4RX3A

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMGTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rx3A00
3GMWA 2P9VA 3DTMA 4BL3A 5EVLA 2ZJ9A 3MZDA 2WAEA 1FQGA 1PWDA 4KZ3A 4MBHA 4DKIA 4R0QA 3VFHA 4KG2A 4C3QA 1ONGA 3HUNA 1QMFA 4U3TA 3SH7A 3WS1A 1NY0A 1N9BA 3IHBA 3NDEA 2WKEA 4RX2A 5CGWA 2ZC6B 5EVIC 5EVIB 4WMCA 5KSCA 1XA1A 4QU3A 3GQZA 3ITAA 4MEZA 5CHJA 5CTNA 1K38A 3W4QA 1SKFA 5A92A 2OLUA 2XFTA 4P0MA 5FQQA 5M18A 3C4OA 4GB7A 3VSKA 3UPPA 4UA9A 4K0XA 3B3XA 1IYQA 4XUXA 5E43A 5E2GA 1G6AA 5HFOA 1E4DA 1W79A 1XGJA 2Y2IA 1Q2PA 5M1AA 5TFQA 2DCFA 1FSYA 1BLPA 2Y4AA 1L2SA 4QY5A 3WS2A 3WS0A 2XH9A 3IF5A 1SDNA 1FSWA 1HTZA 3M6HA 4E3MA 5HAPA 4PM8A 4E3NA 2HDSA 3A3FA 5GHXA 1K54C 2ZLYA 3UDXA 1PW1A 2Y91A 1LL9A 3LY4A 5FI6A 1BULA 3ZNTA 3G31A 1LI0A 5FQJA 1YLYA 2IWBA 1ES4A 2ZC7A 4GD8A 1IKIA 4QY6A 2V1ZA 1O7EA 5AQAA 3OPHA 2Y2JA 4H8RA 1L0GA 1BT5A 4OPQA 4R1GA 2ZC4B 4E3OA 5DF9A 1BTLA 1FCMA 3C7UA 1KGEA 1ES2A 2HPBA 2X71A 4N92A 1EWZA 4EUZA 4XXRA 4U0XA 5FQIA 3MKFA 5FQMA 2Y2NA 2WUQA 2HP5A 1TDGA 2VGKA 4PM7A 3A3DA 4Y7PA 1ZC2A 2J9OA 3IF6A 3IH8A 4YINA 1RGYA 3HLDA 3SH8A 2XD5A 3CZDA 4PM9A 2XR0A 1GHIA 1XPBA 3UNWA 4P87A 1GCEA 3Q1FA 4OOYA 2HDRA 3IWOA 4E3JA 5IHVA 4DF6A 3UN7A 3VMAA 3D4FA 3OCLA 2XEPA 3PAEA 1K6SA 2WYXA 3NBLA 1K57C 3BECA 4JF5A 2DRWA 4RA7A 3SH9A 1S0WA 3Q82A 2HDUA 4ZJ2A 1Z6FA 1I5QA 3ZDJA 3EQUA 2V20A 3IWQA 3FWLA 3M2KA 4GD6A 3BEBA 4JXGA 4S2PA 5FDHA 2IWDA 5EUAA 1CI8A 4EV4A 1K6RA 4BJPA 4OKPA 1YLZA 1MWSA 2G2UA 1G68A 2XDMA 4MLLA 1PWCA 2HDQA 5FAOA 1FCOA 2Y2HA 3Q7VA 4LV0A 1S6RA 4S2KA 4BL2A 2JCHA 4L0LA 1TEMA 4OOLA 4OPYA 3SS4A 4IEDA 2Y2LA 1JTGA 4WELA 1KE4A 1O07A 5U47A 5FI2A 4NK3A 5CECA 1BSGA 1KVLA 5E2FA 4OQIA 4X69A 4LV1A 2EFXA 2R9WA 1HD8A 1CI9A 4GOGA 3NI9A 3Q7ZA 4NETA 1JWVA 4JBFA 5EVIA 4BENA 5EOEA 3EQVA 1KGGA 3VP4A 4KQOA 4DE0A 1LI9A 2H10A 5AQBA 3UE3A 2H0TA 1MKIA 5FAPA 4PMAA 3ITBA 4LV2A 4Y0TA 2WKIA 1NJ4A 5I94A 3BFFA 3NDGA 1MXOA 3P98A 4JF6A 3OCNA 1XP4A 4JXWA 1L0FA 1H8YA 2P74A 3E2KA 3UO9A 4ZDXA 3ZG7B 4P6BA 4DDSA 1J9MA 3MFDA 3GTCA 3HVFA 2BG1A 4GZBA 1E3UD 1MWTA 2I72A 1SCWA 3HLFA 1K54A 2WAFA 4JXVA 3IXGA 4OPRA 3ZVWA 3BM6A 3AGEA 3IQAA 5G18A 2EXAA 4HBTA 4KZ9A 3G2ZA 1NXYA 4U0TA 3VP0A 4BD1A 1HZOA 2EX8A 3RXWA 3ZGAB 2PU2A 3V39A 5DF7A 5TGFA 4PM5A 2RL3A 5L2FA 1MBLA 4OP5A 4KG5A 2ZC3B 5F1GA 5CRFA 4JXSA 2J9PA 4JLFA 1K4FA 1BZAA 4FSFA 5TR7A 3ZG5A 5HAQA 4S2OA 2XFSA 4HEFA 3PBNA 4QJGA 2ZM0A 3IWIA 4KZ5A 4EQIA 3CJMA 5DTSA 4OP8A 4UA7A 1RP5A 3MBZA 3UDFA 3N8LA 3N6IA 2OV5A 3OZHA 4KZ4A 4OVDA 1JVJA 2Q9NA 1M6KA 2Z2LB 3VP2A 3BRMA 1PI4A 1K57A 4LCMA 4B4XA 4OLDA 1IYOA 1QMEA 2ZQ9A 4IBRA 2PBYA 4WMCD 1ERQA 1HVBA 3HREA 2XLNA 4CJNA 3CMZA 1PZPA 4RVAA 2Q9MA 4FCFA 3W4PA 4GDBA 3C5AA 1ESIA 2EX2A 3C4PA 2Y2KA 2QPNA 4IVIA 2ZQDA 4P85A 4DRTA 1W7FA 3ZG9B 5FATA 4S2IA 1H8ZA 1FOFA 4FH2A 2Y2QA 4GDNA 4WM9A 4FD8A 1YM1A 1PIOA 4KZ6A 3ZG8B 1SDEA 4KZ8A 3QHYA 3FYZA 1KE0A 1K56A 2XF3A 3PTEA 4KENB 5J8XA 2XD1A 4X68A 3UPNA 3WWXA 5CHMA 3CG5A 3M2JA 5FA7A 3IXHA 5EECA 1MY8A 2Y2PA 3BLSA 2WK0A 1K25A 4OH0A 3ZCZA 2GDNA 1PZOA 2XGNA 3G32A 3HUMA 4LV3A 2G2WA 4E3LA 5BOHA 4QHCA 2R9XA 3FKVA 3ZHHA 3IHAA 1FCNA 5GHZA 2ZMAA 2J7VA 2C5WB 1YMXA 2FFYA 4N9LA 2ZM8A 3GRJA 5FAQA 3N7WA 3TSGA 3QNCA 3NCKA 1I2WA 5M19A 5CEDA 4OLGA 4ID4A 4B88A 4Y0UA 5FSRA 3O87A 1ERMA 1NRFA 3I7JA 1IELA 3AGDA 5E2EA 1SHVA 5KMWA 3M6BA 1L0EA 2OLVA 1EI5A 1XX2A 4HESA 4WEJA 4M3KA 3IXBA 1XGIA 4ZAMA 1CEGA 4OQHA 1MWUA 4O7DA 3SS3A 3MZEA 3LY3A 3QNBA 4RX3A 2ZC5B 2DNSA 4ZBEA 3PBSA 5KSHA 3FKWA 1MWRA 3VSLA 2WKHA 5DVAA 2WGWA 1XA7A 4UAAA 5D3OA 4S2LA 1PYYA 2ZQ7A 2OSUA 5CHUA 1E3UA 2HP9A 4DDYA 3HLCA 1GHMA 4OOMA 3BYDA 4X56A 3VFFA 4KZ7A 5GLCA 1BUEA 3N8RA 5A91A 4CPKA 2ZQ8A 3MXSA 4KQRA 1L0DA 5GLDA 4A5RA 1AXBA 1JWZA 4LCLA 4EBLA 1DY6A 5CTMA 4GNUA 3G35A 1LHYA 4OQ0A 1CK3A 3NY4A 4E6XA 3NIAA 4QD4A 3VOYA 3TG9A 3PBTA 3O86A 2RCXA 4UHUA 5A90A 1ZG4A 4N1XA 2C6WB 3OC2A 5HW3A 3G34A 3HBRA 2JE5A 1KVMA 2WGWB 4E3KA 3MKEA 2JBFA 4S2NC 4ZJ3A 3PBQA 3HLGA 1CEFA 4GKUA 3GR2A 1DJAA 5EVID 3VOZA 4R4RA 4PM6A 1YMSA 4ZJ1A 1K4EA 1ESUA 2ZQCA 4UA6A 5F82A 3SOIA 4WZ5C 5DF8A 3ZVTA 4FH4A 2J8YA 1N4OA 4IBXA 1NZUA 3IT9A 1VQQA 3AGFA 3ZNYA 1PWGA 3VP3A 4RYEA 5CGXA 2EXBA 1K55C 3Q81A 3LEZA 4K0WA 3ISGA 2A3UA 3FV7A 1BLCA 1NZOA 3N4IA 3S22A 4KQQA 4XUZA 4MNRA 2WGIA 3IH9A 3WS4A 1IYPA 3G4PA 1ZKJA 4WEKA 4Y0OA 1XKZA 1KE3A 4S2MA 1C3BA 3V3SA 1YQSA 1U60A 3C7VA 5E2HA 5FI7A 3P09A 2EX9A 3ZG0A 4ZTKA 4DE3A 4X53A 1LL5A 2X02A 3MXRA 5FQ9A 2A49A 5CXWA 2E8IA 2Y2MA 1IYSA 2EX6A 4Z9QA 3RJUA 2P9VB 4C6YA 4JF4A 3SS5A 3V50A 4F94A 5F1FA 4X6TA 3OPLA 2EFUA 1KDWA 4S2JA 4HBUA 1ONHA 3OPPA 4MBFA 5JYPA 3OPRA 4EBPA 5KZHA 5AQ9A 5FASA 1OMEA 3S4XA 3MZFA 4IVKA 2Y2GA 3GV9A 3G2YA 5GLAA 4DE2A 3HLEA 5GHYA 2QMIA 1GHPA 5AQ7A 2WGVA 2B5RA 5HARA 4DE1A 2XQZA 3DWZA 4B4ZA 5GL9A 4BD0A 4DXCA 3VP1A 3HL9A 1ALQA 2BLSA 3WRTA 2UWXA 3WS5A 1RGZA 3UE1A 1FR6A 1WE4A 1YLJA 3PBOA 4OONA 4R23A 3PAGA 3WRZA 2H5SA 1RCJA 1Y54A 3LO7A 4GN2A 5A93A 1M40A 5DTTA 3UE0A 5EOOA 5HX9A 1JTDA 4LENA 1DJCA 1MPLA 1PW8A 1VM1A 4KZAA 1NYYA 3A3EA 1YT4A 1BLHA 3GSGA 5JYOA 2IWCA 4MBKA 3V5MA 2FFFB 3GVBA 2ZQAA 2VGJA 1DJBA 5DTKA 4KG6A 4N9KA 2PU4A 3BLMA 1Q2QA 2H0YA 4X55A 4EWFA 1FR1A 4R4SA 3O3VA 3RXXA 1GA0A 2V2FF 4WYYA 1PI5A 4Q8IA 2WZZA 1XXMA 1W5DA 1K56D 1TDLA 1W8QA 2XK1A 3BFGA 4YFMA 2ZM2A 1GA9A 5HAIA 5CERA 3FZCA 3ZFZA 4OPZA 1H5XA 1JWPA 3NC8A 4E3IA 3IXDA 4K91A 3N8SA 4S2NA 3IF6B 4PPRA 3IF6C 1YLWA 3BFEA 1I2SA 5CGSA 3DWKA 3TOIA 1WYBA 4EBNA 4KZBA 4WZ5A 2Y2OA 3A3IA 4JPMA 1EROA 5GLBA 3HLBA 3V3RA 1ZG6A 3HUOA 3Q07A 2HP6A 1K55A 1WYCA 2Y59A 3G30A 2CC1A 2ZD8A 3O88A 2WZXA 1W8YA 3DW0A 5HL1A 5EPHA 3BFDA 2X01A 1IKGA 4R3JA 2QZ6A 4C75A 3LCEA 3W8KA 3PBRA 1ES3A 1KGFA 2JC7A 4JKTA 3UY6A 1ES5A 4BQMA 4DXBA 4BLMA 5F83A 1BLSA 3S1YA 5CEBA 1NYMA 1E25A 1YLTA 3UDIA 5FQKA 3W4OA 1IEMA 1LLBA 4R3BA 2WADA 1TVFA 3A3JA 3JYIA 4E6WA 4QB8A 4WBGA 2Y55A 3UPOA 4N1HA 3Q7VB 3E2LA 1KDSA 1YLPA 4OQGA 3BFCA 4WZ4A 2Z2MB 3HLWA 5EE8A 4D2OA
chains in the Genus database with same CATH superfamily
4BL3A 5EVLA 3UB9A 2ZJ9A 4H6JA 4C3QA 1ONGA 3BJNA 5EVIC 1A0KA 4WMCA 5I5LA 5KSCA 4QU3A 4FUWA 2HF6A 3W4QA 2W0NA 5A92A 5EM1A 5HD3A 5FQQA 3TJZC 3VSKA 3UPPA 4K0XA 1DP9A 3EWKA 5HFOA 3WS2A 2Y4AA 4QY5A 2VJWA 2W3DA 4KUKA 4PM8A 2HDSA 3A3FA 2GX5A 3HCYA 1LL9A 5FI6A 1BULA 5F69A 5FQJA 5AQAA 2ZC7A 1IKIA 2V1ZA 4R70A 4F3LB 3OPHA 2K2NA 4H8RA 1OT9A 1BT5A 1FCMA 4UQIS 1ES2A 4EUZA 4XXRA 3R7WA 5FQIA 3MKFA 5FQMA 2VGKA 1TDGA 3EGDC 3T50A 2OWJA 1RGYA 2XD5A 1GHIA 3K3DA 4P87A 1GCEA 3Q1FA 4UEYA 2HDRA 4DF6A 2V0UA 3UN7A 3D4FA 3MFXA 3PAEA 1K6SA 3NBLA 4YOFA 3SH9A 3Q82A 2V20A 3PR6A 3IWQA 4HJ6A 4EV4A 3VE3A 3FPWA 1T18A 2XDMA 4MLLA 1PWCA 2HDQA 5FAOA 4S2KA 4BL2A 2JCHA 3SS4A 3ZQ5A 1JTGA 2J3TC 1KE4A 5U47A 1NRJA 4NK3A 2PHYA 3T12B 5CECA 4G3WA 4Y3IA 1HD8A 1JWVA 2ZOHA 4BENA 1KGGA 3VP4A 2H10A 4PKYG 2ZBBA 3ITBA 3JPUA 2JN7A 3P98A 2EA9A 2HJ9C 2JKFA 3HVFA 1E3UD 2I72A 1SCWA 3HLFA 2CMNA 1K54A 3ZVWA 2NUTC 3BY9A 1MC0A 3IQAA 4HBTA 3G2ZA 3UB8A 1HZOA 5TGFA 5L2FA 4KG5A 2ZC3B 3UMDA 1VEUA 5TR7A 4QJGA 2ZM0A 3IWIA 1RP5A 2I9VA 2OV5A 2ZMFA 3VP2A 4B4XA 1MZUA 2WKPA 1QMEA 2PBYA 1OTAA 2ACGA 5IU1A 2Q9MA 5HDSA 4GDBA 3C5AA 1ESIA 2QPNA 4P85A 1OT6A 1YM1A 1PIOA 4KZ6A 1K56A 3CPTB 4KENB 5CHMA 5FA7A 2WK0A 2XGNA 3HUMA 5BOHA 4QHCA 3ZHHA 3GECA 3HJIA 1YMXA 2FFYA 2ZM8A 3TSGA 3NCKA 1I2WA 4OLGA 3O87A 1ERMA 3I7JA 1IELA 3AGDA 5E2EA 1G5UA 5KMWA 3M6BA 1EI5A 4HESA 2FZ0A 3MXQA 5A8BA 3MQQA 4O7DA 5L07A 3SS3A 3LY3A 3QNBA 4RX3A 2DNSA 3VSLA 2WKHA 2WGWA 3H9WA 2ZQ7A 3NOUC 3MJQA 2V0WA 4IUKA 3BYDA 4LRYC 5GLCA 5DKKA 1CK3A 2A24B 3LI8A 3NIAA 1OTEA 4UHUA 4N1XA 3OC2A 2A2LA 3G34A 2JE5A 1KVMA 4E3KA 3MKEA 2JBFA 3PBQA 2O99A 3HLGA 4FTXA 3GR2A 1DJAA 4GKUA 4R4RA 4UA6A 1ESUA 2ZQCA 3IBJA 5DF8A 2J8YA 2NUPC 2QYBA 3VP3A 5FL3A 4RYEA 5CGXA 3Q81A 1JNUA 3LEZA 4EQ1A 1K0KA 2A3UA 3PHYA 2OWHA 1NZOA 3VE4A 3N4IA 4XUZA 4MNRA 2QJ5A 2WGIA 3LEQA 3LIEA 1HLUP 3C7VA 4MN6A 4WL9A 2V8CA 4DE3A 1LL5A 3EEAA 3MXRA 3CUEA 5DKLA 2O9AA 2XA7S 2EX6A 3RJUA 3SS5A 3LUQA 4H6JB 1ACFA 5F1FA 4P6ZS 4X6TA 1KDWA 5KZHA 3OPRA 4EBPA 5FASA 4IVKA 4GS9A 2K7SA 4EERA 4Q0JA 3QP1A 2QMIA 1GHPA 5AQ7A 5HARA 2XQZA 4B4ZA 5GL9A 2PR5A 4BD0A 3ICYA 4HH2A 4ARZA 1WE4A 2UV0E 3LO7A 1M40A 5DTTA 1JTDA 2BTFP 1MPLA 1YT4A 2B18A 2WKRA 3GSGA 5JYOA 2IWCA 5EFWA 1XJ6A 1DJBA 4N9KA 3BLMA 1XJ4A 3LFVA 3O3VA 4WYYA 5F6AA 1TDLA 1W8QA 2XK1A 3BFGA 1CJFA 3R7WB 4S2NA 2L1MA 5CGSA 1YLWA 5HWVA 5EV0A 3HLBA 1ZG6A 1WYCA 3NJAA 5MC7A 1N9LA 3W8KA 1ES3A 1KGFA 4BLMA 5L8MA 3S7PA 5CEBA 1YLTA 3KYEA 4JGQA 2WADA 1F5MA 3A3JA 2Y55A 1KDSA 4OQGA 1FILA 2Z2MB 3GMWA 3BW6A 4KZ3A 3FG8A 4MBHA 4DKIA 3WS1A 3HUNA 1QMFA 3SH7A 3IHBA 3F1OA 2ZC6B 3QP2A 3C38A 3GQZA 5CHJA 5CTNA 4GCZA 2OLUA 3HJKA 2W1TB 3E4PA 2Y79A 4ME4A 3B3XA 1IYQA 5C5KA 5E43A 3R4KA 1W79A 4EESA 1Q2PA 4X1MA 5M1AA 3OOVA 1L2SA 2VEAA 1SDNA 1FSWA 3M6HA 1VB6A 2HGVA 4JGPA 5F68A 2Y91A 1SKOA 1UGUA 3ZNTA 1ES4A 4DJ2A 2Y2JA 1BTLA 3C7UA 2LB9A 1VEUB 3V67A 1YPRA 2PDRA 2Y2NA 1S1YA 4PM7A 3A3DA 3IF6A 3HLDA 3IX3A 4X25A 3LYXA 2PAVP 3IWOA 4E3JA 5IHVA 4EEUA 1YAXA 3RTYA 2GJ3A 2PYRA 4JF5A 2DRWA 3ZDJA 3U4LP 3EQUA 5G4ZA 2JKGA 3M2KA 3BEBA 4S2PA 1YSQA 3UMEA 4BJPA 1YLZA 2G2UA 4DMZA 4OOLA 4IEDA 3TE8A 1O07A 5FI2A 1BSGA 3KO6A 2P7JA 5E2FA 2WKQA 2EFXA 1CI9A 3NI9A 2VV7A 3H82A 3EQVA 4KQOA 1S4SA 5AQBA 3UE3A 3P7NA 4PMAA 3NULA 3BQAA 4I3IA 3NDGA 4JF6A 3E2KA 1XFQA 3MFDA 3LR5A 2V9AA 3T4JA 4EXOA 4JXVA 3BM6A 3AGEA 5G18A 2EXAA 1XJ3A 5HWWA 1NXYA 3LI9A 5AVFA 3CLOA 2PU2A 3V39A 3QP5A 4PM5A 1MBLA 4OP5A 4ESPA 4I3AA 4JXSA 4MN5A 5FEFA 3E4QA 1BZAA 3JVVA 3MMHA 3PBNA 1S66L 4EQIA 5DTSA 4UA7A 5DJUA 3MBZA 3P01A 2Q9NA 2Z2LB 3BRMA 1K57A 4GHIA 1IYOA 4IBRA 4L9EA 1G6OA 3HREA 4HQAA 4R3AA 3MR0A 3LIFA 1PZPA 4HP9A 4Q0IA 2EX2A 3C4PA 4DRTA 1W7FA 3ZG9B 3LR4A 1H8ZA 1FOFA 4GDNA 4FD8A 2ZOIA 3NOPC 3ZG8B 2QHKA 4DN0A 3QHYA 1DP8A 2IA2A 2KLIA 3PTEA 4HJ3A 4I5SA 2XD1A 5J8XA 2AVXA 4X68A 3IXHA 3FC7A 1MY8A 4OH0A 1PZOA 3G32A 4E3LA 3IHAA 1FCNA 2C5WB 4N9LA 3GRJA 5FAQA 1XFNA 2E8JA 3KX0X 4Y0UA 4GS9B 1NRFA 1SHVA 1L0EA 2OLVA 2J80A 4ARZB 1YSPA 2ZC5B 5KSHA 3B42A 4S2LA 3SZTA 2HP9A 4CLCC 1LSVA 4OOMA 2VZWA 4X56A 1IOUA 3KYZA 1UWPX 1T19A 5A91A 1P0ZA 2ZQ8A 3T1RA 2OAQ1 3MXSA 5GLDA 5J4EA 4A5RA 1DY6A 4GW9A 3CWFA 1LHYA 4QD4A 3VOYA 3PBTA 1ZG4A 2Z6DA 1D7EA 3HBRA 2PYPA 4LPZA 5EVID 2ZL1A 4PAUA 1SZVA 4PM6A 4ZJ1A 3SOIA 3EOIA 1N4OA 2MJ6A 3AGFA 3H7WA 1PWGA 3ZNYA 1K55C 3S7OA 4Z1WA 4AFIA 2YKFA 2FH5A 2QWSA 1IYPA 3LICA 1ZKJA 4WEKA 4Y0OA 4XT2B 1KE3A 3S7QA 2ZMVA 3V3SA 3P09A 2EX9A 4NXEA 3ZG0A 4ZTKA 4X53A 5J3WA 4IJGA 4C6YA 4JF4A 2LB5A 1TF1A 4BBUA 3OPPA 4MBFA 3F1OB 2Y2GA 3G2YA 2WGVA 2B5RA 3DWZA 3S7NA 2W27A 1OTDA 1L3LA 1D06A 1RGZA 2KOIA 3D72A 3UE1A 3T1XA 1Y54A 4GN2A 4WN5A 4HJ4A 5EOOA 4LENA 4KZAA 1VM1A 1NYYA 3A3EA 1BLHA 1SKOB 3V5MA 2FFFB 1NWZA 3CI6A 2ZQAA 2VGJA 5DTKA 4ETXA 5HL6A 2H0YA 4EWFA 3RXXA 1PI5A 2WZZA 2J3TD 3C2WA 4CQHA 3D9YA 3FZCA 4OPZA 1H5XA 1JWPA 3NC8A 3IXDA 4K91A 3IF6B 1I2SA 1LSWA 4WZ5A 4D60A 2Y2OA 4O01A 5GLBA 1KOUA 3Q07A 3G30A 2ZD8A 1W8YA 1Y28A 4DJ3A 1IKGA 4C75A 4JKTA 4BQMA 3W2ZA 3UB6A 1E25A 4I39A 1WA9A 3OBFA 3UE6A 3W4OA 4R3BA 4NKPA 3JYIA 4WBGA 1ODVA 3BFCA 2KDKA 5EE8A 2HJEA 3QP8A 3DTMA 4NG2A 3MZDA 1PWDA 1IFQA 3E0YA 4KG2A 1NY0A 1N9BA 5M18A 1XA1A 3H82B 1W63M 4P0MA 3C4OA 3T4SA 4UA9A 3T4LA 4XUXA 4JGRA 4Y5FA 3L9KA 1CQAA 5TFQA 2DCFA 2H28A 3IF5A 1HTZA 1PNEA 1TS7A 1K54C 2D02A 3UDXA 3LY4A 3G31A 1LI0A 1YLYA 2IWBA 4GD8A 4QY6A 1O7EA 1L0GA 4R1GA 4E3OA 4KUOA 1KGEA 2HPBA 4N92A 4U0XA 1S67L 2WUQA 1ZC2A 2J9OA 3IH8A 3SH8A 4YINA 3CZDA 4PM9A 2XR0A 3RFBA 4L9FA 2XEPA 1T1BA 2WYXA 4ZJ2A 1Z6FA 1I5QA 4KQDA 3FWLA 3LIAA 1BYWA 4GD6A 4JXGA 5FDHA 1CI8A 5LBRA 1CF0A 1F9IA 1MWSA 3MSHA 3KSHA 2Y2HA 3EGXC 3Q7VA 4L0LA 1TEMA 1VETA 1ZHHB 4CLCE 2Y2LA 3F1PA 3CHWP 4HHDA 3B33A 1KVLA 4X69A 3Q7ZA 4JBFA 5EVIA 2M1CA 5EOEA 1LI9A 2H0TA 3CAXA 3IX8A 1H3QA 5FAPA 1NJ4A 5I94A 2W3HA 3BFFA 3BQ8A 1L0FA 3T4QA 1GSWA 4ZDXA 4P6BA 4DDSA 1J9MA 3E4OA 2BG1A 5HD5A 4E04A 4KZ9A 3VP0A 4BD1A 2EX8A 3ZGAB 2O0YA 2JKTM 1LT0A 5CRFA 4JLFA 1K4FA 4FSFA 4NXGA 1AWIA 5HAQA 2XFSA 4WLAA 4HEFA 2B95A 2JKRM 2L0WA 4G3VA 3SW1A 2YKHA 1J3WA 4LGWA 3UDFA 4NXBA 3N8LA 3A0RA 4HIAA 4OVDA 1M6KA 1T1AA 3LIBA 1G28A 1PI4A 4LCMA 1PFLA 3LIDA 2ZQ9A 2ZL1B 1PRQA 1ERQA 1HVBA 4R38A 2VK3A 4CJNA 4HH3A 4RVAA 3VOLA 3W4PA 3H7WB 4IVIA 2ZQDA 3JVUA 4MCWA 4S2IA 2KX6A 4FH2A 2Y2QA 4WUJA 1SDEA 4KZ8A 5AVEA 3FYZA 2XF3A 2M7VA 2W3GA 4BWIA 2VKSA 3WWXA 3CG5A 4FOFA 3TRCA 2GDNA 3IX4A 3CUEC 4LFUA 2G2WA 2R9XA 3FKVA 2Q0OA 5GHZA 4CLCA 2J7VA 2XROA 3QNCA 3A0VA 2PD8A 5CEDA 4ID4A 4HNBA 4B88A 4Y17A 5G4YA 4MN7A 4M3KA 1NLZA 2A24A 4OQHA 2K31A 2DMWA 3DAVA 3PBSA 4II7A 3FKWA 1MWRA 5DVAA 1XA7A 3IBRA 4UAAA 5D3OA 1PYYA 5CHUA 4M4XA 4DDYA 1GHMA 4G3KA 1NLYA 4KZ7A 4CPKA 2W1RA 1L0DA 4KQRA 1AXBA 3BWLA 4LCLA 5CTMA 4GNUA 4B9OA 1UWNX 4OQ0A 3TG9A 3B47A 2RCXA 5A90A 1V9ZA 4QPRA 5HW3A 2WGWB 3DTEA 4S2NC 5HDDA 4ZJ3A 1CEFA 1YMSA 5F82A 2J3WA 1NZUA 3IT9A 1VQQA 1EW0A 4HY8A 1BLCA 3F1NA 1STZA 4BBVA 5HDCA 5L10A 3WS4A 3G4PA 5TBMA 1XKZA 1YKDA 4S2MA 2V1AA 1YQSA 1U60A 2HV1A 5CXWA 5HZHA 4F94A 3OPLA 2EFUA 4S2JA 2INWA 2PT7A 5AQ9A 1S1ZA 1OMEA 1ZTUA 2PD7A 5GHYA 3KSFA 4L9GA 3K2NA 2VGLM 4YWZA 3FPVA 2VX8A 2W3EA 1N9OA 2QJ7A 3HL9A 1ALQA 3VP1A 3WRTA 2B02A 2P08A 3PBOA 2XSSA 2Y8HA 1RCJA 3KYQA 5A93A 5FDSA 3RH8B 3T4KA 1DJCA 1PW8A 4MBKA 4NEED 3GVBA 4KG6A 3PYPA 4RQ9A 1FR1A 4Q8IA 1W63Q 1GA0A 2V2FF 5EM0A 1W5DA 1VHMA 4Q0HA 5CERA 1F98A 3IF6C 3BFEA 3LR0A 2PRFA 3TOIA 1WYBA 4EBNA 2L4RA 4QWOA 4JPMA 1EROA 4GLQA 3HUOA 3DTKA 2Y59A 3O88A 5HL1A 4IHQA 2QZ6A 3LCEA 2JC7A 3UY6A 4O0PA 2VV8A 5CX7A 5F83A 3S1YA 2W1TA 3UDIA 5FQKA 3UPOA 4E6WA 4NXFA 3Q7VB 3E2LA 5J7EA 5AJGA 1VETB 3HLWA 3F1PB 1DRMA 2P9VA 3QP4A 2WAEA 1GSXA 1FQGA 3TW8A 4R0QA 3GDIA 3VFHA 4U3TA 5FEGA 1X0OA 4RX2A 3NDEA 3ULFA 5CGWA 2WKEA 5EVIB 2HZ5A 3ITAA 4MEZA 5HSQA 3MQ0A 1K38A 1SKFA 2XFTA 3T4TA 4GB7A 4I38A 3EEHA 4EEPA 5E2GA 2VV6A 1G6AA 4YNRA 3QP6A 1E4DA 1XGJA 2Y2IA 4UQIM 1OTIA 1FSYA 1BLPA 3WS0A 2XH9A 4E3MA 5HAPA 1F2KA 4E3NA 5GHXA 4HP4A 3DTIA 2ZLYA 1PW1A 4HI4A 3IS2A 1Y4OA 3PXPA 5K5BA 4OPQA 2ZC4B 5DF9A 3E98A 2OOLA 2X71A 1EWZA 3LGOA 1XJ2A 2HP5A 4Y7PA 4JGOA 1TS8A 1XPBA 3UNWA 4OOYA 3VMAA 3BY8A 3OCLA 3CITA 2XRNA 1K57C 3BECA 4RA7A 4MDZA 1S0WA 2HDUA 2D01A 5HPIA 2IWDA 5EUAA 2OAP1 1K6RA 4OKPA 4EETB 1G68A 1FCOA 2M7UA 4LV0A 1S6RA 4OPYA 4WELA 5EVEA 4Y13A 4CLCD 4OQIA 4LV1A 2R9WA 4GOGA 4NETA 2V1BA 4EU0A 4DE0A 4CLCB 4O8GA 1MKIA 4LV2A 4Y0TA 2WKIA 1MXOA 4JXWA 3OCNA 1XP4A 1H8YA 2P74A 3UO9A 3ZG7B 3GTCA 3UB5P 4GZBA 5HWTA 1MWTA 3L7HA 3KSGA 2WAFA 3IXGA 4OPRA 2EWVA 2O9BA 3OLOA 1OJGA 4U0TA 3RXWA 4F3LA 5DF7A 2RL3A 3MS6A 5KIZA 5F1GA 2J9PA 4PHTA 3ZG5A 4S2OA 4KZ5A 3CJMA 4OP8A 4GJ4A 4R6LA 4WF0A 2Z6CA 3N6IA 3OZHA 4KZ4A 1JVJA 4OLDA 2W3FA 4MMNA 4WMCD 5IT5A 2XLNA 3CMZA 4FCFA 2GNXA 4HOIA 2Y2KA 5FATA 3F1NB 4WM9A 1KE0A 4ZRRA 3U2AA 5TBMB 1H0MA 3K3CA 3UPNA 2EWWA 3M2JA 5EECA 2Y2PA 3ZYTA 4LRXC 3BLSA 1TS0A 4GHIB 1K25A 1FIKA 3ZCZA 2G7UA 5DJTA 4BBTA 4LV3A 4K08A 3MF0A 4Y15A 2ZMAA 3N7WA 2O9CA 5M19A 5FSRA 2GZAA 1LL8A 1OJ5A 4EUVA 1XX2A 4WEJA 1LSXA 1OPXA 3IXBA 1XGIA 5DFYA 3NHQA 4BMWA 4ZAMA 1CEGA 1DP6A 1MWUA 3MZEA 4ZBEA 2P04A 4X1LA 2OSUA 1E3UA 1P9RA 3HLCA 4PKYA 4EW7A 3G6OA 3VFFA 1BUEA 3N8RA 5HPFA 5L09A 3NOTC 3KSIA 5F5YA 1P9WA 1JWZA 4EBLA 3G35A 3NY4A 4E6XA 3T4OA 3O86A 4XT2A 2C6WB 3C8CA 3T1SA 3A0SA 3VOZA 3C30A 1K4EA 2PBDP 4WZ5C 3ZVTA 4FH4A 2XA7M 4IBXA 1GSVA 2EXBA 2PR6A 4K0WA 3ISGA 4P6ZM 3FV7A 1D1JA 3S22A 4KQQA 1TD5A 3IH9A 3CPTA 1C3BA 4LLOB 5E2HA 5FI7A 1N9NA 5TJJA 2X02A 5FQ9A 1TS6A 2A49A 2E8IA 2Y2MA 1IYSA 3D3OA 4Z9QA 3O5YA 2P9VB 3V50A 4ETZA 3NECA 4HBUA 1ONHA 5JYPA 3T1QB 3S4XA 3MZFA 3GV9A 5GLAA 4DE2A 3HLEA 3UB7A 4DE1A 2JHEA 1S4RA 2QKPA 4DXCA 2BLSA 2UWXA 3WS5A 1FR6A 1YLJA 5IS1A 4OONA 3MQOA 4R23A 3PAGA 3WRZA 2H5SA 3UE0A 4LRZE 5HX9A 1H8MA 3IS2B 2BASA 4I3JA 2PU4A 1Q2QA 2VGLS 4X55A 4R4SA 1XXMA 1K56D 2V8FA 4YFMA 2JKTI 2R78A 2ZM2A 1GA9A 5HAIA 1MKMA 2VLGA 3ZFZA 1V9YA 1OTBA 1Z09A 4E3IA 3N8SA 4PPRA 2JKRI 3DWKA 1P97A 4KZBA 5DFXA 3A3IA 4Y2FA 3V3RA 4B93A 2HP6A 1K55A 2CC1A 1T1CA 2WZXA 3DBAA 3DW0A 4IUHA 5EPHA 3BFDA 2X01A 4R3JA 3VV4A 3PBRA 1ES5A 4DXBA 3LR3A 1BLSA 1NYMA 1IEMA 1LLBA 1TVFA 4QB8A 4N1HA 1YLPA 4WZ4A 2VA0A 4D2OA
chains in the Genus database with same CATH topology
3GMWA 2P9VA 3DTMA 4BL3A 5EVLA 2ZJ9A 3MZDA 2WAEA 1FQGA 1PWDA 4KZ3A 4MBHA 4DKIA 4R0QA 3VFHA 4KG2A 4C3QA 1ONGA 3HUNA 1QMFA 4U3TA 3SH7A 3WS1A 1NY0A 1N9BA 3IHBA 3NDEA 2WKEA 4RX2A 5CGWA 2ZC6B 5EVIC 5EVIB 4WMCA 5KSCA 1XA1A 4QU3A 3GQZA 3ITAA 4MEZA 5CHJA 5CTNA 1K38A 3W4QA 1SKFA 5A92A 2OLUA 2XFTA 4P0MA 5FQQA 5M18A 3C4OA 4GB7A 3VSKA 3UPPA 4UA9A 4K0XA 3B3XA 1IYQA 4XUXA 5E43A 5E2GA 1G6AA 5HFOA 1E4DA 1W79A 1XGJA 2Y2IA 1Q2PA 5M1AA 5TFQA 2DCFA 1FSYA 1BLPA 2Y4AA 1L2SA 4QY5A 3WS2A 3WS0A 2XH9A 3IF5A 1SDNA 1FSWA 1HTZA 3M6HA 4E3MA 5HAPA 4PM8A 4E3NA 2HDSA 3A3FA 5GHXA 1K54C 2ZLYA 3UDXA 1PW1A 2Y91A 1LL9A 3LY4A 5FI6A 1BULA 3ZNTA 3G31A 1LI0A 5FQJA 1YLYA 2IWBA 1ES4A 2ZC7A 4GD8A 1IKIA 4QY6A 2V1ZA 1O7EA 5AQAA 3OPHA 2Y2JA 4H8RA 1L0GA 1BT5A 4OPQA 4R1GA 2ZC4B 4E3OA 5DF9A 1BTLA 1FCMA 3C7UA 1KGEA 1ES2A 2HPBA 2X71A 4N92A 1EWZA 4EUZA 4XXRA 4U0XA 5FQIA 3MKFA 5FQMA 2Y2NA 2WUQA 2HP5A 1TDGA 2VGKA 4PM7A 3A3DA 4Y7PA 1ZC2A 2J9OA 3IF6A 3IH8A 4YINA 1RGYA 3HLDA 3SH8A 2XD5A 3CZDA 4PM9A 2XR0A 1GHIA 1XPBA 3UNWA 4P87A 1GCEA 3Q1FA 4OOYA 2HDRA 3IWOA 4E3JA 5IHVA 4DF6A 3UN7A 3VMAA 3D4FA 3OCLA 2XEPA 3PAEA 1K6SA 2WYXA 3NBLA 1K57C 3BECA 4JF5A 2DRWA 4RA7A 3SH9A 1S0WA 3Q82A 2HDUA 4ZJ2A 1Z6FA 1I5QA 3ZDJA 3EQUA 2V20A 3IWQA 3FWLA 3M2KA 4GD6A 3BEBA 4JXGA 4S2PA 5FDHA 2IWDA 5EUAA 1CI8A 4EV4A 1K6RA 4BJPA 4OKPA 1YLZA 1MWSA 2G2UA 1G68A 2XDMA 4MLLA 1PWCA 2HDQA 5FAOA 1FCOA 2Y2HA 3Q7VA 4LV0A 1S6RA 4S2KA 4BL2A 2JCHA 4L0LA 1TEMA 4OOLA 4OPYA 3SS4A 4IEDA 2Y2LA 1JTGA 4WELA 1KE4A 1O07A 5U47A 5FI2A 4NK3A 5CECA 1BSGA 1KVLA 5E2FA 4OQIA 4X69A 4LV1A 2EFXA 2R9WA 1HD8A 1CI9A 4GOGA 3NI9A 3Q7ZA 4NETA 1JWVA 4JBFA 5EVIA 4BENA 5EOEA 3EQVA 1KGGA 3VP4A 4KQOA 4DE0A 1LI9A 2H10A 5AQBA 3UE3A 2H0TA 1MKIA 5FAPA 4PMAA 3ITBA 4LV2A 4Y0TA 2WKIA 1NJ4A 5I94A 3BFFA 3NDGA 1MXOA 3P98A 4JF6A 3OCNA 1XP4A 4JXWA 1L0FA 1H8YA 2P74A 3E2KA 3UO9A 4ZDXA 3ZG7B 4P6BA 4DDSA 1J9MA 3MFDA 3GTCA 3HVFA 2BG1A 4GZBA 1E3UD 1MWTA 2I72A 1SCWA 3HLFA 1K54A 2WAFA 4JXVA 3IXGA 4OPRA 3ZVWA 3BM6A 3AGEA 3IQAA 5G18A 2EXAA 4HBTA 4KZ9A 3G2ZA 1NXYA 4U0TA 3VP0A 4BD1A 1HZOA 2EX8A 3RXWA 3ZGAB 2PU2A 3V39A 5DF7A 5TGFA 4PM5A 2RL3A 5L2FA 1MBLA 4OP5A 4KG5A 2ZC3B 5F1GA 5CRFA 4JXSA 2J9PA 4JLFA 1K4FA 1BZAA 4FSFA 5TR7A 3ZG5A 5HAQA 4S2OA 2XFSA 4HEFA 3PBNA 4QJGA 2ZM0A 3IWIA 4KZ5A 4EQIA 3CJMA 5DTSA 4OP8A 4UA7A 1RP5A 3MBZA 3UDFA 3N8LA 3N6IA 2OV5A 3OZHA 4KZ4A 4OVDA 1JVJA 2Q9NA 1M6KA 2Z2LB 3VP2A 3BRMA 1PI4A 1K57A 4LCMA 4B4XA 4OLDA 1IYOA 1QMEA 2ZQ9A 4IBRA 2PBYA 4WMCD 1ERQA 1HVBA 3HREA 2XLNA 4CJNA 3CMZA 1PZPA 4RVAA 2Q9MA 4FCFA 3W4PA 4GDBA 3C5AA 1ESIA 2EX2A 3C4PA 2Y2KA 2QPNA 4IVIA 2ZQDA 4P85A 4DRTA 1W7FA 3ZG9B 5FATA 4S2IA 1H8ZA 1FOFA 4FH2A 2Y2QA 4GDNA 4WM9A 4FD8A 1YM1A 1PIOA 4KZ6A 3ZG8B 1SDEA 4KZ8A 3QHYA 3FYZA 1KE0A 1K56A 2XF3A 3PTEA 4KENB 5J8XA 2XD1A 4X68A 3UPNA 3WWXA 5CHMA 3CG5A 3M2JA 5FA7A 3IXHA 5EECA 1MY8A 2Y2PA 3BLSA 2WK0A 1K25A 4OH0A 3ZCZA 2GDNA 1PZOA 2XGNA 3G32A 3HUMA 4LV3A 2G2WA 4E3LA 5BOHA 4QHCA 2R9XA 3FKVA 3ZHHA 3IHAA 1FCNA 5GHZA 2ZMAA 2J7VA 2C5WB 1YMXA 2FFYA 4N9LA 2ZM8A 3GRJA 5FAQA 3N7WA 3TSGA 3QNCA 3NCKA 1I2WA 5M19A 5CEDA 4OLGA 4ID4A 4B88A 4Y0UA 5FSRA 3O87A 1ERMA 1NRFA 3I7JA 1IELA 3AGDA 5E2EA 1SHVA 5KMWA 3M6BA 1L0EA 2OLVA 1EI5A 1XX2A 4HESA 4WEJA 4M3KA 3IXBA 1XGIA 4ZAMA 1CEGA 4OQHA 1MWUA 4O7DA 3SS3A 3MZEA 3LY3A 3QNBA 4RX3A 2ZC5B 2DNSA 4ZBEA 3PBSA 5KSHA 3FKWA 1MWRA 3VSLA 2WKHA 5DVAA 2WGWA 1XA7A 4UAAA 5D3OA 4S2LA 1PYYA 2ZQ7A 2OSUA 5CHUA 1E3UA 2HP9A 4DDYA 3HLCA 1GHMA 4OOMA 3BYDA 4X56A 3VFFA 4KZ7A 5GLCA 1BUEA 3N8RA 5A91A 4CPKA 2ZQ8A 3MXSA 4KQRA 1L0DA 5GLDA 4A5RA 1AXBA 1JWZA 4LCLA 4EBLA 1DY6A 5CTMA 4GNUA 3G35A 1LHYA 4OQ0A 1CK3A 3NY4A 4E6XA 3NIAA 4QD4A 3VOYA 3TG9A 3PBTA 3O86A 2RCXA 4UHUA 5A90A 1ZG4A 4N1XA 2C6WB 3OC2A 5HW3A 3G34A 3HBRA 2JE5A 1KVMA 2WGWB 4E3KA 3MKEA 2JBFA 4S2NC 4ZJ3A 3PBQA 3HLGA 1CEFA 4GKUA 3GR2A 1DJAA 5EVID 3VOZA 4R4RA 4PM6A 1YMSA 4ZJ1A 1K4EA 1ESUA 2ZQCA 4UA6A 5F82A 3SOIA 4WZ5C 5DF8A 3ZVTA 4FH4A 2J8YA 1N4OA 4IBXA 1NZUA 3IT9A 1VQQA 3AGFA 3ZNYA 1PWGA 3VP3A 4RYEA 5CGXA 2EXBA 1K55C 3Q81A 3LEZA 4K0WA 3ISGA 2A3UA 3FV7A 1BLCA 1NZOA 3N4IA 3S22A 4KQQA 4XUZA 4MNRA 2WGIA 3IH9A 3WS4A 1IYPA 3G4PA 1ZKJA 4WEKA 4Y0OA 1XKZA 1KE3A 4S2MA 1C3BA 3V3SA 1YQSA 1U60A 3C7VA 5E2HA 5FI7A 3P09A 2EX9A 3ZG0A 4ZTKA 4DE3A 4X53A 1LL5A 2X02A 3MXRA 5FQ9A 2A49A 5CXWA 2E8IA 2Y2MA 1IYSA 2EX6A 4Z9QA 3RJUA 2P9VB 4C6YA 4JF4A 3SS5A 3V50A 4F94A 5F1FA 4X6TA 3OPLA 2EFUA 1KDWA 4S2JA 4HBUA 1ONHA 3OPPA 4MBFA 5JYPA 3OPRA 4EBPA 5KZHA 5AQ9A 5FASA 1OMEA 3S4XA 3MZFA 4IVKA 2Y2GA 3GV9A 3G2YA 5GLAA 4DE2A 3HLEA 5GHYA 2QMIA 1GHPA 5AQ7A 2WGVA 2B5RA 5HARA 4DE1A 2XQZA 3DWZA 4B4ZA 5GL9A 4BD0A 4DXCA 3VP1A 3HL9A 1ALQA 2BLSA 3WRTA 2UWXA 3WS5A 1RGZA 3UE1A 1FR6A 1WE4A 1YLJA 3PBOA 4OONA 4R23A 3PAGA 3WRZA 2H5SA 1RCJA 1Y54A 3LO7A 4GN2A 5A93A 1M40A 5DTTA 3UE0A 5EOOA 5HX9A 1JTDA 4LENA 1DJCA 1MPLA 1PW8A 1VM1A 4KZAA 1NYYA 3A3EA 1YT4A 1BLHA 3GSGA 5JYOA 2IWCA 4MBKA 3V5MA 2FFFB 3GVBA 2ZQAA 2VGJA 1DJBA 5DTKA 4KG6A 4N9KA 2PU4A 3BLMA 1Q2QA 2H0YA 4X55A 4EWFA 1FR1A 4R4SA 3O3VA 3RXXA 1GA0A 2V2FF 4WYYA 1PI5A 4Q8IA 2WZZA 1XXMA 1W5DA 1K56D 1TDLA 1W8QA 2XK1A 3BFGA 4YFMA 2ZM2A 1GA9A 5HAIA 5CERA 3FZCA 3ZFZA 4OPZA 1H5XA 1JWPA 3NC8A 4E3IA 3IXDA 4K91A 3N8SA 4S2NA 3IF6B 4PPRA 3IF6C 1YLWA 3BFEA 1I2SA 5CGSA 3DWKA 3TOIA 1WYBA 4EBNA 4KZBA 4WZ5A 2Y2OA 3A3IA 4JPMA 1EROA 5GLBA 3HLBA 3V3RA 1ZG6A 3HUOA 3Q07A 2HP6A 1K55A 1WYCA 2Y59A 3G30A 2CC1A 2ZD8A 3O88A 2WZXA 1W8YA 3DW0A 5HL1A 5EPHA 3BFDA 2X01A 1IKGA 4R3JA 2QZ6A 4C75A 3LCEA 3W8KA 3PBRA 1ES3A 1KGFA 2JC7A 4JKTA 3UY6A 1ES5A 4BQMA 4DXBA 4BLMA 5F83A 1BLSA 3S1YA 5CEBA 1NYMA 1E25A 1YLTA 3UDIA 5FQKA 3W4OA 1IEMA 1LLBA 4R3BA 2WADA 1TVFA 3A3JA 3JYIA 4E6WA 4QB8A 4WBGA 2Y55A 3UPOA 4N1HA 3Q7VB 3E2LA 1KDSA 1YLPA 4OQGA 3BFCA 4WZ4A 2Z2MB 3HLWA 5EE8A 4D2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMW A;  2P9V A;  3DTM A;  4BL3 A;  5EVL A;  2ZJ9 A;  3MZD A;  2WAE A;  1FQG A;  1PWD A;  4KZ3 A;  4MBH A;  4DKI A;  4R0Q A;  3VFH A;  4KG2 A;  4C3Q A;  1ONG A;  3HUN A;  1QMF A;  4U3T A;  3SH7 A;  3WS1 A;  1NY0 A;  1N9B A;  3IHB A;  3NDE A;  2WKE A;  4RX2 A;  5CGW A;  2ZC6 B;  5EVI C;  5EVI B;  4WMC A;  5KSC A;  1XA1 A;  4QU3 A;  3GQZ A;  3ITA A;  4MEZ A;  5CHJ A;  5CTN A;  1K38 A;  3W4Q A;  1SKF A;  5A92 A;  2OLU A;  2XFT A;  4P0M A;  5FQQ A;  5M18 A;  3C4O A;  4GB7 A;  3VSK A;  3UPP A;  4UA9 A;  4K0X A;  3B3X A;  1IYQ A;  4XUX A;  5E43 A;  5E2G A;  1G6A A;  5HFO A;  1E4D A;  1W79 A;  1XGJ A;  2Y2I A;  1Q2P A;  5M1A A;  5TFQ A;  2DCF A;  1FSY A;  1BLP A;  2Y4A A;  1L2S A;  4QY5 A;  3WS2 A;  3WS0 A;  2XH9 A;  3IF5 A;  1SDN A;  1FSW A;  1HTZ A;  3M6H A;  4E3M A;  5HAP A;  4PM8 A;  4E3N A;  2HDS A;  3A3F A;  5GHX A;  1K54 C;  2ZLY A;  3UDX A;  1PW1 A;  2Y91 A;  1LL9 A;  3LY4 A;  5FI6 A;  1BUL A;  3ZNT A;  3G31 A;  1LI0 A;  5FQJ A;  1YLY A;  2IWB A;  1ES4 A;  2ZC7 A;  4GD8 A;  1IKI A;  4QY6 A;  2V1Z A;  1O7E A;  5AQA A;  3OPH A;  2Y2J A;  4H8R A;  1L0G A;  1BT5 A;  4OPQ A;  4R1G A;  2ZC4 B;  4E3O A;  5DF9 A;  1BTL A;  1FCM A;  3C7U A;  1KGE A;  1ES2 A;  2HPB A;  2X71 A;  4N92 A;  1EWZ A;  4EUZ A;  4XXR A;  4U0X A;  5FQI A;  3MKF A;  5FQM A;  2Y2N A;  2WUQ A;  2HP5 A;  1TDG A;  2VGK A;  4PM7 A;  3A3D A;  4Y7P A;  1ZC2 A;  2J9O A;  3IF6 A;  3IH8 A;  4YIN A;  1RGY A;  3HLD A;  3SH8 A;  2XD5 A;  3CZD A;  4PM9 A;  2XR0 A;  1GHI A;  1XPB A;  3UNW A;  4P87 A;  1GCE A;  3Q1F A;  4OOY A;  2HDR A;  3IWO A;  4E3J A;  5IHV A;  4DF6 A;  3UN7 A;  3VMA A;  3D4F A;  3OCL A;  2XEP A;  3PAE A;  1K6S A;  2WYX A;  3NBL A;  1K57 C;  3BEC A;  4JF5 A;  2DRW A;  4RA7 A;  3SH9 A;  1S0W A;  3Q82 A;  2HDU A;  4ZJ2 A;  1Z6F A;  1I5Q A;  3ZDJ A;  3EQU A;  2V20 A;  3IWQ A;  3FWL A;  3M2K A;  4GD6 A;  3BEB A;  4JXG A;  4S2P A;  5FDH A;  2IWD A;  5EUA A;  1CI8 A;  4EV4 A;  1K6R A;  4BJP A;  4OKP A;  1YLZ A;  1MWS A;  2G2U A;  1G68 A;  2XDM A;  4MLL A;  1PWC A;  2HDQ A;  5FAO A;  1FCO A;  2Y2H A;  3Q7V A;  4LV0 A;  1S6R A;  4S2K A;  4BL2 A;  2JCH A;  4L0L A;  1TEM A;  4OOL A;  4OPY A;  3SS4 A;  4IED A;  2Y2L A;  1JTG A;  4WEL A;  1KE4 A;  1O07 A;  5U47 A;  5FI2 A;  4NK3 A;  5CEC A;  1BSG A;  1KVL A;  5E2F A;  4OQI A;  4X69 A;  4LV1 A;  2EFX A;  2R9W A;  1HD8 A;  1CI9 A;  4GOG A;  3NI9 A;  3Q7Z A;  4NET A;  1JWV A;  4JBF A;  5EVI A;  4BEN A;  5EOE A;  3EQV A;  1KGG A;  3VP4 A;  4KQO A;  4DE0 A;  1LI9 A;  2H10 A;  5AQB A;  3UE3 A;  2H0T A;  1MKI A;  5FAP A;  4PMA A;  3ITB A;  4LV2 A;  4Y0T A;  2WKI A;  1NJ4 A;  5I94 A;  3BFF A;  3NDG A;  1MXO A;  3P98 A;  4JF6 A;  3OCN A;  1XP4 A;  4JXW A;  1L0F A;  1H8Y A;  2P74 A;  3E2K A;  3UO9 A;  4ZDX A;  3ZG7 B;  4P6B A;  4DDS A;  1J9M A;  3MFD A;  3GTC A;  3HVF A;  2BG1 A;  4GZB A;  1E3U D;  1MWT A;  2I72 A;  1SCW A;  3HLF A;  1K54 A;  2WAF A;  4JXV A;  3IXG A;  4OPR A;  3ZVW A;  3BM6 A;  3AGE A;  3IQA A;  5G18 A;  2EXA A;  4HBT A;  4KZ9 A;  3G2Z A;  1NXY A;  4U0T A;  3VP0 A;  4BD1 A;  1HZO A;  2EX8 A;  3RXW A;  3ZGA B;  2PU2 A;  3V39 A;  5DF7 A;  5TGF A;  4PM5 A;  2RL3 A;  5L2F A;  1MBL A;  4OP5 A;  4KG5 A;  2ZC3 B;  5F1G A;  5CRF A;  4JXS A;  2J9P A;  4JLF A;  1K4F A;  1BZA A;  4FSF A;  5TR7 A;  3ZG5 A;  5HAQ A;  4S2O A;  2XFS A;  4HEF A;  3PBN A;  4QJG A;  2ZM0 A;  3IWI A;  4KZ5 A;  4EQI A;  3CJM A;  5DTS A;  4OP8 A;  4UA7 A;  1RP5 A;  3MBZ A;  3UDF A;  3N8L A;  3N6I A;  2OV5 A;  3OZH A;  4KZ4 A;  4OVD A;  1JVJ A;  2Q9N A;  1M6K A;  2Z2L B;  3VP2 A;  3BRM A;  1PI4 A;  1K57 A;  4LCM A;  4B4X A;  4OLD A;  1IYO A;  1QME A;  2ZQ9 A;  4IBR A;  2PBY A;  4WMC D;  1ERQ A;  1HVB A;  3HRE A;  2XLN A;  4CJN A;  3CMZ A;  1PZP A;  4RVA A;  2Q9M A;  4FCF A;  3W4P A;  4GDB A;  3C5A A;  1ESI A;  2EX2 A;  3C4P A;  2Y2K A;  2QPN A;  4IVI A;  2ZQD A;  4P85 A;  4DRT A;  1W7F A;  3ZG9 B;  5FAT A;  4S2I A;  1H8Z A;  1FOF A;  4FH2 A;  2Y2Q A;  4GDN A;  4WM9 A;  4FD8 A;  1YM1 A;  1PIO A;  4KZ6 A;  3ZG8 B;  1SDE A;  4KZ8 A;  3QHY A;  3FYZ A;  1KE0 A;  1K56 A;  2XF3 A;  3PTE A;  4KEN B;  5J8X A;  2XD1 A;  4X68 A;  3UPN A;  3WWX A;  5CHM A;  3CG5 A;  3M2J A;  5FA7 A;  3IXH A;  5EEC A;  1MY8 A;  2Y2P A;  3BLS A;  2WK0 A;  1K25 A;  4OH0 A;  3ZCZ A;  2GDN A;  1PZO A;  2XGN A;  3G32 A;  3HUM A;  4LV3 A;  2G2W A;  4E3L A;  5BOH A;  4QHC A;  2R9X A;  3FKV A;  3ZHH A;  3IHA A;  1FCN A;  5GHZ A;  2ZMA A;  2J7V A;  2C5W B;  1YMX A;  2FFY A;  4N9L A;  2ZM8 A;  3GRJ A;  5FAQ A;  3N7W A;  3TSG A;  3QNC A;  3NCK A;  1I2W A;  5M19 A;  5CED A;  4OLG A;  4ID4 A;  4B88 A;  4Y0U A;  5FSR A;  3O87 A;  1ERM A;  1NRF A;  3I7J A;  1IEL A;  3AGD A;  5E2E A;  1SHV A;  5KMW A;  3M6B A;  1L0E A;  2OLV A;  1EI5 A;  1XX2 A;  4HES A;  4WEJ A;  4M3K A;  3IXB A;  1XGI A;  4ZAM A;  1CEG A;  4OQH A;  1MWU A;  4O7D A;  3SS3 A;  3MZE A;  3LY3 A;  3QNB A;  4RX3 A;  2ZC5 B;  2DNS A;  4ZBE A;  3PBS A;  5KSH A;  3FKW A;  1MWR A;  3VSL A;  2WKH A;  5DVA A;  2WGW A;  1XA7 A;  4UAA A;  5D3O A;  4S2L A;  1PYY A;  2ZQ7 A;  2OSU A;  5CHU A;  1E3U A;  2HP9 A;  4DDY A;  3HLC A;  1GHM A;  4OOM A;  3BYD A;  4X56 A;  3VFF A;  4KZ7 A;  5GLC A;  1BUE A;  3N8R A;  5A91 A;  4CPK A;  2ZQ8 A;  3MXS A;  4KQR A;  1L0D A;  5GLD A;  4A5R A;  1AXB A;  1JWZ A;  4LCL A;  4EBL A;  1DY6 A;  5CTM A;  4GNU A;  3G35 A;  1LHY A;  4OQ0 A;  1CK3 A;  3NY4 A;  4E6X A;  3NIA A;  4QD4 A;  3VOY A;  3TG9 A;  3PBT A;  3O86 A;  2RCX A;  4UHU A;  5A90 A;  1ZG4 A;  4N1X A;  2C6W B;  3OC2 A;  5HW3 A;  3G34 A;  3HBR A;  2JE5 A;  1KVM A;  2WGW B;  4E3K A;  3MKE A;  2JBF A;  4S2N C;  4ZJ3 A;  3PBQ A;  3HLG A;  1CEF A;  4GKU A;  3GR2 A;  1DJA A;  5EVI D;  3VOZ A;  4R4R A;  4PM6 A;  1YMS A;  4ZJ1 A;  1K4E A;  1ESU A;  2ZQC A;  4UA6 A;  5F82 A;  3SOI A;  4WZ5 C;  5DF8 A;  3ZVT A;  4FH4 A;  2J8Y A;  1N4O A;  4IBX A;  1NZU A;  3IT9 A;  1VQQ A;  3AGF A;  3ZNY A;  1PWG A;  3VP3 A;  4RYE A;  5CGX A;  2EXB A;  1K55 C;  3Q81 A;  3LEZ A;  4K0W A;  3ISG A;  2A3U A;  3FV7 A;  1BLC A;  1NZO A;  3N4I A;  3S22 A;  4KQQ A;  4XUZ A;  4MNR A;  2WGI A;  3IH9 A;  3WS4 A;  1IYP A;  3G4P A;  1ZKJ A;  4WEK A;  4Y0O A;  1XKZ A;  1KE3 A;  4S2M A;  1C3B A;  3V3S A;  1YQS A;  1U60 A;  3C7V A;  5E2H A;  5FI7 A;  3P09 A;  2EX9 A;  3ZG0 A;  4ZTK A;  4DE3 A;  4X53 A;  1LL5 A;  2X02 A;  3MXR A;  5FQ9 A;  2A49 A;  5CXW A;  2E8I A;  2Y2M A;  1IYS A;  2EX6 A;  4Z9Q A;  3RJU A;  2P9V B;  4C6Y A;  4JF4 A;  3SS5 A;  3V50 A;  4F94 A;  5F1F A;  4X6T A;  3OPL A;  2EFU A;  1KDW A;  4S2J A;  4HBU A;  1ONH A;  3OPP A;  4MBF A;  5JYP A;  3OPR A;  4EBP A;  5KZH A;  5AQ9 A;  5FAS A;  1OME A;  3S4X A;  3MZF A;  4IVK A;  2Y2G A;  3GV9 A;  3G2Y A;  5GLA A;  4DE2 A;  3HLE A;  5GHY A;  2QMI A;  1GHP A;  5AQ7 A;  2WGV A;  2B5R A;  5HAR A;  4DE1 A;  2XQZ A;  3DWZ A;  4B4Z A;  5GL9 A;  4BD0 A;  4DXC A;  3VP1 A;  3HL9 A;  1ALQ A;  2BLS A;  3WRT A;  2UWX A;  3WS5 A;  1RGZ A;  3UE1 A;  1FR6 A;  1WE4 A;  1YLJ A;  3PBO A;  4OON A;  4R23 A;  3PAG A;  3WRZ A;  2H5S A;  1RCJ A;  1Y54 A;  3LO7 A;  4GN2 A;  5A93 A;  1M40 A;  5DTT A;  3UE0 A;  5EOO A;  5HX9 A;  1JTD A;  4LEN A;  1DJC A;  1MPL A;  1PW8 A;  1VM1 A;  4KZA A;  1NYY A;  3A3E A;  1YT4 A;  1BLH A;  3GSG A;  5JYO A;  2IWC A;  4MBK A;  3V5M A;  2FFF B;  3GVB A;  2ZQA A;  2VGJ A;  1DJB A;  5DTK A;  4KG6 A;  4N9K A;  2PU4 A;  3BLM A;  1Q2Q A;  2H0Y A;  4X55 A;  4EWF A;  1FR1 A;  4R4S A;  3O3V A;  3RXX A;  1GA0 A;  2V2F F;  4WYY A;  1PI5 A;  4Q8I A;  2WZZ A;  1XXM A;  1W5D A;  1K56 D;  1TDL A;  1W8Q A;  2XK1 A;  3BFG A;  4YFM A;  2ZM2 A;  1GA9 A;  5HAI A;  5CER A;  3FZC A;  3ZFZ A;  4OPZ A;  1H5X A;  1JWP A;  3NC8 A;  4E3I A;  3IXD A;  4K91 A;  3N8S A;  4S2N A;  3IF6 B;  4PPR A;  3IF6 C;  1YLW A;  3BFE A;  1I2S A;  5CGS A;  3DWK A;  3TOI A;  1WYB A;  4EBN A;  4KZB A;  4WZ5 A;  2Y2O A;  3A3I A;  4JPM A;  1ERO A;  5GLB A;  3HLB A;  3V3R A;  1ZG6 A;  3HUO A;  3Q07 A;  2HP6 A;  1K55 A;  1WYC A;  2Y59 A;  3G30 A;  2CC1 A;  2ZD8 A;  3O88 A;  2WZX A;  1W8Y A;  3DW0 A;  5HL1 A;  5EPH A;  3BFD A;  2X01 A;  1IKG A;  4R3J A;  2QZ6 A;  4C75 A;  3LCE A;  3W8K A;  3PBR A;  1ES3 A;  1KGF A;  2JC7 A;  4JKT A;  3UY6 A;  1ES5 A;  4BQM A;  4DXB A;  4BLM A;  5F83 A;  1BLS A;  3S1Y A;  5CEB A;  1NYM A;  1E25 A;  1YLT A;  3UDI A;  5FQK A;  3W4O A;  1IEM A;  1LLB A;  4R3B A;  2WAD A;  1TVF A;  3A3J A;  3JYI A;  4E6W A;  4QB8 A;  4WBG A;  2Y55 A;  3UPO A;  4N1H A;  3Q7V B;  3E2L A;  1KDS A;  1YLP A;  4OQG A;  3BFC A;  4WZ4 A;  2Z2M B;  3HLW A;  5EE8 A;  4D2O A; 
#chains in the Genus database with same CATH topology
 4BL3 A;  5EVL A;  3UB9 A;  2ZJ9 A;  4H6J A;  4C3Q A;  1ONG A;  3BJN A;  5EVI C;  1A0K A;  4WMC A;  5I5L A;  5KSC A;  4QU3 A;  4FUW A;  2HF6 A;  3W4Q A;  2W0N A;  5A92 A;  5EM1 A;  5HD3 A;  5FQQ A;  3TJZ C;  3VSK A;  3UPP A;  4K0X A;  1DP9 A;  3EWK A;  5HFO A;  3WS2 A;  2Y4A A;  4QY5 A;  2VJW A;  2W3D A;  4KUK A;  4PM8 A;  2HDS A;  3A3F A;  2GX5 A;  3HCY A;  1LL9 A;  5FI6 A;  1BUL A;  5F69 A;  5FQJ A;  5AQA A;  2ZC7 A;  1IKI A;  2V1Z A;  4R70 A;  4F3L B;  3OPH A;  2K2N A;  4H8R A;  1OT9 A;  1BT5 A;  1FCM A;  4UQI S;  1ES2 A;  4EUZ A;  4XXR A;  3R7W A;  5FQI A;  3MKF A;  5FQM A;  2VGK A;  1TDG A;  3EGD C;  3T50 A;  2OWJ A;  1RGY A;  2XD5 A;  1GHI A;  3K3D A;  4P87 A;  1GCE A;  3Q1F A;  4UEY A;  2HDR A;  4DF6 A;  2V0U A;  3UN7 A;  3D4F A;  3MFX A;  3PAE A;  1K6S A;  3NBL A;  4YOF A;  3SH9 A;  3Q82 A;  2V20 A;  3PR6 A;  3IWQ A;  4HJ6 A;  4EV4 A;  3VE3 A;  3FPW A;  1T18 A;  2XDM A;  4MLL A;  1PWC A;  2HDQ A;  5FAO A;  4S2K A;  4BL2 A;  2JCH A;  3SS4 A;  3ZQ5 A;  1JTG A;  2J3T C;  1KE4 A;  5U47 A;  1NRJ A;  4NK3 A;  2PHY A;  3T12 B;  5CEC A;  4G3W A;  4Y3I A;  1HD8 A;  1JWV A;  2ZOH A;  4BEN A;  1KGG A;  3VP4 A;  2H10 A;  4PKY G;  2ZBB A;  3ITB A;  3JPU A;  2JN7 A;  3P98 A;  2EA9 A;  2HJ9 C;  2JKF A;  3HVF A;  1E3U D;  2I72 A;  1SCW A;  3HLF A;  2CMN A;  1K54 A;  3ZVW A;  2NUT C;  3BY9 A;  1MC0 A;  3IQA A;  4HBT A;  3G2Z A;  3UB8 A;  1HZO A;  5TGF A;  5L2F A;  4KG5 A;  2ZC3 B;  3UMD A;  1VEU A;  5TR7 A;  4QJG A;  2ZM0 A;  3IWI A;  1RP5 A;  2I9V A;  2OV5 A;  2ZMF A;  3VP2 A;  4B4X A;  1MZU A;  2WKP A;  1QME A;  2PBY A;  1OTA A;  2ACG A;  5IU1 A;  2Q9M A;  5HDS A;  4GDB A;  3C5A A;  1ESI A;  2QPN A;  4P85 A;  1OT6 A;  1YM1 A;  1PIO A;  4KZ6 A;  1K56 A;  3CPT B;  4KEN B;  5CHM A;  5FA7 A;  2WK0 A;  2XGN A;  3HUM A;  5BOH A;  4QHC A;  3ZHH A;  3GEC A;  3HJI A;  1YMX A;  2FFY A;  2ZM8 A;  3TSG A;  3NCK A;  1I2W A;  4OLG A;  3O87 A;  1ERM A;  3I7J A;  1IEL A;  3AGD A;  5E2E A;  1G5U A;  5KMW A;  3M6B A;  1EI5 A;  4HES A;  2FZ0 A;  3MXQ A;  5A8B A;  3MQQ A;  4O7D A;  5L07 A;  3SS3 A;  3LY3 A;  3QNB A;  4RX3 A;  2DNS A;  3VSL A;  2WKH A;  2WGW A;  3H9W A;  2ZQ7 A;  3NOU C;  3MJQ A;  2V0W A;  4IUK A;  3BYD A;  4LRY C;  5GLC A;  5DKK A;  1CK3 A;  2A24 B;  3LI8 A;  3NIA A;  1OTE A;  4UHU A;  4N1X A;  3OC2 A;  2A2L A;  3G34 A;  2JE5 A;  1KVM A;  4E3K A;  3MKE A;  2JBF A;  3PBQ A;  2O99 A;  3HLG A;  4FTX A;  3GR2 A;  1DJA A;  4GKU A;  4R4R A;  4UA6 A;  1ESU A;  2ZQC A;  3IBJ A;  5DF8 A;  2J8Y A;  2NUP C;  2QYB A;  3VP3 A;  5FL3 A;  4RYE A;  5CGX A;  3Q81 A;  1JNU A;  3LEZ A;  4EQ1 A;  1K0K A;  2A3U A;  3PHY A;  2OWH A;  1NZO A;  3VE4 A;  3N4I A;  4XUZ A;  4MNR A;  2QJ5 A;  2WGI A;  3LEQ A;  3LIE A;  1HLU P;  3C7V A;  4MN6 A;  4WL9 A;  2V8C A;  4DE3 A;  1LL5 A;  3EEA A;  3MXR A;  3CUE A;  5DKL A;  2O9A A;  2XA7 S;  2EX6 A;  3RJU A;  3SS5 A;  3LUQ A;  4H6J B;  1ACF A;  5F1F A;  4P6Z S;  4X6T A;  1KDW A;  5KZH A;  3OPR A;  4EBP A;  5FAS A;  4IVK A;  4GS9 A;  2K7S A;  4EER A;  4Q0J A;  3QP1 A;  2QMI A;  1GHP A;  5AQ7 A;  5HAR A;  2XQZ A;  4B4Z A;  5GL9 A;  2PR5 A;  4BD0 A;  3ICY A;  4HH2 A;  4ARZ A;  1WE4 A;  2UV0 E;  3LO7 A;  1M40 A;  5DTT A;  1JTD A;  2BTF P;  1MPL A;  1YT4 A;  2B18 A;  2WKR A;  3GSG A;  5JYO A;  2IWC A;  5EFW A;  1XJ6 A;  1DJB A;  4N9K A;  3BLM A;  1XJ4 A;  3LFV A;  3O3V A;  4WYY A;  5F6A A;  1TDL A;  1W8Q A;  2XK1 A;  3BFG A;  1CJF A;  3R7W B;  4S2N A;  2L1M A;  5CGS A;  1YLW A;  5HWV A;  5EV0 A;  3HLB A;  1ZG6 A;  1WYC A;  3NJA A;  5MC7 A;  1N9L A;  3W8K A;  1ES3 A;  1KGF A;  4BLM A;  5L8M A;  3S7P A;  5CEB A;  1YLT A;  3KYE A;  4JGQ A;  2WAD A;  1F5M A;  3A3J A;  2Y55 A;  1KDS A;  4OQG A;  1FIL A;  2Z2M B;  3GMW A;  3BW6 A;  4KZ3 A;  3FG8 A;  4MBH A;  4DKI A;  3WS1 A;  3HUN A;  1QMF A;  3SH7 A;  3IHB A;  3F1O A;  2ZC6 B;  3QP2 A;  3C38 A;  3GQZ A;  5CHJ A;  5CTN A;  4GCZ A;  2OLU A;  3HJK A;  2W1T B;  3E4P A;  2Y79 A;  4ME4 A;  3B3X A;  1IYQ A;  5C5K A;  5E43 A;  3R4K A;  1W79 A;  4EES A;  1Q2P A;  4X1M A;  5M1A A;  3OOV A;  1L2S A;  2VEA A;  1SDN A;  1FSW A;  3M6H A;  1VB6 A;  2HGV A;  4JGP A;  5F68 A;  2Y91 A;  1SKO A;  1UGU A;  3ZNT A;  1ES4 A;  4DJ2 A;  2Y2J A;  1BTL A;  3C7U A;  2LB9 A;  1VEU B;  3V67 A;  1YPR A;  2PDR A;  2Y2N A;  1S1Y A;  4PM7 A;  3A3D A;  3IF6 A;  3HLD A;  3IX3 A;  4X25 A;  3LYX A;  2PAV P;  3IWO A;  4E3J A;  5IHV A;  4EEU A;  1YAX A;  3RTY A;  2GJ3 A;  2PYR A;  4JF5 A;  2DRW A;  3ZDJ A;  3U4L P;  3EQU A;  5G4Z A;  2JKG A;  3M2K A;  3BEB A;  4S2P A;  1YSQ A;  3UME A;  4BJP A;  1YLZ A;  2G2U A;  4DMZ A;  4OOL A;  4IED A;  3TE8 A;  1O07 A;  5FI2 A;  1BSG A;  3KO6 A;  2P7J A;  5E2F A;  2WKQ A;  2EFX A;  1CI9 A;  3NI9 A;  2VV7 A;  3H82 A;  3EQV A;  4KQO A;  1S4S A;  5AQB A;  3UE3 A;  3P7N A;  4PMA A;  3NUL A;  3BQA A;  4I3I A;  3NDG A;  4JF6 A;  3E2K A;  1XFQ A;  3MFD A;  3LR5 A;  2V9A A;  3T4J A;  4EXO A;  4JXV A;  3BM6 A;  3AGE A;  5G18 A;  2EXA A;  1XJ3 A;  5HWW A;  1NXY A;  3LI9 A;  5AVF A;  3CLO A;  2PU2 A;  3V39 A;  3QP5 A;  4PM5 A;  1MBL A;  4OP5 A;  4ESP A;  4I3A A;  4JXS A;  4MN5 A;  5FEF A;  3E4Q A;  1BZA A;  3JVV A;  3MMH A;  3PBN A;  1S66 L;  4EQI A;  5DTS A;  4UA7 A;  5DJU A;  3MBZ A;  3P01 A;  2Q9N A;  2Z2L B;  3BRM A;  1K57 A;  4GHI A;  1IYO A;  4IBR A;  4L9E A;  1G6O A;  3HRE A;  4HQA A;  4R3A A;  3MR0 A;  3LIF A;  1PZP A;  4HP9 A;  4Q0I A;  2EX2 A;  3C4P A;  4DRT A;  1W7F A;  3ZG9 B;  3LR4 A;  1H8Z A;  1FOF A;  4GDN A;  4FD8 A;  2ZOI A;  3NOP C;  3ZG8 B;  2QHK A;  4DN0 A;  3QHY A;  1DP8 A;  2IA2 A;  2KLI A;  3PTE A;  4HJ3 A;  4I5S A;  2XD1 A;  5J8X A;  2AVX A;  4X68 A;  3IXH A;  3FC7 A;  1MY8 A;  4OH0 A;  1PZO A;  3G32 A;  4E3L A;  3IHA A;  1FCN A;  2C5W B;  4N9L A;  3GRJ A;  5FAQ A;  1XFN A;  2E8J A;  3KX0 X;  4Y0U A;  4GS9 B;  1NRF A;  1SHV A;  1L0E A;  2OLV A;  2J80 A;  4ARZ B;  1YSP A;  2ZC5 B;  5KSH A;  3B42 A;  4S2L A;  3SZT A;  2HP9 A;  4CLC C;  1LSV A;  4OOM A;  2VZW A;  4X56 A;  1IOU A;  3KYZ A;  1UWP X;  1T19 A;  5A91 A;  1P0Z A;  2ZQ8 A;  3T1R A;  2OAQ 1;  3MXS A;  5GLD A;  5J4E A;  4A5R A;  1DY6 A;  4GW9 A;  3CWF A;  1LHY A;  4QD4 A;  3VOY A;  3PBT A;  1ZG4 A;  2Z6D A;  1D7E A;  3HBR A;  2PYP A;  4LPZ A;  5EVI D;  2ZL1 A;  4PAU A;  1SZV A;  4PM6 A;  4ZJ1 A;  3SOI A;  3EOI A;  1N4O A;  2MJ6 A;  3AGF A;  3H7W A;  1PWG A;  3ZNY A;  1K55 C;  3S7O A;  4Z1W A;  4AFI A;  2YKF A;  2FH5 A;  2QWS A;  1IYP A;  3LIC A;  1ZKJ A;  4WEK A;  4Y0O A;  4XT2 B;  1KE3 A;  3S7Q A;  2ZMV A;  3V3S A;  3P09 A;  2EX9 A;  4NXE A;  3ZG0 A;  4ZTK A;  4X53 A;  5J3W A;  4IJG A;  4C6Y A;  4JF4 A;  2LB5 A;  1TF1 A;  4BBU A;  3OPP A;  4MBF A;  3F1O B;  2Y2G A;  3G2Y A;  2WGV A;  2B5R A;  3DWZ A;  3S7N A;  2W27 A;  1OTD A;  1L3L A;  1D06 A;  1RGZ A;  2KOI A;  3D72 A;  3UE1 A;  3T1X A;  1Y54 A;  4GN2 A;  4WN5 A;  4HJ4 A;  5EOO A;  4LEN A;  4KZA A;  1VM1 A;  1NYY A;  3A3E A;  1BLH A;  1SKO B;  3V5M A;  2FFF B;  1NWZ A;  3CI6 A;  2ZQA A;  2VGJ A;  5DTK A;  4ETX A;  5HL6 A;  2H0Y A;  4EWF A;  3RXX A;  1PI5 A;  2WZZ A;  2J3T D;  3C2W A;  4CQH A;  3D9Y A;  3FZC A;  4OPZ A;  1H5X A;  1JWP A;  3NC8 A;  3IXD A;  4K91 A;  3IF6 B;  1I2S A;  1LSW A;  4WZ5 A;  4D60 A;  2Y2O A;  4O01 A;  5GLB A;  1KOU A;  3Q07 A;  3G30 A;  2ZD8 A;  1W8Y A;  1Y28 A;  4DJ3 A;  1IKG A;  4C75 A;  4JKT A;  4BQM A;  3W2Z A;  3UB6 A;  1E25 A;  4I39 A;  1WA9 A;  3OBF A;  3UE6 A;  3W4O A;  4R3B A;  4NKP A;  3JYI A;  4WBG A;  1ODV A;  3BFC A;  2KDK A;  5EE8 A;  2HJE A;  3QP8 A;  3DTM A;  4NG2 A;  3MZD A;  1PWD A;  1IFQ A;  3E0Y A;  4KG2 A;  1NY0 A;  1N9B A;  5M18 A;  1XA1 A;  3H82 B;  1W63 M;  4P0M A;  3C4O A;  3T4S A;  4UA9 A;  3T4L A;  4XUX A;  4JGR A;  4Y5F A;  3L9K A;  1CQA A;  5TFQ A;  2DCF A;  2H28 A;  3IF5 A;  1HTZ A;  1PNE A;  1TS7 A;  1K54 C;  2D02 A;  3UDX A;  3LY4 A;  3G31 A;  1LI0 A;  1YLY A;  2IWB A;  4GD8 A;  4QY6 A;  1O7E A;  1L0G A;  4R1G A;  4E3O A;  4KUO A;  1KGE A;  2HPB A;  4N92 A;  4U0X A;  1S67 L;  2WUQ A;  1ZC2 A;  2J9O A;  3IH8 A;  3SH8 A;  4YIN A;  3CZD A;  4PM9 A;  2XR0 A;  3RFB A;  4L9F A;  2XEP A;  1T1B A;  2WYX A;  4ZJ2 A;  1Z6F A;  1I5Q A;  4KQD A;  3FWL A;  3LIA A;  1BYW A;  4GD6 A;  4JXG A;  5FDH A;  1CI8 A;  5LBR A;  1CF0 A;  1F9I A;  1MWS A;  3MSH A;  3KSH A;  2Y2H A;  3EGX C;  3Q7V A;  4L0L A;  1TEM A;  1VET A;  1ZHH B;  4CLC E;  2Y2L A;  3F1P A;  3CHW P;  4HHD A;  3B33 A;  1KVL A;  4X69 A;  3Q7Z A;  4JBF A;  5EVI A;  2M1C A;  5EOE A;  1LI9 A;  2H0T A;  3CAX A;  3IX8 A;  1H3Q A;  5FAP A;  1NJ4 A;  5I94 A;  2W3H A;  3BFF A;  3BQ8 A;  1L0F A;  3T4Q A;  1GSW A;  4ZDX A;  4P6B A;  4DDS A;  1J9M A;  3E4O A;  2BG1 A;  5HD5 A;  4E04 A;  4KZ9 A;  3VP0 A;  4BD1 A;  2EX8 A;  3ZGA B;  2O0Y A;  2JKT M;  1LT0 A;  5CRF A;  4JLF A;  1K4F A;  4FSF A;  4NXG A;  1AWI A;  5HAQ A;  2XFS A;  4WLA A;  4HEF A;  2B95 A;  2JKR M;  2L0W A;  4G3V A;  3SW1 A;  2YKH A;  1J3W A;  4LGW A;  3UDF A;  4NXB A;  3N8L A;  3A0R A;  4HIA A;  4OVD A;  1M6K A;  1T1A A;  3LIB A;  1G28 A;  1PI4 A;  4LCM A;  1PFL A;  3LID A;  2ZQ9 A;  2ZL1 B;  1PRQ A;  1ERQ A;  1HVB A;  4R38 A;  2VK3 A;  4CJN A;  4HH3 A;  4RVA A;  3VOL A;  3W4P A;  3H7W B;  4IVI A;  2ZQD A;  3JVU A;  4MCW A;  4S2I A;  2KX6 A;  4FH2 A;  2Y2Q A;  4WUJ A;  1SDE A;  4KZ8 A;  5AVE A;  3FYZ A;  2XF3 A;  2M7V A;  2W3G A;  4BWI A;  2VKS A;  3WWX A;  3CG5 A;  4FOF A;  3TRC A;  2GDN A;  3IX4 A;  3CUE C;  4LFU A;  2G2W A;  2R9X A;  3FKV A;  2Q0O A;  5GHZ A;  4CLC A;  2J7V A;  2XRO A;  3QNC A;  3A0V A;  2PD8 A;  5CED A;  4ID4 A;  4HNB A;  4B88 A;  4Y17 A;  5G4Y A;  4MN7 A;  4M3K A;  1NLZ A;  2A24 A;  4OQH A;  2K31 A;  2DMW A;  3DAV A;  3PBS A;  4II7 A;  3FKW A;  1MWR A;  5DVA A;  1XA7 A;  3IBR A;  4UAA A;  5D3O A;  1PYY A;  5CHU A;  4M4X A;  4DDY A;  1GHM A;  4G3K A;  1NLY A;  4KZ7 A;  4CPK A;  2W1R A;  1L0D A;  4KQR A;  1AXB A;  3BWL A;  4LCL A;  5CTM A;  4GNU A;  4B9O A;  1UWN X;  4OQ0 A;  3TG9 A;  3B47 A;  2RCX A;  5A90 A;  1V9Z A;  4QPR A;  5HW3 A;  2WGW B;  3DTE A;  4S2N C;  5HDD A;  4ZJ3 A;  1CEF A;  1YMS A;  5F82 A;  2J3W A;  1NZU A;  3IT9 A;  1VQQ A;  1EW0 A;  4HY8 A;  1BLC A;  3F1N A;  1STZ A;  4BBV A;  5HDC A;  5L10 A;  3WS4 A;  3G4P A;  5TBM A;  1XKZ A;  1YKD A;  4S2M A;  2V1A A;  1YQS A;  1U60 A;  2HV1 A;  5CXW A;  5HZH A;  4F94 A;  3OPL A;  2EFU A;  4S2J A;  2INW A;  2PT7 A;  5AQ9 A;  1S1Z A;  1OME A;  1ZTU A;  2PD7 A;  5GHY A;  3KSF A;  4L9G A;  3K2N A;  2VGL M;  4YWZ A;  3FPV A;  2VX8 A;  2W3E A;  1N9O A;  2QJ7 A;  3HL9 A;  1ALQ A;  3VP1 A;  3WRT A;  2B02 A;  2P08 A;  3PBO A;  2XSS A;  2Y8H A;  1RCJ A;  3KYQ A;  5A93 A;  5FDS A;  3RH8 B;  3T4K A;  1DJC A;  1PW8 A;  4MBK A;  4NEE D;  3GVB A;  4KG6 A;  3PYP A;  4RQ9 A;  1FR1 A;  4Q8I A;  1W63 Q;  1GA0 A;  2V2F F;  5EM0 A;  1W5D A;  1VHM A;  4Q0H A;  5CER A;  1F98 A;  3IF6 C;  3BFE A;  3LR0 A;  2PRF A;  3TOI A;  1WYB A;  4EBN A;  2L4R A;  4QWO A;  4JPM A;  1ERO A;  4GLQ A;  3HUO A;  3DTK A;  2Y59 A;  3O88 A;  5HL1 A;  4IHQ A;  2QZ6 A;  3LCE A;  2JC7 A;  3UY6 A;  4O0P A;  2VV8 A;  5CX7 A;  5F83 A;  3S1Y A;  2W1T A;  3UDI A;  5FQK A;  3UPO A;  4E6W A;  4NXF A;  3Q7V B;  3E2L A;  5J7E A;  5AJG A;  1VET B;  3HLW A;  3F1P B;  1DRM A;  2P9V A;  3QP4 A;  2WAE A;  1GSX A;  1FQG A;  3TW8 A;  4R0Q A;  3GDI A;  3VFH A;  4U3T A;  5FEG A;  1X0O A;  4RX2 A;  3NDE A;  3ULF A;  5CGW A;  2WKE A;  5EVI B;  2HZ5 A;  3ITA A;  4MEZ A;  5HSQ A;  3MQ0 A;  1K38 A;  1SKF A;  2XFT A;  3T4T A;  4GB7 A;  4I38 A;  3EEH A;  4EEP A;  5E2G A;  2VV6 A;  1G6A A;  4YNR A;  3QP6 A;  1E4D A;  1XGJ A;  2Y2I A;  4UQI M;  1OTI A;  1FSY A;  1BLP A;  3WS0 A;  2XH9 A;  4E3M A;  5HAP A;  1F2K A;  4E3N A;  5GHX A;  4HP4 A;  3DTI A;  2ZLY A;  1PW1 A;  4HI4 A;  3IS2 A;  1Y4O A;  3PXP A;  5K5B A;  4OPQ A;  2ZC4 B;  5DF9 A;  3E98 A;  2OOL A;  2X71 A;  1EWZ A;  3LGO A;  1XJ2 A;  2HP5 A;  4Y7P A;  4JGO A;  1TS8 A;  1XPB A;  3UNW A;  4OOY A;  3VMA A;  3BY8 A;  3OCL A;  3CIT A;  2XRN A;  1K57 C;  3BEC A;  4RA7 A;  4MDZ A;  1S0W A;  2HDU A;  2D01 A;  5HPI A;  2IWD A;  5EUA A;  2OAP 1;  1K6R A;  4OKP A;  4EET B;  1G68 A;  1FCO A;  2M7U A;  4LV0 A;  1S6R A;  4OPY A;  4WEL A;  5EVE A;  4Y13 A;  4CLC D;  4OQI A;  4LV1 A;  2R9W A;  4GOG A;  4NET A;  2V1B A;  4EU0 A;  4DE0 A;  4CLC B;  4O8G A;  1MKI A;  4LV2 A;  4Y0T A;  2WKI A;  1MXO A;  4JXW A;  3OCN A;  1XP4 A;  1H8Y A;  2P74 A;  3UO9 A;  3ZG7 B;  3GTC A;  3UB5 P;  4GZB A;  5HWT A;  1MWT A;  3L7H A;  3KSG A;  2WAF A;  3IXG A;  4OPR A;  2EWV A;  2O9B A;  3OLO A;  1OJG A;  4U0T A;  3RXW A;  4F3L A;  5DF7 A;  2RL3 A;  3MS6 A;  5KIZ A;  5F1G A;  2J9P A;  4PHT A;  3ZG5 A;  4S2O A;  4KZ5 A;  3CJM A;  4OP8 A;  4GJ4 A;  4R6L A;  4WF0 A;  2Z6C A;  3N6I A;  3OZH A;  4KZ4 A;  1JVJ A;  4OLD A;  2W3F A;  4MMN A;  4WMC D;  5IT5 A;  2XLN A;  3CMZ A;  4FCF A;  2GNX A;  4HOI A;  2Y2K A;  5FAT A;  3F1N B;  4WM9 A;  1KE0 A;  4ZRR A;  3U2A A;  5TBM B;  1H0M A;  3K3C A;  3UPN A;  2EWW A;  3M2J A;  5EEC A;  2Y2P A;  3ZYT A;  4LRX C;  3BLS A;  1TS0 A;  4GHI B;  1K25 A;  1FIK A;  3ZCZ A;  2G7U A;  5DJT A;  4BBT A;  4LV3 A;  4K08 A;  3MF0 A;  4Y15 A;  2ZMA A;  3N7W A;  2O9C A;  5M19 A;  5FSR A;  2GZA A;  1LL8 A;  1OJ5 A;  4EUV A;  1XX2 A;  4WEJ A;  1LSX A;  1OPX A;  3IXB A;  1XGI A;  5DFY A;  3NHQ A;  4BMW A;  4ZAM A;  1CEG A;  1DP6 A;  1MWU A;  3MZE A;  4ZBE A;  2P04 A;  4X1L A;  2OSU A;  1E3U A;  1P9R A;  3HLC A;  4PKY A;  4EW7 A;  3G6O A;  3VFF A;  1BUE A;  3N8R A;  5HPF A;  5L09 A;  3NOT C;  3KSI A;  5F5Y A;  1P9W A;  1JWZ A;  4EBL A;  3G35 A;  3NY4 A;  4E6X A;  3T4O A;  3O86 A;  4XT2 A;  2C6W B;  3C8C A;  3T1S A;  3A0S A;  3VOZ A;  3C30 A;  1K4E A;  2PBD P;  4WZ5 C;  3ZVT A;  4FH4 A;  2XA7 M;  4IBX A;  1GSV A;  2EXB A;  2PR6 A;  4K0W A;  3ISG A;  4P6Z M;  3FV7 A;  1D1J A;  3S22 A;  4KQQ A;  1TD5 A;  3IH9 A;  3CPT A;  1C3B A;  4LLO B;  5E2H A;  5FI7 A;  1N9N A;  5TJJ A;  2X02 A;  5FQ9 A;  1TS6 A;  2A49 A;  2E8I A;  2Y2M A;  1IYS A;  3D3O A;  4Z9Q A;  3O5Y A;  2P9V B;  3V50 A;  4ETZ A;  3NEC A;  4HBU A;  1ONH A;  5JYP A;  3T1Q B;  3S4X A;  3MZF A;  3GV9 A;  5GLA A;  4DE2 A;  3HLE A;  3UB7 A;  4DE1 A;  2JHE A;  1S4R A;  2QKP A;  4DXC A;  2BLS A;  2UWX A;  3WS5 A;  1FR6 A;  1YLJ A;  5IS1 A;  4OON A;  3MQO A;  4R23 A;  3PAG A;  3WRZ A;  2H5S A;  3UE0 A;  4LRZ E;  5HX9 A;  1H8M A;  3IS2 B;  2BAS A;  4I3J A;  2PU4 A;  1Q2Q A;  2VGL S;  4X55 A;  4R4S A;  1XXM A;  1K56 D;  2V8F A;  4YFM A;  2JKT I;  2R78 A;  2ZM2 A;  1GA9 A;  5HAI A;  1MKM A;  2VLG A;  3ZFZ A;  1V9Y A;  1OTB A;  1Z09 A;  4E3I A;  3N8S A;  4PPR A;  2JKR I;  3DWK A;  1P97 A;  4KZB A;  5DFX A;  3A3I A;  4Y2F A;  3V3R A;  4B93 A;  2HP6 A;  1K55 A;  2CC1 A;  1T1C A;  2WZX A;  3DBA A;  3DW0 A;  4IUH A;  5EPH A;  3BFD A;  2X01 A;  4R3J A;  3VV4 A;  3PBR A;  1ES5 A;  4DXB A;  3LR3 A;  1BLS A;  1NYM A;  1IEM A;  1LLB A;  1TVF A;  4QB8 A;  4N1H A;  1YLP A;  4WZ4 A;  2VA0 A;  4D2O A; 
#chains in the Genus database with same CATH homology
 3GMW A;  2P9V A;  3DTM A;  4BL3 A;  5EVL A;  2ZJ9 A;  3MZD A;  2WAE A;  1FQG A;  1PWD A;  4KZ3 A;  4MBH A;  4DKI A;  4R0Q A;  3VFH A;  4KG2 A;  4C3Q A;  1ONG A;  3HUN A;  1QMF A;  4U3T A;  3SH7 A;  3WS1 A;  1NY0 A;  1N9B A;  3IHB A;  3NDE A;  2WKE A;  4RX2 A;  5CGW A;  2ZC6 B;  5EVI C;  5EVI B;  4WMC A;  5KSC A;  1XA1 A;  4QU3 A;  3GQZ A;  3ITA A;  4MEZ A;  5CHJ A;  5CTN A;  1K38 A;  3W4Q A;  1SKF A;  5A92 A;  2OLU A;  2XFT A;  4P0M A;  5FQQ A;  5M18 A;  3C4O A;  4GB7 A;  3VSK A;  3UPP A;  4UA9 A;  4K0X A;  3B3X A;  1IYQ A;  4XUX A;  5E43 A;  5E2G A;  1G6A A;  5HFO A;  1E4D A;  1W79 A;  1XGJ A;  2Y2I A;  1Q2P A;  5M1A A;  5TFQ A;  2DCF A;  1FSY A;  1BLP A;  2Y4A A;  1L2S A;  4QY5 A;  3WS2 A;  3WS0 A;  2XH9 A;  3IF5 A;  1SDN A;  1FSW A;  1HTZ A;  3M6H A;  4E3M A;  5HAP A;  4PM8 A;  4E3N A;  2HDS A;  3A3F A;  5GHX A;  1K54 C;  2ZLY A;  3UDX A;  1PW1 A;  2Y91 A;  1LL9 A;  3LY4 A;  5FI6 A;  1BUL A;  3ZNT A;  3G31 A;  1LI0 A;  5FQJ A;  1YLY A;  2IWB A;  1ES4 A;  2ZC7 A;  4GD8 A;  1IKI A;  4QY6 A;  2V1Z A;  1O7E A;  5AQA A;  3OPH A;  2Y2J A;  4H8R A;  1L0G A;  1BT5 A;  4OPQ A;  4R1G A;  2ZC4 B;  4E3O A;  5DF9 A;  1BTL A;  1FCM A;  3C7U A;  1KGE A;  1ES2 A;  2HPB A;  2X71 A;  4N92 A;  1EWZ A;  4EUZ A;  4XXR A;  4U0X A;  5FQI A;  3MKF A;  5FQM A;  2Y2N A;  2WUQ A;  2HP5 A;  1TDG A;  2VGK A;  4PM7 A;  3A3D A;  4Y7P A;  1ZC2 A;  2J9O A;  3IF6 A;  3IH8 A;  4YIN A;  1RGY A;  3HLD A;  3SH8 A;  2XD5 A;  3CZD A;  4PM9 A;  2XR0 A;  1GHI A;  1XPB A;  3UNW A;  4P87 A;  1GCE A;  3Q1F A;  4OOY A;  2HDR A;  3IWO A;  4E3J A;  5IHV A;  4DF6 A;  3UN7 A;  3VMA A;  3D4F A;  3OCL A;  2XEP A;  3PAE A;  1K6S A;  2WYX A;  3NBL A;  1K57 C;  3BEC A;  4JF5 A;  2DRW A;  4RA7 A;  3SH9 A;  1S0W A;  3Q82 A;  2HDU A;  4ZJ2 A;  1Z6F A;  1I5Q A;  3ZDJ A;  3EQU A;  2V20 A;  3IWQ A;  3FWL A;  3M2K A;  4GD6 A;  3BEB A;  4JXG A;  4S2P A;  5FDH A;  2IWD A;  5EUA A;  1CI8 A;  4EV4 A;  1K6R A;  4BJP A;  4OKP A;  1YLZ A;  1MWS A;  2G2U A;  1G68 A;  2XDM A;  4MLL A;  1PWC A;  2HDQ A;  5FAO A;  1FCO A;  2Y2H A;  3Q7V A;  4LV0 A;  1S6R A;  4S2K A;  4BL2 A;  2JCH A;  4L0L A;  1TEM A;  4OOL A;  4OPY A;  3SS4 A;  4IED A;  2Y2L A;  1JTG A;  4WEL A;  1KE4 A;  1O07 A;  5U47 A;  5FI2 A;  4NK3 A;  5CEC A;  1BSG A;  1KVL A;  5E2F A;  4OQI A;  4X69 A;  4LV1 A;  2EFX A;  2R9W A;  1HD8 A;  1CI9 A;  4GOG A;  3NI9 A;  3Q7Z A;  4NET A;  1JWV A;  4JBF A;  5EVI A;  4BEN A;  5EOE A;  3EQV A;  1KGG A;  3VP4 A;  4KQO A;  4DE0 A;  1LI9 A;  2H10 A;  5AQB A;  3UE3 A;  2H0T A;  1MKI A;  5FAP A;  4PMA A;  3ITB A;  4LV2 A;  4Y0T A;  2WKI A;  1NJ4 A;  5I94 A;  3BFF A;  3NDG A;  1MXO A;  3P98 A;  4JF6 A;  3OCN A;  1XP4 A;  4JXW A;  1L0F A;  1H8Y A;  2P74 A;  3E2K A;  3UO9 A;  4ZDX A;  3ZG7 B;  4P6B A;  4DDS A;  1J9M A;  3MFD A;  3GTC A;  3HVF A;  2BG1 A;  4GZB A;  1E3U D;  1MWT A;  2I72 A;  1SCW A;  3HLF A;  1K54 A;  2WAF A;  4JXV A;  3IXG A;  4OPR A;  3ZVW A;  3BM6 A;  3AGE A;  3IQA A;  5G18 A;  2EXA A;  4HBT A;  4KZ9 A;  3G2Z A;  1NXY A;  4U0T A;  3VP0 A;  4BD1 A;  1HZO A;  2EX8 A;  3RXW A;  3ZGA B;  2PU2 A;  3V39 A;  5DF7 A;  5TGF A;  4PM5 A;  2RL3 A;  5L2F A;  1MBL A;  4OP5 A;  4KG5 A;  2ZC3 B;  5F1G A;  5CRF A;  4JXS A;  2J9P A;  4JLF A;  1K4F A;  1BZA A;  4FSF A;  5TR7 A;  3ZG5 A;  5HAQ A;  4S2O A;  2XFS A;  4HEF A;  3PBN A;  4QJG A;  2ZM0 A;  3IWI A;  4KZ5 A;  4EQI A;  3CJM A;  5DTS A;  4OP8 A;  4UA7 A;  1RP5 A;  3MBZ A;  3UDF A;  3N8L A;  3N6I A;  2OV5 A;  3OZH A;  4KZ4 A;  4OVD A;  1JVJ A;  2Q9N A;  1M6K A;  2Z2L B;  3VP2 A;  3BRM A;  1PI4 A;  1K57 A;  4LCM A;  4B4X A;  4OLD A;  1IYO A;  1QME A;  2ZQ9 A;  4IBR A;  2PBY A;  4WMC D;  1ERQ A;  1HVB A;  3HRE A;  2XLN A;  4CJN A;  3CMZ A;  1PZP A;  4RVA A;  2Q9M A;  4FCF A;  3W4P A;  4GDB A;  3C5A A;  1ESI A;  2EX2 A;  3C4P A;  2Y2K A;  2QPN A;  4IVI A;  2ZQD A;  4P85 A;  4DRT A;  1W7F A;  3ZG9 B;  5FAT A;  4S2I A;  1H8Z A;  1FOF A;  4FH2 A;  2Y2Q A;  4GDN A;  4WM9 A;  4FD8 A;  1YM1 A;  1PIO A;  4KZ6 A;  3ZG8 B;  1SDE A;  4KZ8 A;  3QHY A;  3FYZ A;  1KE0 A;  1K56 A;  2XF3 A;  3PTE A;  4KEN B;  5J8X A;  2XD1 A;  4X68 A;  3UPN A;  3WWX A;  5CHM A;  3CG5 A;  3M2J A;  5FA7 A;  3IXH A;  5EEC A;  1MY8 A;  2Y2P A;  3BLS A;  2WK0 A;  1K25 A;  4OH0 A;  3ZCZ A;  2GDN A;  1PZO A;  2XGN A;  3G32 A;  3HUM A;  4LV3 A;  2G2W A;  4E3L A;  5BOH A;  4QHC A;  2R9X A;  3FKV A;  3ZHH A;  3IHA A;  1FCN A;  5GHZ A;  2ZMA A;  2J7V A;  2C5W B;  1YMX A;  2FFY A;  4N9L A;  2ZM8 A;  3GRJ A;  5FAQ A;  3N7W A;  3TSG A;  3QNC A;  3NCK A;  1I2W A;  5M19 A;  5CED A;  4OLG A;  4ID4 A;  4B88 A;  4Y0U A;  5FSR A;  3O87 A;  1ERM A;  1NRF A;  3I7J A;  1IEL A;  3AGD A;  5E2E A;  1SHV A;  5KMW A;  3M6B A;  1L0E A;  2OLV A;  1EI5 A;  1XX2 A;  4HES A;  4WEJ A;  4M3K A;  3IXB A;  1XGI A;  4ZAM A;  1CEG A;  4OQH A;  1MWU A;  4O7D A;  3SS3 A;  3MZE A;  3LY3 A;  3QNB A;  4RX3 A;  2ZC5 B;  2DNS A;  4ZBE A;  3PBS A;  5KSH A;  3FKW A;  1MWR A;  3VSL A;  2WKH A;  5DVA A;  2WGW A;  1XA7 A;  4UAA A;  5D3O A;  4S2L A;  1PYY A;  2ZQ7 A;  2OSU A;  5CHU A;  1E3U A;  2HP9 A;  4DDY A;  3HLC A;  1GHM A;  4OOM A;  3BYD A;  4X56 A;  3VFF A;  4KZ7 A;  5GLC A;  1BUE A;  3N8R A;  5A91 A;  4CPK A;  2ZQ8 A;  3MXS A;  4KQR A;  1L0D A;  5GLD A;  4A5R A;  1AXB A;  1JWZ A;  4LCL A;  4EBL A;  1DY6 A;  5CTM A;  4GNU A;  3G35 A;  1LHY A;  4OQ0 A;  1CK3 A;  3NY4 A;  4E6X A;  3NIA A;  4QD4 A;  3VOY A;  3TG9 A;  3PBT A;  3O86 A;  2RCX A;  4UHU A;  5A90 A;  1ZG4 A;  4N1X A;  2C6W B;  3OC2 A;  5HW3 A;  3G34 A;  3HBR A;  2JE5 A;  1KVM A;  2WGW B;  4E3K A;  3MKE A;  2JBF A;  4S2N C;  4ZJ3 A;  3PBQ A;  3HLG A;  1CEF A;  4GKU A;  3GR2 A;  1DJA A;  5EVI D;  3VOZ A;  4R4R A;  4PM6 A;  1YMS A;  4ZJ1 A;  1K4E A;  1ESU A;  2ZQC A;  4UA6 A;  5F82 A;  3SOI A;  4WZ5 C;  5DF8 A;  3ZVT A;  4FH4 A;  2J8Y A;  1N4O A;  4IBX A;  1NZU A;  3IT9 A;  1VQQ A;  3AGF A;  3ZNY A;  1PWG A;  3VP3 A;  4RYE A;  5CGX A;  2EXB A;  1K55 C;  3Q81 A;  3LEZ A;  4K0W A;  3ISG A;  2A3U A;  3FV7 A;  1BLC A;  1NZO A;  3N4I A;  3S22 A;  4KQQ A;  4XUZ A;  4MNR A;  2WGI A;  3IH9 A;  3WS4 A;  1IYP A;  3G4P A;  1ZKJ A;  4WEK A;  4Y0O A;  1XKZ A;  1KE3 A;  4S2M A;  1C3B A;  3V3S A;  1YQS A;  1U60 A;  3C7V A;  5E2H A;  5FI7 A;  3P09 A;  2EX9 A;  3ZG0 A;  4ZTK A;  4DE3 A;  4X53 A;  1LL5 A;  2X02 A;  3MXR A;  5FQ9 A;  2A49 A;  5CXW A;  2E8I A;  2Y2M A;  1IYS A;  2EX6 A;  4Z9Q A;  3RJU A;  2P9V B;  4C6Y A;  4JF4 A;  3SS5 A;  3V50 A;  4F94 A;  5F1F A;  4X6T A;  3OPL A;  2EFU A;  1KDW A;  4S2J A;  4HBU A;  1ONH A;  3OPP A;  4MBF A;  5JYP A;  3OPR A;  4EBP A;  5KZH A;  5AQ9 A;  5FAS A;  1OME A;  3S4X A;  3MZF A;  4IVK A;  2Y2G A;  3GV9 A;  3G2Y A;  5GLA A;  4DE2 A;  3HLE A;  5GHY A;  2QMI A;  1GHP A;  5AQ7 A;  2WGV A;  2B5R A;  5HAR A;  4DE1 A;  2XQZ A;  3DWZ A;  4B4Z A;  5GL9 A;  4BD0 A;  4DXC A;  3VP1 A;  3HL9 A;  1ALQ A;  2BLS A;  3WRT A;  2UWX A;  3WS5 A;  1RGZ A;  3UE1 A;  1FR6 A;  1WE4 A;  1YLJ A;  3PBO A;  4OON A;  4R23 A;  3PAG A;  3WRZ A;  2H5S A;  1RCJ A;  1Y54 A;  3LO7 A;  4GN2 A;  5A93 A;  1M40 A;  5DTT A;  3UE0 A;  5EOO A;  5HX9 A;  1JTD A;  4LEN A;  1DJC A;  1MPL A;  1PW8 A;  1VM1 A;  4KZA A;  1NYY A;  3A3E A;  1YT4 A;  1BLH A;  3GSG A;  5JYO A;  2IWC A;  4MBK A;  3V5M A;  2FFF B;  3GVB A;  2ZQA A;  2VGJ A;  1DJB A;  5DTK A;  4KG6 A;  4N9K A;  2PU4 A;  3BLM A;  1Q2Q A;  2H0Y A;  4X55 A;  4EWF A;  1FR1 A;  4R4S A;  3O3V A;  3RXX A;  1GA0 A;  2V2F F;  4WYY A;  1PI5 A;  4Q8I A;  2WZZ A;  1XXM A;  1W5D A;  1K56 D;  1TDL A;  1W8Q A;  2XK1 A;  3BFG A;  4YFM A;  2ZM2 A;  1GA9 A;  5HAI A;  5CER A;  3FZC A;  3ZFZ A;  4OPZ A;  1H5X A;  1JWP A;  3NC8 A;  4E3I A;  3IXD A;  4K91 A;  3N8S A;  4S2N A;  3IF6 B;  4PPR A;  3IF6 C;  1YLW A;  3BFE A;  1I2S A;  5CGS A;  3DWK A;  3TOI A;  1WYB A;  4EBN A;  4KZB A;  4WZ5 A;  2Y2O A;  3A3I A;  4JPM A;  1ERO A;  5GLB A;  3HLB A;  3V3R A;  1ZG6 A;  3HUO A;  3Q07 A;  2HP6 A;  1K55 A;  1WYC A;  2Y59 A;  3G30 A;  2CC1 A;  2ZD8 A;  3O88 A;  2WZX A;  1W8Y A;  3DW0 A;  5HL1 A;  5EPH A;  3BFD A;  2X01 A;  1IKG A;  4R3J A;  2QZ6 A;  4C75 A;  3LCE A;  3W8K A;  3PBR A;  1ES3 A;  1KGF A;  2JC7 A;  4JKT A;  3UY6 A;  1ES5 A;  4BQM A;  4DXB A;  4BLM A;  5F83 A;  1BLS A;  3S1Y A;  5CEB A;  1NYM A;  1E25 A;  1YLT A;  3UDI A;  5FQK A;  3W4O A;  1IEM A;  1LLB A;  4R3B A;  2WAD A;  1TVF A;  3A3J A;  3JYI A;  4E6W A;  4QB8 A;  4WBG A;  2Y55 A;  3UPO A;  4N1H A;  3Q7V B;  3E2L A;  1KDS A;  1YLP A;  4OQG A;  3BFC A;  4WZ4 A;  2Z2M B;  3HLW A;  5EE8 A;  4D2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...