 4OOYA 1QMFA 3IF6A 4MNRA 1L2SA 3C8CA 1OJ5A 4QB8A 3KYEA 4JF5A 2B5RA 5GLBA 1XJ6A 3LR5A 5FQJA 2VLGA 5J4EA 5DKLA 5E43A 3G4PA 2HPBA 4BMWA 5DTKA 5G4ZA 4HJ3A 3IHBA 2EX9A 4OLGA 4Y0OA 5CERA 4E04A 3PBSA 2KX6A 2XSSA 1K4FA 1E25A 1MPLA 1XFQA 4DXBA 4N92A 4PAUA 5I94A 1KGGA 4OLDA 5G18A 1L3LA 3D72A 3WRTA 1MWSA 3BRMA 5EVEA 4F3LA 4L0LA 4HESA 3ZFZA 2W3FA 4IHQA 4GS9A 4YOFA 1ZC2A 1LSWA 2ZQ7A 1P9WA 1K56A 2FFYA 4PM5A 2WKEA 1GHPA 3DAVA 1J3WA 2I9VA 3V39A 2GNXA 3QNCA 5FEGA 4H6JA 1IYQA 4GCZA 4LV0A 4HHDA 4U3TA 2ZQ8A 3SH9A 3SOIA 5DF7A 4Q0HA 5DF8A 1NRFA 4IVIA 4OP5A 4KZ5A 1ONHA 5M18A 3FWLA 2J9OA 1QMEA 4X55A 1KVLA 3BQAA 1OMEA 2ZC3B 1UWPX 3PHYA 4OPRA 3C7VA 3NHQA 2WGVA 3W4QA 3UO9A 1YSPA 3TRCA 3BQ8A 1BTLA 3OOVA 3Q82A 1LL5A 1MWRA 3IF6B 4Q8IA 2ZOHA 2VJWA 3I7JA 2Y2JA 5AJGA 5A92A 2A24A 1G28A 1DY6A 1PIOA 4DE3A 2W3HA 1W7FA 3PBQA 4GD8A 1IELA 2Q0OA 5EM1A 5EVIA 2Y2MA 4Y3IA 1BUEA 1FR6A 1D06A 1O7EA 3RJUA 3QP1A 3V3SA 2V8FA 5HDSA 5F82A 2XA7M 3TJZC 1NYYA 4OOMA 1O07A 3BECA 1FSYA 1ESUA 4JXVA 3JYIA 2PD7A 2WKPA 1CQAA 4K08A 3SW1A 5FA7A 3NOPC 5M1AA 3DBAA 4IJGA 4N1HA 2ZMFA 2XFTA 1CK3A 1Z6FA 5GLAA 1F2KA 2JKRM 3UB9A 4NETA 3BFEA 4F3LB 4MN6A 4EWFA 2HV1A 4C75A 1ACFA 1K0KA 4OQGA 4II7A 3G2ZA 2ZQCA 1XXMA 3T1XA 4GS9B 3KX0X 5CX7A 2H10A 1G6OA 1TS8A 3LCEA 3HLWA 3PBNA 4KUKA 3NY4A 1FCOA 3HUMA 5FI6A 3TG9A 2FH5A 2YKHA 4WLAA 3RH8B 4KG6A 3HJIA 2KLIA 3B3XA 3MMHA 3ZNYA 3JVUA 4H6JB 5CTNA 2OSUA 4S2MA 4Z9QA 3ZCZA 3OCLA 1K55A 2XD5A 2OLVA 1YT4A 3TE8A 3V3RA 4X68A 5D3OA 1L0DA 2H0TA 2ZQDA 1Z09A 1IEMA 3D9YA 4DF6A 3B33A 3A3FA 1N9NA 2L1MA 2D01A 1IYOA 3TSGA 2Y2OA 4EESA 3LFVA 4U0XA 5FI2A 4C3QA 4LV3A 2OWHA 2K31A 5AVFA 2O0YA 3G35A 2VZWA 4B88A 2IWBA 2ZC6B 4X6TA 2XLNA 3LI8A 3R7WA 2ZOIA 5CGWA 4S2OA 3BM6A 3PYPA 3G32A 3S7OA 2HP5A 3IWOA 3S1YA 2A24B 3EQUA 3QP2A 1UWNX 4R0QA 3PAGA 1ES5A 3UB7A 3O3VA 1KDSA 3VOZA 1D1JA 4I38A 1BLHA 2GZAA 3UMDA 3OC2A 5EVIB 3GMWA 4H8RA 4QHCA 4B93A 2IWDA 3CUEA 4R3BA 5A8BA 2Y2LA 3MKFA 2QMIA 4EUZA 4G3VA 3P7NA 2J7VA 3WWXA 1N9BA 1YPRA 4FD8A 2EX2A 2J3WA 4GHIA 1S66L 5F83A 1YMSA 4GD6A 4LENA 3VOLA 1S1YA 1BT5A 1CI9A 5EVLA 5HWTA 4MCWA 5F1FA 1CEGA 4JXGA 2M7UA 2EXAA 1K38A 1H8MA 3ZG5A 4HBTA 3GQZA 4OKPA 3HLBA 2QWSA 1DP9A 4HH2A 4YFMA 1H8ZA 4ZBEA 1JTGA 1ZTUA 1BYWA 5FEFA 4EXOA 1PFLA 4UA6A 4WYYA 4JGOA 1IOUA 1GSWA 3EGXC 3L9KA 3WS4A 3ZG0A 2PYRA 3LR4A 1T18A 5AVEA 2XGNA 2PRFA 3MBZA 3HCYA 5HZHA 3ZG9B 2DRWA 4BWIA 3DWZA 2WAFA 4CQHA 1ONGA 3LGOA 3KSFA 1SDNA 4S2NA 1RGZA 2KOIA 3GR2A 5TR7A 4FH2A 1YLZA 2HZ5A 2ZC4B 2MJ6A 5CRFA 2O9AA 5CEBA 5IU1A 2B02A 1LSVA 4BJPA 3RTYA 1YAXA 1OTIA 1EROA 1LLBA 2Y2PA 4OP8A 2V1ZA 2DNSA 5LBRA 2ZC5B 4NKPA 1SKOB 4PM8A 1L0GA 5FSRA 1WYCA 4JBFA 4Q0IA 3LR0A 2VGKA 5DTTA 3MR0A 3EGDC 3T4SA 4S2PA 5J3WA 3CJMA 2JN7A 1DJCA 1GSXA 2EFUA 2Y2GA 2X71A 4JGRA 4ZTKA 3IWIA 4CLCE 3GDIA 3P98A 4E3LA 3ISGA 1YM1A 4I5SA 3BLMA 3JPUA 3A3IA 4NXBA 1FCNA 3E98A 1D7EA 2R78A 3G30A 1WA9A 1KE0A 2EFXA 3VFFA 4LLOB 3RXXA 4Y13A 3SZTA 3AGFA 2W1RA 4GB7A 4HJ6A 2JHEA 1TS7A 4DDSA 3IXDA 3E2KA 1IKGA 1YLYA 1ZHHB 4HI4A 2V1BA 3DWKA 2OWJA 1XJ3A 2IA2A 3WS0A 5TBMA 3MZEA 5KIZA 2HJEA 3SH8A 1JWPA 5EUAA 2W3EA 3U4LP 2ZQAA 3UY6A 4Z1WA 4QD4A 2V2FF 1BLCA 2W3GA 3A0VA 5FL3A 3IXHA 3GVBA 4K91A 5HWVA 1ERQA 3LUQA 4RX3A 4S2JA 4LPZA 2ZC7A 2H28A 1LT0A 3VP3A 1PYYA 2Y59A 1ESIA 4O0PA 1DJBA 1SZVA 1OJGA 4EQIA 1DP8A 3F1PB 4Y15A 4GDBA 3HL9A 3ULFA 3NC8A 1W63M 1N9LA 1MY8A 4MEZA 4R1GA 4OVDA 3TOIA 5I5LA 1XA7A 2Q9MA 4PM6A 4LV2A 3TW8A 4MLLA 2XH9A 4GOGA 1WE4A 3CLOA 4QPRA 5K5BA 2P74A 3NECA 1N4OA 2WGIA 3HLEA 1L0EA 1Q2PA 4B9OA 4P6ZM 4XUXA 3L7HA 3UMEA 5HWWA 1XKZA 3Q1FA 4GJ4A 4PKYG 3T4JA 1F9IA 5E2FA 3CHWP 3V67A 1T1AA 1PZOA 3D4FA 2O99A 1NYMA 3QP4A 4PM7A 1S6RA 1L0FA 1U60A 3B42A 3EOIA 1VEUA 3UB6A 3QP6A 2XDMA 4QWOA 3IX8A 4JXWA 3QP5A 4EUVA 2HJ9C 3F1NA 2VGLM 3MJQA 3ZGAB 1GHMA 2OV5A 2HDUA 3GECA 4OONA 2M1CA 4P87A 3T1QB 4CLCA 3Q81A 3V50A 1MWUA 3O88A 3VSKA 5HAIA 2BG1A 3N6IA 4P6BA 3C38A 1ZKJA 5JYOA 5E2EA 5EECA 5J8XA 4X1MA 4BBVA 3IX4A 4WELA 3SS4A 2X01A 3UE0A 4QJGA 2PBYA 5HW3A 1N9OA 3ZG8B 2WKRA 3CAXA 4QY6A 4OPQA 1MXOA 4MMNA 4FH4A 4A5RA 4PM9A 1EW0A 4P85A 1Y28A 3F1OB 1MBLA 1H5XA 1TDGA 4KZ6A 1NY0A 4GW9A 3OPLA 3K3CA 3UDXA 1KVMA 4R6LA 3GSGA 4EERA 4QU3A 4XUZA 4JGPA 1OTAA 1TD5A 1VHMA 4Q0JA 1BLSA 1PNEA 4KZBA 3IBJA 2Y2IA 1KGEA 5HL1A 5KSCA 2XA7S 4MN5A 1VM1A 4BD0A 1GA9A 2E8IA 2XFSA 3HUNA 4R70A 2Z6DA 4LV1A 2JKFA 2JC7A 5A93A 2DMWA 3FYZA 3NBLA 5CXWA 3OLOA 3SH7A 3KSGA 2JKTI 2BASA 1PI5A 5EV0A 5KMWA 4KG5A 1S0WA 1HLUP 1NZOA 4WZ4A 4E3NA 4UEYA 2ZMAA 4RYEA 5CECA 2HGVA 1FILA 5HPIA 2AVXA 3CPTA 4B4XA 2HF6A 3PBOA 2BLSA 3C7UA 4NEED 4FTXA 2OLUA 3E2LA 3CMZA 5FAQA 3T50A 5HAPA 4IUKA 3UDFA 4XXRA 4LCMA 4S2IA 1E3UD 3F1NB 2DCFA 3DW0A 3G34A 2P04A 4WZ5C 3LICA 4OQHA 3WS2A 1DRMA 1PZPA 2UWXA 2YKFA 5CHMA 3IF5A 4CLCB 2GDNA 2HP9A 4KG2A 4ZJ1A 3MFDA 3M6HA 3HUOA 1FIKA 2HDRA 5EFWA 4X1LA 1HZOA 3K3DA 3A3DA 3MQOA 1CF0A 1HVBA 4D2OA 4EEPA 3WS1A 4P0MA 3LI9A 1VB6A 3EWKA 3VP2A 3MQ0A 5TJJA 2P08A 2OAQ1 3M6BA 3VSLA 1T19A 5CTMA 1PRQA 3UPPA 4DDYA 3BEBA 4LFUA 3NDEA 1NLZA 1STZA 4HBUA 3BW6A 2XQZA 3M2JA 1SCWA 3G2YA 3H7WA 4MBFA 3W2ZA 3H82A 1XA1A 4WMCD 4X25A 1RCJA 5DFXA 3IF6C 4KQRA 3SS3A 3T1RA 4DRTA 1W5DA 4R4SA 3ZVWA 4ZJ3A 4KZ7A 4G3WA 5AQAA 3MZDA 1W63Q 2VKSA 4RVAA 3E0YA 1S4SA 2LB9A 1GSVA 4IUHA 1K57A 2HP6A 3KSHA 3C4PA 4K0XA 3V5MA 4E3KA 1YLPA 4JPMA 1VETA 1KE4A 4KUOA 1LL9A 1XP4A 3VP0A 1XX2A 3UDIA 1DJAA 2J3TC 2EX6A 3ITAA 3VV4A 3N8RA 3VMAA 1YMXA 3GTCA 3OZHA 3CITA 3NOUC 3A0RA 1OTDA 1PI4A 1K54A 2XF3A 2XRNA 2RL3A 5E2GA 4K0WA 4NG2A 3W8KA 3KYZA 1CEFA 4ETXA 4BLMA 4LRZE 5AQ9A 4WF0A 4MBKA 4UA7A 2ACGA 4UQIM 1Y4OA 2WADA 2L0WA 3LIFA 4DE0A 2Z6CA 4G3KA 1VQQA 3HLCA 2V20A 5DKKA 2L4RA 3IWQA 3A3JA 3IS2A 4E3OA 5CEDA 2WZZA 3Q07A 4NXGA 4YNRA 2ZMVA 3E4OA 3H82B 4JF4A 5HPFA 1E3UA 2Y2QA 2HDSA 1NLYA 2A2LA
chains in the Genus database with same CATH topology
3GRJA 2J9PA 2ZC7A 3N8SA 1Q2QA 2A3UA 2ZQ8A 3SH9A 3SOIA 2WKIA 5DF7A 3VP3A 2G2WA 1PYYA 3UE1A 5DF8A 1J9MA 1NRFA 2Y59A 1ESIA 4IVIA 4OP5A 1W79A 4KZ5A 4EBPA 1ONHA 1DJBA 5M18A 2JCHA 5EVIC 3FWLA 2J9OA 4EQIA 3DTMA 1QMEA 4X55A 5AQ7A 1KVLA 5FI7A 1OMEA 2C5WB 4GDBA 2ZC3B 5GL9A 3HL9A 5CHJA 4OPRA 2Z2MB 3NC8A 3ZNTA 1ALQA 1EI5A 3C7VA 4KZ9A 2WGVA 3W4QA 1MY8A 5HX9A 3UO9A 4MEZA 1XGJA 4R1GA 4OVDA 3TOIA 4PMAA 1XA7A 2VGJA 1K25A 2Q9MA 5F1GA 4ID4A 4PM6A 4HEFA 4LV2A 1BTLA 5JYPA 4MLLA 3NCKA 3M2KA 2XH9A 2EX8A 3Q82A 1FQGA 4GOGA 3FZCA 1LL5A 1MWRA 3IF6B 3LY3A 3PBRA 4Q8IA 3UPOA 1MKIA 3LO7A 1WE4A 3I7JA 2Y2JA 5A92A 5FQ9A 1TVFA 1DY6A 3ITBA 1PIOA 4DE3A 1W7FA 2P74A 3N4IA 1N4OA 2WGIA 3HLEA 3PBQA 3NI9A 4GD8A 1IELA 1L0EA 5EVIA 4GZBA 1Q2PA 5U47A 2Y2MA 4XUXA 1BUEA 1FR6A 1O7EA 3V3SA 3RJUA 3FKVA 2C6WB 3VP1A 4R4RA 5DVAA 1XKZA 5EOEA 5F82A 5IHVA 3Q1FA 5E2FA 3VP4A 2J8YA 1NYYA 4OOMA 1O07A 3BECA 3MXSA 4Y7PA 1PZOA 3D4FA 1PWCA 1FSYA 1ESUA 1LI9A 1NYMA 4PM7A 1S6RA 4JXVA 3JYIA 1L0FA 1SDEA 1U60A 4JF6A 2R9WA 5FATA 1JVJA 5FA7A 5M1AA 2H0YA 3MKEA 4GDNA 4UAAA 4N1HA 2XDMA 4JXWA 2XFTA 3NDGA 3MZFA 5DF9A 1K4EA 1CK3A 1Z6FA 3ZGAB 5GLAA 1GHMA 2OV5A 1K55C 4NETA 3IXGA 4R23A 4X69A 3BFEA 2HDUA 4OONA 3WRZA 3UNWA 4P87A 3Q81A 3V50A 4EWFA 1MWUA 1YQSA 3O88A 3FV7A 4C75A 3VSKA 5HAIA 1HD8A 4OQGA 2BG1A 3G2ZA 3MXRA 2ZQCA 3N6IA 1XXMA 4CJNA 3OCNA 1NXYA 4X53A 4P6BA 2H10A 4OQ0A 4KZ4A 5FQQA 1ZKJA 3LCEA 5JYOA 4N9LA 3HLWA 5E2EA 3PBNA 3BFFA 5EECA 3HLDA 3AGDA 3NY4A 5A91A 1YLTA 5J8XA 1NJ4A 1FCOA 2Y91A 3HUMA 4N9KA 2Y2HA 4WELA 5FI6A 3SS4A 2X01A 3TG9A 3HLGA 3UE0A 4B4ZA 2PBYA 4QJGA 2Y4AA 4S2KA 4OPYA 5HW3A 3ZG8B 5FAOA 5EOOA 3IH9A 4KG6A 4QY6A 4KZ3A 1MXOA 4OPQA 3A3EA 3B3XA 3CG5A 4Y0TA 3ZHHA 3ZNYA 4FH4A 4A5RA 5CTNA 2JE5A 4PM9A 4WBGA 2OSUA 4S2MA 4Z9QA 4LCLA 5FQIA 5EE8A 3ZCZA 3OCLA 1K55A 1EWZA 4FSFA 4P85A 3WS5A 4WEJA 1H8YA 1H5XA 1MBLA 1TDGA 2QZ6A 2XD5A 4JXSA 4KZ6A 4S2JA 2OLVA 1YT4A 4QY5A 1I2SA 4X68A 5D3OA 1NY0A 1L0DA 3V3RA 2XK1A 2H0TA 5EVID 2ZQDA 5EPHA 4GKUA 5HARA 1IEMA 4DF6A 3OPLA 1PW8A 4R3JA 3UDXA 1KVMA 3A3FA 3O87A 4E6XA 3GSGA 3HVFA 3ZG7B 1IYOA 3TSGA 2Y2OA 4QU3A 3LY4A 4XUZA 4FCFA 1BLPA 4U0XA 4GN2A 2IWCA 4X56A 5FI2A 3IQAA 3S4XA 4LV3A 4C3QA 4ZJ2A 2PU4A 3PTEA 4WEKA 1BLSA 3G35A 4KZBA 4B88A 1FR1A 5DTSA 2IWBA 2Y2IA 1KGEA 2ZC6B 5HL1A 4X6TA 2XLNA 4ZAMA 1PW1A 3VOYA 1W8YA 1VM1A 4BD0A 1GA9A 2E8IA 5CGWA 2WGWA 2XFSA 3HUNA 3BM6A 4S2OA 1GHIA 4LV1A 1SKFA 2Y55A 2CC1A 1FOFA 1LI0A 2JC7A 4GNUA 1JWVA 4BL3A 5A93A 3FYZA 3NBLA 4WM9A 1BZAA 1YLJA 3G32A 3N7WA 5CXWA 2X02A 3SH7A 2HP5A 3IWOA 4UA9A 4ZDXA 3S1YA 3EQUA 1PI5A 1IKIA 3P09A 4R0QA 3PAGA 1ES5A 3O3VA 4KG5A 5KMWA 1I2WA 1PWDA 1KDSA 3VOZA 1S0WA 3RXWA 1BLHA 4OQIA 3OC2A 1NZOA 5EVIB 1YLWA 4WZ4A 3GMWA 4E3NA 4H8RA 4QHCA 2JBFA 2ZMAA 4RYEA 2P9VA 2IWDA 3BYDA 4E6WA 5CECA 4MBHA 3W4OA 2WUQA 5CHUA 4R3BA 1ZG4A 4WMCA 4B4XA 3SS5A 2Y2LA 2ZM0A 3PBOA 2BLSA 3MKFA 2QMIA 4EUZA 1K56D 4DKIA 1FCMA 4IBXA 2J7VA 4KQOA 3C7UA 4BD1A 1XPBA 4EBNA 4JKTA 3N8LA 4E3JA 5GHYA 3BFDA 3WWXA 1N9BA 2OLUA 3E2LA 4RX2A 3PBTA 3CMZA 5FAQA 5A90A 4FD8A 3UPNA 2EX2A 5HAPA 2A49A 1E4DA 2PU2A 5FAPA 3UDFA 2G2UA 4XXRA 3Q7VA 4LCMA 4S2IA 5CGSA 1E3UD 5F83A 4OOLA 1ERMA 1YMSA 4GD6A 4EBLA 2Q9NA 4LENA 2DCFA 3DW0A 3G34A 4WZ5C 4OQHA 3WS2A 1BT5A 1CI9A 2QPNA 1PZPA 2ZLYA 3OPPA 5EVLA 2UWXA 5CHMA 4U0TA 3IF5A 1TEMA 3VFHA 5F1FA 2GDNA 1CEGA 2HP9A 4IBRA 4KG2A 4JXGA 5GLCA 2EXAA 3BLSA 1K38A 3ZG5A 4HBTA 4UHUA 3GQZA 4ZJ1A 4OKPA 3HLBA 3MFDA 1K6SA 3M6HA 2ZM2A 1KDWA 2R9XA 3QNBA 3HUOA 3C5AA 4YFMA 1M6KA 1GCEA 1H8ZA 2HDRA 1HZOA 4PPRA 1ES2A 1JTGA 4ZBEA 4S2NC 3A3DA 5TFQA 3OPRA 1HVBA 4D2OA 4KZ8A 1BSGA 3WS1A 1HTZA 4P0MA 3ZDJA 2Y2KA 5FDHA 4UA6A 2EXBA 2HDQA 3VP2A 4CPKA 4WYYA 4N1XA 2WAEA 1ES3A 4E3MA 4YINA 3M6BA 1JWZA 3WS4A 3VSLA 3ZG0A 2XEPA 5CTMA 4IVKA 3FKWA 2WYXA 3UPPA 4DDYA 5L2FA 3BEBA 3EQVA 3IH8A 4WZ5A 3NDEA 2XGNA 4HBUA 3MBZA 3QHYA 2XQZA 3M2JA 4O7DA 3UE3A 5E2HA 5FQKA 3G31A 1M40A 1SCWA 3G2YA 1K57C 1GA0A 3ZG9B 1TDLA 4MBFA 2DRWA 2FFFB 5KSCA 3DWZA 3S22A 2WAFA 3HBRA 5FASA 1XA1A 5M19A 1ONGA 4WMCD 5FQMA 1SDNA 3BFCA 1RCJA 3IF6C 4S2NA 4KQRA 1RGZA 3SS3A 4OPZA 3UN7A 5BOHA 3GR2A 5TR7A 4DRTA 1W5DA 2RCXA 4FH2A 3HREA 1YLZA 1SHVA 4R4SA 2ZC4B 3ZVWA 2WGWB 4ZJ3A 4KZ7A 4OH0A 5CRFA 5CEBA 2XD1A 5AQAA 3MZDA 4BJPA 3AGEA 3OPHA 1WYBA 2ZD8A 3NIAA 4KZAA 4RVAA 2WZXA 4NK3A 4JLFA 2WKHA 1EROA 5GLDA 1LLBA 2Y2PA 4OP8A 2V1ZA 2DNSA 3GV9A 4E3IA 1K54C 1Y54A 4F94A 1ES4A 1K57A 2HP6A 2ZC5B 1G6AA 2Y2NA 3C4PA 4PM8A 4K0XA 1PWGA 1XGIA 2P9VB 2ZQ9A 1L0GA 4BQMA 5KSHA 3C4OA 5FSRA 3V5MA 4OOYA 1WYCA 4JBFA 1RGYA 4E3KA 2Z2LB 4DE1A 1YLPA 2VGKA 4JPMA 5HFOA 1QMFA 3IF6A 5DTTA 3W4PA 4KQQA 4MNRA 5GHXA 1L2SA 4S2PA 5HAQA 4QB8A 4JF5A 1KE4A 3CJMA 4C6YA 1DJCA 2B5RA 1LL9A 2EFUA 2WK0A 1FSWA 4KENB 2Y2GA 3Q7ZA 2X71A 5GLBA 2ZJ9A 4ZTKA 3IWIA 4BENA 1XP4A 5FQJA 3VP0A 1XX2A 3UDIA 1DJAA 1ZG6A 3P98A 5CGXA 4E3LA 4S2LA 3ISGA 1YM1A 2EX6A 3ITAA 3BLMA 3Q7VB 4IEDA 3A3IA 4DE2A 5E43A 3G4PA 1K6RA 3IXBA 3N8RA 3VMAA 4EV4A 1KE3A 2HPBA 1FCNA 5DTKA 1YMXA 3GTCA 3OZHA 3ZVTA 4BL2A 2H5SA 5GHZA 1IYPA 3G30A 1PI4A 3IHBA 1KE0A 1K54A 2EFXA 2EX9A 2XF3A 3PAEA 4OLGA 4Y0OA 4Y0UA 1NZUA 3IHAA 5CERA 3VFFA 3PBSA 2RL3A 3RXXA 5E2GA 4K0WA 3W8KA 1CEFA 3AGFA 4RA7A 3HLFA 3BFGA 1K4FA 5AQBA 1E25A 1IYSA 1MPLA 1BULA 4GB7A 4DDSA 4DXBA 4N92A 3IXDA 5I94A 3E2KA 1IKGA 1YLYA 4BLMA 1KGGA 4OLDA 5TGFA 1AXBA 1LHYA 3DWKA 5AQ9A 5G18A 4MBKA 4UA7A 1C3BA 3WRTA 3WS0A 1MWTA 1MWSA 3BRMA 3MZEA 1JTDA 1I5QA 3O86A 4L0LA 5KZHA 3SH8A 2WADA 2I72A 3IT9A 4HESA 3ZFZA 4DE0A 1JWPA 5EUAA 1VQQA 2ZQAA 3LEZA 1ZC2A 3HLCA 3UY6A 2ZQ7A 1RP5A 1KGFA 1G68A 2V20A 4QD4A 2V2FF 3IWQA 1K56A 1BLCA 3A3JA 4E3OA 5CEDA 2FFYA 2WZZA 2ZM8A 4PM5A 3Q07A 2WKEA 2XR0A 1GHPA 3IXHA 1CI8A 1W8QA 3CZDA 4M3KA 3GVBA 4JF4A 4K91A 4DXCA 3V39A 1ERQA 3QNCA 4RX3A 1E3UA 1IYQA 2Y2QA 2HDSA 4LV0A 4U3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRJ A;  2J9P A;  2ZC7 A;  3N8S A;  1Q2Q A;  2A3U A;  2ZQ8 A;  3SH9 A;  3SOI A;  2WKI A;  5DF7 A;  3VP3 A;  2G2W A;  1PYY A;  3UE1 A;  5DF8 A;  1J9M A;  1NRF A;  2Y59 A;  1ESI A;  4IVI A;  4OP5 A;  1W79 A;  4KZ5 A;  4EBP A;  1ONH A;  1DJB A;  5M18 A;  2JCH A;  5EVI C;  3FWL A;  2J9O A;  4EQI A;  3DTM A;  1QME A;  4X55 A;  5AQ7 A;  1KVL A;  5FI7 A;  1OME A;  2C5W B;  4GDB A;  2ZC3 B;  5GL9 A;  3HL9 A;  5CHJ A;  4OPR A;  2Z2M B;  3NC8 A;  3ZNT A;  1ALQ A;  1EI5 A;  3C7V A;  4KZ9 A;  2WGV A;  3W4Q A;  1MY8 A;  5HX9 A;  3UO9 A;  4MEZ A;  1XGJ A;  4R1G A;  4OVD A;  3TOI A;  4PMA A;  1XA7 A;  2VGJ A;  1K25 A;  2Q9M A;  5F1G A;  4ID4 A;  4PM6 A;  4HEF A;  4LV2 A;  1BTL A;  5JYP A;  4MLL A;  3NCK A;  3M2K A;  2XH9 A;  2EX8 A;  3Q82 A;  1FQG A;  4GOG A;  3FZC A;  1LL5 A;  1MWR A;  3IF6 B;  3LY3 A;  3PBR A;  4Q8I A;  3UPO A;  1MKI A;  3LO7 A;  1WE4 A;  3I7J A;  2Y2J A;  5A92 A;  5FQ9 A;  1TVF A;  1DY6 A;  3ITB A;  1PIO A;  4DE3 A;  1W7F A;  2P74 A;  3N4I A;  1N4O A;  2WGI A;  3HLE A;  3PBQ A;  3NI9 A;  4GD8 A;  1IEL A;  1L0E A;  5EVI A;  4GZB A;  1Q2P A;  5U47 A;  2Y2M A;  4XUX A;  1BUE A;  1FR6 A;  1O7E A;  3V3S A;  3RJU A;  3FKV A;  2C6W B;  3VP1 A;  4R4R A;  5DVA A;  1XKZ A;  5EOE A;  5F82 A;  5IHV A;  3Q1F A;  5E2F A;  3VP4 A;  2J8Y A;  1NYY A;  4OOM A;  1O07 A;  3BEC A;  3MXS A;  4Y7P A;  1PZO A;  3D4F A;  1PWC A;  1FSY A;  1ESU A;  1LI9 A;  1NYM A;  4PM7 A;  1S6R A;  4JXV A;  3JYI A;  1L0F A;  1SDE A;  1U60 A;  4JF6 A;  2R9W A;  5FAT A;  1JVJ A;  5FA7 A;  5M1A A;  2H0Y A;  3MKE A;  4GDN A;  4UAA A;  4N1H A;  2XDM A;  4JXW A;  2XFT A;  3NDG A;  3MZF A;  5DF9 A;  1K4E A;  1CK3 A;  1Z6F A;  3ZGA B;  5GLA A;  1GHM A;  2OV5 A;  1K55 C;  4NET A;  3IXG A;  4R23 A;  4X69 A;  3BFE A;  2HDU A;  4OON A;  3WRZ A;  3UNW A;  4P87 A;  3Q81 A;  3V50 A;  4EWF A;  1MWU A;  1YQS A;  3O88 A;  3FV7 A;  4C75 A;  3VSK A;  5HAI A;  1HD8 A;  4OQG A;  2BG1 A;  3G2Z A;  3MXR A;  2ZQC A;  3N6I A;  1XXM A;  4CJN A;  3OCN A;  1NXY A;  4X53 A;  4P6B A;  2H10 A;  4OQ0 A;  4KZ4 A;  5FQQ A;  1ZKJ A;  3LCE A;  5JYO A;  4N9L A;  3HLW A;  5E2E A;  3PBN A;  3BFF A;  5EEC A;  3HLD A;  3AGD A;  3NY4 A;  5A91 A;  1YLT A;  5J8X A;  1NJ4 A;  1FCO A;  2Y91 A;  3HUM A;  4N9K A;  2Y2H A;  4WEL A;  5FI6 A;  3SS4 A;  2X01 A;  3TG9 A;  3HLG A;  3UE0 A;  4B4Z A;  2PBY A;  4QJG A;  2Y4A A;  4S2K A;  4OPY A;  5HW3 A;  3ZG8 B;  5FAO A;  5EOO A;  3IH9 A;  4KG6 A;  4QY6 A;  4KZ3 A;  1MXO A;  4OPQ A;  3A3E A;  3B3X A;  3CG5 A;  4Y0T A;  3ZHH A;  3ZNY A;  4FH4 A;  4A5R A;  5CTN A;  2JE5 A;  4PM9 A;  4WBG A;  2OSU A;  4S2M A;  4Z9Q A;  4LCL A;  5FQI A;  5EE8 A;  3ZCZ A;  3OCL A;  1K55 A;  1EWZ A;  4FSF A;  4P85 A;  3WS5 A;  4WEJ A;  1H8Y A;  1H5X A;  1MBL A;  1TDG A;  2QZ6 A;  2XD5 A;  4JXS A;  4KZ6 A;  4S2J A;  2OLV A;  1YT4 A;  4QY5 A;  1I2S A;  4X68 A;  5D3O A;  1NY0 A;  1L0D A;  3V3R A;  2XK1 A;  2H0T A;  5EVI D;  2ZQD A;  5EPH A;  4GKU A;  5HAR A;  1IEM A;  4DF6 A;  3OPL A;  1PW8 A;  4R3J A;  3UDX A;  1KVM A;  3A3F A;  3O87 A;  4E6X A;  3GSG A;  3HVF A;  3ZG7 B;  1IYO A;  3TSG A;  2Y2O A;  4QU3 A;  3LY4 A;  4XUZ A;  4FCF A;  1BLP A;  4U0X A;  4GN2 A;  2IWC A;  4X56 A;  5FI2 A;  3IQA A;  3S4X A;  4LV3 A;  4C3Q A;  4ZJ2 A;  2PU4 A;  3PTE A;  4WEK A;  1BLS A;  3G35 A;  4KZB A;  4B88 A;  1FR1 A;  5DTS A;  2IWB A;  2Y2I A;  1KGE A;  2ZC6 B;  5HL1 A;  4X6T A;  2XLN A;  4ZAM A;  1PW1 A;  3VOY A;  1W8Y A;  1VM1 A;  4BD0 A;  1GA9 A;  2E8I A;  5CGW A;  2WGW A;  2XFS A;  3HUN A;  3BM6 A;  4S2O A;  1GHI A;  4LV1 A;  1SKF A;  2Y55 A;  2CC1 A;  1FOF A;  1LI0 A;  2JC7 A;  4GNU A;  1JWV A;  4BL3 A;  5A93 A;  3FYZ A;  3NBL A;  4WM9 A;  1BZA A;  1YLJ A;  3G32 A;  3N7W A;  5CXW A;  2X02 A;  3SH7 A;  2HP5 A;  3IWO A;  4UA9 A;  4ZDX A;  3S1Y A;  3EQU A;  1PI5 A;  1IKI A;  3P09 A;  4R0Q A;  3PAG A;  1ES5 A;  3O3V A;  4KG5 A;  5KMW A;  1I2W A;  1PWD A;  1KDS A;  3VOZ A;  1S0W A;  3RXW A;  1BLH A;  4OQI A;  3OC2 A;  1NZO A;  5EVI B;  1YLW A;  4WZ4 A;  3GMW A;  4E3N A;  4H8R A;  4QHC A;  2JBF A;  2ZMA A;  4RYE A;  2P9V A;  2IWD A;  3BYD A;  4E6W A;  5CEC A;  4MBH A;  3W4O A;  2WUQ A;  5CHU A;  4R3B A;  1ZG4 A;  4WMC A;  4B4X A;  3SS5 A;  2Y2L A;  2ZM0 A;  3PBO A;  2BLS A;  3MKF A;  2QMI A;  4EUZ A;  1K56 D;  4DKI A;  1FCM A;  4IBX A;  2J7V A;  4KQO A;  3C7U A;  4BD1 A;  1XPB A;  4EBN A;  4JKT A;  3N8L A;  4E3J A;  5GHY A;  3BFD A;  3WWX A;  1N9B A;  2OLU A;  3E2L A;  4RX2 A;  3PBT A;  3CMZ A;  5FAQ A;  5A90 A;  4FD8 A;  3UPN A;  2EX2 A;  5HAP A;  2A49 A;  1E4D A;  2PU2 A;  5FAP A;  3UDF A;  2G2U A;  4XXR A;  3Q7V A;  4LCM A;  4S2I A;  5CGS A;  1E3U D;  5F83 A;  4OOL A;  1ERM A;  1YMS A;  4GD6 A;  4EBL A;  2Q9N A;  4LEN A;  2DCF A;  3DW0 A;  3G34 A;  4WZ5 C;  4OQH A;  3WS2 A;  1BT5 A;  1CI9 A;  2QPN A;  1PZP A;  2ZLY A;  3OPP A;  5EVL A;  2UWX A;  5CHM A;  4U0T A;  3IF5 A;  1TEM A;  3VFH A;  5F1F A;  2GDN A;  1CEG A;  2HP9 A;  4IBR A;  4KG2 A;  4JXG A;  5GLC A;  2EXA A;  3BLS A;  1K38 A;  3ZG5 A;  4HBT A;  4UHU A;  3GQZ A;  4ZJ1 A;  4OKP A;  3HLB A;  3MFD A;  1K6S A;  3M6H A;  2ZM2 A;  1KDW A;  2R9X A;  3QNB A;  3HUO A;  3C5A A;  4YFM A;  1M6K A;  1GCE A;  1H8Z A;  2HDR A;  1HZO A;  4PPR A;  1ES2 A;  1JTG A;  4ZBE A;  4S2N C;  3A3D A;  5TFQ A;  3OPR A;  1HVB A;  4D2O A;  4KZ8 A;  1BSG A;  3WS1 A;  1HTZ A;  4P0M A;  3ZDJ A;  2Y2K A;  5FDH A;  4UA6 A;  2EXB A;  2HDQ A;  3VP2 A;  4CPK A;  4WYY A;  4N1X A;  2WAE A;  1ES3 A;  4E3M A;  4YIN A;  3M6B A;  1JWZ A;  3WS4 A;  3VSL A;  3ZG0 A;  2XEP A;  5CTM A;  4IVK A;  3FKW A;  2WYX A;  3UPP A;  4DDY A;  5L2F A;  3BEB A;  3EQV A;  3IH8 A;  4WZ5 A;  3NDE A;  2XGN A;  4HBU A;  3MBZ A;  3QHY A;  2XQZ A;  3M2J A;  4O7D A;  3UE3 A;  5E2H A;  5FQK A;  3G31 A;  1M40 A;  1SCW A;  3G2Y A;  1K57 C;  1GA0 A;  3ZG9 B;  1TDL A;  4MBF A;  2DRW A;  2FFF B;  5KSC A;  3DWZ A;  3S22 A;  2WAF A;  3HBR A;  5FAS A;  1XA1 A;  5M19 A;  1ONG A;  4WMC D;  5FQM A;  1SDN A;  3BFC A;  1RCJ A;  3IF6 C;  4S2N A;  4KQR A;  1RGZ A;  3SS3 A;  4OPZ A;  3UN7 A;  5BOH A;  3GR2 A;  5TR7 A;  4DRT A;  1W5D A;  2RCX A;  4FH2 A;  3HRE A;  1YLZ A;  1SHV A;  4R4S A;  2ZC4 B;  3ZVW A;  2WGW B;  4ZJ3 A;  4KZ7 A;  4OH0 A;  5CRF A;  5CEB A;  2XD1 A;  5AQA A;  3MZD A;  4BJP A;  3AGE A;  3OPH A;  1WYB A;  2ZD8 A;  3NIA A;  4KZA A;  4RVA A;  2WZX A;  4NK3 A;  4JLF A;  2WKH A;  1ERO A;  5GLD A;  1LLB A;  2Y2P A;  4OP8 A;  2V1Z A;  2DNS A;  3GV9 A;  4E3I A;  1K54 C;  1Y54 A;  4F94 A;  1ES4 A;  1K57 A;  2HP6 A;  2ZC5 B;  1G6A A;  2Y2N A;  3C4P A;  4PM8 A;  4K0X A;  1PWG A;  1XGI A;  2P9V B;  2ZQ9 A;  1L0G A;  4BQM A;  5KSH A;  3C4O A;  5FSR A;  3V5M A;  4OOY A;  1WYC A;  4JBF A;  1RGY A;  4E3K A;  2Z2L B;  4DE1 A;  1YLP A;  2VGK A;  4JPM A;  5HFO A;  1QMF A;  3IF6 A;  5DTT A;  3W4P A;  4KQQ A;  4MNR A;  5GHX A;  1L2S A;  4S2P A;  5HAQ A;  4QB8 A;  4JF5 A;  1KE4 A;  3CJM A;  4C6Y A;  1DJC A;  2B5R A;  1LL9 A;  2EFU A;  2WK0 A;  1FSW A;  4KEN B;  2Y2G A;  3Q7Z A;  2X71 A;  5GLB A;  2ZJ9 A;  4ZTK A;  3IWI A;  4BEN A;  1XP4 A;  5FQJ A;  3VP0 A;  1XX2 A;  3UDI A;  1DJA A;  1ZG6 A;  3P98 A;  5CGX A;  4E3L A;  4S2L A;  3ISG A;  1YM1 A;  2EX6 A;  3ITA A;  3BLM A;  3Q7V B;  4IED A;  3A3I A;  4DE2 A;  5E43 A;  3G4P A;  1K6R A;  3IXB A;  3N8R A;  3VMA A;  4EV4 A;  1KE3 A;  2HPB A;  1FCN A;  5DTK A;  1YMX A;  3GTC A;  3OZH A;  3ZVT A;  4BL2 A;  2H5S A;  5GHZ A;  1IYP A;  3G30 A;  1PI4 A;  3IHB A;  1KE0 A;  1K54 A;  2EFX A;  2EX9 A;  2XF3 A;  3PAE A;  4OLG A;  4Y0O A;  4Y0U A;  1NZU A;  3IHA A;  5CER A;  3VFF A;  3PBS A;  2RL3 A;  3RXX A;  5E2G A;  4K0W A;  3W8K A;  1CEF A;  3AGF A;  4RA7 A;  3HLF A;  3BFG A;  1K4F A;  5AQB A;  1E25 A;  1IYS A;  1MPL A;  1BUL A;  4GB7 A;  4DDS A;  4DXB A;  4N92 A;  3IXD A;  5I94 A;  3E2K A;  1IKG A;  1YLY A;  4BLM A;  1KGG A;  4OLD A;  5TGF A;  1AXB A;  1LHY A;  3DWK A;  5AQ9 A;  5G18 A;  4MBK A;  4UA7 A;  1C3B A;  3WRT A;  3WS0 A;  1MWT A;  1MWS A;  3BRM A;  3MZE A;  1JTD A;  1I5Q A;  3O86 A;  4L0L A;  5KZH A;  3SH8 A;  2WAD A;  2I72 A;  3IT9 A;  4HES A;  3ZFZ A;  4DE0 A;  1JWP A;  5EUA A;  1VQQ A;  2ZQA A;  3LEZ A;  1ZC2 A;  3HLC A;  3UY6 A;  2ZQ7 A;  1RP5 A;  1KGF A;  1G68 A;  2V20 A;  4QD4 A;  2V2F F;  3IWQ A;  1K56 A;  1BLC A;  3A3J A;  4E3O A;  5CED A;  2FFY A;  2WZZ A;  2ZM8 A;  4PM5 A;  3Q07 A;  2WKE A;  2XR0 A;  1GHP A;  3IXH A;  1CI8 A;  1W8Q A;  3CZD A;  4M3K A;  3GVB A;  4JF4 A;  4K91 A;  4DXC A;  3V39 A;  1ERQ A;  3QNC A;  4RX3 A;  1E3U A;  1IYQ A;  2Y2Q A;  2HDS A;  4LV0 A;  4U3T A; 
#chains in the Genus database with same CATH topology
 3UB5 P;  1Q2Q A;  2G2W A;  2B95 A;  2G7U A;  4MDZ A;  3R7W B;  3H9W A;  2JCH A;  2O9C A;  5EVI C;  5AQ7 A;  5FI7 A;  2C5W B;  1MZU A;  2Z2M B;  3ZNT A;  1ALQ A;  1EI5 A;  5HX9 A;  1XGJ A;  3LYX A;  2QJ7 A;  3PR6 A;  5L8M A;  4ID4 A;  4HEF A;  3NCK A;  4GLQ A;  2EX8 A;  3FZC A;  3LY3 A;  3PBR A;  1VET B;  1MKI A;  2W27 A;  2PAV P;  3N4I A;  1OPX A;  4LRX C;  4I3J A;  4GZB A;  5U47 A;  4GHI B;  3E4P A;  4Y17 A;  2VV7 A;  2V0U A;  5DVA A;  4NXF A;  5EOE A;  3VP4 A;  2J8Y A;  4Y7P A;  1PWC A;  1LI9 A;  5FAT A;  2V9A A;  1JVJ A;  3MKE A;  3BJN A;  4GDN A;  4UAA A;  1G5U A;  3MZF A;  5DF9 A;  1K55 C;  3T12 B;  4X69 A;  3WRZ A;  1MKM A;  1YQS A;  1HD8 A;  2UV0 E;  4CJN A;  3OCN A;  4L9E A;  1LSX A;  3FG8 A;  4I3A A;  3BFF A;  3HLD A;  3AGD A;  1YLT A;  3IS2 B;  1NJ4 A;  2Y91 A;  4N9K A;  3O5Y A;  2Y2H A;  1TS6 A;  3HLG A;  2Y4A A;  5FAO A;  1CJF A;  5L07 A;  3IH9 A;  4R3A A;  4KZ3 A;  3A3E A;  1S67 L;  3ZHH A;  5EM0 A;  3E4Q A;  2FZ0 A;  4FSF A;  3WS5 A;  4WEJ A;  1H8Y A;  2QZ6 A;  4BBU A;  2NUT C;  4QY5 A;  3LID A;  2V1A A;  1I2S A;  1DP6 A;  5EVI D;  5EPH A;  3QP8 A;  4GKU A;  5HAR A;  3T4Q A;  2VV8 A;  1H0M A;  1PW8 A;  4FOF A;  4I3I A;  3LY4 A;  3CUE C;  1BLP A;  4GN2 A;  2IWC A;  3B47 A;  4X56 A;  4P6Z S;  2PU4 A;  4WEK A;  1FR1 A;  5DTS A;  5F6A A;  3VE4 A;  2GJ3 A;  1PW1 A;  1W8Y A;  3RFB A;  4O8G A;  2INW A;  1GHI A;  4EU0 A;  3C2W A;  4ZRR A;  1OT6 A;  1JWV A;  4BL3 A;  3N7W A;  3UB8 A;  1UGU A;  4L9G A;  2B18 A;  5L10 A;  1I2W A;  2VGL S;  1TS0 A;  4DJ3 A;  1F5M A;  1LL8 A;  3RXW A;  1YLW A;  3A0S A;  5HDC A;  3BYD A;  4E6W A;  3FPV A;  5CHU A;  1ZG4 A;  3SS5 A;  2D02 A;  2ZM0 A;  1JNU A;  3CWF A;  3D3O A;  4KQO A;  4IBX A;  1XPB A;  4EBN A;  4JKT A;  4RX2 A;  4HNB A;  3PBT A;  5A90 A;  4HY8 A;  3UPN A;  5F68 A;  2A49 A;  1E4D A;  2PU2 A;  3Q7V A;  5F5Y A;  1ODV A;  3OPP A;  4U0T A;  3LEQ A;  5TBM B;  3T4T A;  5GLC A;  4IBR A;  2NUP C;  4ME4 A;  1K6S A;  4EET B;  2ZM2 A;  2W3D A;  2XRO A;  1M6K A;  2Y79 A;  4EQ1 A;  2EWW A;  1ES2 A;  3MQQ A;  4S2N C;  3EEA A;  3DTK A;  2VEA A;  1HTZ A;  3ZDJ A;  5FDH A;  2HDQ A;  4HH3 A;  3NOT C;  2WAE A;  3MXQ A;  4LGW A;  4E3M A;  1JWZ A;  5FDS A;  5IS1 A;  2XEP A;  4R38 A;  3JVV A;  5L09 A;  4IVK A;  2VX8 A;  5L2F A;  3EQV A;  3IH8 A;  1H3Q A;  2ZL1 A;  1AWI A;  3UE3 A;  4O7D A;  5FQK A;  3G31 A;  1M40 A;  1GA0 A;  1TDL A;  2CMN A;  3S22 A;  5M19 A;  5FQM A;  3BFC A;  2JKR I;  3UN7 A;  3IBR A;  5BOH A;  2RCX A;  1P9R A;  1SHV A;  3KSI A;  4OH0 A;  2XD1 A;  3AGE A;  3OPH A;  5MC7 A;  1NWZ A;  1WYB A;  4KZA A;  1P97 A;  2ZBB A;  2WZX A;  2OAP 1;  4NK3 A;  5J7E A;  4O01 A;  1T1C A;  2LB5 A;  4F94 A;  1ES4 A;  1G6A A;  2Y2N A;  1PWG A;  1A0K A;  4WL9 A;  1RGY A;  2Z2L B;  4LRY C;  4DE1 A;  5HFO A;  3U2A A;  3BWL A;  3W4P A;  4KQQ A;  5GHX A;  3T4L A;  2EWV A;  5HAQ A;  2BTF P;  4C6Y A;  2WK0 A;  1FSW A;  2QYB A;  3Q7Z A;  4KEN B;  2ZJ9 A;  4BEN A;  1T1B A;  1VEU B;  1ZG6 A;  5CGX A;  1V9Y A;  3LIE A;  4S2L A;  2VA0 A;  3Q7V B;  4IED A;  4DMZ A;  4DE2 A;  1K6R A;  3IXB A;  4EV4 A;  1KE3 A;  3HJK A;  5DFY A;  3ZVT A;  4BL2 A;  2H5S A;  5GHZ A;  3S7P A;  1IYP A;  3PAE A;  4Y0U A;  1NZU A;  3IHA A;  1OTB A;  4ARZ A;  4HOI A;  4RA7 A;  3HLF A;  3BFG A;  5AQB A;  1IYS A;  1BUL A;  3KYQ A;  5TGF A;  1AXB A;  1LHY A;  1XFN A;  2EA9 A;  1C3B A;  3T1S A;  3ICY A;  1MWT A;  1JTD A;  1I5Q A;  4XT2 A;  3O86 A;  5KZH A;  3IT9 A;  2I72 A;  3KO6 A;  3MF0 A;  3NUL A;  3LEZ A;  2ZL1 B;  1RP5 A;  1KGF A;  2JKT M;  1G68 A;  2O9B A;  4RQ9 A;  2ZM8 A;  2XR0 A;  1XJ2 A;  5HSQ A;  1OT9 A;  1CI8 A;  1W8Q A;  3CZD A;  4M3K A;  4DXC A;  3GRJ A;  2J9P A;  3N8S A;  2A3U A;  4D60 A;  4Y2F A;  2WKI A;  3UE1 A;  1J9M A;  1W79 A;  3MS6 A;  4EBP A;  3DTM A;  2QJ5 A;  3P01 A;  5GL9 A;  5CHJ A;  4KZ9 A;  2JKG A;  4PMA A;  4I39 A;  2VGJ A;  1K25 A;  5F1G A;  5JYP A;  2P7J A;  3M2K A;  1FQG A;  3LR3 A;  3CPT B;  3UPO A;  5HD5 A;  3LO7 A;  5FQ9 A;  1TVF A;  4Y5F A;  1NRJ A;  3ITB A;  5HD3 A;  5C5K A;  5IT5 A;  2J80 A;  2PDR A;  4CLC C;  3NI9 A;  2PR6 A;  1SKO A;  3FKV A;  2C6W B;  4UQI S;  3VP1 A;  4R4R A;  2E8J A;  5IHV A;  3MXS A;  1SDE A;  4ARZ B;  4JF6 A;  2R9W A;  1XJ4 A;  2WKQ A;  4HIA A;  2H0Y A;  3BY9 A;  3NDG A;  4WUJ A;  1K4E A;  4NXE A;  4ESP A;  3IXG A;  4R23 A;  3MSH A;  3NJA A;  3UNW A;  2PBD P;  3PXP A;  4XT2 B;  3LIA A;  2W1T A;  3FV7 A;  2Y8H A;  3MXR A;  4HP4 A;  3LIB A;  4ETZ A;  1NXY A;  4HP9 A;  4X53 A;  4OQ0 A;  4KZ4 A;  5FQQ A;  1YKD A;  4N9L A;  2PYP A;  4MN7 A;  5A91 A;  3R4K A;  4B4Z A;  4S2K A;  4OPY A;  3H7W B;  5EOO A;  4Y0T A;  3CG5 A;  1KOU A;  5HL6 A;  2JE5 A;  4WBG A;  4LCL A;  5FQI A;  2W0N A;  5EE8 A;  1EWZ A;  4JXS A;  4EEU A;  2XK1 A;  2KDK A;  2PT7 A;  4PHT A;  4R3J A;  3O87 A;  4E6X A;  4BBT A;  3HVF A;  1OTE A;  3ZG7 B;  4YWZ A;  4FCF A;  2VK3 A;  3S4X A;  3IQA A;  4ZJ2 A;  2V0W A;  3PTE A;  5HDD A;  3VE3 A;  3EEH A;  4ZAM A;  3VOY A;  2WGW A;  1MC0 A;  1SKF A;  2Y55 A;  2CC1 A;  1FOF A;  1LI0 A;  4GNU A;  4WM9 A;  1BZA A;  3MFX A;  1YLJ A;  3F1P A;  3T4O A;  2X02 A;  4UA9 A;  4ZDX A;  1IKI A;  3P09 A;  3DTI A;  5F69 A;  1S4R A;  1PWD A;  4CLC D;  5DJU A;  2J3T D;  4OQI A;  3G6O A;  4HQA A;  2JBF A;  4M4X A;  2P9V A;  2QHK A;  4EW7 A;  4MBH A;  3W4O A;  2WUQ A;  4WMC A;  4FUW A;  1K56 D;  4JGQ A;  4L9F A;  4DKI A;  1FCM A;  2VV6 A;  4BD1 A;  3N8L A;  4E3J A;  5GHY A;  3BFD A;  5FAP A;  3C30 A;  5DJT A;  2G2U A;  5CGS A;  4OOL A;  1ERM A;  4EBL A;  2Q9N A;  1X0O A;  2QPN A;  2ZLY A;  3IX3 A;  1TEM A;  3VFH A;  3BLS A;  2W1T B;  4UHU A;  1P0Z A;  1YSQ A;  3OBF A;  1KDW A;  2R9X A;  2PD8 A;  3QNB A;  3C5A A;  2M7V A;  1GCE A;  2PR5 A;  4PPR A;  2PHY A;  5TFQ A;  3OPR A;  4WN5 A;  3CI6 A;  4KZ8 A;  1BSG A;  2Y2K A;  3BY8 A;  3ZYT A;  2EXB A;  4CPK A;  3DTE A;  4N1X A;  1ES3 A;  4YIN A;  1IFQ A;  3FPW A;  3FKW A;  2WYX A;  4KQD A;  4AFI A;  5G4Y A;  4WZ5 A;  3S7N A;  3QHY A;  5E2H A;  1K57 C;  2GX5 A;  2V8C A;  2FFF B;  3HBR A;  5FAS A;  3FC7 A;  1F98 A;  3ZQ5 A;  3S7Q A;  4OPZ A;  3F1O A;  1TF1 A;  1V9Z A;  1S1Z A;  3HRE A;  4DN0 A;  2OOL A;  2QKP A;  2WGW B;  3K2N A;  4HJ4 A;  2ZD8 A;  3NIA A;  3T4K A;  4JLF A;  2WKH A;  5GLD A;  3UE6 A;  3GV9 A;  4E3I A;  2K2N A;  4PKY A;  1K54 C;  1Y54 A;  4DJ2 A;  2K7S A;  1XGI A;  2P9V B;  2ZQ9 A;  4BQM A;  5KSH A;  3C4O A;  4OOY A;  1QMF A;  3IF6 A;  4MNR A;  1L2S A;  3C8C A;  1OJ5 A;  4QB8 A;  3KYE A;  4JF5 A;  2B5R A;  5GLB A;  1XJ6 A;  3LR5 A;  5FQJ A;  2VLG A;  5J4E A;  5DKL A;  5E43 A;  3G4P A;  2HPB A;  4BMW A;  5DTK A;  5G4Z A;  4HJ3 A;  3IHB A;  2EX9 A;  4OLG A;  4Y0O A;  5CER A;  4E04 A;  3PBS A;  2KX6 A;  2XSS A;  1K4F A;  1E25 A;  1MPL A;  1XFQ A;  4DXB A;  4N92 A;  4PAU A;  5I94 A;  1KGG A;  4OLD A;  5G18 A;  1L3L A;  3D72 A;  3WRT A;  1MWS A;  3BRM A;  5EVE A;  4F3L A;  4L0L A;  4HES A;  3ZFZ A;  2W3F A;  4IHQ A;  4GS9 A;  4YOF A;  1ZC2 A;  1LSW A;  2ZQ7 A;  1P9W A;  1K56 A;  2FFY A;  4PM5 A;  2WKE A;  1GHP A;  3DAV A;  1J3W A;  2I9V A;  3V39 A;  2GNX A;  3QNC A;  5FEG A;  4H6J A;  1IYQ A;  4GCZ A;  4LV0 A;  4HHD A;  4U3T A;  2ZQ8 A;  3SH9 A;  3SOI A;  5DF7 A;  4Q0H A;  5DF8 A;  1NRF A;  4IVI A;  4OP5 A;  4KZ5 A;  1ONH A;  5M18 A;  3FWL A;  2J9O A;  1QME A;  4X55 A;  1KVL A;  3BQA A;  1OME A;  2ZC3 B;  1UWP X;  3PHY A;  4OPR A;  3C7V A;  3NHQ A;  2WGV A;  3W4Q A;  3UO9 A;  1YSP A;  3TRC A;  3BQ8 A;  1BTL A;  3OOV A;  3Q82 A;  1LL5 A;  1MWR A;  3IF6 B;  4Q8I A;  2ZOH A;  2VJW A;  3I7J A;  2Y2J A;  5AJG A;  5A92 A;  2A24 A;  1G28 A;  1DY6 A;  1PIO A;  4DE3 A;  2W3H A;  1W7F A;  3PBQ A;  4GD8 A;  1IEL A;  2Q0O A;  5EM1 A;  5EVI A;  2Y2M A;  4Y3I A;  1BUE A;  1FR6 A;  1D06 A;  1O7E A;  3RJU A;  3QP1 A;  3V3S A;  2V8F A;  5HDS A;  5F82 A;  2XA7 M;  3TJZ C;  1NYY A;  4OOM A;  1O07 A;  3BEC A;  1FSY A;  1ESU A;  4JXV A;  3JYI A;  2PD7 A;  2WKP A;  1CQA A;  4K08 A;  3SW1 A;  5FA7 A;  3NOP C;  5M1A A;  3DBA A;  4IJG A;  4N1H A;  2ZMF A;  2XFT A;  1CK3 A;  1Z6F A;  5GLA A;  1F2K A;  2JKR M;  3UB9 A;  4NET A;  3BFE A;  4F3L B;  4MN6 A;  4EWF A;  2HV1 A;  4C75 A;  1ACF A;  1K0K A;  4OQG A;  4II7 A;  3G2Z A;  2ZQC A;  1XXM A;  3T1X A;  4GS9 B;  3KX0 X;  5CX7 A;  2H10 A;  1G6O A;  1TS8 A;  3LCE A;  3HLW A;  3PBN A;  4KUK A;  3NY4 A;  1FCO A;  3HUM A;  5FI6 A;  3TG9 A;  2FH5 A;  2YKH A;  4WLA A;  3RH8 B;  4KG6 A;  3HJI A;  2KLI A;  3B3X A;  3MMH A;  3ZNY A;  3JVU A;  4H6J B;  5CTN A;  2OSU A;  4S2M A;  4Z9Q A;  3ZCZ A;  3OCL A;  1K55 A;  2XD5 A;  2OLV A;  1YT4 A;  3TE8 A;  3V3R A;  4X68 A;  5D3O A;  1L0D A;  2H0T A;  2ZQD A;  1Z09 A;  1IEM A;  3D9Y A;  4DF6 A;  3B33 A;  3A3F A;  1N9N A;  2L1M A;  2D01 A;  1IYO A;  3TSG A;  2Y2O A;  4EES A;  3LFV A;  4U0X A;  5FI2 A;  4C3Q A;  4LV3 A;  2OWH A;  2K31 A;  5AVF A;  2O0Y A;  3G35 A;  2VZW A;  4B88 A;  2IWB A;  2ZC6 B;  4X6T A;  2XLN A;  3LI8 A;  3R7W A;  2ZOI A;  5CGW A;  4S2O A;  3BM6 A;  3PYP A;  3G32 A;  3S7O A;  2HP5 A;  3IWO A;  3S1Y A;  2A24 B;  3EQU A;  3QP2 A;  1UWN X;  4R0Q A;  3PAG A;  1ES5 A;  3UB7 A;  3O3V A;  1KDS A;  3VOZ A;  1D1J A;  4I38 A;  1BLH A;  2GZA A;  3UMD A;  3OC2 A;  5EVI B;  3GMW A;  4H8R A;  4QHC A;  4B93 A;  2IWD A;  3CUE A;  4R3B A;  5A8B A;  2Y2L A;  3MKF A;  2QMI A;  4EUZ A;  4G3V A;  3P7N A;  2J7V A;  3WWX A;  1N9B A;  1YPR A;  4FD8 A;  2EX2 A;  2J3W A;  4GHI A;  1S66 L;  5F83 A;  1YMS A;  4GD6 A;  4LEN A;  3VOL A;  1S1Y A;  1BT5 A;  1CI9 A;  5EVL A;  5HWT A;  4MCW A;  5F1F A;  1CEG A;  4JXG A;  2M7U A;  2EXA A;  1K38 A;  1H8M A;  3ZG5 A;  4HBT A;  3GQZ A;  4OKP A;  3HLB A;  2QWS A;  1DP9 A;  4HH2 A;  4YFM A;  1H8Z A;  4ZBE A;  1JTG A;  1ZTU A;  1BYW A;  5FEF A;  4EXO A;  1PFL A;  4UA6 A;  4WYY A;  4JGO A;  1IOU A;  1GSW A;  3EGX C;  3L9K A;  3WS4 A;  3ZG0 A;  2PYR A;  3LR4 A;  1T18 A;  5AVE A;  2XGN A;  2PRF A;  3MBZ A;  3HCY A;  5HZH A;  3ZG9 B;  2DRW A;  4BWI A;  3DWZ A;  2WAF A;  4CQH A;  1ONG A;  3LGO A;  3KSF A;  1SDN A;  4S2N A;  1RGZ A;  2KOI A;  3GR2 A;  5TR7 A;  4FH2 A;  1YLZ A;  2HZ5 A;  2ZC4 B;  2MJ6 A;  5CRF A;  2O9A A;  5CEB A;  5IU1 A;  2B02 A;  1LSV A;  4BJP A;  3RTY A;  1YAX A;  1OTI A;  1ERO A;  1LLB A;  2Y2P A;  4OP8 A;  2V1Z A;  2DNS A;  5LBR A;  2ZC5 B;  4NKP A;  1SKO B;  4PM8 A;  1L0G A;  5FSR A;  1WYC A;  4JBF A;  4Q0I A;  3LR0 A;  2VGK A;  5DTT A;  3MR0 A;  3EGD C;  3T4S A;  4S2P A;  5J3W A;  3CJM A;  2JN7 A;  1DJC A;  1GSX A;  2EFU A;  2Y2G A;  2X71 A;  4JGR A;  4ZTK A;  3IWI A;  4CLC E;  3GDI A;  3P98 A;  4E3L A;  3ISG A;  1YM1 A;  4I5S A;  3BLM A;  3JPU A;  3A3I A;  4NXB A;  1FCN A;  3E98 A;  1D7E A;  2R78 A;  3G30 A;  1WA9 A;  1KE0 A;  2EFX A;  3VFF A;  4LLO B;  3RXX A;  4Y13 A;  3SZT A;  3AGF A;  2W1R A;  4GB7 A;  4HJ6 A;  2JHE A;  1TS7 A;  4DDS A;  3IXD A;  3E2K A;  1IKG A;  1YLY A;  1ZHH B;  4HI4 A;  2V1B A;  3DWK A;  2OWJ A;  1XJ3 A;  2IA2 A;  3WS0 A;  5TBM A;  3MZE A;  5KIZ A;  2HJE A;  3SH8 A;  1JWP A;  5EUA A;  2W3E A;  3U4L P;  2ZQA A;  3UY6 A;  4Z1W A;  4QD4 A;  2V2F F;  1BLC A;  2W3G A;  3A0V A;  5FL3 A;  3IXH A;  3GVB A;  4K91 A;  5HWV A;  1ERQ A;  3LUQ A;  4RX3 A;  4S2J A;  4LPZ A;  2ZC7 A;  2H28 A;  1LT0 A;  3VP3 A;  1PYY A;  2Y59 A;  1ESI A;  4O0P A;  1DJB A;  1SZV A;  1OJG A;  4EQI A;  1DP8 A;  3F1P B;  4Y15 A;  4GDB A;  3HL9 A;  3ULF A;  3NC8 A;  1W63 M;  1N9L A;  1MY8 A;  4MEZ A;  4R1G A;  4OVD A;  3TOI A;  5I5L A;  1XA7 A;  2Q9M A;  4PM6 A;  4LV2 A;  3TW8 A;  4MLL A;  2XH9 A;  4GOG A;  1WE4 A;  3CLO A;  4QPR A;  5K5B A;  2P74 A;  3NEC A;  1N4O A;  2WGI A;  3HLE A;  1L0E A;  1Q2P A;  4B9O A;  4P6Z M;  4XUX A;  3L7H A;  3UME A;  5HWW A;  1XKZ A;  3Q1F A;  4GJ4 A;  4PKY G;  3T4J A;  1F9I A;  5E2F A;  3CHW P;  3V67 A;  1T1A A;  1PZO A;  3D4F A;  2O99 A;  1NYM A;  3QP4 A;  4PM7 A;  1S6R A;  1L0F A;  1U60 A;  3B42 A;  3EOI A;  1VEU A;  3UB6 A;  3QP6 A;  2XDM A;  4QWO A;  3IX8 A;  4JXW A;  3QP5 A;  4EUV A;  2HJ9 C;  3F1N A;  2VGL M;  3MJQ A;  3ZGA B;  1GHM A;  2OV5 A;  2HDU A;  3GEC A;  4OON A;  2M1C A;  4P87 A;  3T1Q B;  4CLC A;  3Q81 A;  3V50 A;  1MWU A;  3O88 A;  3VSK A;  5HAI A;  2BG1 A;  3N6I A;  4P6B A;  3C38 A;  1ZKJ A;  5JYO A;  5E2E A;  5EEC A;  5J8X A;  4X1M A;  4BBV A;  3IX4 A;  4WEL A;  3SS4 A;  2X01 A;  3UE0 A;  4QJG A;  2PBY A;  5HW3 A;  1N9O A;  3ZG8 B;  2WKR A;  3CAX A;  4QY6 A;  4OPQ A;  1MXO A;  4MMN A;  4FH4 A;  4A5R A;  4PM9 A;  1EW0 A;  4P85 A;  1Y28 A;  3F1O B;  1MBL A;  1H5X A;  1TDG A;  4KZ6 A;  1NY0 A;  4GW9 A;  3OPL A;  3K3C A;  3UDX A;  1KVM A;  4R6L A;  3GSG A;  4EER A;  4QU3 A;  4XUZ A;  4JGP A;  1OTA A;  1TD5 A;  1VHM A;  4Q0J A;  1BLS A;  1PNE A;  4KZB A;  3IBJ A;  2Y2I A;  1KGE A;  5HL1 A;  5KSC A;  2XA7 S;  4MN5 A;  1VM1 A;  4BD0 A;  1GA9 A;  2E8I A;  2XFS A;  3HUN A;  4R70 A;  2Z6D A;  4LV1 A;  2JKF A;  2JC7 A;  5A93 A;  2DMW A;  3FYZ A;  3NBL A;  5CXW A;  3OLO A;  3SH7 A;  3KSG A;  2JKT I;  2BAS A;  1PI5 A;  5EV0 A;  5KMW A;  4KG5 A;  1S0W A;  1HLU P;  1NZO A;  4WZ4 A;  4E3N A;  4UEY A;  2ZMA A;  4RYE A;  5CEC A;  2HGV A;  1FIL A;  5HPI A;  2AVX A;  3CPT A;  4B4X A;  2HF6 A;  3PBO A;  2BLS A;  3C7U A;  4NEE D;  4FTX A;  2OLU A;  3E2L A;  3CMZ A;  5FAQ A;  3T50 A;  5HAP A;  4IUK A;  3UDF A;  4XXR A;  4LCM A;  4S2I A;  1E3U D;  3F1N B;  2DCF A;  3DW0 A;  3G34 A;  2P04 A;  4WZ5 C;  3LIC A;  4OQH A;  3WS2 A;  1DRM A;  1PZP A;  2UWX A;  2YKF A;  5CHM A;  3IF5 A;  4CLC B;  2GDN A;  2HP9 A;  4KG2 A;  4ZJ1 A;  3MFD A;  3M6H A;  3HUO A;  1FIK A;  2HDR A;  5EFW A;  4X1L A;  1HZO A;  3K3D A;  3A3D A;  3MQO A;  1CF0 A;  1HVB A;  4D2O A;  4EEP A;  3WS1 A;  4P0M A;  3LI9 A;  1VB6 A;  3EWK A;  3VP2 A;  3MQ0 A;  5TJJ A;  2P08 A;  2OAQ 1;  3M6B A;  3VSL A;  1T19 A;  5CTM A;  1PRQ A;  3UPP A;  4DDY A;  3BEB A;  4LFU A;  3NDE A;  1NLZ A;  1STZ A;  4HBU A;  3BW6 A;  2XQZ A;  3M2J A;  1SCW A;  3G2Y A;  3H7W A;  4MBF A;  3W2Z A;  3H82 A;  1XA1 A;  4WMC D;  4X25 A;  1RCJ A;  5DFX A;  3IF6 C;  4KQR A;  3SS3 A;  3T1R A;  4DRT A;  1W5D A;  4R4S A;  3ZVW A;  4ZJ3 A;  4KZ7 A;  4G3W A;  5AQA A;  3MZD A;  1W63 Q;  2VKS A;  4RVA A;  3E0Y A;  1S4S A;  2LB9 A;  1GSV A;  4IUH A;  1K57 A;  2HP6 A;  3KSH A;  3C4P A;  4K0X A;  3V5M A;  4E3K A;  1YLP A;  4JPM A;  1VET A;  1KE4 A;  4KUO A;  1LL9 A;  1XP4 A;  3VP0 A;  1XX2 A;  3UDI A;  1DJA A;  2J3T C;  2EX6 A;  3ITA A;  3VV4 A;  3N8R A;  3VMA A;  1YMX A;  3GTC A;  3OZH A;  3CIT A;  3NOU C;  3A0R A;  1OTD A;  1PI4 A;  1K54 A;  2XF3 A;  2XRN A;  2RL3 A;  5E2G A;  4K0W A;  4NG2 A;  3W8K A;  3KYZ A;  1CEF A;  4ETX A;  4BLM A;  4LRZ E;  5AQ9 A;  4WF0 A;  4MBK A;  4UA7 A;  2ACG A;  4UQI M;  1Y4O A;  2WAD A;  2L0W A;  3LIF A;  4DE0 A;  2Z6C A;  4G3K A;  1VQQ A;  3HLC A;  2V20 A;  5DKK A;  2L4R A;  3IWQ A;  3A3J A;  3IS2 A;  4E3O A;  5CED A;  2WZZ A;  3Q07 A;  4NXG A;  4YNR A;  2ZMV A;  3E4O A;  3H82 B;  4JF4 A;  5HPF A;  1E3U A;  2Y2Q A;  2HDS A;  1NLY A;  2A2L A; 
#chains in the Genus database with same CATH homology
 3GRJ A;  2J9P A;  2ZC7 A;  3N8S A;  1Q2Q A;  2A3U A;  2ZQ8 A;  3SH9 A;  3SOI A;  2WKI A;  5DF7 A;  3VP3 A;  2G2W A;  1PYY A;  3UE1 A;  5DF8 A;  1J9M A;  1NRF A;  2Y59 A;  1ESI A;  4IVI A;  4OP5 A;  1W79 A;  4KZ5 A;  4EBP A;  1ONH A;  1DJB A;  5M18 A;  2JCH A;  5EVI C;  3FWL A;  2J9O A;  4EQI A;  3DTM A;  1QME A;  4X55 A;  5AQ7 A;  1KVL A;  5FI7 A;  1OME A;  2C5W B;  4GDB A;  2ZC3 B;  5GL9 A;  3HL9 A;  5CHJ A;  4OPR A;  2Z2M B;  3NC8 A;  3ZNT A;  1ALQ A;  1EI5 A;  3C7V A;  4KZ9 A;  2WGV A;  3W4Q A;  1MY8 A;  5HX9 A;  3UO9 A;  4MEZ A;  1XGJ A;  4R1G A;  4OVD A;  3TOI A;  4PMA A;  1XA7 A;  2VGJ A;  1K25 A;  2Q9M A;  5F1G A;  4ID4 A;  4PM6 A;  4HEF A;  4LV2 A;  1BTL A;  5JYP A;  4MLL A;  3NCK A;  3M2K A;  2XH9 A;  2EX8 A;  3Q82 A;  1FQG A;  4GOG A;  3FZC A;  1LL5 A;  1MWR A;  3IF6 B;  3LY3 A;  3PBR A;  4Q8I A;  3UPO A;  1MKI A;  3LO7 A;  1WE4 A;  3I7J A;  2Y2J A;  5A92 A;  5FQ9 A;  1TVF A;  1DY6 A;  3ITB A;  1PIO A;  4DE3 A;  1W7F A;  2P74 A;  3N4I A;  1N4O A;  2WGI A;  3HLE A;  3PBQ A;  3NI9 A;  4GD8 A;  1IEL A;  1L0E A;  5EVI A;  4GZB A;  1Q2P A;  5U47 A;  2Y2M A;  4XUX A;  1BUE A;  1FR6 A;  1O7E A;  3V3S A;  3RJU A;  3FKV A;  2C6W B;  3VP1 A;  4R4R A;  5DVA A;  1XKZ A;  5EOE A;  5F82 A;  5IHV A;  3Q1F A;  5E2F A;  3VP4 A;  2J8Y A;  1NYY A;  4OOM A;  1O07 A;  3BEC A;  3MXS A;  4Y7P A;  1PZO A;  3D4F A;  1PWC A;  1FSY A;  1ESU A;  1LI9 A;  1NYM A;  4PM7 A;  1S6R A;  4JXV A;  3JYI A;  1L0F A;  1SDE A;  1U60 A;  4JF6 A;  2R9W A;  5FAT A;  1JVJ A;  5FA7 A;  5M1A A;  2H0Y A;  3MKE A;  4GDN A;  4UAA A;  4N1H A;  2XDM A;  4JXW A;  2XFT A;  3NDG A;  3MZF A;  5DF9 A;  1K4E A;  1CK3 A;  1Z6F A;  3ZGA B;  5GLA A;  1GHM A;  2OV5 A;  1K55 C;  4NET A;  3IXG A;  4R23 A;  4X69 A;  3BFE A;  2HDU A;  4OON A;  3WRZ A;  3UNW A;  4P87 A;  3Q81 A;  3V50 A;  4EWF A;  1MWU A;  1YQS A;  3O88 A;  3FV7 A;  4C75 A;  3VSK A;  5HAI A;  1HD8 A;  4OQG A;  2BG1 A;  3G2Z A;  3MXR A;  2ZQC A;  3N6I A;  1XXM A;  4CJN A;  3OCN A;  1NXY A;  4X53 A;  4P6B A;  2H10 A;  4OQ0 A;  4KZ4 A;  5FQQ A;  1ZKJ A;  3LCE A;  5JYO A;  4N9L A;  3HLW A;  5E2E A;  3PBN A;  3BFF A;  5EEC A;  3HLD A;  3AGD A;  3NY4 A;  5A91 A;  1YLT A;  5J8X A;  1NJ4 A;  1FCO A;  2Y91 A;  3HUM A;  4N9K A;  2Y2H A;  4WEL A;  5FI6 A;  3SS4 A;  2X01 A;  3TG9 A;  3HLG A;  3UE0 A;  4B4Z A;  2PBY A;  4QJG A;  2Y4A A;  4S2K A;  4OPY A;  5HW3 A;  3ZG8 B;  5FAO A;  5EOO A;  3IH9 A;  4KG6 A;  4QY6 A;  4KZ3 A;  1MXO A;  4OPQ A;  3A3E A;  3B3X A;  3CG5 A;  4Y0T A;  3ZHH A;  3ZNY A;  4FH4 A;  4A5R A;  5CTN A;  2JE5 A;  4PM9 A;  4WBG A;  2OSU A;  4S2M A;  4Z9Q A;  4LCL A;  5FQI A;  5EE8 A;  3ZCZ A;  3OCL A;  1K55 A;  1EWZ A;  4FSF A;  4P85 A;  3WS5 A;  4WEJ A;  1H8Y A;  1H5X A;  1MBL A;  1TDG A;  2QZ6 A;  2XD5 A;  4JXS A;  4KZ6 A;  4S2J A;  2OLV A;  1YT4 A;  4QY5 A;  1I2S A;  4X68 A;  5D3O A;  1NY0 A;  1L0D A;  3V3R A;  2XK1 A;  2H0T A;  5EVI D;  2ZQD A;  5EPH A;  4GKU A;  5HAR A;  1IEM A;  4DF6 A;  3OPL A;  1PW8 A;  4R3J A;  3UDX A;  1KVM A;  3A3F A;  3O87 A;  4E6X A;  3GSG A;  3HVF A;  3ZG7 B;  1IYO A;  3TSG A;  2Y2O A;  4QU3 A;  3LY4 A;  4XUZ A;  4FCF A;  1BLP A;  4U0X A;  4GN2 A;  2IWC A;  4X56 A;  5FI2 A;  3IQA A;  3S4X A;  4LV3 A;  4C3Q A;  4ZJ2 A;  2PU4 A;  3PTE A;  4WEK A;  1BLS A;  3G35 A;  4KZB A;  4B88 A;  1FR1 A;  5DTS A;  2IWB A;  2Y2I A;  1KGE A;  2ZC6 B;  5HL1 A;  4X6T A;  2XLN A;  4ZAM A;  1PW1 A;  3VOY A;  1W8Y A;  1VM1 A;  4BD0 A;  1GA9 A;  2E8I A;  5CGW A;  2WGW A;  2XFS A;  3HUN A;  3BM6 A;  4S2O A;  1GHI A;  4LV1 A;  1SKF A;  2Y55 A;  2CC1 A;  1FOF A;  1LI0 A;  2JC7 A;  4GNU A;  1JWV A;  4BL3 A;  5A93 A;  3FYZ A;  3NBL A;  4WM9 A;  1BZA A;  1YLJ A;  3G32 A;  3N7W A;  5CXW A;  2X02 A;  3SH7 A;  2HP5 A;  3IWO A;  4UA9 A;  4ZDX A;  3S1Y A;  3EQU A;  1PI5 A;  1IKI A;  3P09 A;  4R0Q A;  3PAG A;  1ES5 A;  3O3V A;  4KG5 A;  5KMW A;  1I2W A;  1PWD A;  1KDS A;  3VOZ A;  1S0W A;  3RXW A;  1BLH A;  4OQI A;  3OC2 A;  1NZO A;  5EVI B;  1YLW A;  4WZ4 A;  3GMW A;  4E3N A;  4H8R A;  4QHC A;  2JBF A;  2ZMA A;  4RYE A;  2P9V A;  2IWD A;  3BYD A;  4E6W A;  5CEC A;  4MBH A;  3W4O A;  2WUQ A;  5CHU A;  4R3B A;  1ZG4 A;  4WMC A;  4B4X A;  3SS5 A;  2Y2L A;  2ZM0 A;  3PBO A;  2BLS A;  3MKF A;  2QMI A;  4EUZ A;  1K56 D;  4DKI A;  1FCM A;  4IBX A;  2J7V A;  4KQO A;  3C7U A;  4BD1 A;  1XPB A;  4EBN A;  4JKT A;  3N8L A;  4E3J A;  5GHY A;  3BFD A;  3WWX A;  1N9B A;  2OLU A;  3E2L A;  4RX2 A;  3PBT A;  3CMZ A;  5FAQ A;  5A90 A;  4FD8 A;  3UPN A;  2EX2 A;  5HAP A;  2A49 A;  1E4D A;  2PU2 A;  5FAP A;  3UDF A;  2G2U A;  4XXR A;  3Q7V A;  4LCM A;  4S2I A;  5CGS A;  1E3U D;  5F83 A;  4OOL A;  1ERM A;  1YMS A;  4GD6 A;  4EBL A;  2Q9N A;  4LEN A;  2DCF A;  3DW0 A;  3G34 A;  4WZ5 C;  4OQH A;  3WS2 A;  1BT5 A;  1CI9 A;  2QPN A;  1PZP A;  2ZLY A;  3OPP A;  5EVL A;  2UWX A;  5CHM A;  4U0T A;  3IF5 A;  1TEM A;  3VFH A;  5F1F A;  2GDN A;  1CEG A;  2HP9 A;  4IBR A;  4KG2 A;  4JXG A;  5GLC A;  2EXA A;  3BLS A;  1K38 A;  3ZG5 A;  4HBT A;  4UHU A;  3GQZ A;  4ZJ1 A;  4OKP A;  3HLB A;  3MFD A;  1K6S A;  3M6H A;  2ZM2 A;  1KDW A;  2R9X A;  3QNB A;  3HUO A;  3C5A A;  4YFM A;  1M6K A;  1GCE A;  1H8Z A;  2HDR A;  1HZO A;  4PPR A;  1ES2 A;  1JTG A;  4ZBE A;  4S2N C;  3A3D A;  5TFQ A;  3OPR A;  1HVB A;  4D2O A;  4KZ8 A;  1BSG A;  3WS1 A;  1HTZ A;  4P0M A;  3ZDJ A;  2Y2K A;  5FDH A;  4UA6 A;  2EXB A;  2HDQ A;  3VP2 A;  4CPK A;  4WYY A;  4N1X A;  2WAE A;  1ES3 A;  4E3M A;  4YIN A;  3M6B A;  1JWZ A;  3WS4 A;  3VSL A;  3ZG0 A;  2XEP A;  5CTM A;  4IVK A;  3FKW A;  2WYX A;  3UPP A;  4DDY A;  5L2F A;  3BEB A;  3EQV A;  3IH8 A;  4WZ5 A;  3NDE A;  2XGN A;  4HBU A;  3MBZ A;  3QHY A;  2XQZ A;  3M2J A;  4O7D A;  3UE3 A;  5E2H A;  5FQK A;  3G31 A;  1M40 A;  1SCW A;  3G2Y A;  1K57 C;  1GA0 A;  3ZG9 B;  1TDL A;  4MBF A;  2DRW A;  2FFF B;  5KSC A;  3DWZ A;  3S22 A;  2WAF A;  3HBR A;  5FAS A;  1XA1 A;  5M19 A;  1ONG A;  4WMC D;  5FQM A;  1SDN A;  3BFC A;  1RCJ A;  3IF6 C;  4S2N A;  4KQR A;  1RGZ A;  3SS3 A;  4OPZ A;  3UN7 A;  5BOH A;  3GR2 A;  5TR7 A;  4DRT A;  1W5D A;  2RCX A;  4FH2 A;  3HRE A;  1YLZ A;  1SHV A;  4R4S A;  2ZC4 B;  3ZVW A;  2WGW B;  4ZJ3 A;  4KZ7 A;  4OH0 A;  5CRF A;  5CEB A;  2XD1 A;  5AQA A;  3MZD A;  4BJP A;  3AGE A;  3OPH A;  1WYB A;  2ZD8 A;  3NIA A;  4KZA A;  4RVA A;  2WZX A;  4NK3 A;  4JLF A;  2WKH A;  1ERO A;  5GLD A;  1LLB A;  2Y2P A;  4OP8 A;  2V1Z A;  2DNS A;  3GV9 A;  4E3I A;  1K54 C;  1Y54 A;  4F94 A;  1ES4 A;  1K57 A;  2HP6 A;  2ZC5 B;  1G6A A;  2Y2N A;  3C4P A;  4PM8 A;  4K0X A;  1PWG A;  1XGI A;  2P9V B;  2ZQ9 A;  1L0G A;  4BQM A;  5KSH A;  3C4O A;  5FSR A;  3V5M A;  4OOY A;  1WYC A;  4JBF A;  1RGY A;  4E3K A;  2Z2L B;  4DE1 A;  1YLP A;  2VGK A;  4JPM A;  5HFO A;  1QMF A;  3IF6 A;  5DTT A;  3W4P A;  4KQQ A;  4MNR A;  5GHX A;  1L2S A;  4S2P A;  5HAQ A;  4QB8 A;  4JF5 A;  1KE4 A;  3CJM A;  4C6Y A;  1DJC A;  2B5R A;  1LL9 A;  2EFU A;  2WK0 A;  1FSW A;  4KEN B;  2Y2G A;  3Q7Z A;  2X71 A;  5GLB A;  2ZJ9 A;  4ZTK A;  3IWI A;  4BEN A;  1XP4 A;  5FQJ A;  3VP0 A;  1XX2 A;  3UDI A;  1DJA A;  1ZG6 A;  3P98 A;  5CGX A;  4E3L A;  4S2L A;  3ISG A;  1YM1 A;  2EX6 A;  3ITA A;  3BLM A;  3Q7V B;  4IED A;  3A3I A;  4DE2 A;  5E43 A;  3G4P A;  1K6R A;  3IXB A;  3N8R A;  3VMA A;  4EV4 A;  1KE3 A;  2HPB A;  1FCN A;  5DTK A;  1YMX A;  3GTC A;  3OZH A;  3ZVT A;  4BL2 A;  2H5S A;  5GHZ A;  1IYP A;  3G30 A;  1PI4 A;  3IHB A;  1KE0 A;  1K54 A;  2EFX A;  2EX9 A;  2XF3 A;  3PAE A;  4OLG A;  4Y0O A;  4Y0U A;  1NZU A;  3IHA A;  5CER A;  3VFF A;  3PBS A;  2RL3 A;  3RXX A;  5E2G A;  4K0W A;  3W8K A;  1CEF A;  3AGF A;  4RA7 A;  3HLF A;  3BFG A;  1K4F A;  5AQB A;  1E25 A;  1IYS A;  1MPL A;  1BUL A;  4GB7 A;  4DDS A;  4DXB A;  4N92 A;  3IXD A;  5I94 A;  3E2K A;  1IKG A;  1YLY A;  4BLM A;  1KGG A;  4OLD A;  5TGF A;  1AXB A;  1LHY A;  3DWK A;  5AQ9 A;  5G18 A;  4MBK A;  4UA7 A;  1C3B A;  3WRT A;  3WS0 A;  1MWT A;  1MWS A;  3BRM A;  3MZE A;  1JTD A;  1I5Q A;  3O86 A;  4L0L A;  5KZH A;  3SH8 A;  2WAD A;  2I72 A;  3IT9 A;  4HES A;  3ZFZ A;  4DE0 A;  1JWP A;  5EUA A;  1VQQ A;  2ZQA A;  3LEZ A;  1ZC2 A;  3HLC A;  3UY6 A;  2ZQ7 A;  1RP5 A;  1KGF A;  1G68 A;  2V20 A;  4QD4 A;  2V2F F;  3IWQ A;  1K56 A;  1BLC A;  3A3J A;  4E3O A;  5CED A;  2FFY A;  2WZZ A;  2ZM8 A;  4PM5 A;  3Q07 A;  2WKE A;  2XR0 A;  1GHP A;  3IXH A;  1CI8 A;  1W8Q A;  3CZD A;  4M3K A;  3GVB A;  4JF4 A;  4K91 A;  4DXC A;  3V39 A;  1ERQ A;  3QNC A;  4RX3 A;  1E3U A;  1IYQ A;  2Y2Q A;  2HDS A;  4LV0 A;  4U3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...