4RX2A

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
255
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 255
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rx2A00
1ZG4A 1ERQA 4OPZA 4UAAA 2J9PA 2HDSA 1ESIA 2ZM0A 1RGZA 4BD0A 1JWVA 4KZ6A 4IBXA 1K55A 4A5RA 4H8RA 5EVIA 1K25A 2EX2A 1K38A 1KVMA 1YLWA 3Q07A 4OP5A 1S6RA 4GKUA 3RXXA 5J8XA 3QNCA 5E43A 5TFQA 3N4IA 4K0WA 4N1XA 3ZGAB 3D4FA 5F1GA 3PTEA 4IBRA 4OPYA 2ZQ7A 4R1GA 4ZAMA 3V50A 1MWTA 1RCJA 3CG5A 1BUEA 3GTCA 1NZUA 2ZQDA 2ZQCA 1HD8A 1YMXA 4PM9A 2EFXA 4BLMA 3PBOA 5CECA 1FSWA 3IHBA 4EQIA 2H0TA 1LLBA 3ZVTA 4S2NA 1VQQA 5EE8A 2Y55A 1MWRA 3BLMA 4X56A 3S4XA 2XQZA 3PAGA 1IYOA 3MZEA 5FQJA 4DRTA 3HLCA 3UDFA 5CEDA 1ESUA 1IELA 1H8YA 1CI9A 1L2SA 1MWUA 3SS3A 4GDBA 4LV0A 1W7FA 4JPMA 1W5DA 3UPPA 3A3IA 3B3XA 4JXWA 5A91A 2C5WB 3MFDA 5JYPA 3NBLA 5M1AA 3OPLA 4JLFA 2XK1A 5GLBA 2X02A 2XD1A 3WS1A 3A3FA 3RJUA 4BD1A 4R3JA 1ES3A 5I94A 4N9LA 2P9VA 3GRJA 2Y2OA 3A3DA 4JF6A 3UPNA 4BL3A 1XA1A 4E6WA 2JCHA 4DE1A 1KGEA 3CMZA 3EQUA 3ZNTA 3QHYA 3BECA 5HW3A 4MBFA 5IHVA 5HX9A 2BG1A 1YT4A 3MKEA 4DXBA 1CK3A 3UNWA 3MZFA 1I2WA 3ZG5A 4WYYA 1IKGA 3FZCA 1S0WA 1ES4A 3G30A 2WAFA 1C3BA 4KZAA 1YLPA 2HDQA 5FQ9A 1NZOA 4R3BA 3BFGA 5CHMA 3WRTA 3P09A 4U3TA 1LL9A 3IQAA 5DTSA 3ZG0A 5CTMA 5A90A 2Y2IA 5CHJA 5FSRA 4OQGA 1WYBA 3G2YA 5KZHA 1I2SA 2ZQ9A 3WS0A 5FI7A 3HL9A 3QNBA 1EROA 4JXGA 3N8LA 3BEBA 4UA7A 4KZ9A 3VOYA 1ONHA 3WRZA 3M2JA 3MBZA 5FQIA 5KMWA 3G4PA 2EFUA 1FQGA 5A93A 3HLWA 3NDGA 4S2JA 3UDIA 1XGIA 2Y59A 3OPPA 3HLGA 1JWZA 1O07A 1YLYA 2WKEA 4LENA 1ONGA 1AXBA 1LI9A 2DNSA 1ZKJA 1PYYA 4FH4A 5FAOA 2WUQA 3GR2A 1FCNA 4WMCD 5CTNA 4F94A 1TDLA 3GVBA 3OZHA 5M19A 1PWGA 2EX9A 3Q7VA 3HUOA 3M2KA 4U0TA 3OCNA 1KGFA 4MBKA 1W79A 3PBRA 1XXMA 1GHIA 3VOZA 2DRWA 3GQZA 4XXRA 2QMIA 3GMWA 1SHVA 3OC2A 3BYDA 1KDWA 1PW8A 2WKHA 1ES5A 5F1FA 2IWCA 4HEFA 3IF6A 5AQ7A 4S2KA 1Q2QA 3W8KA 4NK3A 3BFEA 5EPHA 4DE2A 3N7WA 3NIAA 1N9BA 4KZ4A 2QPNA 1W8QA 2V20A 2HP6A 3WS2A 2XH9A 1K54C 3S1YA 4EUZA 3WS4A 1N4OA 2HDRA 1WE4A 4QD4A 1XGJA 3PBNA 3BFCA 4N1HA 1XA7A 2G2UA 3AGFA 5JYOA 5GLAA 2Y2NA 4RA7A 3TG9A 1O7EA 2UWXA 5E2FA 2HP9A 1KVLA 3HUNA 4OOMA 1K55C 5AQBA 5EVIC 1DJAA 3HVFA 1NY0A 1XPBA 2A49A 3FYZA 3IXGA 1M40A 4JF4A 1WYCA 5AQ9A 4BQMA 4LV3A 3WS5A 4LV1A 3C7UA 5EVLA 3C5AA 3V3SA 4MBHA 3ZVWA 1L0DA 4C3QA 4WM9A 1ERMA 2OLVA 3HLFA 5U47A 1XP4A 3E2KA 1H8ZA 3NI9A 4KZ3A 4RVAA 3MZDA 1PZPA 2WADA 3V39A 3SH7A 1PI4A 3M6BA 5CHUA 1GHMA 5EVIB 4WZ4A 2H10A 1KE0A 4S2PA 4GNUA 4PM6A 4P6BA 3SH9A 4FSFA 1GA0A 4MLLA 1MBLA 1DY6A 4K91A 5HAQA 4WMCA 2Y2HA 4ID4A 4BENA 5EUAA 3UE0A 4P0MA 2FFFB 5F82A 3TSGA 3ISGA 3Q7ZA 1ES2A 1YLJA 1GHPA 4ZJ3A 3AGEA 3VP0A 1HVBA 1K4EA 3E2LA 3VFFA 1KE4A 1OMEA 2ZC4B 3IT9A 4D2OA 5TR7A 2EX8A 2HDUA 4YINA 1QMFA 4JKTA 4E3LA 1KE3A 1L0FA 1L0EA 3IHAA 4S2IA 5A92A 1K56D 2ZQ8A 2VGJA 3OPRA 3JYIA 3UDXA 3ZNYA 1K4FA 2Y2JA 1ZC2A 1K57C 3UPOA 4S2MA 1BLSA 2RL3A 3G31A 1ZG6A 3WWXA 3G32A 3Q1FA 2ZJ9A 1LL5A 1MXOA 4K0XA 4CJNA 1NJ4A 4DE0A 4E6XA 5HFOA 5HAPA 3N8SA 4RYEA 1IYPA 4U0XA 3Q82A 5GL9A 4RX3A 3VP4A 4IVIA 5HL1A 4WELA 2GDNA 2OSUA 1E4DA 4JF5A 4X69A 1JTGA 3N8RA 4GN2A 3IF5A 5FDHA 1YLZA 2DCFA 3ZG7B 5E2HA 3MXSA 1YLTA 3S22A 1PWDA 3LY4A 3HLBA 2Z2LB 3GSGA 3MKFA 2P9VB 4DXCA 4EBLA 5HAIA 1J9MA 3LCEA 2Q9NA 2ZC3B 4IEDA 1K6RA 2ZC7A 3NC8A 3VP2A 2WYXA 3IWIA 1XX2A 5FASA 3N6IA 1MY8A 2Z2MB 3C4OA 2XR0A 1YM1A 4LV2A 3LEZA 4UA6A 2XFTA 4XUXA 3UY6A 4QHCA 3M6HA 2WGIA 4KG5A 4ZBEA 1PI5A 5FA7A 4GB7A 1NYYA 3UE3A 4R23A 2WZZA 4X68A 3PBQA 4X55A 4KG2A 3LO7A 5CEBA 2ZMAA 5E2EA 2OV5A 2WGWB 3O3VA 5CRFA 4N92A 4OPRA 3ZG8B 4RX2A 2G2WA 1SKFA 4WEJA 2R9WA 2IWDA 2XLNA 2BLSA 1CEFA 4QY6A 2PU4A 4PPRA 3C7VA 4R4RA 4Y7PA 1KDSA 4JBFA 2JE5A 2Y2KA 3IWQA 1HZOA 5FI6A 4UA9A 5HARA 3ZFZA 1M6KA 2WGVA 2EXAA 3IXHA 4EBNA 1SDNA 4R4SA 3BFFA 5GHZA 1BT5A 1NYMA 4N9KA 1NXYA 3G35A 2EXBA 2B5RA 4WZ5A 3VFHA 2XGNA 2ZLYA 3ITBA 1K56A 2E8IA 3OCLA 4M3KA 3CJMA 3NY4A 4MEZA 4Z9QA 3VSKA 2Y2GA 1NRFA 4MNRA 3SOIA 4KENB 3C4PA 2H0YA 3IF6C 2QZ6A 4KZBA 4KZ8A 1G6AA 4C75A 5KSHA 3IXDA 3UO9A 2H5SA 4OKPA 4OQ0A 2XDMA 1RGYA 4OQIA 3Q7VB 1RP5A 2A3UA 2Y2MA 1VM1A 2Q9MA 4R0QA 1TVFA 3FV7A 3BM6A 2Y91A 3IWOA 3SS4A 1LI0A 4KZ7A 2WK0A 3G34A 3V3RA 4Y0TA 1K54A 2VGKA 1BULA 1MKIA 1EWZA 2C6WB 2XF3A 4QY5A 5AQAA 1ALQA 3ZDJA 3IF6B 5CGXA 3FKWA 4QB8A 3IH8A 3V5MA 1FR1A 3I7JA 3MXRA 4Y0OA 5EOOA 1PIOA 1XKZA 4E3KA 4BL2A 3PBTA 4B4ZA 2EX6A 1E25A 1FOFA 4YFMA 2V1ZA 5FI2A 4Y0UA 3VMAA 3FKVA 3EQVA 4OP8A 4ZTKA 3W4OA 5CGWA 2P74A 2CC1A 3OPHA 4PM7A 5M18A 1Z6FA 4HBUA 3RXWA 1IYSA 2V2FF 2X01A 3VSLA 1BTLA 4LCMA 1MWSA 1IKIA 4S2NC 1JTDA 2OLUA 3UN7A 5L2FA 1FSYA 2ZM8A 3P98A 4JXSA 3O86A 3DW0A 3BFDA 4OOYA 2PBYA 3BRMA 4PMAA 1K6SA 5TGFA 3UE1A 4GD6A 3TOIA 1PWCA 4FCFA 1E3UD 1EI5A 2J9OA 5GHXA 2XEPA 1LHYA 1PW1A 4ZJ1A 4GZBA 2ZQAA 3VP3A 3ZG9B 3DWKA 4WBGA 1U60A 2XFSA 5FAQA 5DF9A 3IH9A 3BLSA 5GLDA 3IXBA 2Y2QA 3G2ZA 1FR6A 3O87A 2PU2A 4NETA 4OVDA 4HBTA 3W4QA 1Q2PA 3HLEA 4ZJ2A 3PAEA 1BLPA 4DKIA 5CGSA 1DJCA 1IEMA 4BJPA 4ZDXA 4L0LA 1BLCA 2J7VA 5FAPA 1BZAA 1CI8A 3GV9A 4P85A 1K57A 4X53A 2J8YA 4FD8A 5DTTA 1JVJA 5CERA 3HBRA 4UHUA 3VP1A 1YMSA 2R9XA 4X6TA 1MPLA 5KSCA 5EOEA 4S2LA 1W8YA 1G68A 3W4PA 5FQMA 3HREA 3LY3A 5FATA 5DVAA 5D3OA 1YQSA 3ZHHA 4KQOA 2WKIA 3AGDA 4DDYA 3ITAA 5E2GA 4GOGA 1DJBA 5EVID 4JXVA 4DDSA 5FQQA 4LCLA 2X71A 3PBSA 4KQRA 4B88A 3NCKA 4E3NA 4QU3A 1HTZA 1TEMA 2JC7A 2WAEA 4DF6A 4O7DA 4OONA 2WGWA 5G18A 1PZOA 1FCMA 4PM5A 4QJGA 3DTMA 3CZDA 4HESA 5GLCA 4OQHA 1TDGA 4WEKA 2I72A 3FWLA 5DF7A 1I5QA 1KGGA 4C6YA 1H5XA 3NDEA 1BSGA 2ZC5B 5CXWA 3O88A 1L0GA 4XUZA 5DTKA 5F83A 3SS5A 4CPKA 4DE3A 1BLHA 4EV4A 5DF8A 4GD8A 4E3OA 1JWPA 1SCWA 1E3UA 2ZM2A 4B4XA 5BOHA 5GHYA 2Y2LA 4P87A 2Y2PA 4OLDA 5FQKA 1SDEA 4KZ5A 5EECA 2ZD8A 2JBFA 3HLDA 4IVKA 1FCOA 3Q81A 4WZ5C 4KQQA 2HPBA 1QMEA 3HUMA 4OPQA 3SH8A 4FH2A 3A3JA 3DWZA 4OOLA 3ZCZA 2Y4AA 1GCEA 1Y54A 4PM8A 2FFYA 2WZXA 4E3JA 2HP5A 4S2OA 4Q8IA 4E3IA 4GDNA 2ZC6B 3A3EA 2XD5A 4KG6A 2IWBA 4E3MA 1GA9A 4OLGA 4EBPA 4OH0A 1IYQA 4EWFA 2RCXA 1CEGA
chains in the Genus database with same CATH superfamily
5F5YA 1N9LA 1ACFA 4KZ6A 1K55A 4ESPA 1K25A 2KOIA 5EV0A 1K38A 3QNCA 2W1TB 5E43A 3N4IA 4K0WA 3ZGAB 3D4FA 3PTEA 4OPYA 3GDIA 4Q0HA 2VA0A 1NZUA 2ZQCA 1FSWA 1LLBA 4I3JA 1MWRA 3BLMA 2JKRM 3F1NB 3HLCA 3UDFA 1H8YA 4NXGA 1CI9A 4GDBA 4LV0A 4EUVA 4O0PA 4GJ4A 4JLFA 3WS1A 4N9LA 4E6WA 5IU1A 4GS9A 5HW3A 1OTIA 2PYPA 1YSPA 2BG1A 2VGLS 1LSWA 5L07A 2WAFA 1C3BA 5FQ9A 4R3BA 1H0MA 3P09A 4Z1WA 5DTSA 3ZG0A 5A90A 2Y2IA 3FPWA 1WYBA 3G2YA 1I2SA 2ZQ9A 3HL9A 4JXGA 4UA7A 3BEBA 1OTAA 3ULFA 2EFUA 3HLWA 3NDGA 3UDIA 3OPPA 3HLGA 2K31A 4O8GA 2WKEA 4LENA 3T1XA 1P97A 4WF0A 1VHMA 3GR2A 5F6AA 1TDLA 3OZHA 4UQIS 3T4LA 5HSQA 4U0TA 1KGFA 4HOIA 1XXMA 4JGQA 2D01A 4XXRA 3GQZA 3BYDA 3TRCA 1PW8A 4R70A 5F1FA 3IF6A 4CQHA 4PAUA 4IUKA 4Y2FA 1N9BA 4KZ4A 5F68A 4DMZA 1W8QA 2HP6A 1YPRA 4UEYA 2W3HA 2HDRA 1WE4A 4QD4A 1UGUA 3PBNA 5GLAA 4RA7A 4MMNA 2UWXA 2HP9A 1KVLA 3HUNA 3OLOA 1NY0A 3FYZA 1WYCA 4LV3A 5J7EA 3UB6A 1FILA 1XJ2A 2CMNA 2OLVA 3JPUA 1H8ZA 4RVAA 4KZ3A 3MZDA 2WADA 2O99A 4JGOA 2H10A 1KE0A 4S2PA 1PNEA 1NWZA 3NOUC 1MBLA 4ZRRA 5EUAA 4P0MA 4FUWA 1ES2A 4ZJ3A 3AGEA 1HVBA 1K4EA 3VFFA 1KE4A 4D2OA 5HPIA 5TR7A 1KE3A 1L0FA 1L0EA 3IHAA 4GW9A 5A92A 2ZQ8A 4YNRA 5LBRA 2VGJA 4P6ZM 1XFQA 2Y2JA 3T4TA 4EERA 1K57C 3UPOA 3NULA 3BQAA 1SKOB 3G32A 2V0WA 1LL5A 5HZHA 1NJ4A 2XSSA 3DAVA 3LIDA 1IYPA 3Q82A 3VP4A 4IVIA 5HL1A 4WELA 2GDNA 4L9GA 2O9AA 3ZG7B 1PWDA 2VJWA 3LFVA 1Z09A 3HLBA 2L0WA 3GSGA 4DXCA 3LCEA 2VX8A 3NJAA 4IEDA 3VP2A 5FASA 2Y8HA 3LI8A 1MY8A 3C4OA 2BTFP 4LV2A 4UA6A 4XUXA 2NUTC 4KG5A 1PI5A 1NYYA 4HY8A 4DN0A 2WZZA 3PBQA 4X55A 2ACGA 5E2EA 3S7OA 2XA7M 2G2WA 1SKFA 4QY6A 3MS6A 4G3KA 1KDSA 4JBFA 2Y2KA 5FI6A 3D3OA 4UA9A 3ZFZA 3IXHA 4I39A 1NYMA 2VZWA 3VOLA 3NY4A 2HJEA 1YAXA 3VV4A 5HWVA 4Q0JA 3T4QA 4L9FA 3O5YA 2QZ6A 5TBMA 2PAVP 3FPVA 3IXDA 4OKPA 4OQIA 2W1TA 2A3UA 3EEAA 2Y2MA 3R4KA 2H28A 4MN6A 3IWOA 1OT6A 2WK0A 3G34A 4Y0TA 1K54A 1DP6A 1MKIA 1ALQA 3ZDJA 3OOVA 5EOOA 4E3KA 2QYBA 4YFMA 3EQVA 1XJ4A 4OP8A 3S7NA 3W4OA 2P74A 2CC1A 4LRYC 4LCMA 1IKIA 4HIAA 4JXSA 4BBUA 3DW0A 4KQDA 3BRMA 5TGFA 3UE1A 2PR5A 4ETXA 1PWCA 1E3UD 2GJ3A 4PKYA 4ZJ1A 2ZQAA 2QWSA 1N9NA 2O9CA 1BLPA 2VLGA 4DKIA 3MQ0A 5CGSA 5DFXA 1DJCA 1CI8A 5DTTA 1JVJA 3HBRA 2R9XA 5KSCA 3C30A 4HH2A 3HREA 5FATA 3QP6A 2WKIA 4GS9B 4GOGA 4GHIB 3G6OA 4B88A 4ETZA 4QU3A 2JC7A 2WGWA 5GLCA 4NXEA 4C6YA 3NDEA 1BSGA 3O88A 1L0GA 2V9AA 1BLHA 1BYWA 4GD8A 5AVEA 1JWPA 1SCWA 1E3UA 2ZM2A 1ZHHB 5GHYA 2DMWA 3KSIA 1SDEA 1FCOA 3UMEA 3Q81A 4WZ5C 1QMEA 4OPQA 2QHKA 4FH2A 1LT0A 4EESA 4PM8A 2FFYA 4S2OA 4E3IA 2ZC6B 3A3EA 2XD5A 4HH3A 1MZUA 2IWBA 4OLGA 4Q0IA 4EBPA 3LEQA 2A2LA 4UAAA 4MN5A 4IBXA 4LRZE 2GZAA 3KSGA 3T4KA 2EX2A 1KVMA 2HJ9C 4OP5A 1S6RA 1TD5A 5TFQA 1N9OA 3MR0A 4IBRA 2ZQ7A 4ZAMA 1RCJA 3GTCA 3CG5A 1YMXA 2EFXA 4EQIA 2HZ5A 3ZVTA 4S2NA 2VV8A 5EE8A 4Y17A 1UWNX 4X56A 1XFNA 2XQZA 1IYOA 2OAQ1 3TJZC 5CEDA 2ZMFA 1X0OA 3SS3A 2NUPC 1W7FA 3MJQA 1W5DA 3A3IA 3B3XA 4JXWA 3NBLA 2X02A 2JKTI 2XD1A 3LIEA 3R7WA 5I94A 3GRJA 2Y2OA 2JCHA 2PR6A 3EQUA 3IBRA 5HX9A 1D7EA 3ZG5A 3G30A 1NZOA 5CHMA 1G5UA 5CHJA 4CLCA 4HJ3A 3N8LA 3M2JA 3G4PA 3UB5P 1FQGA 2Y59A 5FDSA 1YLYA 3ICYA 5HPFA 4MN7A 1ONGA 1A0KA 2DNSA 2A24B 5FAOA 2WUQA 4I3IA 4WMCD 5CTNA 3GVBA 4MCWA 3M2KA 3OCNA 4HP4A 3K2NA 5F69A 4B9OA 3E0YA 3PBRA 1SHVA 3MQQA 3OC2A 1KDWA 1F2KA 2WKHA 3L7HA 2IWCA 5CX7A 4S2KA 3W8KA 3DTKA 5EPHA 3N7WA 1H8MA 3NIAA 2QPNA 3IS2A 1K54C 3ZYTA 5C5KA 3S1YA 2EA9A 5TBMB 3BFCA 2OWJA 1XA7A 2G2UA 2R78A 5E2FA 2HF6A 5AQBA 1V9ZA 5EVIC 1DJAA 2A49A 4JF4A 4BQMA 3C7UA 5AJGA 5MC7A 3V3SA 4MBHA 1L0DA 4C3QA 1XP4A 3E2KA 3V39A 3M6BA 5EVIB 3MMHA 4M4XA 4GNUA 1DY6A 4K91A 5HAQA 4WMCA 4BENA 2FFFB 3LI9A 3ISGA 3VP0A 3SW1A 3IT9A 2W3EA 4YINA 1K56D 2J80A 4FTXA 3JYIA 2Y79A 1ZC2A 4S2MA 4MDZA 3G31A 4GHIA 3WWXA 1MXOA 4G3VA 2V1BA 4RYEA 4Y5FA 2OSUA 4JF5A 5FDHA 3IX3A 1YLTA 3S22A 3LY4A 2Z2LB 2P9VB 4EETB 4EBLA 1EW0A 1T18A 5HAIA 2ZC3B 2ZC7A 3NC8A 2JHEA 4P6ZS 1XX2A 4BBVA 4B93A 2Z2MB 5DJUA 3JVUA 2QKPA 3UY6A 2LB9A 2WGIA 1XJ3A 1DRMA 4KG2A 3LO7A 4YOFA 2ZMAA 2OV5A 2WGWB 5EM0A 1NLZA 2V8CA 3QP8A 2IWDA 2XLNA 5EVEA 3P01A 1GSVA 4KUOA 5A8BA 4Y7PA 2JE5A 1M6KA 3RTYA 2EXAA 1NXYA 2B5RA 4WZ5A 2ZLYA 1K56A 2E8IA 5DKLA 2Y2GA 3SOIA 4KENB 2WKPA 2H0YA 4KZ8A 1TS0A 3UO9A 2GX5A 2H5SA 4OQ0A 2W0NA 1RGYA 2XA7S 1RP5A 2B95A 1TVFA 3KSFA 3SS4A 1LI0A 3V3RA 1TS8A 1BULA 5CGXA 3FKWA 4WL9A 3IH8A 3V5MA 3V67A 3I7JA 2L4RA 1OTEA 1S1YA 4B4ZA 2EX6A 1E25A 1FOFA 5FI2A 3KSHA 2GNXA 5CGWA 5M18A 4PM7A 4HBUA 1IYSA 3BJNA 1BTLA 1STZA 4S2NC 1JTDA 1VB6A 3O86A 2PBYA 3CUEC 3GECA 2B02A 4PMAA 5DJTA 3T50A 4GD6A 3QP4A 4FCFA 3VE3A 4GZBA 3VP3A 4PHTA 3ZG9B 4WBGA 1U60A 2XFSA 3T1SA 4R6LA 2OOLA 3BLSA 3IXBA 4NETA 4OVDA 4HBTA 3UB8A 3HLEA 4ZJ2A 3PAEA 2PDRA 3D9YA 4ZDXA 4LLOB 1BLCA 5FAPA 1BZAA 4P85A 2PBDP 4UHUA 3VP1A 3R7WB 1MPLA 3UMDA 5FQMA 5DVAA 3QP1A 4NEED 3AGDA 4DDYA 5E2GA 4CLCC 5I5LA 5EVID 4DDSA 4LCLA 4E3NA 1HTZA 4DF6A 3B47A 2A24A 2HGVA 4OONA 1PZOA 5AVFA 1FCMA 4PM5A 4OQHA 3CWFA 4WEKA 1P9WA 2O0YA 4CLCB 5CXWA 5DTKA 4DE3A 2YKFA 4LPZA 4B4XA 4EW7A 3C8CA 2Y2PA 5EECA 2QJ5A 3HLDA 4FOFA 2HPBA 3SH8A 1D06A 4OOLA 3QP5A 4X25A 1Y54A 4X1MA 2HP5A 4KG6A 4OH0A 1IYQA 4EWFA 2J9PA 3NOTC 2HDSA 2ZM0A 1RGZA 4A5RA 5EVIA 3IS2B 3KYQA 3LGOA 1YLWA 2P08A 3L9KA 4GKUA 4R1GA 3V50A 3T1RA 1MWTA 1BUEA 2ZQDA 5HD5A 4PM9A 3PBOA 5CECA 3IHBA 2H0TA 4KUKA 4GLQA 3E98A 2ZL1B 2VEAA 3MF0A 2Y55A 3IX4A 5FQJA 3EEHA 1L2SA 1MWUA 4JPMA 4HJ6A 3UPPA 2V0UA 4WN5A 4WLAA 5JYPA 5HL6A 1MC0A 5M1AA 5GLBA 2XK1A 3LR4A 1PFLA 3A3FA 4BD1A 3H82B 3U2AA 2P9VA 4BL3A 1TS7A 4DE1A 2ZOIA 3BECA 4MBFA 3MKEA 1CK3A 5J4EA 1I2WA 1IKGA 1S0WA 1ES4A 4KZAA 3WRTA 3IQAA 5CTMA 4LGWA 4Y15A 3WS0A 5FI7A 1WA9A 3JVVA 3QNBA 1EROA 3VOYA 4KZ9A 1ONHA 3WRZA 2M1CA 3PYPA 4NG2A 5A93A 4S2JA 1XGIA 4I3AA 2P7JA 1JWZA 4IUHA 1O07A 3PXPA 1OTBA 1AXBA 1LI9A 1ZKJA 4O01A 1PYYA 1V9YA 3LR3A 4F94A 1VETB 1PWGA 3LIFA 3HUOA 3FG8A 1OT9A 2QMIA 2VK3A 1ES5A 4HEFA 4NXFA 1Q2QA 3BFEA 3FC7A 2V20A 2XH9A 1OPXA 4BWIA 5EM1A 5HWWA 3WS4A 5FEGA 1KOUA 4H6JB 1CQAA 2JKTM 4N1HA 2FZ0A 3AGFA 5JYOA 2WKQA 2Y2NA 3TG9A 1XJ6A 4CLCD 1XPBA 2AVXA 1M40A 5AQ9A 3WS5A 4LV1A 1GSWA 4ME4A 5DFYA 5EVLA 3C5AA 5DKKA 3ZVWA 1ERMA 3HLFA 3SH7A 1GHMA 3CUEA 3IBJA 4PM6A 4FSFA 1GA0A 4EEUA 2Y2HA 4ID4A 3UE0A 5F82A 3TSGA 3F1OB 3E2LA 1OMEA 4E3LA 4S2IA 2M7VA 4EQ1A 3OPRA 3UDXA 4LFUA 3K3CA 1BLSA 2RL3A 4Y3IA 2Q0OA 1ZG6A 1OJGA 2ZJ9A 4K0XA 3CHWP 1ZTUA 4DE0A 5HFOA 4U0XA 5GL9A 4RX3A 1ODVA 1E4DA 4X69A 1JTGA 3N8RA 4GN2A 2DCFA 5E2HA 3E4OA 3MKFA 2HV1A 5G4ZA 1K6RA 3E4QA 2WYXA 3IWIA 3RFBA 1YM1A 4BMWA 2XFTA 3TE8A 4QHCA 4ZBEA 3UE3A 4R23A 1S1ZA 5CEBA 1Y4OA 2VV6A 3A0RA 2XROA 4N92A 4OPRA 2YKHA 3PR6A 4WEJA 4RX2A 2R9WA 5KIZA 1Y28A 3EGDC 3C7VA 3IWQA 1HZOA 3H9WA 2WGVA 4D60A 1SDNA 4R4SA 3BFFA 1LSXA 3LR0A 1VEUA 3ITBA 3OCLA 4M3KA 4MEZA 2LB5A 3UE6A 3VSKA 3BWLA 1NRFA 2J3TD 4YWZA 3C4PA 4QPRA 4K08A 5KSHA 4KZBA 2ZMVA 4C75A 2XRNA 5HDCA 5HD3A 2JKFA 2XDMA 3Q7VB 4R0QA 2O9BA 1VM1A 3KYEA 2Q9MA 4KZ7A 2C6WB 4QY5A 1EWZA 5AQAA 5HDSA 1FR1A 3MXRA 1F98A 2ZL1A 4F3LB 4Y0UA 3VMAA 3FKVA 3OPHA 1Z6FA 4IJGA 3RXWA 2V2FF 3CLOA 2OLUA 3UN7A 5L2FA 1FSYA 3P98A 4IHQA 3BFDA 4OOYA 3H82A 2ZBBA 2OAP1 2J9OA 1LHYA 3CPTB 4I5SA 3DWKA 2EWWA 5DF9A 5GLDA 3EOIA 1FR6A 2PU2A 3W4QA 1T1BA 1CF0A 4L0LA 2J7VA 3GV9A 2J8YA 4FD8A 5CERA 1YMSA 5L09A 4X6TA 1G68A 3W4PA 3LY3A 1FIKA 1YQSA 2PD8A 4KQOA 4JGPA 1DJBA 4JXVA 4ARZB 3EGXC 3PBSA 4KQRA 3NCKA 2JKRI 5G18A 4QJGA 1VETA 3CI6A 4HESA 1TDGA 3D72A 1S67L 1AWIA 1H5XA 2B18A 3T4OA 4CPKA 4EV4A 4E3OA 5BOHA 2Y2LA 2PHYA 5FEFA 2JBFA 2V1AA 4H6JA 3HUMA 2KDKA 3A3JA 2Y4AA 3T12B 4XT2A 2WZXA 2BASA 4Q8IA 2IA2A 3DTEA 4R38A 2W3DA 1G28A 3T4SA 3BW6A 1CEGA 1TF1A 1ZG4A 2JKGA 1ERQA 3CITA 3A0SA 4OPZA 1ESIA 2L1MA 4BD0A 1JWVA 2W1RA 3HJKA 1T19A 3H7WA 3C38A 4H8RA 3C2WA 3Q07A 3RXXA 5J8XA 1J3WA 3F1PB 4N1XA 5F1GA 3F1OA 1HD8A 4BLMA 4WUJA 2MJ6A 1VQQA 2Z6CA 3S4XA 2VGLM 3PAGA 3MZEA 4DRTA 1ESUA 1IELA 1IFQA 1P0ZA 5A91A 2C5WB 3MFDA 3OPLA 3B33A 2I9VA 3RJUA 3U4LP 4R3JA 1ES3A 2D02A 4HHDA 3A3DA 4JF6A 3UPNA 1XA1A 3QP2A 1KGEA 3CMZA 3BQ8A 3ZNTA 3QHYA 1F9IA 5IHVA 5K5BA 1SZVA 1YT4A 4DXBA 3UNWA 3MZFA 5J3WA 3ZQ5A 4WYYA 3FZCA 1W63Q 3K3DA 3KO6A 1YLPA 2HDQA 3BFGA 1YKDA 4U3TA 1LL9A 4UQIM 2K2NA 5FSRA 4OQGA 5KZHA 1S4SA 4BBTA 2Z6DA 4HJ4A 3MBZA 5FQIA 5KMWA 1TS6A 2G7UA 1YSQA 3RH8B 1CJFA 4X1LA 4FH4A 1T1AA 1FCNA 3DTIA 5M19A 2EX9A 3Q7VA 5L10A 3NECA 4MBKA 1W79A 3MSHA 4HI4A 1GHIA 3VOZA 2DRWA 3GMWA 3IX8A 3DBAA 5AQ7A 3KYZA 4NK3A 4DE2A 4NKPA 1VEUB 4F3LA 2INWA 3WS2A 5HDDA 4EUZA 1N4OA 1OJ5A 1XGJA 1HLUP 4CLCE 1O7EA 4PKYG 4OOMA 1K55C 3MQOA 3HVFA 3IXGA 4L9EA 2OWHA 5EFWA 5TJJA 3A0VA 1OTDA 4WM9A 3T1QB 1DP8A 3CPTA 5U47A 3F1NA 3NI9A 4HQAA 1PZPA 1PI4A 5CHUA 4WZ4A 1MKMA 2PT7A 4P6BA 3SH9A 4MLLA 3LUQA 4E04A 5IT5A 3HJIA 3Q7ZA 1YLJA 1GHPA 2J3TC 2ZC4B 2EX8A 2HDUA 1QMFA 4JKTA 3ZNYA 1K4FA 3TW8A 4JGRA 2W3FA 1NRJA 4ARZA 3S7PA 3HCYA 3Q1FA 4CJNA 3NOPC 5HAPA 4E6XA 3N8SA 3S7QA 3P7NA 4DJ2A 3UB9A 3IF5A 1YLZA 2UV0E 4R3AA 3VE4A 3MXSA 1J9MA 5HWTA 2Q9NA 2W27A 3T4JA 3N6IA 2XR0A 3LEZA 3M6HA 5FA7A 4GB7A 2KLIA 4X68A 5IS1A 2QJ7A 2EWVA 2V8FA 3O3VA 5CRFA 3ZG8B 3OBFA 1L3LA 1W63M 2BLSA 1CEFA 2PU4A 4PPRA 4R4RA 2JN7A 5HARA 4QWOA 4EBNA 3EWKA 5GHZA 1BT5A 4N9KA 3G35A 2EXBA 3VFHA 2KX6A 2XGNA 1DP9A 3LICA 2ZOHA 3CJMA 4Z9QA 4MNRA 3LIBA 3IF6C 1S4RA 1G6AA 4I38A 4RQ9A 3F1PA 2PD7A 3FV7A 1D1JA 3BM6A 2Y91A 5L8MA 1LL8A 2E8JA 4XT2B 2VGKA 3LR5A 2XF3A 4G3WA 3IF6B 4QB8A 2FH5A 4Y0OA 4HP9A 1PIOA 1XKZA 4BL2A 3PBTA 3UB7A 3KX0X 2V1ZA 4ZTKA 3MFXA 3H7WB 2P04A 2X01A 3VSLA 2K7SA 1MWSA 3CAXA 4EEPA 2ZM8A 1K6SA 2VV7A 3TOIA 1K0KA 1EI5A 5GHXA 2XEPA 2VKSA 1PW1A 3LIAA 1SKOA 5FAQA 1UWPX 3IH9A 2Y2QA 3G2ZA 3O87A 1Q2PA 4LRXC 3LYXA 2W3GA 4BJPA 1IEMA 4X53A 1K57A 1PRQA 5EOEA 4S2LA 1W8YA 3SZTA 1S66L 2J3WA 2PYRA 5D3OA 3ZHHA 3NHQA 3MXQA 2WKRA 3BY8A 3ITAA 5FQQA 2X71A 4NXBA 2WAEA 1GSXA 1G6OA 1TEMA 4O7DA 1JNUA 3DTMA 3CZDA 5FL3A 2I72A 3FWLA 5DF7A 1I5QA 1KGGA 3PHYA 2ZC5B 3SS5A 4XUZA 4GCZA 5F83A 4EU0A 5DF8A 1T1CA 4EXOA 4Y13A 1P9RA 1IOUA 1H3QA 3BY9A 4II7A 4P87A 4OLDA 5FQKA 4KZ5A 3B42A 2PRFA 1NLYA 2ZD8A 4IVKA 4KQQA 5G4YA 4DJ3A 2M7UA 3DWZA 3ZCZA 1GCEA 4E3JA 1LSVA 1F5MA 4GDNA 4HNBA 1GA9A 4E3MA 3E4PA 4AFIA 2RCXA 3W2ZA
chains in the Genus database with same CATH topology
1ZG4A 1ERQA 4OPZA 4UAAA 2J9PA 2HDSA 1ESIA 2ZM0A 1RGZA 4BD0A 1JWVA 4KZ6A 4IBXA 1K55A 4A5RA 4H8RA 5EVIA 1K25A 2EX2A 1K38A 1KVMA 1YLWA 3Q07A 4OP5A 1S6RA 4GKUA 3RXXA 5J8XA 3QNCA 5E43A 5TFQA 3N4IA 4K0WA 4N1XA 3ZGAB 3D4FA 5F1GA 3PTEA 4IBRA 4OPYA 2ZQ7A 4R1GA 4ZAMA 3V50A 1MWTA 1RCJA 3CG5A 1BUEA 3GTCA 1NZUA 2ZQDA 2ZQCA 1HD8A 1YMXA 4PM9A 2EFXA 4BLMA 3PBOA 5CECA 1FSWA 3IHBA 4EQIA 2H0TA 1LLBA 3ZVTA 4S2NA 1VQQA 5EE8A 2Y55A 1MWRA 3BLMA 4X56A 3S4XA 2XQZA 3PAGA 1IYOA 3MZEA 5FQJA 4DRTA 3HLCA 3UDFA 5CEDA 1ESUA 1IELA 1H8YA 1CI9A 1L2SA 1MWUA 3SS3A 4GDBA 4LV0A 1W7FA 4JPMA 1W5DA 3UPPA 3A3IA 3B3XA 4JXWA 5A91A 2C5WB 3MFDA 5JYPA 3NBLA 5M1AA 3OPLA 4JLFA 2XK1A 5GLBA 2X02A 2XD1A 3WS1A 3A3FA 3RJUA 4BD1A 4R3JA 1ES3A 5I94A 4N9LA 2P9VA 3GRJA 2Y2OA 3A3DA 4JF6A 3UPNA 4BL3A 1XA1A 4E6WA 2JCHA 4DE1A 1KGEA 3CMZA 3EQUA 3ZNTA 3QHYA 3BECA 5HW3A 4MBFA 5IHVA 5HX9A 2BG1A 1YT4A 3MKEA 4DXBA 1CK3A 3UNWA 3MZFA 1I2WA 3ZG5A 4WYYA 1IKGA 3FZCA 1S0WA 1ES4A 3G30A 2WAFA 1C3BA 4KZAA 1YLPA 2HDQA 5FQ9A 1NZOA 4R3BA 3BFGA 5CHMA 3WRTA 3P09A 4U3TA 1LL9A 3IQAA 5DTSA 3ZG0A 5CTMA 5A90A 2Y2IA 5CHJA 5FSRA 4OQGA 1WYBA 3G2YA 5KZHA 1I2SA 2ZQ9A 3WS0A 5FI7A 3HL9A 3QNBA 1EROA 4JXGA 3N8LA 3BEBA 4UA7A 4KZ9A 3VOYA 1ONHA 3WRZA 3M2JA 3MBZA 5FQIA 5KMWA 3G4PA 2EFUA 1FQGA 5A93A 3HLWA 3NDGA 4S2JA 3UDIA 1XGIA 2Y59A 3OPPA 3HLGA 1JWZA 1O07A 1YLYA 2WKEA 4LENA 1ONGA 1AXBA 1LI9A 2DNSA 1ZKJA 1PYYA 4FH4A 5FAOA 2WUQA 3GR2A 1FCNA 4WMCD 5CTNA 4F94A 1TDLA 3GVBA 3OZHA 5M19A 1PWGA 2EX9A 3Q7VA 3HUOA 3M2KA 4U0TA 3OCNA 1KGFA 4MBKA 1W79A 3PBRA 1XXMA 1GHIA 3VOZA 2DRWA 3GQZA 4XXRA 2QMIA 3GMWA 1SHVA 3OC2A 3BYDA 1KDWA 1PW8A 2WKHA 1ES5A 5F1FA 2IWCA 4HEFA 3IF6A 5AQ7A 4S2KA 1Q2QA 3W8KA 4NK3A 3BFEA 5EPHA 4DE2A 3N7WA 3NIAA 1N9BA 4KZ4A 2QPNA 1W8QA 2V20A 2HP6A 3WS2A 2XH9A 1K54C 3S1YA 4EUZA 3WS4A 1N4OA 2HDRA 1WE4A 4QD4A 1XGJA 3PBNA 3BFCA 4N1HA 1XA7A 2G2UA 3AGFA 5JYOA 5GLAA 2Y2NA 4RA7A 3TG9A 1O7EA 2UWXA 5E2FA 2HP9A 1KVLA 3HUNA 4OOMA 1K55C 5AQBA 5EVIC 1DJAA 3HVFA 1NY0A 1XPBA 2A49A 3FYZA 3IXGA 1M40A 4JF4A 1WYCA 5AQ9A 4BQMA 4LV3A 3WS5A 4LV1A 3C7UA 5EVLA 3C5AA 3V3SA 4MBHA 3ZVWA 1L0DA 4C3QA 4WM9A 1ERMA 2OLVA 3HLFA 5U47A 1XP4A 3E2KA 1H8ZA 3NI9A 4KZ3A 4RVAA 3MZDA 1PZPA 2WADA 3V39A 3SH7A 1PI4A 3M6BA 5CHUA 1GHMA 5EVIB 4WZ4A 2H10A 1KE0A 4S2PA 4GNUA 4PM6A 4P6BA 3SH9A 4FSFA 1GA0A 4MLLA 1MBLA 1DY6A 4K91A 5HAQA 4WMCA 2Y2HA 4ID4A 4BENA 5EUAA 3UE0A 4P0MA 2FFFB 5F82A 3TSGA 3ISGA 3Q7ZA 1ES2A 1YLJA 1GHPA 4ZJ3A 3AGEA 3VP0A 1HVBA 1K4EA 3E2LA 3VFFA 1KE4A 1OMEA 2ZC4B 3IT9A 4D2OA 5TR7A 2EX8A 2HDUA 4YINA 1QMFA 4JKTA 4E3LA 1KE3A 1L0FA 1L0EA 3IHAA 4S2IA 5A92A 1K56D 2ZQ8A 2VGJA 3OPRA 3JYIA 3UDXA 3ZNYA 1K4FA 2Y2JA 1ZC2A 1K57C 3UPOA 4S2MA 1BLSA 2RL3A 3G31A 1ZG6A 3WWXA 3G32A 3Q1FA 2ZJ9A 1LL5A 1MXOA 4K0XA 4CJNA 1NJ4A 4DE0A 4E6XA 5HFOA 5HAPA 3N8SA 4RYEA 1IYPA 4U0XA 3Q82A 5GL9A 4RX3A 3VP4A 4IVIA 5HL1A 4WELA 2GDNA 2OSUA 1E4DA 4JF5A 4X69A 1JTGA 3N8RA 4GN2A 3IF5A 5FDHA 1YLZA 2DCFA 3ZG7B 5E2HA 3MXSA 1YLTA 3S22A 1PWDA 3LY4A 3HLBA 2Z2LB 3GSGA 3MKFA 2P9VB 4DXCA 4EBLA 5HAIA 1J9MA 3LCEA 2Q9NA 2ZC3B 4IEDA 1K6RA 2ZC7A 3NC8A 3VP2A 2WYXA 3IWIA 1XX2A 5FASA 3N6IA 1MY8A 2Z2MB 3C4OA 2XR0A 1YM1A 4LV2A 3LEZA 4UA6A 2XFTA 4XUXA 3UY6A 4QHCA 3M6HA 2WGIA 4KG5A 4ZBEA 1PI5A 5FA7A 4GB7A 1NYYA 3UE3A 4R23A 2WZZA 4X68A 3PBQA 4X55A 4KG2A 3LO7A 5CEBA 2ZMAA 5E2EA 2OV5A 2WGWB 3O3VA 5CRFA 4N92A 4OPRA 3ZG8B 4RX2A 2G2WA 1SKFA 4WEJA 2R9WA 2IWDA 2XLNA 2BLSA 1CEFA 4QY6A 2PU4A 4PPRA 3C7VA 4R4RA 4Y7PA 1KDSA 4JBFA 2JE5A 2Y2KA 3IWQA 1HZOA 5FI6A 4UA9A 5HARA 3ZFZA 1M6KA 2WGVA 2EXAA 3IXHA 4EBNA 1SDNA 4R4SA 3BFFA 5GHZA 1BT5A 1NYMA 4N9KA 1NXYA 3G35A 2EXBA 2B5RA 4WZ5A 3VFHA 2XGNA 2ZLYA 3ITBA 1K56A 2E8IA 3OCLA 4M3KA 3CJMA 3NY4A 4MEZA 4Z9QA 3VSKA 2Y2GA 1NRFA 4MNRA 3SOIA 4KENB 3C4PA 2H0YA 3IF6C 2QZ6A 4KZBA 4KZ8A 1G6AA 4C75A 5KSHA 3IXDA 3UO9A 2H5SA 4OKPA 4OQ0A 2XDMA 1RGYA 4OQIA 3Q7VB 1RP5A 2A3UA 2Y2MA 1VM1A 2Q9MA 4R0QA 1TVFA 3FV7A 3BM6A 2Y91A 3IWOA 3SS4A 1LI0A 4KZ7A 2WK0A 3G34A 3V3RA 4Y0TA 1K54A 2VGKA 1BULA 1MKIA 1EWZA 2C6WB 2XF3A 4QY5A 5AQAA 1ALQA 3ZDJA 3IF6B 5CGXA 3FKWA 4QB8A 3IH8A 3V5MA 1FR1A 3I7JA 3MXRA 4Y0OA 5EOOA 1PIOA 1XKZA 4E3KA 4BL2A 3PBTA 4B4ZA 2EX6A 1E25A 1FOFA 4YFMA 2V1ZA 5FI2A 4Y0UA 3VMAA 3FKVA 3EQVA 4OP8A 4ZTKA 3W4OA 5CGWA 2P74A 2CC1A 3OPHA 4PM7A 5M18A 1Z6FA 4HBUA 3RXWA 1IYSA 2V2FF 2X01A 3VSLA 1BTLA 4LCMA 1MWSA 1IKIA 4S2NC 1JTDA 2OLUA 3UN7A 5L2FA 1FSYA 2ZM8A 3P98A 4JXSA 3O86A 3DW0A 3BFDA 4OOYA 2PBYA 3BRMA 4PMAA 1K6SA 5TGFA 3UE1A 4GD6A 3TOIA 1PWCA 4FCFA 1E3UD 1EI5A 2J9OA 5GHXA 2XEPA 1LHYA 1PW1A 4ZJ1A 4GZBA 2ZQAA 3VP3A 3ZG9B 3DWKA 4WBGA 1U60A 2XFSA 5FAQA 5DF9A 3IH9A 3BLSA 5GLDA 3IXBA 2Y2QA 3G2ZA 1FR6A 3O87A 2PU2A 4NETA 4OVDA 4HBTA 3W4QA 1Q2PA 3HLEA 4ZJ2A 3PAEA 1BLPA 4DKIA 5CGSA 1DJCA 1IEMA 4BJPA 4ZDXA 4L0LA 1BLCA 2J7VA 5FAPA 1BZAA 1CI8A 3GV9A 4P85A 1K57A 4X53A 2J8YA 4FD8A 5DTTA 1JVJA 5CERA 3HBRA 4UHUA 3VP1A 1YMSA 2R9XA 4X6TA 1MPLA 5KSCA 5EOEA 4S2LA 1W8YA 1G68A 3W4PA 5FQMA 3HREA 3LY3A 5FATA 5DVAA 5D3OA 1YQSA 3ZHHA 4KQOA 2WKIA 3AGDA 4DDYA 3ITAA 5E2GA 4GOGA 1DJBA 5EVID 4JXVA 4DDSA 5FQQA 4LCLA 2X71A 3PBSA 4KQRA 4B88A 3NCKA 4E3NA 4QU3A 1HTZA 1TEMA 2JC7A 2WAEA 4DF6A 4O7DA 4OONA 2WGWA 5G18A 1PZOA 1FCMA 4PM5A 4QJGA 3DTMA 3CZDA 4HESA 5GLCA 4OQHA 1TDGA 4WEKA 2I72A 3FWLA 5DF7A 1I5QA 1KGGA 4C6YA 1H5XA 3NDEA 1BSGA 2ZC5B 5CXWA 3O88A 1L0GA 4XUZA 5DTKA 5F83A 3SS5A 4CPKA 4DE3A 1BLHA 4EV4A 5DF8A 4GD8A 4E3OA 1JWPA 1SCWA 1E3UA 2ZM2A 4B4XA 5BOHA 5GHYA 2Y2LA 4P87A 2Y2PA 4OLDA 5FQKA 1SDEA 4KZ5A 5EECA 2ZD8A 2JBFA 3HLDA 4IVKA 1FCOA 3Q81A 4WZ5C 4KQQA 2HPBA 1QMEA 3HUMA 4OPQA 3SH8A 4FH2A 3A3JA 3DWZA 4OOLA 3ZCZA 2Y4AA 1GCEA 1Y54A 4PM8A 2FFYA 2WZXA 4E3JA 2HP5A 4S2OA 4Q8IA 4E3IA 4GDNA 2ZC6B 3A3EA 2XD5A 4KG6A 2IWBA 4E3MA 1GA9A 4OLGA 4EBPA 4OH0A 1IYQA 4EWFA 2RCXA 1CEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG4 A;  1ERQ A;  4OPZ A;  4UAA A;  2J9P A;  2HDS A;  1ESI A;  2ZM0 A;  1RGZ A;  4BD0 A;  1JWV A;  4KZ6 A;  4IBX A;  1K55 A;  4A5R A;  4H8R A;  5EVI A;  1K25 A;  2EX2 A;  1K38 A;  1KVM A;  1YLW A;  3Q07 A;  4OP5 A;  1S6R A;  4GKU A;  3RXX A;  5J8X A;  3QNC A;  5E43 A;  5TFQ A;  3N4I A;  4K0W A;  4N1X A;  3ZGA B;  3D4F A;  5F1G A;  3PTE A;  4IBR A;  4OPY A;  2ZQ7 A;  4R1G A;  4ZAM A;  3V50 A;  1MWT A;  1RCJ A;  3CG5 A;  1BUE A;  3GTC A;  1NZU A;  2ZQD A;  2ZQC A;  1HD8 A;  1YMX A;  4PM9 A;  2EFX A;  4BLM A;  3PBO A;  5CEC A;  1FSW A;  3IHB A;  4EQI A;  2H0T A;  1LLB A;  3ZVT A;  4S2N A;  1VQQ A;  5EE8 A;  2Y55 A;  1MWR A;  3BLM A;  4X56 A;  3S4X A;  2XQZ A;  3PAG A;  1IYO A;  3MZE A;  5FQJ A;  4DRT A;  3HLC A;  3UDF A;  5CED A;  1ESU A;  1IEL A;  1H8Y A;  1CI9 A;  1L2S A;  1MWU A;  3SS3 A;  4GDB A;  4LV0 A;  1W7F A;  4JPM A;  1W5D A;  3UPP A;  3A3I A;  3B3X A;  4JXW A;  5A91 A;  2C5W B;  3MFD A;  5JYP A;  3NBL A;  5M1A A;  3OPL A;  4JLF A;  2XK1 A;  5GLB A;  2X02 A;  2XD1 A;  3WS1 A;  3A3F A;  3RJU A;  4BD1 A;  4R3J A;  1ES3 A;  5I94 A;  4N9L A;  2P9V A;  3GRJ A;  2Y2O A;  3A3D A;  4JF6 A;  3UPN A;  4BL3 A;  1XA1 A;  4E6W A;  2JCH A;  4DE1 A;  1KGE A;  3CMZ A;  3EQU A;  3ZNT A;  3QHY A;  3BEC A;  5HW3 A;  4MBF A;  5IHV A;  5HX9 A;  2BG1 A;  1YT4 A;  3MKE A;  4DXB A;  1CK3 A;  3UNW A;  3MZF A;  1I2W A;  3ZG5 A;  4WYY A;  1IKG A;  3FZC A;  1S0W A;  1ES4 A;  3G30 A;  2WAF A;  1C3B A;  4KZA A;  1YLP A;  2HDQ A;  5FQ9 A;  1NZO A;  4R3B A;  3BFG A;  5CHM A;  3WRT A;  3P09 A;  4U3T A;  1LL9 A;  3IQA A;  5DTS A;  3ZG0 A;  5CTM A;  5A90 A;  2Y2I A;  5CHJ A;  5FSR A;  4OQG A;  1WYB A;  3G2Y A;  5KZH A;  1I2S A;  2ZQ9 A;  3WS0 A;  5FI7 A;  3HL9 A;  3QNB A;  1ERO A;  4JXG A;  3N8L A;  3BEB A;  4UA7 A;  4KZ9 A;  3VOY A;  1ONH A;  3WRZ A;  3M2J A;  3MBZ A;  5FQI A;  5KMW A;  3G4P A;  2EFU A;  1FQG A;  5A93 A;  3HLW A;  3NDG A;  4S2J A;  3UDI A;  1XGI A;  2Y59 A;  3OPP A;  3HLG A;  1JWZ A;  1O07 A;  1YLY A;  2WKE A;  4LEN A;  1ONG A;  1AXB A;  1LI9 A;  2DNS A;  1ZKJ A;  1PYY A;  4FH4 A;  5FAO A;  2WUQ A;  3GR2 A;  1FCN A;  4WMC D;  5CTN A;  4F94 A;  1TDL A;  3GVB A;  3OZH A;  5M19 A;  1PWG A;  2EX9 A;  3Q7V A;  3HUO A;  3M2K A;  4U0T A;  3OCN A;  1KGF A;  4MBK A;  1W79 A;  3PBR A;  1XXM A;  1GHI A;  3VOZ A;  2DRW A;  3GQZ A;  4XXR A;  2QMI A;  3GMW A;  1SHV A;  3OC2 A;  3BYD A;  1KDW A;  1PW8 A;  2WKH A;  1ES5 A;  5F1F A;  2IWC A;  4HEF A;  3IF6 A;  5AQ7 A;  4S2K A;  1Q2Q A;  3W8K A;  4NK3 A;  3BFE A;  5EPH A;  4DE2 A;  3N7W A;  3NIA A;  1N9B A;  4KZ4 A;  2QPN A;  1W8Q A;  2V20 A;  2HP6 A;  3WS2 A;  2XH9 A;  1K54 C;  3S1Y A;  4EUZ A;  3WS4 A;  1N4O A;  2HDR A;  1WE4 A;  4QD4 A;  1XGJ A;  3PBN A;  3BFC A;  4N1H A;  1XA7 A;  2G2U A;  3AGF A;  5JYO A;  5GLA A;  2Y2N A;  4RA7 A;  3TG9 A;  1O7E A;  2UWX A;  5E2F A;  2HP9 A;  1KVL A;  3HUN A;  4OOM A;  1K55 C;  5AQB A;  5EVI C;  1DJA A;  3HVF A;  1NY0 A;  1XPB A;  2A49 A;  3FYZ A;  3IXG A;  1M40 A;  4JF4 A;  1WYC A;  5AQ9 A;  4BQM A;  4LV3 A;  3WS5 A;  4LV1 A;  3C7U A;  5EVL A;  3C5A A;  3V3S A;  4MBH A;  3ZVW A;  1L0D A;  4C3Q A;  4WM9 A;  1ERM A;  2OLV A;  3HLF A;  5U47 A;  1XP4 A;  3E2K A;  1H8Z A;  3NI9 A;  4KZ3 A;  4RVA A;  3MZD A;  1PZP A;  2WAD A;  3V39 A;  3SH7 A;  1PI4 A;  3M6B A;  5CHU A;  1GHM A;  5EVI B;  4WZ4 A;  2H10 A;  1KE0 A;  4S2P A;  4GNU A;  4PM6 A;  4P6B A;  3SH9 A;  4FSF A;  1GA0 A;  4MLL A;  1MBL A;  1DY6 A;  4K91 A;  5HAQ A;  4WMC A;  2Y2H A;  4ID4 A;  4BEN A;  5EUA A;  3UE0 A;  4P0M A;  2FFF B;  5F82 A;  3TSG A;  3ISG A;  3Q7Z A;  1ES2 A;  1YLJ A;  1GHP A;  4ZJ3 A;  3AGE A;  3VP0 A;  1HVB A;  1K4E A;  3E2L A;  3VFF A;  1KE4 A;  1OME A;  2ZC4 B;  3IT9 A;  4D2O A;  5TR7 A;  2EX8 A;  2HDU A;  4YIN A;  1QMF A;  4JKT A;  4E3L A;  1KE3 A;  1L0F A;  1L0E A;  3IHA A;  4S2I A;  5A92 A;  1K56 D;  2ZQ8 A;  2VGJ A;  3OPR A;  3JYI A;  3UDX A;  3ZNY A;  1K4F A;  2Y2J A;  1ZC2 A;  1K57 C;  3UPO A;  4S2M A;  1BLS A;  2RL3 A;  3G31 A;  1ZG6 A;  3WWX A;  3G32 A;  3Q1F A;  2ZJ9 A;  1LL5 A;  1MXO A;  4K0X A;  4CJN A;  1NJ4 A;  4DE0 A;  4E6X A;  5HFO A;  5HAP A;  3N8S A;  4RYE A;  1IYP A;  4U0X A;  3Q82 A;  5GL9 A;  4RX3 A;  3VP4 A;  4IVI A;  5HL1 A;  4WEL A;  2GDN A;  2OSU A;  1E4D A;  4JF5 A;  4X69 A;  1JTG A;  3N8R A;  4GN2 A;  3IF5 A;  5FDH A;  1YLZ A;  2DCF A;  3ZG7 B;  5E2H A;  3MXS A;  1YLT A;  3S22 A;  1PWD A;  3LY4 A;  3HLB A;  2Z2L B;  3GSG A;  3MKF A;  2P9V B;  4DXC A;  4EBL A;  5HAI A;  1J9M A;  3LCE A;  2Q9N A;  2ZC3 B;  4IED A;  1K6R A;  2ZC7 A;  3NC8 A;  3VP2 A;  2WYX A;  3IWI A;  1XX2 A;  5FAS A;  3N6I A;  1MY8 A;  2Z2M B;  3C4O A;  2XR0 A;  1YM1 A;  4LV2 A;  3LEZ A;  4UA6 A;  2XFT A;  4XUX A;  3UY6 A;  4QHC A;  3M6H A;  2WGI A;  4KG5 A;  4ZBE A;  1PI5 A;  5FA7 A;  4GB7 A;  1NYY A;  3UE3 A;  4R23 A;  2WZZ A;  4X68 A;  3PBQ A;  4X55 A;  4KG2 A;  3LO7 A;  5CEB A;  2ZMA A;  5E2E A;  2OV5 A;  2WGW B;  3O3V A;  5CRF A;  4N92 A;  4OPR A;  3ZG8 B;  4RX2 A;  2G2W A;  1SKF A;  4WEJ A;  2R9W A;  2IWD A;  2XLN A;  2BLS A;  1CEF A;  4QY6 A;  2PU4 A;  4PPR A;  3C7V A;  4R4R A;  4Y7P A;  1KDS A;  4JBF A;  2JE5 A;  2Y2K A;  3IWQ A;  1HZO A;  5FI6 A;  4UA9 A;  5HAR A;  3ZFZ A;  1M6K A;  2WGV A;  2EXA A;  3IXH A;  4EBN A;  1SDN A;  4R4S A;  3BFF A;  5GHZ A;  1BT5 A;  1NYM A;  4N9K A;  1NXY A;  3G35 A;  2EXB A;  2B5R A;  4WZ5 A;  3VFH A;  2XGN A;  2ZLY A;  3ITB A;  1K56 A;  2E8I A;  3OCL A;  4M3K A;  3CJM A;  3NY4 A;  4MEZ A;  4Z9Q A;  3VSK A;  2Y2G A;  1NRF A;  4MNR A;  3SOI A;  4KEN B;  3C4P A;  2H0Y A;  3IF6 C;  2QZ6 A;  4KZB A;  4KZ8 A;  1G6A A;  4C75 A;  5KSH A;  3IXD A;  3UO9 A;  2H5S A;  4OKP A;  4OQ0 A;  2XDM A;  1RGY A;  4OQI A;  3Q7V B;  1RP5 A;  2A3U A;  2Y2M A;  1VM1 A;  2Q9M A;  4R0Q A;  1TVF A;  3FV7 A;  3BM6 A;  2Y91 A;  3IWO A;  3SS4 A;  1LI0 A;  4KZ7 A;  2WK0 A;  3G34 A;  3V3R A;  4Y0T A;  1K54 A;  2VGK A;  1BUL A;  1MKI A;  1EWZ A;  2C6W B;  2XF3 A;  4QY5 A;  5AQA A;  1ALQ A;  3ZDJ A;  3IF6 B;  5CGX A;  3FKW A;  4QB8 A;  3IH8 A;  3V5M A;  1FR1 A;  3I7J A;  3MXR A;  4Y0O A;  5EOO A;  1PIO A;  1XKZ A;  4E3K A;  4BL2 A;  3PBT A;  4B4Z A;  2EX6 A;  1E25 A;  1FOF A;  4YFM A;  2V1Z A;  5FI2 A;  4Y0U A;  3VMA A;  3FKV A;  3EQV A;  4OP8 A;  4ZTK A;  3W4O A;  5CGW A;  2P74 A;  2CC1 A;  3OPH A;  4PM7 A;  5M18 A;  1Z6F A;  4HBU A;  3RXW A;  1IYS A;  2V2F F;  2X01 A;  3VSL A;  1BTL A;  4LCM A;  1MWS A;  1IKI A;  4S2N C;  1JTD A;  2OLU A;  3UN7 A;  5L2F A;  1FSY A;  2ZM8 A;  3P98 A;  4JXS A;  3O86 A;  3DW0 A;  3BFD A;  4OOY A;  2PBY A;  3BRM A;  4PMA A;  1K6S A;  5TGF A;  3UE1 A;  4GD6 A;  3TOI A;  1PWC A;  4FCF A;  1E3U D;  1EI5 A;  2J9O A;  5GHX A;  2XEP A;  1LHY A;  1PW1 A;  4ZJ1 A;  4GZB A;  2ZQA A;  3VP3 A;  3ZG9 B;  3DWK A;  4WBG A;  1U60 A;  2XFS A;  5FAQ A;  5DF9 A;  3IH9 A;  3BLS A;  5GLD A;  3IXB A;  2Y2Q A;  3G2Z A;  1FR6 A;  3O87 A;  2PU2 A;  4NET A;  4OVD A;  4HBT A;  3W4Q A;  1Q2P A;  3HLE A;  4ZJ2 A;  3PAE A;  1BLP A;  4DKI A;  5CGS A;  1DJC A;  1IEM A;  4BJP A;  4ZDX A;  4L0L A;  1BLC A;  2J7V A;  5FAP A;  1BZA A;  1CI8 A;  3GV9 A;  4P85 A;  1K57 A;  4X53 A;  2J8Y A;  4FD8 A;  5DTT A;  1JVJ A;  5CER A;  3HBR A;  4UHU A;  3VP1 A;  1YMS A;  2R9X A;  4X6T A;  1MPL A;  5KSC A;  5EOE A;  4S2L A;  1W8Y A;  1G68 A;  3W4P A;  5FQM A;  3HRE A;  3LY3 A;  5FAT A;  5DVA A;  5D3O A;  1YQS A;  3ZHH A;  4KQO A;  2WKI A;  3AGD A;  4DDY A;  3ITA A;  5E2G A;  4GOG A;  1DJB A;  5EVI D;  4JXV A;  4DDS A;  5FQQ A;  4LCL A;  2X71 A;  3PBS A;  4KQR A;  4B88 A;  3NCK A;  4E3N A;  4QU3 A;  1HTZ A;  1TEM A;  2JC7 A;  2WAE A;  4DF6 A;  4O7D A;  4OON A;  2WGW A;  5G18 A;  1PZO A;  1FCM A;  4PM5 A;  4QJG A;  3DTM A;  3CZD A;  4HES A;  5GLC A;  4OQH A;  1TDG A;  4WEK A;  2I72 A;  3FWL A;  5DF7 A;  1I5Q A;  1KGG A;  4C6Y A;  1H5X A;  3NDE A;  1BSG A;  2ZC5 B;  5CXW A;  3O88 A;  1L0G A;  4XUZ A;  5DTK A;  5F83 A;  3SS5 A;  4CPK A;  4DE3 A;  1BLH A;  4EV4 A;  5DF8 A;  4GD8 A;  4E3O A;  1JWP A;  1SCW A;  1E3U A;  2ZM2 A;  4B4X A;  5BOH A;  5GHY A;  2Y2L A;  4P87 A;  2Y2P A;  4OLD A;  5FQK A;  1SDE A;  4KZ5 A;  5EEC A;  2ZD8 A;  2JBF A;  3HLD A;  4IVK A;  1FCO A;  3Q81 A;  4WZ5 C;  4KQQ A;  2HPB A;  1QME A;  3HUM A;  4OPQ A;  3SH8 A;  4FH2 A;  3A3J A;  3DWZ A;  4OOL A;  3ZCZ A;  2Y4A A;  1GCE A;  1Y54 A;  4PM8 A;  2FFY A;  2WZX A;  4E3J A;  2HP5 A;  4S2O A;  4Q8I A;  4E3I A;  4GDN A;  2ZC6 B;  3A3E A;  2XD5 A;  4KG6 A;  2IWB A;  4E3M A;  1GA9 A;  4OLG A;  4EBP A;  4OH0 A;  1IYQ A;  4EWF A;  2RCX A;  1CEG A; 
#chains in the Genus database with same CATH topology
 5F5Y A;  1N9L A;  1ACF A;  4KZ6 A;  1K55 A;  4ESP A;  1K25 A;  2KOI A;  5EV0 A;  1K38 A;  3QNC A;  2W1T B;  5E43 A;  3N4I A;  4K0W A;  3ZGA B;  3D4F A;  3PTE A;  4OPY A;  3GDI A;  4Q0H A;  2VA0 A;  1NZU A;  2ZQC A;  1FSW A;  1LLB A;  4I3J A;  1MWR A;  3BLM A;  2JKR M;  3F1N B;  3HLC A;  3UDF A;  1H8Y A;  4NXG A;  1CI9 A;  4GDB A;  4LV0 A;  4EUV A;  4O0P A;  4GJ4 A;  4JLF A;  3WS1 A;  4N9L A;  4E6W A;  5IU1 A;  4GS9 A;  5HW3 A;  1OTI A;  2PYP A;  1YSP A;  2BG1 A;  2VGL S;  1LSW A;  5L07 A;  2WAF A;  1C3B A;  5FQ9 A;  4R3B A;  1H0M A;  3P09 A;  4Z1W A;  5DTS A;  3ZG0 A;  5A90 A;  2Y2I A;  3FPW A;  1WYB A;  3G2Y A;  1I2S A;  2ZQ9 A;  3HL9 A;  4JXG A;  4UA7 A;  3BEB A;  1OTA A;  3ULF A;  2EFU A;  3HLW A;  3NDG A;  3UDI A;  3OPP A;  3HLG A;  2K31 A;  4O8G A;  2WKE A;  4LEN A;  3T1X A;  1P97 A;  4WF0 A;  1VHM A;  3GR2 A;  5F6A A;  1TDL A;  3OZH A;  4UQI S;  3T4L A;  5HSQ A;  4U0T A;  1KGF A;  4HOI A;  1XXM A;  4JGQ A;  2D01 A;  4XXR A;  3GQZ A;  3BYD A;  3TRC A;  1PW8 A;  4R70 A;  5F1F A;  3IF6 A;  4CQH A;  4PAU A;  4IUK A;  4Y2F A;  1N9B A;  4KZ4 A;  5F68 A;  4DMZ A;  1W8Q A;  2HP6 A;  1YPR A;  4UEY A;  2W3H A;  2HDR A;  1WE4 A;  4QD4 A;  1UGU A;  3PBN A;  5GLA A;  4RA7 A;  4MMN A;  2UWX A;  2HP9 A;  1KVL A;  3HUN A;  3OLO A;  1NY0 A;  3FYZ A;  1WYC A;  4LV3 A;  5J7E A;  3UB6 A;  1FIL A;  1XJ2 A;  2CMN A;  2OLV A;  3JPU A;  1H8Z A;  4RVA A;  4KZ3 A;  3MZD A;  2WAD A;  2O99 A;  4JGO A;  2H10 A;  1KE0 A;  4S2P A;  1PNE A;  1NWZ A;  3NOU C;  1MBL A;  4ZRR A;  5EUA A;  4P0M A;  4FUW A;  1ES2 A;  4ZJ3 A;  3AGE A;  1HVB A;  1K4E A;  3VFF A;  1KE4 A;  4D2O A;  5HPI A;  5TR7 A;  1KE3 A;  1L0F A;  1L0E A;  3IHA A;  4GW9 A;  5A92 A;  2ZQ8 A;  4YNR A;  5LBR A;  2VGJ A;  4P6Z M;  1XFQ A;  2Y2J A;  3T4T A;  4EER A;  1K57 C;  3UPO A;  3NUL A;  3BQA A;  1SKO B;  3G32 A;  2V0W A;  1LL5 A;  5HZH A;  1NJ4 A;  2XSS A;  3DAV A;  3LID A;  1IYP A;  3Q82 A;  3VP4 A;  4IVI A;  5HL1 A;  4WEL A;  2GDN A;  4L9G A;  2O9A A;  3ZG7 B;  1PWD A;  2VJW A;  3LFV A;  1Z09 A;  3HLB A;  2L0W A;  3GSG A;  4DXC A;  3LCE A;  2VX8 A;  3NJA A;  4IED A;  3VP2 A;  5FAS A;  2Y8H A;  3LI8 A;  1MY8 A;  3C4O A;  2BTF P;  4LV2 A;  4UA6 A;  4XUX A;  2NUT C;  4KG5 A;  1PI5 A;  1NYY A;  4HY8 A;  4DN0 A;  2WZZ A;  3PBQ A;  4X55 A;  2ACG A;  5E2E A;  3S7O A;  2XA7 M;  2G2W A;  1SKF A;  4QY6 A;  3MS6 A;  4G3K A;  1KDS A;  4JBF A;  2Y2K A;  5FI6 A;  3D3O A;  4UA9 A;  3ZFZ A;  3IXH A;  4I39 A;  1NYM A;  2VZW A;  3VOL A;  3NY4 A;  2HJE A;  1YAX A;  3VV4 A;  5HWV A;  4Q0J A;  3T4Q A;  4L9F A;  3O5Y A;  2QZ6 A;  5TBM A;  2PAV P;  3FPV A;  3IXD A;  4OKP A;  4OQI A;  2W1T A;  2A3U A;  3EEA A;  2Y2M A;  3R4K A;  2H28 A;  4MN6 A;  3IWO A;  1OT6 A;  2WK0 A;  3G34 A;  4Y0T A;  1K54 A;  1DP6 A;  1MKI A;  1ALQ A;  3ZDJ A;  3OOV A;  5EOO A;  4E3K A;  2QYB A;  4YFM A;  3EQV A;  1XJ4 A;  4OP8 A;  3S7N A;  3W4O A;  2P74 A;  2CC1 A;  4LRY C;  4LCM A;  1IKI A;  4HIA A;  4JXS A;  4BBU A;  3DW0 A;  4KQD A;  3BRM A;  5TGF A;  3UE1 A;  2PR5 A;  4ETX A;  1PWC A;  1E3U D;  2GJ3 A;  4PKY A;  4ZJ1 A;  2ZQA A;  2QWS A;  1N9N A;  2O9C A;  1BLP A;  2VLG A;  4DKI A;  3MQ0 A;  5CGS A;  5DFX A;  1DJC A;  1CI8 A;  5DTT A;  1JVJ A;  3HBR A;  2R9X A;  5KSC A;  3C30 A;  4HH2 A;  3HRE A;  5FAT A;  3QP6 A;  2WKI A;  4GS9 B;  4GOG A;  4GHI B;  3G6O A;  4B88 A;  4ETZ A;  4QU3 A;  2JC7 A;  2WGW A;  5GLC A;  4NXE A;  4C6Y A;  3NDE A;  1BSG A;  3O88 A;  1L0G A;  2V9A A;  1BLH A;  1BYW A;  4GD8 A;  5AVE A;  1JWP A;  1SCW A;  1E3U A;  2ZM2 A;  1ZHH B;  5GHY A;  2DMW A;  3KSI A;  1SDE A;  1FCO A;  3UME A;  3Q81 A;  4WZ5 C;  1QME A;  4OPQ A;  2QHK A;  4FH2 A;  1LT0 A;  4EES A;  4PM8 A;  2FFY A;  4S2O A;  4E3I A;  2ZC6 B;  3A3E A;  2XD5 A;  4HH3 A;  1MZU A;  2IWB A;  4OLG A;  4Q0I A;  4EBP A;  3LEQ A;  2A2L A;  4UAA A;  4MN5 A;  4IBX A;  4LRZ E;  2GZA A;  3KSG A;  3T4K A;  2EX2 A;  1KVM A;  2HJ9 C;  4OP5 A;  1S6R A;  1TD5 A;  5TFQ A;  1N9O A;  3MR0 A;  4IBR A;  2ZQ7 A;  4ZAM A;  1RCJ A;  3GTC A;  3CG5 A;  1YMX A;  2EFX A;  4EQI A;  2HZ5 A;  3ZVT A;  4S2N A;  2VV8 A;  5EE8 A;  4Y17 A;  1UWN X;  4X56 A;  1XFN A;  2XQZ A;  1IYO A;  2OAQ 1;  3TJZ C;  5CED A;  2ZMF A;  1X0O A;  3SS3 A;  2NUP C;  1W7F A;  3MJQ A;  1W5D A;  3A3I A;  3B3X A;  4JXW A;  3NBL A;  2X02 A;  2JKT I;  2XD1 A;  3LIE A;  3R7W A;  5I94 A;  3GRJ A;  2Y2O A;  2JCH A;  2PR6 A;  3EQU A;  3IBR A;  5HX9 A;  1D7E A;  3ZG5 A;  3G30 A;  1NZO A;  5CHM A;  1G5U A;  5CHJ A;  4CLC A;  4HJ3 A;  3N8L A;  3M2J A;  3G4P A;  3UB5 P;  1FQG A;  2Y59 A;  5FDS A;  1YLY A;  3ICY A;  5HPF A;  4MN7 A;  1ONG A;  1A0K A;  2DNS A;  2A24 B;  5FAO A;  2WUQ A;  4I3I A;  4WMC D;  5CTN A;  3GVB A;  4MCW A;  3M2K A;  3OCN A;  4HP4 A;  3K2N A;  5F69 A;  4B9O A;  3E0Y A;  3PBR A;  1SHV A;  3MQQ A;  3OC2 A;  1KDW A;  1F2K A;  2WKH A;  3L7H A;  2IWC A;  5CX7 A;  4S2K A;  3W8K A;  3DTK A;  5EPH A;  3N7W A;  1H8M A;  3NIA A;  2QPN A;  3IS2 A;  1K54 C;  3ZYT A;  5C5K A;  3S1Y A;  2EA9 A;  5TBM B;  3BFC A;  2OWJ A;  1XA7 A;  2G2U A;  2R78 A;  5E2F A;  2HF6 A;  5AQB A;  1V9Z A;  5EVI C;  1DJA A;  2A49 A;  4JF4 A;  4BQM A;  3C7U A;  5AJG A;  5MC7 A;  3V3S A;  4MBH A;  1L0D A;  4C3Q A;  1XP4 A;  3E2K A;  3V39 A;  3M6B A;  5EVI B;  3MMH A;  4M4X A;  4GNU A;  1DY6 A;  4K91 A;  5HAQ A;  4WMC A;  4BEN A;  2FFF B;  3LI9 A;  3ISG A;  3VP0 A;  3SW1 A;  3IT9 A;  2W3E A;  4YIN A;  1K56 D;  2J80 A;  4FTX A;  3JYI A;  2Y79 A;  1ZC2 A;  4S2M A;  4MDZ A;  3G31 A;  4GHI A;  3WWX A;  1MXO A;  4G3V A;  2V1B A;  4RYE A;  4Y5F A;  2OSU A;  4JF5 A;  5FDH A;  3IX3 A;  1YLT A;  3S22 A;  3LY4 A;  2Z2L B;  2P9V B;  4EET B;  4EBL A;  1EW0 A;  1T18 A;  5HAI A;  2ZC3 B;  2ZC7 A;  3NC8 A;  2JHE A;  4P6Z S;  1XX2 A;  4BBV A;  4B93 A;  2Z2M B;  5DJU A;  3JVU A;  2QKP A;  3UY6 A;  2LB9 A;  2WGI A;  1XJ3 A;  1DRM A;  4KG2 A;  3LO7 A;  4YOF A;  2ZMA A;  2OV5 A;  2WGW B;  5EM0 A;  1NLZ A;  2V8C A;  3QP8 A;  2IWD A;  2XLN A;  5EVE A;  3P01 A;  1GSV A;  4KUO A;  5A8B A;  4Y7P A;  2JE5 A;  1M6K A;  3RTY A;  2EXA A;  1NXY A;  2B5R A;  4WZ5 A;  2ZLY A;  1K56 A;  2E8I A;  5DKL A;  2Y2G A;  3SOI A;  4KEN B;  2WKP A;  2H0Y A;  4KZ8 A;  1TS0 A;  3UO9 A;  2GX5 A;  2H5S A;  4OQ0 A;  2W0N A;  1RGY A;  2XA7 S;  1RP5 A;  2B95 A;  1TVF A;  3KSF A;  3SS4 A;  1LI0 A;  3V3R A;  1TS8 A;  1BUL A;  5CGX A;  3FKW A;  4WL9 A;  3IH8 A;  3V5M A;  3V67 A;  3I7J A;  2L4R A;  1OTE A;  1S1Y A;  4B4Z A;  2EX6 A;  1E25 A;  1FOF A;  5FI2 A;  3KSH A;  2GNX A;  5CGW A;  5M18 A;  4PM7 A;  4HBU A;  1IYS A;  3BJN A;  1BTL A;  1STZ A;  4S2N C;  1JTD A;  1VB6 A;  3O86 A;  2PBY A;  3CUE C;  3GEC A;  2B02 A;  4PMA A;  5DJT A;  3T50 A;  4GD6 A;  3QP4 A;  4FCF A;  3VE3 A;  4GZB A;  3VP3 A;  4PHT A;  3ZG9 B;  4WBG A;  1U60 A;  2XFS A;  3T1S A;  4R6L A;  2OOL A;  3BLS A;  3IXB A;  4NET A;  4OVD A;  4HBT A;  3UB8 A;  3HLE A;  4ZJ2 A;  3PAE A;  2PDR A;  3D9Y A;  4ZDX A;  4LLO B;  1BLC A;  5FAP A;  1BZA A;  4P85 A;  2PBD P;  4UHU A;  3VP1 A;  3R7W B;  1MPL A;  3UMD A;  5FQM A;  5DVA A;  3QP1 A;  4NEE D;  3AGD A;  4DDY A;  5E2G A;  4CLC C;  5I5L A;  5EVI D;  4DDS A;  4LCL A;  4E3N A;  1HTZ A;  4DF6 A;  3B47 A;  2A24 A;  2HGV A;  4OON A;  1PZO A;  5AVF A;  1FCM A;  4PM5 A;  4OQH A;  3CWF A;  4WEK A;  1P9W A;  2O0Y A;  4CLC B;  5CXW A;  5DTK A;  4DE3 A;  2YKF A;  4LPZ A;  4B4X A;  4EW7 A;  3C8C A;  2Y2P A;  5EEC A;  2QJ5 A;  3HLD A;  4FOF A;  2HPB A;  3SH8 A;  1D06 A;  4OOL A;  3QP5 A;  4X25 A;  1Y54 A;  4X1M A;  2HP5 A;  4KG6 A;  4OH0 A;  1IYQ A;  4EWF A;  2J9P A;  3NOT C;  2HDS A;  2ZM0 A;  1RGZ A;  4A5R A;  5EVI A;  3IS2 B;  3KYQ A;  3LGO A;  1YLW A;  2P08 A;  3L9K A;  4GKU A;  4R1G A;  3V50 A;  3T1R A;  1MWT A;  1BUE A;  2ZQD A;  5HD5 A;  4PM9 A;  3PBO A;  5CEC A;  3IHB A;  2H0T A;  4KUK A;  4GLQ A;  3E98 A;  2ZL1 B;  2VEA A;  3MF0 A;  2Y55 A;  3IX4 A;  5FQJ A;  3EEH A;  1L2S A;  1MWU A;  4JPM A;  4HJ6 A;  3UPP A;  2V0U A;  4WN5 A;  4WLA A;  5JYP A;  5HL6 A;  1MC0 A;  5M1A A;  5GLB A;  2XK1 A;  3LR4 A;  1PFL A;  3A3F A;  4BD1 A;  3H82 B;  3U2A A;  2P9V A;  4BL3 A;  1TS7 A;  4DE1 A;  2ZOI A;  3BEC A;  4MBF A;  3MKE A;  1CK3 A;  5J4E A;  1I2W A;  1IKG A;  1S0W A;  1ES4 A;  4KZA A;  3WRT A;  3IQA A;  5CTM A;  4LGW A;  4Y15 A;  3WS0 A;  5FI7 A;  1WA9 A;  3JVV A;  3QNB A;  1ERO A;  3VOY A;  4KZ9 A;  1ONH A;  3WRZ A;  2M1C A;  3PYP A;  4NG2 A;  5A93 A;  4S2J A;  1XGI A;  4I3A A;  2P7J A;  1JWZ A;  4IUH A;  1O07 A;  3PXP A;  1OTB A;  1AXB A;  1LI9 A;  1ZKJ A;  4O01 A;  1PYY A;  1V9Y A;  3LR3 A;  4F94 A;  1VET B;  1PWG A;  3LIF A;  3HUO A;  3FG8 A;  1OT9 A;  2QMI A;  2VK3 A;  1ES5 A;  4HEF A;  4NXF A;  1Q2Q A;  3BFE A;  3FC7 A;  2V20 A;  2XH9 A;  1OPX A;  4BWI A;  5EM1 A;  5HWW A;  3WS4 A;  5FEG A;  1KOU A;  4H6J B;  1CQA A;  2JKT M;  4N1H A;  2FZ0 A;  3AGF A;  5JYO A;  2WKQ A;  2Y2N A;  3TG9 A;  1XJ6 A;  4CLC D;  1XPB A;  2AVX A;  1M40 A;  5AQ9 A;  3WS5 A;  4LV1 A;  1GSW A;  4ME4 A;  5DFY A;  5EVL A;  3C5A A;  5DKK A;  3ZVW A;  1ERM A;  3HLF A;  3SH7 A;  1GHM A;  3CUE A;  3IBJ A;  4PM6 A;  4FSF A;  1GA0 A;  4EEU A;  2Y2H A;  4ID4 A;  3UE0 A;  5F82 A;  3TSG A;  3F1O B;  3E2L A;  1OME A;  4E3L A;  4S2I A;  2M7V A;  4EQ1 A;  3OPR A;  3UDX A;  4LFU A;  3K3C A;  1BLS A;  2RL3 A;  4Y3I A;  2Q0O A;  1ZG6 A;  1OJG A;  2ZJ9 A;  4K0X A;  3CHW P;  1ZTU A;  4DE0 A;  5HFO A;  4U0X A;  5GL9 A;  4RX3 A;  1ODV A;  1E4D A;  4X69 A;  1JTG A;  3N8R A;  4GN2 A;  2DCF A;  5E2H A;  3E4O A;  3MKF A;  2HV1 A;  5G4Z A;  1K6R A;  3E4Q A;  2WYX A;  3IWI A;  3RFB A;  1YM1 A;  4BMW A;  2XFT A;  3TE8 A;  4QHC A;  4ZBE A;  3UE3 A;  4R23 A;  1S1Z A;  5CEB A;  1Y4O A;  2VV6 A;  3A0R A;  2XRO A;  4N92 A;  4OPR A;  2YKH A;  3PR6 A;  4WEJ A;  4RX2 A;  2R9W A;  5KIZ A;  1Y28 A;  3EGD C;  3C7V A;  3IWQ A;  1HZO A;  3H9W A;  2WGV A;  4D60 A;  1SDN A;  4R4S A;  3BFF A;  1LSX A;  3LR0 A;  1VEU A;  3ITB A;  3OCL A;  4M3K A;  4MEZ A;  2LB5 A;  3UE6 A;  3VSK A;  3BWL A;  1NRF A;  2J3T D;  4YWZ A;  3C4P A;  4QPR A;  4K08 A;  5KSH A;  4KZB A;  2ZMV A;  4C75 A;  2XRN A;  5HDC A;  5HD3 A;  2JKF A;  2XDM A;  3Q7V B;  4R0Q A;  2O9B A;  1VM1 A;  3KYE A;  2Q9M A;  4KZ7 A;  2C6W B;  4QY5 A;  1EWZ A;  5AQA A;  5HDS A;  1FR1 A;  3MXR A;  1F98 A;  2ZL1 A;  4F3L B;  4Y0U A;  3VMA A;  3FKV A;  3OPH A;  1Z6F A;  4IJG A;  3RXW A;  2V2F F;  3CLO A;  2OLU A;  3UN7 A;  5L2F A;  1FSY A;  3P98 A;  4IHQ A;  3BFD A;  4OOY A;  3H82 A;  2ZBB A;  2OAP 1;  2J9O A;  1LHY A;  3CPT B;  4I5S A;  3DWK A;  2EWW A;  5DF9 A;  5GLD A;  3EOI A;  1FR6 A;  2PU2 A;  3W4Q A;  1T1B A;  1CF0 A;  4L0L A;  2J7V A;  3GV9 A;  2J8Y A;  4FD8 A;  5CER A;  1YMS A;  5L09 A;  4X6T A;  1G68 A;  3W4P A;  3LY3 A;  1FIK A;  1YQS A;  2PD8 A;  4KQO A;  4JGP A;  1DJB A;  4JXV A;  4ARZ B;  3EGX C;  3PBS A;  4KQR A;  3NCK A;  2JKR I;  5G18 A;  4QJG A;  1VET A;  3CI6 A;  4HES A;  1TDG A;  3D72 A;  1S67 L;  1AWI A;  1H5X A;  2B18 A;  3T4O A;  4CPK A;  4EV4 A;  4E3O A;  5BOH A;  2Y2L A;  2PHY A;  5FEF A;  2JBF A;  2V1A A;  4H6J A;  3HUM A;  2KDK A;  3A3J A;  2Y4A A;  3T12 B;  4XT2 A;  2WZX A;  2BAS A;  4Q8I A;  2IA2 A;  3DTE A;  4R38 A;  2W3D A;  1G28 A;  3T4S A;  3BW6 A;  1CEG A;  1TF1 A;  1ZG4 A;  2JKG A;  1ERQ A;  3CIT A;  3A0S A;  4OPZ A;  1ESI A;  2L1M A;  4BD0 A;  1JWV A;  2W1R A;  3HJK A;  1T19 A;  3H7W A;  3C38 A;  4H8R A;  3C2W A;  3Q07 A;  3RXX A;  5J8X A;  1J3W A;  3F1P B;  4N1X A;  5F1G A;  3F1O A;  1HD8 A;  4BLM A;  4WUJ A;  2MJ6 A;  1VQQ A;  2Z6C A;  3S4X A;  2VGL M;  3PAG A;  3MZE A;  4DRT A;  1ESU A;  1IEL A;  1IFQ A;  1P0Z A;  5A91 A;  2C5W B;  3MFD A;  3OPL A;  3B33 A;  2I9V A;  3RJU A;  3U4L P;  4R3J A;  1ES3 A;  2D02 A;  4HHD A;  3A3D A;  4JF6 A;  3UPN A;  1XA1 A;  3QP2 A;  1KGE A;  3CMZ A;  3BQ8 A;  3ZNT A;  3QHY A;  1F9I A;  5IHV A;  5K5B A;  1SZV A;  1YT4 A;  4DXB A;  3UNW A;  3MZF A;  5J3W A;  3ZQ5 A;  4WYY A;  3FZC A;  1W63 Q;  3K3D A;  3KO6 A;  1YLP A;  2HDQ A;  3BFG A;  1YKD A;  4U3T A;  1LL9 A;  4UQI M;  2K2N A;  5FSR A;  4OQG A;  5KZH A;  1S4S A;  4BBT A;  2Z6D A;  4HJ4 A;  3MBZ A;  5FQI A;  5KMW A;  1TS6 A;  2G7U A;  1YSQ A;  3RH8 B;  1CJF A;  4X1L A;  4FH4 A;  1T1A A;  1FCN A;  3DTI A;  5M19 A;  2EX9 A;  3Q7V A;  5L10 A;  3NEC A;  4MBK A;  1W79 A;  3MSH A;  4HI4 A;  1GHI A;  3VOZ A;  2DRW A;  3GMW A;  3IX8 A;  3DBA A;  5AQ7 A;  3KYZ A;  4NK3 A;  4DE2 A;  4NKP A;  1VEU B;  4F3L A;  2INW A;  3WS2 A;  5HDD A;  4EUZ A;  1N4O A;  1OJ5 A;  1XGJ A;  1HLU P;  4CLC E;  1O7E A;  4PKY G;  4OOM A;  1K55 C;  3MQO A;  3HVF A;  3IXG A;  4L9E A;  2OWH A;  5EFW A;  5TJJ A;  3A0V A;  1OTD A;  4WM9 A;  3T1Q B;  1DP8 A;  3CPT A;  5U47 A;  3F1N A;  3NI9 A;  4HQA A;  1PZP A;  1PI4 A;  5CHU A;  4WZ4 A;  1MKM A;  2PT7 A;  4P6B A;  3SH9 A;  4MLL A;  3LUQ A;  4E04 A;  5IT5 A;  3HJI A;  3Q7Z A;  1YLJ A;  1GHP A;  2J3T C;  2ZC4 B;  2EX8 A;  2HDU A;  1QMF A;  4JKT A;  3ZNY A;  1K4F A;  3TW8 A;  4JGR A;  2W3F A;  1NRJ A;  4ARZ A;  3S7P A;  3HCY A;  3Q1F A;  4CJN A;  3NOP C;  5HAP A;  4E6X A;  3N8S A;  3S7Q A;  3P7N A;  4DJ2 A;  3UB9 A;  3IF5 A;  1YLZ A;  2UV0 E;  4R3A A;  3VE4 A;  3MXS A;  1J9M A;  5HWT A;  2Q9N A;  2W27 A;  3T4J A;  3N6I A;  2XR0 A;  3LEZ A;  3M6H A;  5FA7 A;  4GB7 A;  2KLI A;  4X68 A;  5IS1 A;  2QJ7 A;  2EWV A;  2V8F A;  3O3V A;  5CRF A;  3ZG8 B;  3OBF A;  1L3L A;  1W63 M;  2BLS A;  1CEF A;  2PU4 A;  4PPR A;  4R4R A;  2JN7 A;  5HAR A;  4QWO A;  4EBN A;  3EWK A;  5GHZ A;  1BT5 A;  4N9K A;  3G35 A;  2EXB A;  3VFH A;  2KX6 A;  2XGN A;  1DP9 A;  3LIC A;  2ZOH A;  3CJM A;  4Z9Q A;  4MNR A;  3LIB A;  3IF6 C;  1S4R A;  1G6A A;  4I38 A;  4RQ9 A;  3F1P A;  2PD7 A;  3FV7 A;  1D1J A;  3BM6 A;  2Y91 A;  5L8M A;  1LL8 A;  2E8J A;  4XT2 B;  2VGK A;  3LR5 A;  2XF3 A;  4G3W A;  3IF6 B;  4QB8 A;  2FH5 A;  4Y0O A;  4HP9 A;  1PIO A;  1XKZ A;  4BL2 A;  3PBT A;  3UB7 A;  3KX0 X;  2V1Z A;  4ZTK A;  3MFX A;  3H7W B;  2P04 A;  2X01 A;  3VSL A;  2K7S A;  1MWS A;  3CAX A;  4EEP A;  2ZM8 A;  1K6S A;  2VV7 A;  3TOI A;  1K0K A;  1EI5 A;  5GHX A;  2XEP A;  2VKS A;  1PW1 A;  3LIA A;  1SKO A;  5FAQ A;  1UWP X;  3IH9 A;  2Y2Q A;  3G2Z A;  3O87 A;  1Q2P A;  4LRX C;  3LYX A;  2W3G A;  4BJP A;  1IEM A;  4X53 A;  1K57 A;  1PRQ A;  5EOE A;  4S2L A;  1W8Y A;  3SZT A;  1S66 L;  2J3W A;  2PYR A;  5D3O A;  3ZHH A;  3NHQ A;  3MXQ A;  2WKR A;  3BY8 A;  3ITA A;  5FQQ A;  2X71 A;  4NXB A;  2WAE A;  1GSX A;  1G6O A;  1TEM A;  4O7D A;  1JNU A;  3DTM A;  3CZD A;  5FL3 A;  2I72 A;  3FWL A;  5DF7 A;  1I5Q A;  1KGG A;  3PHY A;  2ZC5 B;  3SS5 A;  4XUZ A;  4GCZ A;  5F83 A;  4EU0 A;  5DF8 A;  1T1C A;  4EXO A;  4Y13 A;  1P9R A;  1IOU A;  1H3Q A;  3BY9 A;  4II7 A;  4P87 A;  4OLD A;  5FQK A;  4KZ5 A;  3B42 A;  2PRF A;  1NLY A;  2ZD8 A;  4IVK A;  4KQQ A;  5G4Y A;  4DJ3 A;  2M7U A;  3DWZ A;  3ZCZ A;  1GCE A;  4E3J A;  1LSV A;  1F5M A;  4GDN A;  4HNB A;  1GA9 A;  4E3M A;  3E4P A;  4AFI A;  2RCX A;  3W2Z A; 
#chains in the Genus database with same CATH homology
 1ZG4 A;  1ERQ A;  4OPZ A;  4UAA A;  2J9P A;  2HDS A;  1ESI A;  2ZM0 A;  1RGZ A;  4BD0 A;  1JWV A;  4KZ6 A;  4IBX A;  1K55 A;  4A5R A;  4H8R A;  5EVI A;  1K25 A;  2EX2 A;  1K38 A;  1KVM A;  1YLW A;  3Q07 A;  4OP5 A;  1S6R A;  4GKU A;  3RXX A;  5J8X A;  3QNC A;  5E43 A;  5TFQ A;  3N4I A;  4K0W A;  4N1X A;  3ZGA B;  3D4F A;  5F1G A;  3PTE A;  4IBR A;  4OPY A;  2ZQ7 A;  4R1G A;  4ZAM A;  3V50 A;  1MWT A;  1RCJ A;  3CG5 A;  1BUE A;  3GTC A;  1NZU A;  2ZQD A;  2ZQC A;  1HD8 A;  1YMX A;  4PM9 A;  2EFX A;  4BLM A;  3PBO A;  5CEC A;  1FSW A;  3IHB A;  4EQI A;  2H0T A;  1LLB A;  3ZVT A;  4S2N A;  1VQQ A;  5EE8 A;  2Y55 A;  1MWR A;  3BLM A;  4X56 A;  3S4X A;  2XQZ A;  3PAG A;  1IYO A;  3MZE A;  5FQJ A;  4DRT A;  3HLC A;  3UDF A;  5CED A;  1ESU A;  1IEL A;  1H8Y A;  1CI9 A;  1L2S A;  1MWU A;  3SS3 A;  4GDB A;  4LV0 A;  1W7F A;  4JPM A;  1W5D A;  3UPP A;  3A3I A;  3B3X A;  4JXW A;  5A91 A;  2C5W B;  3MFD A;  5JYP A;  3NBL A;  5M1A A;  3OPL A;  4JLF A;  2XK1 A;  5GLB A;  2X02 A;  2XD1 A;  3WS1 A;  3A3F A;  3RJU A;  4BD1 A;  4R3J A;  1ES3 A;  5I94 A;  4N9L A;  2P9V A;  3GRJ A;  2Y2O A;  3A3D A;  4JF6 A;  3UPN A;  4BL3 A;  1XA1 A;  4E6W A;  2JCH A;  4DE1 A;  1KGE A;  3CMZ A;  3EQU A;  3ZNT A;  3QHY A;  3BEC A;  5HW3 A;  4MBF A;  5IHV A;  5HX9 A;  2BG1 A;  1YT4 A;  3MKE A;  4DXB A;  1CK3 A;  3UNW A;  3MZF A;  1I2W A;  3ZG5 A;  4WYY A;  1IKG A;  3FZC A;  1S0W A;  1ES4 A;  3G30 A;  2WAF A;  1C3B A;  4KZA A;  1YLP A;  2HDQ A;  5FQ9 A;  1NZO A;  4R3B A;  3BFG A;  5CHM A;  3WRT A;  3P09 A;  4U3T A;  1LL9 A;  3IQA A;  5DTS A;  3ZG0 A;  5CTM A;  5A90 A;  2Y2I A;  5CHJ A;  5FSR A;  4OQG A;  1WYB A;  3G2Y A;  5KZH A;  1I2S A;  2ZQ9 A;  3WS0 A;  5FI7 A;  3HL9 A;  3QNB A;  1ERO A;  4JXG A;  3N8L A;  3BEB A;  4UA7 A;  4KZ9 A;  3VOY A;  1ONH A;  3WRZ A;  3M2J A;  3MBZ A;  5FQI A;  5KMW A;  3G4P A;  2EFU A;  1FQG A;  5A93 A;  3HLW A;  3NDG A;  4S2J A;  3UDI A;  1XGI A;  2Y59 A;  3OPP A;  3HLG A;  1JWZ A;  1O07 A;  1YLY A;  2WKE A;  4LEN A;  1ONG A;  1AXB A;  1LI9 A;  2DNS A;  1ZKJ A;  1PYY A;  4FH4 A;  5FAO A;  2WUQ A;  3GR2 A;  1FCN A;  4WMC D;  5CTN A;  4F94 A;  1TDL A;  3GVB A;  3OZH A;  5M19 A;  1PWG A;  2EX9 A;  3Q7V A;  3HUO A;  3M2K A;  4U0T A;  3OCN A;  1KGF A;  4MBK A;  1W79 A;  3PBR A;  1XXM A;  1GHI A;  3VOZ A;  2DRW A;  3GQZ A;  4XXR A;  2QMI A;  3GMW A;  1SHV A;  3OC2 A;  3BYD A;  1KDW A;  1PW8 A;  2WKH A;  1ES5 A;  5F1F A;  2IWC A;  4HEF A;  3IF6 A;  5AQ7 A;  4S2K A;  1Q2Q A;  3W8K A;  4NK3 A;  3BFE A;  5EPH A;  4DE2 A;  3N7W A;  3NIA A;  1N9B A;  4KZ4 A;  2QPN A;  1W8Q A;  2V20 A;  2HP6 A;  3WS2 A;  2XH9 A;  1K54 C;  3S1Y A;  4EUZ A;  3WS4 A;  1N4O A;  2HDR A;  1WE4 A;  4QD4 A;  1XGJ A;  3PBN A;  3BFC A;  4N1H A;  1XA7 A;  2G2U A;  3AGF A;  5JYO A;  5GLA A;  2Y2N A;  4RA7 A;  3TG9 A;  1O7E A;  2UWX A;  5E2F A;  2HP9 A;  1KVL A;  3HUN A;  4OOM A;  1K55 C;  5AQB A;  5EVI C;  1DJA A;  3HVF A;  1NY0 A;  1XPB A;  2A49 A;  3FYZ A;  3IXG A;  1M40 A;  4JF4 A;  1WYC A;  5AQ9 A;  4BQM A;  4LV3 A;  3WS5 A;  4LV1 A;  3C7U A;  5EVL A;  3C5A A;  3V3S A;  4MBH A;  3ZVW A;  1L0D A;  4C3Q A;  4WM9 A;  1ERM A;  2OLV A;  3HLF A;  5U47 A;  1XP4 A;  3E2K A;  1H8Z A;  3NI9 A;  4KZ3 A;  4RVA A;  3MZD A;  1PZP A;  2WAD A;  3V39 A;  3SH7 A;  1PI4 A;  3M6B A;  5CHU A;  1GHM A;  5EVI B;  4WZ4 A;  2H10 A;  1KE0 A;  4S2P A;  4GNU A;  4PM6 A;  4P6B A;  3SH9 A;  4FSF A;  1GA0 A;  4MLL A;  1MBL A;  1DY6 A;  4K91 A;  5HAQ A;  4WMC A;  2Y2H A;  4ID4 A;  4BEN A;  5EUA A;  3UE0 A;  4P0M A;  2FFF B;  5F82 A;  3TSG A;  3ISG A;  3Q7Z A;  1ES2 A;  1YLJ A;  1GHP A;  4ZJ3 A;  3AGE A;  3VP0 A;  1HVB A;  1K4E A;  3E2L A;  3VFF A;  1KE4 A;  1OME A;  2ZC4 B;  3IT9 A;  4D2O A;  5TR7 A;  2EX8 A;  2HDU A;  4YIN A;  1QMF A;  4JKT A;  4E3L A;  1KE3 A;  1L0F A;  1L0E A;  3IHA A;  4S2I A;  5A92 A;  1K56 D;  2ZQ8 A;  2VGJ A;  3OPR A;  3JYI A;  3UDX A;  3ZNY A;  1K4F A;  2Y2J A;  1ZC2 A;  1K57 C;  3UPO A;  4S2M A;  1BLS A;  2RL3 A;  3G31 A;  1ZG6 A;  3WWX A;  3G32 A;  3Q1F A;  2ZJ9 A;  1LL5 A;  1MXO A;  4K0X A;  4CJN A;  1NJ4 A;  4DE0 A;  4E6X A;  5HFO A;  5HAP A;  3N8S A;  4RYE A;  1IYP A;  4U0X A;  3Q82 A;  5GL9 A;  4RX3 A;  3VP4 A;  4IVI A;  5HL1 A;  4WEL A;  2GDN A;  2OSU A;  1E4D A;  4JF5 A;  4X69 A;  1JTG A;  3N8R A;  4GN2 A;  3IF5 A;  5FDH A;  1YLZ A;  2DCF A;  3ZG7 B;  5E2H A;  3MXS A;  1YLT A;  3S22 A;  1PWD A;  3LY4 A;  3HLB A;  2Z2L B;  3GSG A;  3MKF A;  2P9V B;  4DXC A;  4EBL A;  5HAI A;  1J9M A;  3LCE A;  2Q9N A;  2ZC3 B;  4IED A;  1K6R A;  2ZC7 A;  3NC8 A;  3VP2 A;  2WYX A;  3IWI A;  1XX2 A;  5FAS A;  3N6I A;  1MY8 A;  2Z2M B;  3C4O A;  2XR0 A;  1YM1 A;  4LV2 A;  3LEZ A;  4UA6 A;  2XFT A;  4XUX A;  3UY6 A;  4QHC A;  3M6H A;  2WGI A;  4KG5 A;  4ZBE A;  1PI5 A;  5FA7 A;  4GB7 A;  1NYY A;  3UE3 A;  4R23 A;  2WZZ A;  4X68 A;  3PBQ A;  4X55 A;  4KG2 A;  3LO7 A;  5CEB A;  2ZMA A;  5E2E A;  2OV5 A;  2WGW B;  3O3V A;  5CRF A;  4N92 A;  4OPR A;  3ZG8 B;  4RX2 A;  2G2W A;  1SKF A;  4WEJ A;  2R9W A;  2IWD A;  2XLN A;  2BLS A;  1CEF A;  4QY6 A;  2PU4 A;  4PPR A;  3C7V A;  4R4R A;  4Y7P A;  1KDS A;  4JBF A;  2JE5 A;  2Y2K A;  3IWQ A;  1HZO A;  5FI6 A;  4UA9 A;  5HAR A;  3ZFZ A;  1M6K A;  2WGV A;  2EXA A;  3IXH A;  4EBN A;  1SDN A;  4R4S A;  3BFF A;  5GHZ A;  1BT5 A;  1NYM A;  4N9K A;  1NXY A;  3G35 A;  2EXB A;  2B5R A;  4WZ5 A;  3VFH A;  2XGN A;  2ZLY A;  3ITB A;  1K56 A;  2E8I A;  3OCL A;  4M3K A;  3CJM A;  3NY4 A;  4MEZ A;  4Z9Q A;  3VSK A;  2Y2G A;  1NRF A;  4MNR A;  3SOI A;  4KEN B;  3C4P A;  2H0Y A;  3IF6 C;  2QZ6 A;  4KZB A;  4KZ8 A;  1G6A A;  4C75 A;  5KSH A;  3IXD A;  3UO9 A;  2H5S A;  4OKP A;  4OQ0 A;  2XDM A;  1RGY A;  4OQI A;  3Q7V B;  1RP5 A;  2A3U A;  2Y2M A;  1VM1 A;  2Q9M A;  4R0Q A;  1TVF A;  3FV7 A;  3BM6 A;  2Y91 A;  3IWO A;  3SS4 A;  1LI0 A;  4KZ7 A;  2WK0 A;  3G34 A;  3V3R A;  4Y0T A;  1K54 A;  2VGK A;  1BUL A;  1MKI A;  1EWZ A;  2C6W B;  2XF3 A;  4QY5 A;  5AQA A;  1ALQ A;  3ZDJ A;  3IF6 B;  5CGX A;  3FKW A;  4QB8 A;  3IH8 A;  3V5M A;  1FR1 A;  3I7J A;  3MXR A;  4Y0O A;  5EOO A;  1PIO A;  1XKZ A;  4E3K A;  4BL2 A;  3PBT A;  4B4Z A;  2EX6 A;  1E25 A;  1FOF A;  4YFM A;  2V1Z A;  5FI2 A;  4Y0U A;  3VMA A;  3FKV A;  3EQV A;  4OP8 A;  4ZTK A;  3W4O A;  5CGW A;  2P74 A;  2CC1 A;  3OPH A;  4PM7 A;  5M18 A;  1Z6F A;  4HBU A;  3RXW A;  1IYS A;  2V2F F;  2X01 A;  3VSL A;  1BTL A;  4LCM A;  1MWS A;  1IKI A;  4S2N C;  1JTD A;  2OLU A;  3UN7 A;  5L2F A;  1FSY A;  2ZM8 A;  3P98 A;  4JXS A;  3O86 A;  3DW0 A;  3BFD A;  4OOY A;  2PBY A;  3BRM A;  4PMA A;  1K6S A;  5TGF A;  3UE1 A;  4GD6 A;  3TOI A;  1PWC A;  4FCF A;  1E3U D;  1EI5 A;  2J9O A;  5GHX A;  2XEP A;  1LHY A;  1PW1 A;  4ZJ1 A;  4GZB A;  2ZQA A;  3VP3 A;  3ZG9 B;  3DWK A;  4WBG A;  1U60 A;  2XFS A;  5FAQ A;  5DF9 A;  3IH9 A;  3BLS A;  5GLD A;  3IXB A;  2Y2Q A;  3G2Z A;  1FR6 A;  3O87 A;  2PU2 A;  4NET A;  4OVD A;  4HBT A;  3W4Q A;  1Q2P A;  3HLE A;  4ZJ2 A;  3PAE A;  1BLP A;  4DKI A;  5CGS A;  1DJC A;  1IEM A;  4BJP A;  4ZDX A;  4L0L A;  1BLC A;  2J7V A;  5FAP A;  1BZA A;  1CI8 A;  3GV9 A;  4P85 A;  1K57 A;  4X53 A;  2J8Y A;  4FD8 A;  5DTT A;  1JVJ A;  5CER A;  3HBR A;  4UHU A;  3VP1 A;  1YMS A;  2R9X A;  4X6T A;  1MPL A;  5KSC A;  5EOE A;  4S2L A;  1W8Y A;  1G68 A;  3W4P A;  5FQM A;  3HRE A;  3LY3 A;  5FAT A;  5DVA A;  5D3O A;  1YQS A;  3ZHH A;  4KQO A;  2WKI A;  3AGD A;  4DDY A;  3ITA A;  5E2G A;  4GOG A;  1DJB A;  5EVI D;  4JXV A;  4DDS A;  5FQQ A;  4LCL A;  2X71 A;  3PBS A;  4KQR A;  4B88 A;  3NCK A;  4E3N A;  4QU3 A;  1HTZ A;  1TEM A;  2JC7 A;  2WAE A;  4DF6 A;  4O7D A;  4OON A;  2WGW A;  5G18 A;  1PZO A;  1FCM A;  4PM5 A;  4QJG A;  3DTM A;  3CZD A;  4HES A;  5GLC A;  4OQH A;  1TDG A;  4WEK A;  2I72 A;  3FWL A;  5DF7 A;  1I5Q A;  1KGG A;  4C6Y A;  1H5X A;  3NDE A;  1BSG A;  2ZC5 B;  5CXW A;  3O88 A;  1L0G A;  4XUZ A;  5DTK A;  5F83 A;  3SS5 A;  4CPK A;  4DE3 A;  1BLH A;  4EV4 A;  5DF8 A;  4GD8 A;  4E3O A;  1JWP A;  1SCW A;  1E3U A;  2ZM2 A;  4B4X A;  5BOH A;  5GHY A;  2Y2L A;  4P87 A;  2Y2P A;  4OLD A;  5FQK A;  1SDE A;  4KZ5 A;  5EEC A;  2ZD8 A;  2JBF A;  3HLD A;  4IVK A;  1FCO A;  3Q81 A;  4WZ5 C;  4KQQ A;  2HPB A;  1QME A;  3HUM A;  4OPQ A;  3SH8 A;  4FH2 A;  3A3J A;  3DWZ A;  4OOL A;  3ZCZ A;  2Y4A A;  1GCE A;  1Y54 A;  4PM8 A;  2FFY A;  2WZX A;  4E3J A;  2HP5 A;  4S2O A;  4Q8I A;  4E3I A;  4GDN A;  2ZC6 B;  3A3E A;  2XD5 A;  4KG6 A;  2IWB A;  4E3M A;  1GA9 A;  4OLG A;  4EBP A;  4OH0 A;  1IYQ A;  4EWF A;  2RCX A;  1CEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...