4RX3A

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMGTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rx3A00
3W4PA 2EXAA 3FZCA 4KG5A 4ZJ3A 2HDSA 4RX3A 5GHXA 2EFXA 3NCKA 3EQVA 1NY0A 5CHJA 1M6KA 2R9XA 1GA0A 3C7UA 4IBRA 3WRTA 3G2YA 2VGJA 2JBFA 2QZ6A 2FFFB 1JTGA 3C5AA 4IEDA 2WKHA 5EPHA 2IWDA 3IXHA 4DE0A 1SDNA 3N8SA 1YM1A 3QNCA 3Q7VB 4OP8A 1XA7A 5DF9A 5FQ9A 1K6RA 1LL5A 3Q1FA 1ESIA 5FI6A 2RL3A 5FATA 1NZUA 2J7VA 4QB8A 1HD8A 3VP3A 2B5RA 3WS1A 3FKWA 4ZTKA 4BQMA 4PM7A 1K55C 2OSUA 2DRWA 1SCWA 3DTMA 3HLDA 1AXBA 5DF7A 2IWBA 1XXMA 4ZBEA 5TGFA 4HBUA 2XD1A 2WGWB 2ZQCA 3QHYA 5KSCA 3IF6A 2RCXA 1XGIA 2ZLYA 3HLBA 3C4OA 5HAPA 1MWUA 4P6BA 4MEZA 2Z2MB 2ZQ7A 5FA7A 3CJMA 1ERMA 1HZOA 3UE3A 5GHZA 1JTDA 4BL3A 3VFHA 3MZFA 3ZNYA 3Q07A 4DDYA 3VP1A 2XQZA 5GLCA 4B4ZA 3ZG8B 4BLMA 1XGJA 4Y0TA 4OOLA 2ZD8A 5FQQA 2OV5A 4BJPA 5CEDA 5AQ7A 2IWCA 5TFQA 1WYBA 3IF6B 2GDNA 3RXXA 1NRFA 3FKVA 1HVBA 2R9WA 4E3MA 2Q9MA 2Y2HA 4ZJ1A 3NDGA 1PWDA 4WZ4A 3PBNA 3ZVTA 4EBLA 5A90A 3ZGAB 1RGYA 1IKIA 1WYCA 1PW8A 1IEMA 3WS4A 1ERQA 2PBYA 3W8KA 2Y59A 4M3KA 5FQMA 3S4XA 2Z2LB 3GQZA 1YLPA 1FR6A 3V50A 4N9KA 4OPQA 5F82A 1K54C 4WMCA 4OQGA 3VSKA 3MXSA 2CC1A 2WK0A 2ZQDA 2HDQA 5E2GA 5HAQA 1SDEA 2BLSA 4LV2A 2OLVA 2EFUA 2ZC7A 4L0LA 2Y2QA 4U3TA 3N8RA 1GHMA 5EVIC 3V3SA 4IVIA 4EQIA 4GOGA 1PZPA 3BECA 5FI7A 3OC2A 5FASA 4N1HA 3NBLA 1YLZA 3S1YA 4C75A 3ZNTA 4WBGA 3V3RA 1XA1A 3HUOA 4N92A 3V39A 1H8YA 3IWOA 4JXVA 3G2ZA 3NDEA 4FH4A 4OQ0A 3PBQA 1GA9A 4KG6A 5EVIB 2DNSA 4WMCD 4B4XA 1BULA 2H10A 4U0XA 4KZ6A 2QMIA 1RP5A 1NJ4A 3TSGA 4KG2A 1LI9A 3PBRA 3N8LA 3HREA 3N7WA 1NYMA 2XGNA 1GHIA 3UDIA 4S2LA 4H8RA 1W8YA 2J9PA 3A3DA 1NXYA 4K0WA 4E3NA 4OPYA 5CRFA 4S2NA 1SHVA 3Q7ZA 5FAPA 1H8ZA 4Y0OA 3ZVWA 3FWLA 4OKPA 5E43A 3AGEA 5A92A 4N9LA 1ALQA 4LV0A 4KZ3A 4WEKA 4KZAA 1I2SA 2A49A 2WGVA 3IT9A 3D4FA 4FD8A 1QMEA 3CMZA 3BRMA 4WYYA 4UAAA 4MBFA 3HUNA 3TOIA 2P9VA 4X55A 3A3FA 5AQAA 2JC7A 3VOZA 2WGWA 2Q9NA 3BFCA 1GCEA 5D3OA 2HP5A 4OQHA 4QY5A 1JWZA 1ZG4A 1IELA 1FQGA 3OZHA 1YLYA 1LL9A 3ZHHA 4R4RA 5G18A 4DKIA 3N6IA 5CXWA 3M2KA 4UA7A 1K55A 2Y2NA 5E2HA 3NI9A 3G35A 3LO7A 1MWSA 3UN7A 3IH8A 3IXDA 4GDNA 1I2WA 4B88A 1E25A 2XH9A 2H0TA 1Q2QA 4DE1A 1L0EA 4X53A 1KGGA 3Q7VA 1ZC2A 5EVID 2Y2IA 5HAIA 1BZAA 1FCNA 2J8YA 3PTEA 3UE0A 3ZG7B 5EVIA 1PW1A 5KSHA 4S2NC 2Y2KA 3ZDJA 2V1ZA 4JKTA 5F83A 1FSWA 3C4PA 3C7VA 2C6WB 3GMWA 1NYYA 3SH9A 3HLEA 3RJUA 1OMEA 2FFYA 1ES4A 3E2KA 3BYDA 2J9OA 4MLLA 5FSRA 4GD6A 2X02A 4WZ5C 1JWPA 4XXRA 3VOYA 5AQ9A 2EX9A 1DJCA 5DVAA 3FV7A 1S0WA 2G2UA 4Z9QA 2Y55A 4OOYA 3SH8A 4C3QA 4EBPA 1KGEA 4DRTA 1K56D 3MKEA 3VSLA 2WAFA 2XF3A 2ZC4B 3GV9A 3OPRA 4UHUA 5E2EA 4E3KA 2ZMAA 1K56A 4LV1A 1IYQA 3OCNA 3MBZA 1VM1A 3GVBA 1E3UD 1K6SA 2XD5A 4UA9A 2ZQ9A 5FQIA 1KE0A 1FSYA 5CTNA 2ZQ8A 2WAEA 3BFFA 3ITAA 1GHPA 1SKFA 1XP4A 3IHBA 3EQUA 4X68A 3UY6A 2ZC5B 4OP5A 1L0DA 4DF6A 5GL9A 1MBLA 2V2FF 3JYIA 5CHUA 1YQSA 1ZKJA 1K54A 5JYPA 4PM5A 1BLCA 1S6RA 1CEGA 3E2LA 4KZ5A 3G31A 2ZQAA 4KZ8A 4MBKA 4N1XA 2XK1A 4U0TA 2H5SA 5EE8A 3UPNA 3LY4A 1FR1A 1JWVA 4Y0UA 1KVLA 2A3UA 2XFTA 4GD8A 2ZM0A 3B3XA 4WM9A 1MWRA 5F1FA 1ONGA 3A3IA 4YINA 3UE1A 1PYYA 1EWZA 5DTTA 5EUAA 4QY6A 3MKFA 2Y2MA 4KZ9A 5GLBA 5U47A 2WYXA 1Y54A 4WZ5A 4GNUA 1O07A 2EX8A 1ES2A 1TVFA 5FQKA 4K0XA 5HARA 1C3BA 4MBHA 3SOIA 2BG1A 4HBTA 4OLGA 5HL1A 3IXBA 2WGIA 4GKUA 4E3IA 1K57A 1MY8A 3P09A 1YMSA 1IYPA 1ZG6A 3VP4A 4ID4A 2JE5A 3G30A 1DJAA 4QU3A 4LV3A 1TDLA 3LEZA 4OPZA 1YLJA 2OLUA 3DW0A 3HLWA 4WELA 3SS5A 5FQJA 1IYSA 4S2IA 3VFFA 1I5QA 1WE4A 3M2JA 5CEBA 5TR7A 4YFMA 4QJGA 5M19A 3IQAA 2HP9A 3HUMA 3WRZA 5JYOA 1Z6FA 4JF4A 2G2WA 3V5MA 2XFSA 1ES3A 2EX6A 2V20A 4OVDA 1KE4A 3BFEA 3TG9A 5F1GA 4S2OA 4XUZA 4RA7A 1PZOA 2Y2JA 2ZJ9A 3ZG5A 5IHVA 4S2PA 3MXRA 3W4OA 1MXOA 3GTCA 4R1GA 3BLSA 4RX2A 5CERA 4R0QA 4PM8A 2ZM2A 4JF6A 2ZC3B 3NY4A 1BUEA 4UA6A 1K57C 1MPLA 4GB7A 4CJNA 5A93A 1G68A 4EWFA 3AGFA 3PBSA 4IBXA 5I94A 3A3EA 4R3JA 4MNRA 3FYZA 3GSGA 2WZZA 5GLDA 3A3JA 3IXGA 1KVMA 4RVAA 3UNWA 3HBRA 4OOMA 4FSFA 4R23A 1L0GA 1W8QA 4S2JA 4RYEA 2P9VB 3OPHA 1LI0A 1RCJA 3Q82A 3VP0A 4BD0A 5HX9A 2Y2LA 1XX2A 4OONA 4P87A 1H5XA 2WKIA 2Y2GA 4KQOA 1E3UA 5EECA 4HESA 1Q2PA 4DDSA 3AGDA 1QMFA 3PAEA 3MFDA 4X56A 1IYOA 1RGZA 2XLNA 3BFGA 4P0MA 4S2KA 4JXWA 4OH0A 5FDHA 2Y2PA 4HEFA 4ZJ2A 4D2OA 3GRJA 1CI8A 2VGKA 5EOEA 1KDSA 3G34A 3VMAA 4ZDXA 3MZDA 4NK3A 1O7EA 2JCHA 1BLSA 1TEMA 1YT4A 1KE3A 3O86A 1JVJA 1EROA 1PI4A 4JLFA 1N9BA 4JXSA 4KQRA 4E3JA 3UPOA 2P74A 2WKEA 1KGFA 4PM9A 4DXCA 1YLTA 2ZM8A 1L2SA 1NZOA 1PIOA 1W79A 5L2FA 3HLFA 4LCLA 3LY3A 3HL9A 4R4SA 1FCMA 4DE3A 4PMAA 4E3LA 3WWXA 1PWGA 1J9MA 2HDRA 3CG5A 3IH9A 1LLBA 4LCMA 3ZG0A 3HVFA 3O88A 1ES5A 5A91A 3UDFA 4C6YA 1YLWA 4Q8IA 2Y2OA 1CK3A 2DCFA 1M40A 5DTSA 3NC8A 4GN2A 2HDUA 4JPMA 4OLDA 4QD4A 3UPPA 1KDWA 4KZBA 4A5RA 2XR0A 3N4IA 4PPRA 1BLPA 2ZC6B 1ESUA 3BEBA 4E3OA 4Y7PA 2X71A 5CTMA 5HW3A 2HPBA 3I7JA 5FAOA 3OPLA 4KENB 2Y4AA 3IHAA 4JF5A 5HFOA 3S22A 3SS3A 3PBOA 5CGSA 3IWQA 5GHYA 4GDBA 3NIAA 2EXBA 3OPPA 3M6BA 3RXWA 4EBNA 4DXBA 1FOFA 1LHYA 2EX2A 3Q81A 3SS4A 3ZG9B 3O3VA 4X6TA 3CZDA 1E4DA 4KZ4A 2QPNA 5CGWA 5EVLA 3SH7A 1W7FA 2Y91A 3G32A 3ITBA 4KQQA 4XUXA 4S2MA 2PU4A 1G6AA 3G4PA 1K38A 4IVKA 1CI9A 1YMXA 1BLHA 3ISGA 2WZXA 5KZHA 4OQIA 4LENA 4R3BA 2XDMA 3M6HA 4QHCA 4GZBA 5GLAA 4PM6A 1IKGA 3HLCA 4O7DA 5FI2A 5BOHA 3IF6C 3O87A 1BSGA 3BFDA 1PWCA 4EUZA 5EOOA 4K91A 5CHMA 5M1AA 3BLMA 2UWXA 4JXGA 1BTLA 3VP2A 1TDGA 2C5WB 2H0YA 4DE2A 4FCFA 2WADA 5E2FA 2X01A 1MKIA 1N4OA 1XKZA 4BENA 4E6XA 5CECA 4ZAMA 4CPKA 4BL2A 5M18A 3ZCZA 2E8IA 4JBFA 3UDXA 3PAGA 5KMWA 5AQBA 1FCOA 3WS5A 1CEFA 3BM6A 2XEPA 4WEJA 2I72A 4KZ7A 4X69A 2WUQA 5J8XA 2HP6A 3IF5A 3P98A 4FH2A 5DTKA 3W4QA 1MWTA 4E6WA 1L0FA 1ONHA 1BT5A 1U60A 3DWKA 4OPRA 1K4FA 1W5DA 1EI5A 1K25A 3LCEA 4F94A 5DF8A 3ZFZA 4NETA 1HTZA 3QNBA 5FAQA 1PI5A 1DJBA 3MZEA 4P85A 3WS0A 4BD1A 3IWIA 1VQQA 2PU2A 1DY6A 3DWZA 1XPBA 5CGXA 3WS2A 3UO9A 3HLGA 1K4EA 3OCLA 4EV4A 3PBTA 3GR2A
chains in the Genus database with same CATH superfamily
4KG5A 3CLOA 4ZJ3A 5GHXA 3NCKA 1NY0A 1T19A 2VGJA 2FFFB 5EPHA 4DE0A 1SDNA 2OWHA 1VB6A 5FQ9A 1K6RA 3Q1FA 1XFNA 1TD5A 3UB6A 3VP3A 1S1YA 3UMEA 3WS1A 1N9LA 3FKWA 4ZTKA 4BQMA 5IS1A 1DP8A 5TGFA 4HBUA 3QHYA 3HLBA 3C4OA 1MWUA 3LIFA 1LL8A 4MEZA 4LRXC 5FA7A 1ERMA 3HJKA 5GHZA 3MZFA 3ZNYA 3Q07A 3VP1A 5GLCA 4BLMA 3ZG8B 5IT5A 2L4RA 4H6JB 2H28A 3E4QA 2PR5A 4EU0A 4E3MA 3UB9A 4F3LA 1LSXA 1PWDA 3PBNA 3ZVTA 1YPRA 5A90A 3ZGAB 3L7HA 2E8JA 1PW8A 4UQIS 3W8KA 4M3KA 5FQMA 3GQZA 1CF0A 1FR6A 3VSKA 5L8MA 2CC1A 2WK0A 2ZQDA 2HDQA 3EOIA 1D06A 3PR6A 2EFUA 1GHMA 3MQOA 4EQIA 1MC0A 3OC2A 5G4YA 3ZNTA 4B9OA 4JXVA 3S7NA 2DNSA 4KZ6A 5HDCA 1LI9A 4NKPA 3N8LA 3N7WA 2XGNA 4S2LA 2J9PA 4E3NA 1J3WA 1SHVA 1OTAA 3Q7ZA 5FAPA 4Y0OA 4WEKA 4KZAA 4WYYA 3C38A 1F2KA 3HUNA 4X55A 4NXBA 4IUKA 5AQAA 4QPRA 2JC7A 3VOZA 5EM1A 3BFCA 4QY5A 2PBDP 1IELA 3K3DA 5AJGA 2VX8A 3N6IA 4NEED 3S7OA 3IXDA 1TS6A 4B88A 2H0TA 4DE1A 5HAIA 3F1NA 2JKRI 2Y2KA 2Z6DA 2V1ZA 4JKTA 4NXEA 5J7EA 3C7VA 1H0MA 4ARZA 3RJUA 2QJ5A 2FFYA 5F69A 2J9OA 5FSRA 4GD6A 4WZ5C 1JWPA 4Z9QA 4RQ9A 4OOYA 1KGEA 3BQ8A 1K56D 1F9IA 1VHMA 4UHUA 3OPRA 4B93A 2ZMAA 2HGVA 3JPUA 3UY6A 2ZL1A 2ZC5B 5GL9A 3KX0X 3NULA 2VK3A 4EXOA 3E2LA 4KZ5A 4MBKA 4N1XA 4U0TA 5EE8A 2H5SA 1KVLA 1ONGA 1VETB 2WKQA 3CUEA 4YINA 3UE1A 5EUAA 3MKFA 5GLBA 5U47A 1K0KA 1O07A 3R4KA 1ES2A 3JVUA 2KX6A 3S7QA 3F1OB 3TW8A 1ZG6A 1DJAA 4M4XA 1YLJA 3DW0A 3HLWA 3SS5A 2DMWA 1IYSA 5CEBA 4QJGA 4YFMA 3MF0A 3LI9A 4LGWA 4JF4A 2G2WA 3T50A 2V20A 4X25A 3CWFA 2EWVA 3IX8A 4XUZA 4GJ4A 4WL9A 5IHVA 4HP4A 3W4OA 4R1GA 2ZM2A 3LR5A 3NY4A 1K57C 1MPLA 4CJNA 1G68A 5I94A 4R3JA 4MNRA 5GLDA 2KDKA 4XT2A 2W1RA 4S2JA 2P9VB 3OPHA 1LI0A 3VP0A 1XX2A 2PDRA 5CX7A 2OAQ1 5DFXA 3IBJA 4X56A 4Q0HA 3T4OA 2KLIA 4OH0A 4HEFA 5J3WA 3VMAA 3MZDA 5AVEA 4JLFA 3PXPA 3UPOA 1YKDA 4DXCA 2QJ7A 1NZOA 4NXFA 1W79A 5EM0A 3HLFA 2HJ9C 3WWXA 1J9MA 3ZG0A 3UDFA 2L1MA 4C6YA 2Y2OA 2DCFA 5DTSA 3B33A 3RFBA 4EETB 2IA2A 5HDSA 2KOIA 1W63Q 2XR0A 3H82A 5HWVA 2PAVP 4E3OA 1HLUP 2YKFA 5HW3A 3E4PA 5FAOA 3SS3A 5CGSA 3NIAA 3M6BA 4Y17A 1VEUA 2O0YA 5CGWA 2Y91A 3MQ0A 4OQIA 4LENA 3B47A 2XDMA 4X1LA 3LIEA 4GZBA 4CLCD 4PM6A 2VZWA 3IF6C 5CHMA 3BLMA 1Z09A 3K3CA 4DE2A 2X01A 5CECA 1MKIA 3OOVA 1XKZA 2W3FA 4PHTA 2ZOIA 3ZCZA 2E8IA 4JBFA 3PAGA 3T4JA 5AQBA 4FUWA 3BM6A 4FOFA 4KZ7A 4X69A 3IF5A 4R70A 2VLGA 1BT5A 2INWA 1W5DA 1K25A 4Y13A 5DF8A 3C8CA 4NETA 5FAQA 3MZEA 2O9AA 3IWIA 3WS2A 5A8BA 3LI8A 3UO9A 4JGOA 1K4EA 5J4EA 2ZMFA 4ZJ1A 3PBTA 3GR2A 4O8GA 2EXAA 3FZCA 3ZQ5A 4RX3A 5L09A 4IBRA 1G28A 2HV1A 3T1QB 3C5AA 2IWDA 3IXHA 1WA9A 4OP8A 2J7VA 2ACGA 5HZHA 4NG2A 4PM7A 1FILA 1K55C 2DRWA 3CUEC 3DTMA 5DF7A 2IWBA 5AVFA 3T1RA 2QKPA 2B95A 2WGWB 3IF6A 3T4SA 2W1TB 1ACFA 1Y28A 4L9EA 4P6BA 3CJMA 1BYWA 4I3JA 3UE3A 4DDYA 2XQZA 5HDDA 4Y0TA 1OTDA 2XA7S 2OV5A 1OT9A 2IWCA 5TFQA 1WYBA 3IF6B 1N9NA 2EA9A 2R9WA 4WN5A 4HJ3A 1PFLA 1YSQA 2QWSA 4ME4A 4OPQA 1K54C 3T4KA 5E2GA 5HAQA 2Y2QA 3V3SA 4DN0A 4IVIA 4O01A 1PZPA 2Z6CA 4C75A 3S1YA 1SKOB 3V3RA 1PNEA 3IWOA 3QP4A 3NDEA 2Q0OA 4OQ0A 1BULA 2QMIA 3LGOA 3TSGA 1NYMA 4H8RA 1W8YA 2PYRA 3A3DA 4IHQA 1NXYA 1CJFA 2W3HA 3FWLA 2W3DA 3AGEA 5A92A 1ALQA 2Y8HA 4LV0A 4BBTA 2WGVA 3IT9A 4HOIA 2WGWA 1T1AA 1GCEA 4GS9A 1FQGA 1YLYA 4CLCE 2PYPA 3ZHHA 4DKIA 4UA7A 3LO7A 4GDNA 4DJ3A 2XH9A 2AVXA 1ZTUA 3H7WA 1KGGA 3S7PA 1ZC2A 2Y2IA 1FCNA 3UE0A 3D3OA 2M7VA 3BJNA 1PW1A 3ZDJA 4LPZA 5I5LA 4DJ2A 1NYYA 3SH9A 1G5UA 1D1JA 4Q0JA 3F1OA 3BYDA 4MLLA 2X02A 2EX9A 5DVAA 1DP9A 2J3WA 2Y55A 4C3QA 2V8CA 2XF3A 3MFXA 1OJGA 1UGUA 1VM1A 3GVBA 1E3UD 2ZQ9A 2O9BA 5DKKA 1XP4A 3IHBA 4LFUA 4X68A 1L0DA 5CHUA 1YQSA 1IFQA 1K54A 4L9GA 5HSQA 1CEGA 1DRMA 2XK1A 1JWVA 4GD8A 1MWRA 4I3IA 4JGPA 2OWJA 2NUTC 1PYYA 1EWZA 5DTTA 4QY6A 2Y2MA 4KZ9A 1Y54A 3UB5P 3R7WB 4GNUA 2HJEA 2PD7A 1TVFA 1XFQA 1OTEA 4II7A 4HBTA 1T1BA 4JGQA 2PD8A 2FH5A 3IXBA 5DJTA 1K57A 3MJQA 3VP4A 4MDZA 4ID4A 1OTBA 2D02A 3LEZA 1TF1A 5HD3A 5EFWA 5FQJA 1I5QA 1WE4A 3M2JA 3EGXC 5HWWA 5M19A 4BBUA 3IQAA 3HUMA 4LRYC 3WRZA 3KSGA 5DFYA 1ES3A 3KSHA 5F1GA 4RA7A 3IS2B 4UEYA 4S2PA 3UB8A 3GTCA 3H9WA 5CERA 3BLSA 4RX2A 4PM8A 4LLOB 4UA6A 5A93A 1OTIA 4EWFA 3A3EA 3GSGA 2WZZA 3IXGA 3HBRA 4OOMA 4FSFA 2G7UA 1SZVA 1RCJA 2M1CA 4BD0A 4CLCC 4PAUA 2WKIA 3ULFA 5EECA 4HESA 1Q2PA 3DTIA 3DBAA 3P01A 3T4TA 1TS7A 5FDHA 2VJWA 2Y2PA 4ZJ2A 4D2OA 1CI8A 5EOEA 2JCHA 1BLSA 3O86A 1JVJA 4KQRA 4E3JA 1N9BA 1P9RA 2P74A 4EERA 1L2SA 3D72A 1ZHHB 4LCLA 3HL9A 1FCMA 4PMAA 2P7JA 1PWGA 3IH9A 2HDRA 3CG5A 4NXGA 4Q8IA 1ES5A 5A91A 1CK3A 1M40A 3LR4A 4UQIM 2HDUA 2I9VA 1KDWA 4KZBA 4A5RA 3N4IA 1ESUA 4Y15A 1S67L 3FG8A 3BY8A 1KOUA 4HNBA 3FC7A 1S4RA 3F1PA 5C5KA 5HFOA 3KO6A 3PBOA 5F6AA 3RXWA 3H7WB 4DXBA 1LHYA 3Q81A 2A24B 3UMDA 4EESA 2A2LA 5EVLA 2PU4A 3G4PA 4IVKA 1BLHA 3ISGA 3BY9A 2P04A 2UV0E 3U4LP 3L9KA 3M6HA 4QWOA 2J3TC 1S4SA 1IKGA 5FI2A 5BOHA 3LR3A 3O87A 2UWXA 1XJ4A 4JXGA 4ZRRA 3VE3A 1TDGA 2H0YA 4FCFA 3EWKA 4BENA 4CPKA 4BL2A 2XEPA 4KUKA 2XROA 1V9YA 3W4QA 1U60A 3DWKA 4OPRA 1EI5A 3LCEA 2GJ3A 3ZFZA 1HTZA 1PI5A 4AFIA 1GSXA 1T1CA 3W2ZA 1VQQA 2PU2A 1UWNX 4Y5FA 3LICA 1S1ZA 4WMCA 5EVEA 3W4PA 1F98A 2WKRA 2EFXA 3EQVA 2R9XA 3C7UA 1GA0A 2P08A 3TJZC 3QP5A 5DJUA 1JTGA 2WKHA 2GX5A 2V9AA 4P6ZM 3N8SA 1YM1A 3Q7VB 1XA7A 5DF9A 3IX3A 2RL3A 5FEGA 5FATA 1HD8A 1OPXA 2B5RA 5F5YA 2OSUA 1AXBA 1XXMA 4ZBEA 2XD1A 2NUPC 2ZQCA 4I39A 2OAP1 1P0ZA 2J80A 2RCXA 1A0KA 2ZLYA 4HY8A 3T4QA 5HAPA 3CI6A 4R3AA 4O0PA 2R78A 1MKMA 2ZQ7A 2J3TD 4P6ZS 4BL3A 3VFHA 1W63M 4X1MA 5MC7A 2ZD8A 2K7SA 2BTFP 2GDNA 2VV8A 3RXXA 3FKVA 1HVBA 1P97A 2Q9MA 2Y2HA 4EW7A 1FIKA 4EBLA 1IKIA 1GSWA 1IEMA 3DTKA 3WS4A 2PBYA 3NOPC 2Y59A 3S4XA 5L07A 1YLPA 2V1AA 5F82A 1NLYA 4OQGA 1L3LA 3MXSA 1UWPX 4IJGA 1SDEA 4LV2A 2OLVA 5LBRA 2ZC7A 4L0LA 4U3TA 3BECA 4KUOA 1CQAA 4N1HA 1YLZA 3TE8A 3UE6A 3T1SA 4N92A 1H8YA 2B02A 5EVIB 4WMCD 2H10A 1NJ4A 3LFVA 3C2WA 3PBRA 3HREA 4CQHA 1GHIA 2K2NA 3O5YA 4EUVA 4K0WA 5CRFA 5TBMB 2FZ0A 1H8ZA 5E43A 4OKPA 4KZ3A 1I2SA 2A49A 3D4FA 2JKTM 3CMZA 3BRMA 4MBFA 3TOIA 3HCYA 2P9VA 3A3FA 1STZA 5EV0A 2Q9NA 2O9CA 1LSWA 2HP5A 4OQHA 1ZG4A 3IX4A 3LR0A 4R4RA 1K55A 2Y2NA 3G6OA 3MR0A 1Q2QA 4X53A 3Q7VA 4K08A 1MZUA 1BZAA 3PTEA 2MJ6A 2M7UA 5EVIA 4Y3IA 5KSHA 2ZOHA 5F83A 3C4PA 4PKYG 2C6WB 3LIAA 2LB9A 3HLEA 2JKRM 4LRZE 3GDIA 1OMEA 4XXRA 5AQ9A 4GLQA 1S0WA 2G2UA 3SH8A 4DRTA 2WAFA 2ZC4B 4E3KA 2PHYA 3BWLA 3HJIA 1K6SA 4CLCB 1FSYA 2WAEA 3BFFA 1GHPA 1PRQA 3EQUA 1V9ZA 2PT7A 5L10A 1ZKJA 4MN5A 5JYPA 4PM5A 1BLCA 1S6RA 4KZ8A 3LIDA 3LY4A 1FR1A 4Y0UA 2A3UA 2XFTA 5F1FA 4WM9A 3B3XA 4HH3A 3A3IA 3T1XA 3QP6A 4MN6A 5IU1A 4WZ5A 3GECA 4K0XA 1C3BA 3SOIA 3V67A 2BG1A 5HL1A 2WGIA 5HD5A 4E3IA 1MY8A 3P09A 1YMSA 1IYPA 2JE5A 1XJ2A 4LV3A 1TDLA 3K2NA 2XRNA 3FPWA 3VFFA 4S2IA 2ZMVA 2VV7A 2HP9A 5JYOA 3V5MA 2XFSA 2QYBA 4OVDA 2ZBBA 4YOFA 4S2OA 3ZG5A 3MSHA 4R6LA 1XJ6A 4R0QA 3LIBA 3VE4A 3PBSA 4IBXA 2CMNA 1T18A 1KVMA 3UNWA 4R23A 4L9FA 4ETZA 4I38A 3Q82A 4ETXA 2Y2GA 2A24A 1E3UA 3T12B 3AGDA 3NOUC 5TBMA 1RGZA 2XLNA 4GHIA 4S2KA 4JXWA 4HH2A 3GRJA 4ZDXA 2PR6A 4NK3A 1O7EA 1TEMA 4JXSA 1EROA 2XA7M 2WKEA 4PM9A 1YLTA 4EEPA 5L2FA 4WF0A 5KIZA 3LY3A 4DE3A 4E3LA 4DMZA 4LCMA 1LLBA 2V0UA 3HVFA 3O88A 4GN2A 4QD4A 4GCZA 4PPRA 1BLPA 2ZC6B 3LEQA 4BBVA 2EWWA 4Y7PA 1YAXA 5CTMA 2HPBA 4KENB 3F1NB 3E0YA 3IHAA 3C30A 4JF5A 4WUJA 3IWQA 5GHYA 3OPPA 2EXBA 3EEAA 4EBNA 1FOFA 2EX2A 4G3WA 4X6TA 2W27A 3VOLA 2QPNA 3ITBA 4KQQA 3PHYA 4S2MA 1G6AA 1K38A 5FEFA 1YMXA 2WZXA 1Y4OA 4I3AA 4GS9B 4QHCA 5K5BA 3R7WA 4O7DA 4HI4A 4EUZA 1PWCA 5EOOA 5M1AA 1DP6A 4YWZA 3NECA 1XJ3A 2C5WB 3TRCA 5E2FA 4E6XA 4ZAMA 3CAXA 5KMWA 1FCOA 4WEJA 2I72A 2WUQA 2JHEA 3P98A 4FH2A 5DTKA 4E6WA 1MWTA 1ONHA 3SZTA 2PRFA 3EGDC 3ZYTA 1AWIA 5F68A 3QNBA 1DJBA 3PYPA 1DY6A 3DWZA 1XPBA 5CGXA 3HLGA 3U2AA 3OCLA 4EV4A 2HDSA 5CHJA 1M6KA 3WRTA 3G2YA 3RTYA 2JBFA 2QZ6A 1VEUB 4IEDA 3QP2A 3QNCA 1LL5A 1ESIA 5FI6A 3A0VA 1NZUA 4QB8A 3VV4A 5HL6A 4D60A 1SCWA 3HLDA 2HZ5A 5KSCA 3NHQA 1XGIA 3FPVA 3IS2A 2Z2MB 4GW9A 1HZOA 1JTDA 4B4ZA 2JKTI 1LSVA 1XGJA 2W1TA 4OOLA 5FQQA 4BJPA 5CEDA 5AQ7A 3P7NA 1NRFA 3LYXA 3NDGA 4MMNA 3KSFA 2V1BA 4WZ4A 3UB7A 1RGYA 4BWIA 1WYCA 1ERQA 4GHIB 2Z2LB 4MN7A 3A0SA 3V50A 4N9KA 3NOTC 2VA0A 2BLSA 4JGRA 3MS6A 2Y79A 5EVIC 3N8RA 4Q0IA 4GOGA 5FI7A 5FASA 3NBLA 4WBGA 2ZL1B 1JNUA 3E98A 1XA1A 3HUOA 3V39A 3G2ZA 4FH4A 1YSPA 3PBQA 1GA9A 4KG6A 4B4XA 4IUHA 4U0XA 1RP5A 4KG2A 3BW6A 3UDIA 3EEHA 3LUQA 4H6JA 4OPYA 4S2NA 3RH8B 3B42A 3ZVWA 4N9LA 4FD8A 1QMEA 2XSSA 2LB5A 4XT2B 4UAAA 3D9YA 2VGLS 3QP1A 3KSIA 1N9OA 5D3OA 2W3GA 1JWZA 3OZHA 1LL9A 5G18A 5CXWA 3M2KA 2L0WA 5E2HA 3NI9A 3G35A 1MWSA 3UN7A 3IH8A 1I2WA 1E25A 1L0EA 2BASA 3NJAA 5EVID 1S66L 2J8YA 3ZG7B 2VGLM 1IOUA 4S2NC 1FSWA 4FTXA 2QHKA 3GMWA 3KYEA 3JVVA 1OJ5A 1ES4A 3E2KA 1NWZA 4HP9A 3VOYA 2D01A 1DJCA 3FV7A 3E4OA 4EBPA 3MKEA 3VSLA 4MCWA 5E2EA 3GV9A 5DKLA 1K56A 4LV1A 1IYQA 3OCNA 3MBZA 2XD5A 4UA9A 5FQIA 1NLZA 1KE0A 5CTNA 2ZQ8A 3ITAA 1SKFA 1VETA 4OP5A 4DF6A 1MBLA 2V2FF 1ODVA 3JYIA 3CITA 3G31A 2ZQAA 4WLAA 4CLCA 3UPNA 2ZM0A 5G4ZA 1LT0A 2W3EA 2WYXA 4HQAA 3ICYA 3OBFA 4KQDA 4E04A 2EX8A 3CPTA 5FQKA 5HARA 4MBHA 4OLGA 4GKUA 4EEUA 3H82B 3G30A 2GZAA 2JKFA 4QU3A 3DTEA 4OPZA 2OLUA 4WELA 3CPTB 5TR7A 1H3QA 1Z6FA 2EX6A 1KE4A 3BFEA 3TG9A 2GNXA 1PZOA 2Y2JA 2W0NA 2ZJ9A 4I5SA 3MXRA 1MXOA 1GSVA 4JF6A 2ZC3B 4HJ4A 1BUEA 4GB7A 3AGFA 3KYQA 3FYZA 2WKPA 3A3JA 4RVAA 5FL3A 1L0GA 1W8QA 4RYEA 5HPIA 2JKGA 5HX9A 2Y2LA 4OONA 4P87A 1H5XA 1EW0A 4KQOA 2K31A 4HJ6A 4G3KA 1P9WA 4DDSA 1QMFA 3PAEA 5FDSA 3MFDA 2B18A 3QP8A 1IYOA 3BFGA 4P0MA 2VKSA 1H8MA 2VGKA 1KDSA 3G34A 1TS0A 2VV6A 3DAVA 1YT4A 1KE3A 1PI4A 3MMHA 2VEAA 1NRJA 1KGFA 3A0RA 2ZM8A 1PIOA 3F1PB 4G3VA 3OLOA 4R4SA 4HHDA 3SW1A 5J8XA 4EQ1A 1YLWA 3NC8A 1SKOA 4JPMA 4ESPA 4OLDA 3UPPA 4HIAA 3BEBA 2V8FA 4F3LB 2X71A 2YKHA 3I7JA 2HF6A 5HWTA 3OPLA 2Y4AA 5TJJA 3IBRA 3S22A 2JN7A 4GDBA 3CHWP 4Z1WA 3SS4A 3ZG9B 1F5MA 4PKYA 3O3VA 1G6OA 3KYZA 1OT6A 2OOLA 1E4DA 3CZDA 4KZ4A 3SH7A 1W7FA 3G32A 4XUXA 1D7EA 1CI9A 5KZHA 2O99A 4R3BA 1TS8A 5GLAA 3HLCA 3BQAA 1BSGA 3BFDA 4BMWA 4YNRA 4K91A 1BTLA 3VP2A 1X0OA 2WADA 3T4LA 1N4OA 5M18A 4Y2FA 3UDXA 3MQQA 3WS5A 1CEFA 4ARZB 2HP6A 4R38A 1L0FA 1K4FA 4F94A 2V0WA 4P85A 5HPFA 3WS0A 4BD1A 3MXQA
chains in the Genus database with same CATH topology
3W4PA 2EXAA 3FZCA 4KG5A 4ZJ3A 2HDSA 4RX3A 5GHXA 2EFXA 3NCKA 3EQVA 1NY0A 5CHJA 1M6KA 2R9XA 1GA0A 3C7UA 4IBRA 3WRTA 3G2YA 2VGJA 2JBFA 2QZ6A 2FFFB 1JTGA 3C5AA 4IEDA 2WKHA 5EPHA 2IWDA 3IXHA 4DE0A 1SDNA 3N8SA 1YM1A 3QNCA 3Q7VB 4OP8A 1XA7A 5DF9A 5FQ9A 1K6RA 1LL5A 3Q1FA 1ESIA 5FI6A 2RL3A 5FATA 1NZUA 2J7VA 4QB8A 1HD8A 3VP3A 2B5RA 3WS1A 3FKWA 4ZTKA 4BQMA 4PM7A 1K55C 2OSUA 2DRWA 1SCWA 3DTMA 3HLDA 1AXBA 5DF7A 2IWBA 1XXMA 4ZBEA 5TGFA 4HBUA 2XD1A 2WGWB 2ZQCA 3QHYA 5KSCA 3IF6A 2RCXA 1XGIA 2ZLYA 3HLBA 3C4OA 5HAPA 1MWUA 4P6BA 4MEZA 2Z2MB 2ZQ7A 5FA7A 3CJMA 1ERMA 1HZOA 3UE3A 5GHZA 1JTDA 4BL3A 3VFHA 3MZFA 3ZNYA 3Q07A 4DDYA 3VP1A 2XQZA 5GLCA 4B4ZA 3ZG8B 4BLMA 1XGJA 4Y0TA 4OOLA 2ZD8A 5FQQA 2OV5A 4BJPA 5CEDA 5AQ7A 2IWCA 5TFQA 1WYBA 3IF6B 2GDNA 3RXXA 1NRFA 3FKVA 1HVBA 2R9WA 4E3MA 2Q9MA 2Y2HA 4ZJ1A 3NDGA 1PWDA 4WZ4A 3PBNA 3ZVTA 4EBLA 5A90A 3ZGAB 1RGYA 1IKIA 1WYCA 1PW8A 1IEMA 3WS4A 1ERQA 2PBYA 3W8KA 2Y59A 4M3KA 5FQMA 3S4XA 2Z2LB 3GQZA 1YLPA 1FR6A 3V50A 4N9KA 4OPQA 5F82A 1K54C 4WMCA 4OQGA 3VSKA 3MXSA 2CC1A 2WK0A 2ZQDA 2HDQA 5E2GA 5HAQA 1SDEA 2BLSA 4LV2A 2OLVA 2EFUA 2ZC7A 4L0LA 2Y2QA 4U3TA 3N8RA 1GHMA 5EVIC 3V3SA 4IVIA 4EQIA 4GOGA 1PZPA 3BECA 5FI7A 3OC2A 5FASA 4N1HA 3NBLA 1YLZA 3S1YA 4C75A 3ZNTA 4WBGA 3V3RA 1XA1A 3HUOA 4N92A 3V39A 1H8YA 3IWOA 4JXVA 3G2ZA 3NDEA 4FH4A 4OQ0A 3PBQA 1GA9A 4KG6A 5EVIB 2DNSA 4WMCD 4B4XA 1BULA 2H10A 4U0XA 4KZ6A 2QMIA 1RP5A 1NJ4A 3TSGA 4KG2A 1LI9A 3PBRA 3N8LA 3HREA 3N7WA 1NYMA 2XGNA 1GHIA 3UDIA 4S2LA 4H8RA 1W8YA 2J9PA 3A3DA 1NXYA 4K0WA 4E3NA 4OPYA 5CRFA 4S2NA 1SHVA 3Q7ZA 5FAPA 1H8ZA 4Y0OA 3ZVWA 3FWLA 4OKPA 5E43A 3AGEA 5A92A 4N9LA 1ALQA 4LV0A 4KZ3A 4WEKA 4KZAA 1I2SA 2A49A 2WGVA 3IT9A 3D4FA 4FD8A 1QMEA 3CMZA 3BRMA 4WYYA 4UAAA 4MBFA 3HUNA 3TOIA 2P9VA 4X55A 3A3FA 5AQAA 2JC7A 3VOZA 2WGWA 2Q9NA 3BFCA 1GCEA 5D3OA 2HP5A 4OQHA 4QY5A 1JWZA 1ZG4A 1IELA 1FQGA 3OZHA 1YLYA 1LL9A 3ZHHA 4R4RA 5G18A 4DKIA 3N6IA 5CXWA 3M2KA 4UA7A 1K55A 2Y2NA 5E2HA 3NI9A 3G35A 3LO7A 1MWSA 3UN7A 3IH8A 3IXDA 4GDNA 1I2WA 4B88A 1E25A 2XH9A 2H0TA 1Q2QA 4DE1A 1L0EA 4X53A 1KGGA 3Q7VA 1ZC2A 5EVID 2Y2IA 5HAIA 1BZAA 1FCNA 2J8YA 3PTEA 3UE0A 3ZG7B 5EVIA 1PW1A 5KSHA 4S2NC 2Y2KA 3ZDJA 2V1ZA 4JKTA 5F83A 1FSWA 3C4PA 3C7VA 2C6WB 3GMWA 1NYYA 3SH9A 3HLEA 3RJUA 1OMEA 2FFYA 1ES4A 3E2KA 3BYDA 2J9OA 4MLLA 5FSRA 4GD6A 2X02A 4WZ5C 1JWPA 4XXRA 3VOYA 5AQ9A 2EX9A 1DJCA 5DVAA 3FV7A 1S0WA 2G2UA 4Z9QA 2Y55A 4OOYA 3SH8A 4C3QA 4EBPA 1KGEA 4DRTA 1K56D 3MKEA 3VSLA 2WAFA 2XF3A 2ZC4B 3GV9A 3OPRA 4UHUA 5E2EA 4E3KA 2ZMAA 1K56A 4LV1A 1IYQA 3OCNA 3MBZA 1VM1A 3GVBA 1E3UD 1K6SA 2XD5A 4UA9A 2ZQ9A 5FQIA 1KE0A 1FSYA 5CTNA 2ZQ8A 2WAEA 3BFFA 3ITAA 1GHPA 1SKFA 1XP4A 3IHBA 3EQUA 4X68A 3UY6A 2ZC5B 4OP5A 1L0DA 4DF6A 5GL9A 1MBLA 2V2FF 3JYIA 5CHUA 1YQSA 1ZKJA 1K54A 5JYPA 4PM5A 1BLCA 1S6RA 1CEGA 3E2LA 4KZ5A 3G31A 2ZQAA 4KZ8A 4MBKA 4N1XA 2XK1A 4U0TA 2H5SA 5EE8A 3UPNA 3LY4A 1FR1A 1JWVA 4Y0UA 1KVLA 2A3UA 2XFTA 4GD8A 2ZM0A 3B3XA 4WM9A 1MWRA 5F1FA 1ONGA 3A3IA 4YINA 3UE1A 1PYYA 1EWZA 5DTTA 5EUAA 4QY6A 3MKFA 2Y2MA 4KZ9A 5GLBA 5U47A 2WYXA 1Y54A 4WZ5A 4GNUA 1O07A 2EX8A 1ES2A 1TVFA 5FQKA 4K0XA 5HARA 1C3BA 4MBHA 3SOIA 2BG1A 4HBTA 4OLGA 5HL1A 3IXBA 2WGIA 4GKUA 4E3IA 1K57A 1MY8A 3P09A 1YMSA 1IYPA 1ZG6A 3VP4A 4ID4A 2JE5A 3G30A 1DJAA 4QU3A 4LV3A 1TDLA 3LEZA 4OPZA 1YLJA 2OLUA 3DW0A 3HLWA 4WELA 3SS5A 5FQJA 1IYSA 4S2IA 3VFFA 1I5QA 1WE4A 3M2JA 5CEBA 5TR7A 4YFMA 4QJGA 5M19A 3IQAA 2HP9A 3HUMA 3WRZA 5JYOA 1Z6FA 4JF4A 2G2WA 3V5MA 2XFSA 1ES3A 2EX6A 2V20A 4OVDA 1KE4A 3BFEA 3TG9A 5F1GA 4S2OA 4XUZA 4RA7A 1PZOA 2Y2JA 2ZJ9A 3ZG5A 5IHVA 4S2PA 3MXRA 3W4OA 1MXOA 3GTCA 4R1GA 3BLSA 4RX2A 5CERA 4R0QA 4PM8A 2ZM2A 4JF6A 2ZC3B 3NY4A 1BUEA 4UA6A 1K57C 1MPLA 4GB7A 4CJNA 5A93A 1G68A 4EWFA 3AGFA 3PBSA 4IBXA 5I94A 3A3EA 4R3JA 4MNRA 3FYZA 3GSGA 2WZZA 5GLDA 3A3JA 3IXGA 1KVMA 4RVAA 3UNWA 3HBRA 4OOMA 4FSFA 4R23A 1L0GA 1W8QA 4S2JA 4RYEA 2P9VB 3OPHA 1LI0A 1RCJA 3Q82A 3VP0A 4BD0A 5HX9A 2Y2LA 1XX2A 4OONA 4P87A 1H5XA 2WKIA 2Y2GA 4KQOA 1E3UA 5EECA 4HESA 1Q2PA 4DDSA 3AGDA 1QMFA 3PAEA 3MFDA 4X56A 1IYOA 1RGZA 2XLNA 3BFGA 4P0MA 4S2KA 4JXWA 4OH0A 5FDHA 2Y2PA 4HEFA 4ZJ2A 4D2OA 3GRJA 1CI8A 2VGKA 5EOEA 1KDSA 3G34A 3VMAA 4ZDXA 3MZDA 4NK3A 1O7EA 2JCHA 1BLSA 1TEMA 1YT4A 1KE3A 3O86A 1JVJA 1EROA 1PI4A 4JLFA 1N9BA 4JXSA 4KQRA 4E3JA 3UPOA 2P74A 2WKEA 1KGFA 4PM9A 4DXCA 1YLTA 2ZM8A 1L2SA 1NZOA 1PIOA 1W79A 5L2FA 3HLFA 4LCLA 3LY3A 3HL9A 4R4SA 1FCMA 4DE3A 4PMAA 4E3LA 3WWXA 1PWGA 1J9MA 2HDRA 3CG5A 3IH9A 1LLBA 4LCMA 3ZG0A 3HVFA 3O88A 1ES5A 5A91A 3UDFA 4C6YA 1YLWA 4Q8IA 2Y2OA 1CK3A 2DCFA 1M40A 5DTSA 3NC8A 4GN2A 2HDUA 4JPMA 4OLDA 4QD4A 3UPPA 1KDWA 4KZBA 4A5RA 2XR0A 3N4IA 4PPRA 1BLPA 2ZC6B 1ESUA 3BEBA 4E3OA 4Y7PA 2X71A 5CTMA 5HW3A 2HPBA 3I7JA 5FAOA 3OPLA 4KENB 2Y4AA 3IHAA 4JF5A 5HFOA 3S22A 3SS3A 3PBOA 5CGSA 3IWQA 5GHYA 4GDBA 3NIAA 2EXBA 3OPPA 3M6BA 3RXWA 4EBNA 4DXBA 1FOFA 1LHYA 2EX2A 3Q81A 3SS4A 3ZG9B 3O3VA 4X6TA 3CZDA 1E4DA 4KZ4A 2QPNA 5CGWA 5EVLA 3SH7A 1W7FA 2Y91A 3G32A 3ITBA 4KQQA 4XUXA 4S2MA 2PU4A 1G6AA 3G4PA 1K38A 4IVKA 1CI9A 1YMXA 1BLHA 3ISGA 2WZXA 5KZHA 4OQIA 4LENA 4R3BA 2XDMA 3M6HA 4QHCA 4GZBA 5GLAA 4PM6A 1IKGA 3HLCA 4O7DA 5FI2A 5BOHA 3IF6C 3O87A 1BSGA 3BFDA 1PWCA 4EUZA 5EOOA 4K91A 5CHMA 5M1AA 3BLMA 2UWXA 4JXGA 1BTLA 3VP2A 1TDGA 2C5WB 2H0YA 4DE2A 4FCFA 2WADA 5E2FA 2X01A 1MKIA 1N4OA 1XKZA 4BENA 4E6XA 5CECA 4ZAMA 4CPKA 4BL2A 5M18A 3ZCZA 2E8IA 4JBFA 3UDXA 3PAGA 5KMWA 5AQBA 1FCOA 3WS5A 1CEFA 3BM6A 2XEPA 4WEJA 2I72A 4KZ7A 4X69A 2WUQA 5J8XA 2HP6A 3IF5A 3P98A 4FH2A 5DTKA 3W4QA 1MWTA 4E6WA 1L0FA 1ONHA 1BT5A 1U60A 3DWKA 4OPRA 1K4FA 1W5DA 1EI5A 1K25A 3LCEA 4F94A 5DF8A 3ZFZA 4NETA 1HTZA 3QNBA 5FAQA 1PI5A 1DJBA 3MZEA 4P85A 3WS0A 4BD1A 3IWIA 1VQQA 2PU2A 1DY6A 3DWZA 1XPBA 5CGXA 3WS2A 3UO9A 3HLGA 1K4EA 3OCLA 4EV4A 3PBTA 3GR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4P A;  2EXA A;  3FZC A;  4KG5 A;  4ZJ3 A;  2HDS A;  4RX3 A;  5GHX A;  2EFX A;  3NCK A;  3EQV A;  1NY0 A;  5CHJ A;  1M6K A;  2R9X A;  1GA0 A;  3C7U A;  4IBR A;  3WRT A;  3G2Y A;  2VGJ A;  2JBF A;  2QZ6 A;  2FFF B;  1JTG A;  3C5A A;  4IED A;  2WKH A;  5EPH A;  2IWD A;  3IXH A;  4DE0 A;  1SDN A;  3N8S A;  1YM1 A;  3QNC A;  3Q7V B;  4OP8 A;  1XA7 A;  5DF9 A;  5FQ9 A;  1K6R A;  1LL5 A;  3Q1F A;  1ESI A;  5FI6 A;  2RL3 A;  5FAT A;  1NZU A;  2J7V A;  4QB8 A;  1HD8 A;  3VP3 A;  2B5R A;  3WS1 A;  3FKW A;  4ZTK A;  4BQM A;  4PM7 A;  1K55 C;  2OSU A;  2DRW A;  1SCW A;  3DTM A;  3HLD A;  1AXB A;  5DF7 A;  2IWB A;  1XXM A;  4ZBE A;  5TGF A;  4HBU A;  2XD1 A;  2WGW B;  2ZQC A;  3QHY A;  5KSC A;  3IF6 A;  2RCX A;  1XGI A;  2ZLY A;  3HLB A;  3C4O A;  5HAP A;  1MWU A;  4P6B A;  4MEZ A;  2Z2M B;  2ZQ7 A;  5FA7 A;  3CJM A;  1ERM A;  1HZO A;  3UE3 A;  5GHZ A;  1JTD A;  4BL3 A;  3VFH A;  3MZF A;  3ZNY A;  3Q07 A;  4DDY A;  3VP1 A;  2XQZ A;  5GLC A;  4B4Z A;  3ZG8 B;  4BLM A;  1XGJ A;  4Y0T A;  4OOL A;  2ZD8 A;  5FQQ A;  2OV5 A;  4BJP A;  5CED A;  5AQ7 A;  2IWC A;  5TFQ A;  1WYB A;  3IF6 B;  2GDN A;  3RXX A;  1NRF A;  3FKV A;  1HVB A;  2R9W A;  4E3M A;  2Q9M A;  2Y2H A;  4ZJ1 A;  3NDG A;  1PWD A;  4WZ4 A;  3PBN A;  3ZVT A;  4EBL A;  5A90 A;  3ZGA B;  1RGY A;  1IKI A;  1WYC A;  1PW8 A;  1IEM A;  3WS4 A;  1ERQ A;  2PBY A;  3W8K A;  2Y59 A;  4M3K A;  5FQM A;  3S4X A;  2Z2L B;  3GQZ A;  1YLP A;  1FR6 A;  3V50 A;  4N9K A;  4OPQ A;  5F82 A;  1K54 C;  4WMC A;  4OQG A;  3VSK A;  3MXS A;  2CC1 A;  2WK0 A;  2ZQD A;  2HDQ A;  5E2G A;  5HAQ A;  1SDE A;  2BLS A;  4LV2 A;  2OLV A;  2EFU A;  2ZC7 A;  4L0L A;  2Y2Q A;  4U3T A;  3N8R A;  1GHM A;  5EVI C;  3V3S A;  4IVI A;  4EQI A;  4GOG A;  1PZP A;  3BEC A;  5FI7 A;  3OC2 A;  5FAS A;  4N1H A;  3NBL A;  1YLZ A;  3S1Y A;  4C75 A;  3ZNT A;  4WBG A;  3V3R A;  1XA1 A;  3HUO A;  4N92 A;  3V39 A;  1H8Y A;  3IWO A;  4JXV A;  3G2Z A;  3NDE A;  4FH4 A;  4OQ0 A;  3PBQ A;  1GA9 A;  4KG6 A;  5EVI B;  2DNS A;  4WMC D;  4B4X A;  1BUL A;  2H10 A;  4U0X A;  4KZ6 A;  2QMI A;  1RP5 A;  1NJ4 A;  3TSG A;  4KG2 A;  1LI9 A;  3PBR A;  3N8L A;  3HRE A;  3N7W A;  1NYM A;  2XGN A;  1GHI A;  3UDI A;  4S2L A;  4H8R A;  1W8Y A;  2J9P A;  3A3D A;  1NXY A;  4K0W A;  4E3N A;  4OPY A;  5CRF A;  4S2N A;  1SHV A;  3Q7Z A;  5FAP A;  1H8Z A;  4Y0O A;  3ZVW A;  3FWL A;  4OKP A;  5E43 A;  3AGE A;  5A92 A;  4N9L A;  1ALQ A;  4LV0 A;  4KZ3 A;  4WEK A;  4KZA A;  1I2S A;  2A49 A;  2WGV A;  3IT9 A;  3D4F A;  4FD8 A;  1QME A;  3CMZ A;  3BRM A;  4WYY A;  4UAA A;  4MBF A;  3HUN A;  3TOI A;  2P9V A;  4X55 A;  3A3F A;  5AQA A;  2JC7 A;  3VOZ A;  2WGW A;  2Q9N A;  3BFC A;  1GCE A;  5D3O A;  2HP5 A;  4OQH A;  4QY5 A;  1JWZ A;  1ZG4 A;  1IEL A;  1FQG A;  3OZH A;  1YLY A;  1LL9 A;  3ZHH A;  4R4R A;  5G18 A;  4DKI A;  3N6I A;  5CXW A;  3M2K A;  4UA7 A;  1K55 A;  2Y2N A;  5E2H A;  3NI9 A;  3G35 A;  3LO7 A;  1MWS A;  3UN7 A;  3IH8 A;  3IXD A;  4GDN A;  1I2W A;  4B88 A;  1E25 A;  2XH9 A;  2H0T A;  1Q2Q A;  4DE1 A;  1L0E A;  4X53 A;  1KGG A;  3Q7V A;  1ZC2 A;  5EVI D;  2Y2I A;  5HAI A;  1BZA A;  1FCN A;  2J8Y A;  3PTE A;  3UE0 A;  3ZG7 B;  5EVI A;  1PW1 A;  5KSH A;  4S2N C;  2Y2K A;  3ZDJ A;  2V1Z A;  4JKT A;  5F83 A;  1FSW A;  3C4P A;  3C7V A;  2C6W B;  3GMW A;  1NYY A;  3SH9 A;  3HLE A;  3RJU A;  1OME A;  2FFY A;  1ES4 A;  3E2K A;  3BYD A;  2J9O A;  4MLL A;  5FSR A;  4GD6 A;  2X02 A;  4WZ5 C;  1JWP A;  4XXR A;  3VOY A;  5AQ9 A;  2EX9 A;  1DJC A;  5DVA A;  3FV7 A;  1S0W A;  2G2U A;  4Z9Q A;  2Y55 A;  4OOY A;  3SH8 A;  4C3Q A;  4EBP A;  1KGE A;  4DRT A;  1K56 D;  3MKE A;  3VSL A;  2WAF A;  2XF3 A;  2ZC4 B;  3GV9 A;  3OPR A;  4UHU A;  5E2E A;  4E3K A;  2ZMA A;  1K56 A;  4LV1 A;  1IYQ A;  3OCN A;  3MBZ A;  1VM1 A;  3GVB A;  1E3U D;  1K6S A;  2XD5 A;  4UA9 A;  2ZQ9 A;  5FQI A;  1KE0 A;  1FSY A;  5CTN A;  2ZQ8 A;  2WAE A;  3BFF A;  3ITA A;  1GHP A;  1SKF A;  1XP4 A;  3IHB A;  3EQU A;  4X68 A;  3UY6 A;  2ZC5 B;  4OP5 A;  1L0D A;  4DF6 A;  5GL9 A;  1MBL A;  2V2F F;  3JYI A;  5CHU A;  1YQS A;  1ZKJ A;  1K54 A;  5JYP A;  4PM5 A;  1BLC A;  1S6R A;  1CEG A;  3E2L A;  4KZ5 A;  3G31 A;  2ZQA A;  4KZ8 A;  4MBK A;  4N1X A;  2XK1 A;  4U0T A;  2H5S A;  5EE8 A;  3UPN A;  3LY4 A;  1FR1 A;  1JWV A;  4Y0U A;  1KVL A;  2A3U A;  2XFT A;  4GD8 A;  2ZM0 A;  3B3X A;  4WM9 A;  1MWR A;  5F1F A;  1ONG A;  3A3I A;  4YIN A;  3UE1 A;  1PYY A;  1EWZ A;  5DTT A;  5EUA A;  4QY6 A;  3MKF A;  2Y2M A;  4KZ9 A;  5GLB A;  5U47 A;  2WYX A;  1Y54 A;  4WZ5 A;  4GNU A;  1O07 A;  2EX8 A;  1ES2 A;  1TVF A;  5FQK A;  4K0X A;  5HAR A;  1C3B A;  4MBH A;  3SOI A;  2BG1 A;  4HBT A;  4OLG A;  5HL1 A;  3IXB A;  2WGI A;  4GKU A;  4E3I A;  1K57 A;  1MY8 A;  3P09 A;  1YMS A;  1IYP A;  1ZG6 A;  3VP4 A;  4ID4 A;  2JE5 A;  3G30 A;  1DJA A;  4QU3 A;  4LV3 A;  1TDL A;  3LEZ A;  4OPZ A;  1YLJ A;  2OLU A;  3DW0 A;  3HLW A;  4WEL A;  3SS5 A;  5FQJ A;  1IYS A;  4S2I A;  3VFF A;  1I5Q A;  1WE4 A;  3M2J A;  5CEB A;  5TR7 A;  4YFM A;  4QJG A;  5M19 A;  3IQA A;  2HP9 A;  3HUM A;  3WRZ A;  5JYO A;  1Z6F A;  4JF4 A;  2G2W A;  3V5M A;  2XFS A;  1ES3 A;  2EX6 A;  2V20 A;  4OVD A;  1KE4 A;  3BFE A;  3TG9 A;  5F1G A;  4S2O A;  4XUZ A;  4RA7 A;  1PZO A;  2Y2J A;  2ZJ9 A;  3ZG5 A;  5IHV A;  4S2P A;  3MXR A;  3W4O A;  1MXO A;  3GTC A;  4R1G A;  3BLS A;  4RX2 A;  5CER A;  4R0Q A;  4PM8 A;  2ZM2 A;  4JF6 A;  2ZC3 B;  3NY4 A;  1BUE A;  4UA6 A;  1K57 C;  1MPL A;  4GB7 A;  4CJN A;  5A93 A;  1G68 A;  4EWF A;  3AGF A;  3PBS A;  4IBX A;  5I94 A;  3A3E A;  4R3J A;  4MNR A;  3FYZ A;  3GSG A;  2WZZ A;  5GLD A;  3A3J A;  3IXG A;  1KVM A;  4RVA A;  3UNW A;  3HBR A;  4OOM A;  4FSF A;  4R23 A;  1L0G A;  1W8Q A;  4S2J A;  4RYE A;  2P9V B;  3OPH A;  1LI0 A;  1RCJ A;  3Q82 A;  3VP0 A;  4BD0 A;  5HX9 A;  2Y2L A;  1XX2 A;  4OON A;  4P87 A;  1H5X A;  2WKI A;  2Y2G A;  4KQO A;  1E3U A;  5EEC A;  4HES A;  1Q2P A;  4DDS A;  3AGD A;  1QMF A;  3PAE A;  3MFD A;  4X56 A;  1IYO A;  1RGZ A;  2XLN A;  3BFG A;  4P0M A;  4S2K A;  4JXW A;  4OH0 A;  5FDH A;  2Y2P A;  4HEF A;  4ZJ2 A;  4D2O A;  3GRJ A;  1CI8 A;  2VGK A;  5EOE A;  1KDS A;  3G34 A;  3VMA A;  4ZDX A;  3MZD A;  4NK3 A;  1O7E A;  2JCH A;  1BLS A;  1TEM A;  1YT4 A;  1KE3 A;  3O86 A;  1JVJ A;  1ERO A;  1PI4 A;  4JLF A;  1N9B A;  4JXS A;  4KQR A;  4E3J A;  3UPO A;  2P74 A;  2WKE A;  1KGF A;  4PM9 A;  4DXC A;  1YLT A;  2ZM8 A;  1L2S A;  1NZO A;  1PIO A;  1W79 A;  5L2F A;  3HLF A;  4LCL A;  3LY3 A;  3HL9 A;  4R4S A;  1FCM A;  4DE3 A;  4PMA A;  4E3L A;  3WWX A;  1PWG A;  1J9M A;  2HDR A;  3CG5 A;  3IH9 A;  1LLB A;  4LCM A;  3ZG0 A;  3HVF A;  3O88 A;  1ES5 A;  5A91 A;  3UDF A;  4C6Y A;  1YLW A;  4Q8I A;  2Y2O A;  1CK3 A;  2DCF A;  1M40 A;  5DTS A;  3NC8 A;  4GN2 A;  2HDU A;  4JPM A;  4OLD A;  4QD4 A;  3UPP A;  1KDW A;  4KZB A;  4A5R A;  2XR0 A;  3N4I A;  4PPR A;  1BLP A;  2ZC6 B;  1ESU A;  3BEB A;  4E3O A;  4Y7P A;  2X71 A;  5CTM A;  5HW3 A;  2HPB A;  3I7J A;  5FAO A;  3OPL A;  4KEN B;  2Y4A A;  3IHA A;  4JF5 A;  5HFO A;  3S22 A;  3SS3 A;  3PBO A;  5CGS A;  3IWQ A;  5GHY A;  4GDB A;  3NIA A;  2EXB A;  3OPP A;  3M6B A;  3RXW A;  4EBN A;  4DXB A;  1FOF A;  1LHY A;  2EX2 A;  3Q81 A;  3SS4 A;  3ZG9 B;  3O3V A;  4X6T A;  3CZD A;  1E4D A;  4KZ4 A;  2QPN A;  5CGW A;  5EVL A;  3SH7 A;  1W7F A;  2Y91 A;  3G32 A;  3ITB A;  4KQQ A;  4XUX A;  4S2M A;  2PU4 A;  1G6A A;  3G4P A;  1K38 A;  4IVK A;  1CI9 A;  1YMX A;  1BLH A;  3ISG A;  2WZX A;  5KZH A;  4OQI A;  4LEN A;  4R3B A;  2XDM A;  3M6H A;  4QHC A;  4GZB A;  5GLA A;  4PM6 A;  1IKG A;  3HLC A;  4O7D A;  5FI2 A;  5BOH A;  3IF6 C;  3O87 A;  1BSG A;  3BFD A;  1PWC A;  4EUZ A;  5EOO A;  4K91 A;  5CHM A;  5M1A A;  3BLM A;  2UWX A;  4JXG A;  1BTL A;  3VP2 A;  1TDG A;  2C5W B;  2H0Y A;  4DE2 A;  4FCF A;  2WAD A;  5E2F A;  2X01 A;  1MKI A;  1N4O A;  1XKZ A;  4BEN A;  4E6X A;  5CEC A;  4ZAM A;  4CPK A;  4BL2 A;  5M18 A;  3ZCZ A;  2E8I A;  4JBF A;  3UDX A;  3PAG A;  5KMW A;  5AQB A;  1FCO A;  3WS5 A;  1CEF A;  3BM6 A;  2XEP A;  4WEJ A;  2I72 A;  4KZ7 A;  4X69 A;  2WUQ A;  5J8X A;  2HP6 A;  3IF5 A;  3P98 A;  4FH2 A;  5DTK A;  3W4Q A;  1MWT A;  4E6W A;  1L0F A;  1ONH A;  1BT5 A;  1U60 A;  3DWK A;  4OPR A;  1K4F A;  1W5D A;  1EI5 A;  1K25 A;  3LCE A;  4F94 A;  5DF8 A;  3ZFZ A;  4NET A;  1HTZ A;  3QNB A;  5FAQ A;  1PI5 A;  1DJB A;  3MZE A;  4P85 A;  3WS0 A;  4BD1 A;  3IWI A;  1VQQ A;  2PU2 A;  1DY6 A;  3DWZ A;  1XPB A;  5CGX A;  3WS2 A;  3UO9 A;  3HLG A;  1K4E A;  3OCL A;  4EV4 A;  3PBT A;  3GR2 A; 
#chains in the Genus database with same CATH topology
 4KG5 A;  3CLO A;  4ZJ3 A;  5GHX A;  3NCK A;  1NY0 A;  1T19 A;  2VGJ A;  2FFF B;  5EPH A;  4DE0 A;  1SDN A;  2OWH A;  1VB6 A;  5FQ9 A;  1K6R A;  3Q1F A;  1XFN A;  1TD5 A;  3UB6 A;  3VP3 A;  1S1Y A;  3UME A;  3WS1 A;  1N9L A;  3FKW A;  4ZTK A;  4BQM A;  5IS1 A;  1DP8 A;  5TGF A;  4HBU A;  3QHY A;  3HLB A;  3C4O A;  1MWU A;  3LIF A;  1LL8 A;  4MEZ A;  4LRX C;  5FA7 A;  1ERM A;  3HJK A;  5GHZ A;  3MZF A;  3ZNY A;  3Q07 A;  3VP1 A;  5GLC A;  4BLM A;  3ZG8 B;  5IT5 A;  2L4R A;  4H6J B;  2H28 A;  3E4Q A;  2PR5 A;  4EU0 A;  4E3M A;  3UB9 A;  4F3L A;  1LSX A;  1PWD A;  3PBN A;  3ZVT A;  1YPR A;  5A90 A;  3ZGA B;  3L7H A;  2E8J A;  1PW8 A;  4UQI S;  3W8K A;  4M3K A;  5FQM A;  3GQZ A;  1CF0 A;  1FR6 A;  3VSK A;  5L8M A;  2CC1 A;  2WK0 A;  2ZQD A;  2HDQ A;  3EOI A;  1D06 A;  3PR6 A;  2EFU A;  1GHM A;  3MQO A;  4EQI A;  1MC0 A;  3OC2 A;  5G4Y A;  3ZNT A;  4B9O A;  4JXV A;  3S7N A;  2DNS A;  4KZ6 A;  5HDC A;  1LI9 A;  4NKP A;  3N8L A;  3N7W A;  2XGN A;  4S2L A;  2J9P A;  4E3N A;  1J3W A;  1SHV A;  1OTA A;  3Q7Z A;  5FAP A;  4Y0O A;  4WEK A;  4KZA A;  4WYY A;  3C38 A;  1F2K A;  3HUN A;  4X55 A;  4NXB A;  4IUK A;  5AQA A;  4QPR A;  2JC7 A;  3VOZ A;  5EM1 A;  3BFC A;  4QY5 A;  2PBD P;  1IEL A;  3K3D A;  5AJG A;  2VX8 A;  3N6I A;  4NEE D;  3S7O A;  3IXD A;  1TS6 A;  4B88 A;  2H0T A;  4DE1 A;  5HAI A;  3F1N A;  2JKR I;  2Y2K A;  2Z6D A;  2V1Z A;  4JKT A;  4NXE A;  5J7E A;  3C7V A;  1H0M A;  4ARZ A;  3RJU A;  2QJ5 A;  2FFY A;  5F69 A;  2J9O A;  5FSR A;  4GD6 A;  4WZ5 C;  1JWP A;  4Z9Q A;  4RQ9 A;  4OOY A;  1KGE A;  3BQ8 A;  1K56 D;  1F9I A;  1VHM A;  4UHU A;  3OPR A;  4B93 A;  2ZMA A;  2HGV A;  3JPU A;  3UY6 A;  2ZL1 A;  2ZC5 B;  5GL9 A;  3KX0 X;  3NUL A;  2VK3 A;  4EXO A;  3E2L A;  4KZ5 A;  4MBK A;  4N1X A;  4U0T A;  5EE8 A;  2H5S A;  1KVL A;  1ONG A;  1VET B;  2WKQ A;  3CUE A;  4YIN A;  3UE1 A;  5EUA A;  3MKF A;  5GLB A;  5U47 A;  1K0K A;  1O07 A;  3R4K A;  1ES2 A;  3JVU A;  2KX6 A;  3S7Q A;  3F1O B;  3TW8 A;  1ZG6 A;  1DJA A;  4M4X A;  1YLJ A;  3DW0 A;  3HLW A;  3SS5 A;  2DMW A;  1IYS A;  5CEB A;  4QJG A;  4YFM A;  3MF0 A;  3LI9 A;  4LGW A;  4JF4 A;  2G2W A;  3T50 A;  2V20 A;  4X25 A;  3CWF A;  2EWV A;  3IX8 A;  4XUZ A;  4GJ4 A;  4WL9 A;  5IHV A;  4HP4 A;  3W4O A;  4R1G A;  2ZM2 A;  3LR5 A;  3NY4 A;  1K57 C;  1MPL A;  4CJN A;  1G68 A;  5I94 A;  4R3J A;  4MNR A;  5GLD A;  2KDK A;  4XT2 A;  2W1R A;  4S2J A;  2P9V B;  3OPH A;  1LI0 A;  3VP0 A;  1XX2 A;  2PDR A;  5CX7 A;  2OAQ 1;  5DFX A;  3IBJ A;  4X56 A;  4Q0H A;  3T4O A;  2KLI A;  4OH0 A;  4HEF A;  5J3W A;  3VMA A;  3MZD A;  5AVE A;  4JLF A;  3PXP A;  3UPO A;  1YKD A;  4DXC A;  2QJ7 A;  1NZO A;  4NXF A;  1W79 A;  5EM0 A;  3HLF A;  2HJ9 C;  3WWX A;  1J9M A;  3ZG0 A;  3UDF A;  2L1M A;  4C6Y A;  2Y2O A;  2DCF A;  5DTS A;  3B33 A;  3RFB A;  4EET B;  2IA2 A;  5HDS A;  2KOI A;  1W63 Q;  2XR0 A;  3H82 A;  5HWV A;  2PAV P;  4E3O A;  1HLU P;  2YKF A;  5HW3 A;  3E4P A;  5FAO A;  3SS3 A;  5CGS A;  3NIA A;  3M6B A;  4Y17 A;  1VEU A;  2O0Y A;  5CGW A;  2Y91 A;  3MQ0 A;  4OQI A;  4LEN A;  3B47 A;  2XDM A;  4X1L A;  3LIE A;  4GZB A;  4CLC D;  4PM6 A;  2VZW A;  3IF6 C;  5CHM A;  3BLM A;  1Z09 A;  3K3C A;  4DE2 A;  2X01 A;  5CEC A;  1MKI A;  3OOV A;  1XKZ A;  2W3F A;  4PHT A;  2ZOI A;  3ZCZ A;  2E8I A;  4JBF A;  3PAG A;  3T4J A;  5AQB A;  4FUW A;  3BM6 A;  4FOF A;  4KZ7 A;  4X69 A;  3IF5 A;  4R70 A;  2VLG A;  1BT5 A;  2INW A;  1W5D A;  1K25 A;  4Y13 A;  5DF8 A;  3C8C A;  4NET A;  5FAQ A;  3MZE A;  2O9A A;  3IWI A;  3WS2 A;  5A8B A;  3LI8 A;  3UO9 A;  4JGO A;  1K4E A;  5J4E A;  2ZMF A;  4ZJ1 A;  3PBT A;  3GR2 A;  4O8G A;  2EXA A;  3FZC A;  3ZQ5 A;  4RX3 A;  5L09 A;  4IBR A;  1G28 A;  2HV1 A;  3T1Q B;  3C5A A;  2IWD A;  3IXH A;  1WA9 A;  4OP8 A;  2J7V A;  2ACG A;  5HZH A;  4NG2 A;  4PM7 A;  1FIL A;  1K55 C;  2DRW A;  3CUE C;  3DTM A;  5DF7 A;  2IWB A;  5AVF A;  3T1R A;  2QKP A;  2B95 A;  2WGW B;  3IF6 A;  3T4S A;  2W1T B;  1ACF A;  1Y28 A;  4L9E A;  4P6B A;  3CJM A;  1BYW A;  4I3J A;  3UE3 A;  4DDY A;  2XQZ A;  5HDD A;  4Y0T A;  1OTD A;  2XA7 S;  2OV5 A;  1OT9 A;  2IWC A;  5TFQ A;  1WYB A;  3IF6 B;  1N9N A;  2EA9 A;  2R9W A;  4WN5 A;  4HJ3 A;  1PFL A;  1YSQ A;  2QWS A;  4ME4 A;  4OPQ A;  1K54 C;  3T4K A;  5E2G A;  5HAQ A;  2Y2Q A;  3V3S A;  4DN0 A;  4IVI A;  4O01 A;  1PZP A;  2Z6C A;  4C75 A;  3S1Y A;  1SKO B;  3V3R A;  1PNE A;  3IWO A;  3QP4 A;  3NDE A;  2Q0O A;  4OQ0 A;  1BUL A;  2QMI A;  3LGO A;  3TSG A;  1NYM A;  4H8R A;  1W8Y A;  2PYR A;  3A3D A;  4IHQ A;  1NXY A;  1CJF A;  2W3H A;  3FWL A;  2W3D A;  3AGE A;  5A92 A;  1ALQ A;  2Y8H A;  4LV0 A;  4BBT A;  2WGV A;  3IT9 A;  4HOI A;  2WGW A;  1T1A A;  1GCE A;  4GS9 A;  1FQG A;  1YLY A;  4CLC E;  2PYP A;  3ZHH A;  4DKI A;  4UA7 A;  3LO7 A;  4GDN A;  4DJ3 A;  2XH9 A;  2AVX A;  1ZTU A;  3H7W A;  1KGG A;  3S7P A;  1ZC2 A;  2Y2I A;  1FCN A;  3UE0 A;  3D3O A;  2M7V A;  3BJN A;  1PW1 A;  3ZDJ A;  4LPZ A;  5I5L A;  4DJ2 A;  1NYY A;  3SH9 A;  1G5U A;  1D1J A;  4Q0J A;  3F1O A;  3BYD A;  4MLL A;  2X02 A;  2EX9 A;  5DVA A;  1DP9 A;  2J3W A;  2Y55 A;  4C3Q A;  2V8C A;  2XF3 A;  3MFX A;  1OJG A;  1UGU A;  1VM1 A;  3GVB A;  1E3U D;  2ZQ9 A;  2O9B A;  5DKK A;  1XP4 A;  3IHB A;  4LFU A;  4X68 A;  1L0D A;  5CHU A;  1YQS A;  1IFQ A;  1K54 A;  4L9G A;  5HSQ A;  1CEG A;  1DRM A;  2XK1 A;  1JWV A;  4GD8 A;  1MWR A;  4I3I A;  4JGP A;  2OWJ A;  2NUT C;  1PYY A;  1EWZ A;  5DTT A;  4QY6 A;  2Y2M A;  4KZ9 A;  1Y54 A;  3UB5 P;  3R7W B;  4GNU A;  2HJE A;  2PD7 A;  1TVF A;  1XFQ A;  1OTE A;  4II7 A;  4HBT A;  1T1B A;  4JGQ A;  2PD8 A;  2FH5 A;  3IXB A;  5DJT A;  1K57 A;  3MJQ A;  3VP4 A;  4MDZ A;  4ID4 A;  1OTB A;  2D02 A;  3LEZ A;  1TF1 A;  5HD3 A;  5EFW A;  5FQJ A;  1I5Q A;  1WE4 A;  3M2J A;  3EGX C;  5HWW A;  5M19 A;  4BBU A;  3IQA A;  3HUM A;  4LRY C;  3WRZ A;  3KSG A;  5DFY A;  1ES3 A;  3KSH A;  5F1G A;  4RA7 A;  3IS2 B;  4UEY A;  4S2P A;  3UB8 A;  3GTC A;  3H9W A;  5CER A;  3BLS A;  4RX2 A;  4PM8 A;  4LLO B;  4UA6 A;  5A93 A;  1OTI A;  4EWF A;  3A3E A;  3GSG A;  2WZZ A;  3IXG A;  3HBR A;  4OOM A;  4FSF A;  2G7U A;  1SZV A;  1RCJ A;  2M1C A;  4BD0 A;  4CLC C;  4PAU A;  2WKI A;  3ULF A;  5EEC A;  4HES A;  1Q2P A;  3DTI A;  3DBA A;  3P01 A;  3T4T A;  1TS7 A;  5FDH A;  2VJW A;  2Y2P A;  4ZJ2 A;  4D2O A;  1CI8 A;  5EOE A;  2JCH A;  1BLS A;  3O86 A;  1JVJ A;  4KQR A;  4E3J A;  1N9B A;  1P9R A;  2P74 A;  4EER A;  1L2S A;  3D72 A;  1ZHH B;  4LCL A;  3HL9 A;  1FCM A;  4PMA A;  2P7J A;  1PWG A;  3IH9 A;  2HDR A;  3CG5 A;  4NXG A;  4Q8I A;  1ES5 A;  5A91 A;  1CK3 A;  1M40 A;  3LR4 A;  4UQI M;  2HDU A;  2I9V A;  1KDW A;  4KZB A;  4A5R A;  3N4I A;  1ESU A;  4Y15 A;  1S67 L;  3FG8 A;  3BY8 A;  1KOU A;  4HNB A;  3FC7 A;  1S4R A;  3F1P A;  5C5K A;  5HFO A;  3KO6 A;  3PBO A;  5F6A A;  3RXW A;  3H7W B;  4DXB A;  1LHY A;  3Q81 A;  2A24 B;  3UMD A;  4EES A;  2A2L A;  5EVL A;  2PU4 A;  3G4P A;  4IVK A;  1BLH A;  3ISG A;  3BY9 A;  2P04 A;  2UV0 E;  3U4L P;  3L9K A;  3M6H A;  4QWO A;  2J3T C;  1S4S A;  1IKG A;  5FI2 A;  5BOH A;  3LR3 A;  3O87 A;  2UWX A;  1XJ4 A;  4JXG A;  4ZRR A;  3VE3 A;  1TDG A;  2H0Y A;  4FCF A;  3EWK A;  4BEN A;  4CPK A;  4BL2 A;  2XEP A;  4KUK A;  2XRO A;  1V9Y A;  3W4Q A;  1U60 A;  3DWK A;  4OPR A;  1EI5 A;  3LCE A;  2GJ3 A;  3ZFZ A;  1HTZ A;  1PI5 A;  4AFI A;  1GSX A;  1T1C A;  3W2Z A;  1VQQ A;  2PU2 A;  1UWN X;  4Y5F A;  3LIC A;  1S1Z A;  4WMC A;  5EVE A;  3W4P A;  1F98 A;  2WKR A;  2EFX A;  3EQV A;  2R9X A;  3C7U A;  1GA0 A;  2P08 A;  3TJZ C;  3QP5 A;  5DJU A;  1JTG A;  2WKH A;  2GX5 A;  2V9A A;  4P6Z M;  3N8S A;  1YM1 A;  3Q7V B;  1XA7 A;  5DF9 A;  3IX3 A;  2RL3 A;  5FEG A;  5FAT A;  1HD8 A;  1OPX A;  2B5R A;  5F5Y A;  2OSU A;  1AXB A;  1XXM A;  4ZBE A;  2XD1 A;  2NUP C;  2ZQC A;  4I39 A;  2OAP 1;  1P0Z A;  2J80 A;  2RCX A;  1A0K A;  2ZLY A;  4HY8 A;  3T4Q A;  5HAP A;  3CI6 A;  4R3A A;  4O0P A;  2R78 A;  1MKM A;  2ZQ7 A;  2J3T D;  4P6Z S;  4BL3 A;  3VFH A;  1W63 M;  4X1M A;  5MC7 A;  2ZD8 A;  2K7S A;  2BTF P;  2GDN A;  2VV8 A;  3RXX A;  3FKV A;  1HVB A;  1P97 A;  2Q9M A;  2Y2H A;  4EW7 A;  1FIK A;  4EBL A;  1IKI A;  1GSW A;  1IEM A;  3DTK A;  3WS4 A;  2PBY A;  3NOP C;  2Y59 A;  3S4X A;  5L07 A;  1YLP A;  2V1A A;  5F82 A;  1NLY A;  4OQG A;  1L3L A;  3MXS A;  1UWP X;  4IJG A;  1SDE A;  4LV2 A;  2OLV A;  5LBR A;  2ZC7 A;  4L0L A;  4U3T A;  3BEC A;  4KUO A;  1CQA A;  4N1H A;  1YLZ A;  3TE8 A;  3UE6 A;  3T1S A;  4N92 A;  1H8Y A;  2B02 A;  5EVI B;  4WMC D;  2H10 A;  1NJ4 A;  3LFV A;  3C2W A;  3PBR A;  3HRE A;  4CQH A;  1GHI A;  2K2N A;  3O5Y A;  4EUV A;  4K0W A;  5CRF A;  5TBM B;  2FZ0 A;  1H8Z A;  5E43 A;  4OKP A;  4KZ3 A;  1I2S A;  2A49 A;  3D4F A;  2JKT M;  3CMZ A;  3BRM A;  4MBF A;  3TOI A;  3HCY A;  2P9V A;  3A3F A;  1STZ A;  5EV0 A;  2Q9N A;  2O9C A;  1LSW A;  2HP5 A;  4OQH A;  1ZG4 A;  3IX4 A;  3LR0 A;  4R4R A;  1K55 A;  2Y2N A;  3G6O A;  3MR0 A;  1Q2Q A;  4X53 A;  3Q7V A;  4K08 A;  1MZU A;  1BZA A;  3PTE A;  2MJ6 A;  2M7U A;  5EVI A;  4Y3I A;  5KSH A;  2ZOH A;  5F83 A;  3C4P A;  4PKY G;  2C6W B;  3LIA A;  2LB9 A;  3HLE A;  2JKR M;  4LRZ E;  3GDI A;  1OME A;  4XXR A;  5AQ9 A;  4GLQ A;  1S0W A;  2G2U A;  3SH8 A;  4DRT A;  2WAF A;  2ZC4 B;  4E3K A;  2PHY A;  3BWL A;  3HJI A;  1K6S A;  4CLC B;  1FSY A;  2WAE A;  3BFF A;  1GHP A;  1PRQ A;  3EQU A;  1V9Z A;  2PT7 A;  5L10 A;  1ZKJ A;  4MN5 A;  5JYP A;  4PM5 A;  1BLC A;  1S6R A;  4KZ8 A;  3LID A;  3LY4 A;  1FR1 A;  4Y0U A;  2A3U A;  2XFT A;  5F1F A;  4WM9 A;  3B3X A;  4HH3 A;  3A3I A;  3T1X A;  3QP6 A;  4MN6 A;  5IU1 A;  4WZ5 A;  3GEC A;  4K0X A;  1C3B A;  3SOI A;  3V67 A;  2BG1 A;  5HL1 A;  2WGI A;  5HD5 A;  4E3I A;  1MY8 A;  3P09 A;  1YMS A;  1IYP A;  2JE5 A;  1XJ2 A;  4LV3 A;  1TDL A;  3K2N A;  2XRN A;  3FPW A;  3VFF A;  4S2I A;  2ZMV A;  2VV7 A;  2HP9 A;  5JYO A;  3V5M A;  2XFS A;  2QYB A;  4OVD A;  2ZBB A;  4YOF A;  4S2O A;  3ZG5 A;  3MSH A;  4R6L A;  1XJ6 A;  4R0Q A;  3LIB A;  3VE4 A;  3PBS A;  4IBX A;  2CMN A;  1T18 A;  1KVM A;  3UNW A;  4R23 A;  4L9F A;  4ETZ A;  4I38 A;  3Q82 A;  4ETX A;  2Y2G A;  2A24 A;  1E3U A;  3T12 B;  3AGD A;  3NOU C;  5TBM A;  1RGZ A;  2XLN A;  4GHI A;  4S2K A;  4JXW A;  4HH2 A;  3GRJ A;  4ZDX A;  2PR6 A;  4NK3 A;  1O7E A;  1TEM A;  4JXS A;  1ERO A;  2XA7 M;  2WKE A;  4PM9 A;  1YLT A;  4EEP A;  5L2F A;  4WF0 A;  5KIZ A;  3LY3 A;  4DE3 A;  4E3L A;  4DMZ A;  4LCM A;  1LLB A;  2V0U A;  3HVF A;  3O88 A;  4GN2 A;  4QD4 A;  4GCZ A;  4PPR A;  1BLP A;  2ZC6 B;  3LEQ A;  4BBV A;  2EWW A;  4Y7P A;  1YAX A;  5CTM A;  2HPB A;  4KEN B;  3F1N B;  3E0Y A;  3IHA A;  3C30 A;  4JF5 A;  4WUJ A;  3IWQ A;  5GHY A;  3OPP A;  2EXB A;  3EEA A;  4EBN A;  1FOF A;  2EX2 A;  4G3W A;  4X6T A;  2W27 A;  3VOL A;  2QPN A;  3ITB A;  4KQQ A;  3PHY A;  4S2M A;  1G6A A;  1K38 A;  5FEF A;  1YMX A;  2WZX A;  1Y4O A;  4I3A A;  4GS9 B;  4QHC A;  5K5B A;  3R7W A;  4O7D A;  4HI4 A;  4EUZ A;  1PWC A;  5EOO A;  5M1A A;  1DP6 A;  4YWZ A;  3NEC A;  1XJ3 A;  2C5W B;  3TRC A;  5E2F A;  4E6X A;  4ZAM A;  3CAX A;  5KMW A;  1FCO A;  4WEJ A;  2I72 A;  2WUQ A;  2JHE A;  3P98 A;  4FH2 A;  5DTK A;  4E6W A;  1MWT A;  1ONH A;  3SZT A;  2PRF A;  3EGD C;  3ZYT A;  1AWI A;  5F68 A;  3QNB A;  1DJB A;  3PYP A;  1DY6 A;  3DWZ A;  1XPB A;  5CGX A;  3HLG A;  3U2A A;  3OCL A;  4EV4 A;  2HDS A;  5CHJ A;  1M6K A;  3WRT A;  3G2Y A;  3RTY A;  2JBF A;  2QZ6 A;  1VEU B;  4IED A;  3QP2 A;  3QNC A;  1LL5 A;  1ESI A;  5FI6 A;  3A0V A;  1NZU A;  4QB8 A;  3VV4 A;  5HL6 A;  4D60 A;  1SCW A;  3HLD A;  2HZ5 A;  5KSC A;  3NHQ A;  1XGI A;  3FPV A;  3IS2 A;  2Z2M B;  4GW9 A;  1HZO A;  1JTD A;  4B4Z A;  2JKT I;  1LSV A;  1XGJ A;  2W1T A;  4OOL A;  5FQQ A;  4BJP A;  5CED A;  5AQ7 A;  3P7N A;  1NRF A;  3LYX A;  3NDG A;  4MMN A;  3KSF A;  2V1B A;  4WZ4 A;  3UB7 A;  1RGY A;  4BWI A;  1WYC A;  1ERQ A;  4GHI B;  2Z2L B;  4MN7 A;  3A0S A;  3V50 A;  4N9K A;  3NOT C;  2VA0 A;  2BLS A;  4JGR A;  3MS6 A;  2Y79 A;  5EVI C;  3N8R A;  4Q0I A;  4GOG A;  5FI7 A;  5FAS A;  3NBL A;  4WBG A;  2ZL1 B;  1JNU A;  3E98 A;  1XA1 A;  3HUO A;  3V39 A;  3G2Z A;  4FH4 A;  1YSP A;  3PBQ A;  1GA9 A;  4KG6 A;  4B4X A;  4IUH A;  4U0X A;  1RP5 A;  4KG2 A;  3BW6 A;  3UDI A;  3EEH A;  3LUQ A;  4H6J A;  4OPY A;  4S2N A;  3RH8 B;  3B42 A;  3ZVW A;  4N9L A;  4FD8 A;  1QME A;  2XSS A;  2LB5 A;  4XT2 B;  4UAA A;  3D9Y A;  2VGL S;  3QP1 A;  3KSI A;  1N9O A;  5D3O A;  2W3G A;  1JWZ A;  3OZH A;  1LL9 A;  5G18 A;  5CXW A;  3M2K A;  2L0W A;  5E2H A;  3NI9 A;  3G35 A;  1MWS A;  3UN7 A;  3IH8 A;  1I2W A;  1E25 A;  1L0E A;  2BAS A;  3NJA A;  5EVI D;  1S66 L;  2J8Y A;  3ZG7 B;  2VGL M;  1IOU A;  4S2N C;  1FSW A;  4FTX A;  2QHK A;  3GMW A;  3KYE A;  3JVV A;  1OJ5 A;  1ES4 A;  3E2K A;  1NWZ A;  4HP9 A;  3VOY A;  2D01 A;  1DJC A;  3FV7 A;  3E4O A;  4EBP A;  3MKE A;  3VSL A;  4MCW A;  5E2E A;  3GV9 A;  5DKL A;  1K56 A;  4LV1 A;  1IYQ A;  3OCN A;  3MBZ A;  2XD5 A;  4UA9 A;  5FQI A;  1NLZ A;  1KE0 A;  5CTN A;  2ZQ8 A;  3ITA A;  1SKF A;  1VET A;  4OP5 A;  4DF6 A;  1MBL A;  2V2F F;  1ODV A;  3JYI A;  3CIT A;  3G31 A;  2ZQA A;  4WLA A;  4CLC A;  3UPN A;  2ZM0 A;  5G4Z A;  1LT0 A;  2W3E A;  2WYX A;  4HQA A;  3ICY A;  3OBF A;  4KQD A;  4E04 A;  2EX8 A;  3CPT A;  5FQK A;  5HAR A;  4MBH A;  4OLG A;  4GKU A;  4EEU A;  3H82 B;  3G30 A;  2GZA A;  2JKF A;  4QU3 A;  3DTE A;  4OPZ A;  2OLU A;  4WEL A;  3CPT B;  5TR7 A;  1H3Q A;  1Z6F A;  2EX6 A;  1KE4 A;  3BFE A;  3TG9 A;  2GNX A;  1PZO A;  2Y2J A;  2W0N A;  2ZJ9 A;  4I5S A;  3MXR A;  1MXO A;  1GSV A;  4JF6 A;  2ZC3 B;  4HJ4 A;  1BUE A;  4GB7 A;  3AGF A;  3KYQ A;  3FYZ A;  2WKP A;  3A3J A;  4RVA A;  5FL3 A;  1L0G A;  1W8Q A;  4RYE A;  5HPI A;  2JKG A;  5HX9 A;  2Y2L A;  4OON A;  4P87 A;  1H5X A;  1EW0 A;  4KQO A;  2K31 A;  4HJ6 A;  4G3K A;  1P9W A;  4DDS A;  1QMF A;  3PAE A;  5FDS A;  3MFD A;  2B18 A;  3QP8 A;  1IYO A;  3BFG A;  4P0M A;  2VKS A;  1H8M A;  2VGK A;  1KDS A;  3G34 A;  1TS0 A;  2VV6 A;  3DAV A;  1YT4 A;  1KE3 A;  1PI4 A;  3MMH A;  2VEA A;  1NRJ A;  1KGF A;  3A0R A;  2ZM8 A;  1PIO A;  3F1P B;  4G3V A;  3OLO A;  4R4S A;  4HHD A;  3SW1 A;  5J8X A;  4EQ1 A;  1YLW A;  3NC8 A;  1SKO A;  4JPM A;  4ESP A;  4OLD A;  3UPP A;  4HIA A;  3BEB A;  2V8F A;  4F3L B;  2X71 A;  2YKH A;  3I7J A;  2HF6 A;  5HWT A;  3OPL A;  2Y4A A;  5TJJ A;  3IBR A;  3S22 A;  2JN7 A;  4GDB A;  3CHW P;  4Z1W A;  3SS4 A;  3ZG9 B;  1F5M A;  4PKY A;  3O3V A;  1G6O A;  3KYZ A;  1OT6 A;  2OOL A;  1E4D A;  3CZD A;  4KZ4 A;  3SH7 A;  1W7F A;  3G32 A;  4XUX A;  1D7E A;  1CI9 A;  5KZH A;  2O99 A;  4R3B A;  1TS8 A;  5GLA A;  3HLC A;  3BQA A;  1BSG A;  3BFD A;  4BMW A;  4YNR A;  4K91 A;  1BTL A;  3VP2 A;  1X0O A;  2WAD A;  3T4L A;  1N4O A;  5M18 A;  4Y2F A;  3UDX A;  3MQQ A;  3WS5 A;  1CEF A;  4ARZ B;  2HP6 A;  4R38 A;  1L0F A;  1K4F A;  4F94 A;  2V0W A;  4P85 A;  5HPF A;  3WS0 A;  4BD1 A;  3MXQ A; 
#chains in the Genus database with same CATH homology
 3W4P A;  2EXA A;  3FZC A;  4KG5 A;  4ZJ3 A;  2HDS A;  4RX3 A;  5GHX A;  2EFX A;  3NCK A;  3EQV A;  1NY0 A;  5CHJ A;  1M6K A;  2R9X A;  1GA0 A;  3C7U A;  4IBR A;  3WRT A;  3G2Y A;  2VGJ A;  2JBF A;  2QZ6 A;  2FFF B;  1JTG A;  3C5A A;  4IED A;  2WKH A;  5EPH A;  2IWD A;  3IXH A;  4DE0 A;  1SDN A;  3N8S A;  1YM1 A;  3QNC A;  3Q7V B;  4OP8 A;  1XA7 A;  5DF9 A;  5FQ9 A;  1K6R A;  1LL5 A;  3Q1F A;  1ESI A;  5FI6 A;  2RL3 A;  5FAT A;  1NZU A;  2J7V A;  4QB8 A;  1HD8 A;  3VP3 A;  2B5R A;  3WS1 A;  3FKW A;  4ZTK A;  4BQM A;  4PM7 A;  1K55 C;  2OSU A;  2DRW A;  1SCW A;  3DTM A;  3HLD A;  1AXB A;  5DF7 A;  2IWB A;  1XXM A;  4ZBE A;  5TGF A;  4HBU A;  2XD1 A;  2WGW B;  2ZQC A;  3QHY A;  5KSC A;  3IF6 A;  2RCX A;  1XGI A;  2ZLY A;  3HLB A;  3C4O A;  5HAP A;  1MWU A;  4P6B A;  4MEZ A;  2Z2M B;  2ZQ7 A;  5FA7 A;  3CJM A;  1ERM A;  1HZO A;  3UE3 A;  5GHZ A;  1JTD A;  4BL3 A;  3VFH A;  3MZF A;  3ZNY A;  3Q07 A;  4DDY A;  3VP1 A;  2XQZ A;  5GLC A;  4B4Z A;  3ZG8 B;  4BLM A;  1XGJ A;  4Y0T A;  4OOL A;  2ZD8 A;  5FQQ A;  2OV5 A;  4BJP A;  5CED A;  5AQ7 A;  2IWC A;  5TFQ A;  1WYB A;  3IF6 B;  2GDN A;  3RXX A;  1NRF A;  3FKV A;  1HVB A;  2R9W A;  4E3M A;  2Q9M A;  2Y2H A;  4ZJ1 A;  3NDG A;  1PWD A;  4WZ4 A;  3PBN A;  3ZVT A;  4EBL A;  5A90 A;  3ZGA B;  1RGY A;  1IKI A;  1WYC A;  1PW8 A;  1IEM A;  3WS4 A;  1ERQ A;  2PBY A;  3W8K A;  2Y59 A;  4M3K A;  5FQM A;  3S4X A;  2Z2L B;  3GQZ A;  1YLP A;  1FR6 A;  3V50 A;  4N9K A;  4OPQ A;  5F82 A;  1K54 C;  4WMC A;  4OQG A;  3VSK A;  3MXS A;  2CC1 A;  2WK0 A;  2ZQD A;  2HDQ A;  5E2G A;  5HAQ A;  1SDE A;  2BLS A;  4LV2 A;  2OLV A;  2EFU A;  2ZC7 A;  4L0L A;  2Y2Q A;  4U3T A;  3N8R A;  1GHM A;  5EVI C;  3V3S A;  4IVI A;  4EQI A;  4GOG A;  1PZP A;  3BEC A;  5FI7 A;  3OC2 A;  5FAS A;  4N1H A;  3NBL A;  1YLZ A;  3S1Y A;  4C75 A;  3ZNT A;  4WBG A;  3V3R A;  1XA1 A;  3HUO A;  4N92 A;  3V39 A;  1H8Y A;  3IWO A;  4JXV A;  3G2Z A;  3NDE A;  4FH4 A;  4OQ0 A;  3PBQ A;  1GA9 A;  4KG6 A;  5EVI B;  2DNS A;  4WMC D;  4B4X A;  1BUL A;  2H10 A;  4U0X A;  4KZ6 A;  2QMI A;  1RP5 A;  1NJ4 A;  3TSG A;  4KG2 A;  1LI9 A;  3PBR A;  3N8L A;  3HRE A;  3N7W A;  1NYM A;  2XGN A;  1GHI A;  3UDI A;  4S2L A;  4H8R A;  1W8Y A;  2J9P A;  3A3D A;  1NXY A;  4K0W A;  4E3N A;  4OPY A;  5CRF A;  4S2N A;  1SHV A;  3Q7Z A;  5FAP A;  1H8Z A;  4Y0O A;  3ZVW A;  3FWL A;  4OKP A;  5E43 A;  3AGE A;  5A92 A;  4N9L A;  1ALQ A;  4LV0 A;  4KZ3 A;  4WEK A;  4KZA A;  1I2S A;  2A49 A;  2WGV A;  3IT9 A;  3D4F A;  4FD8 A;  1QME A;  3CMZ A;  3BRM A;  4WYY A;  4UAA A;  4MBF A;  3HUN A;  3TOI A;  2P9V A;  4X55 A;  3A3F A;  5AQA A;  2JC7 A;  3VOZ A;  2WGW A;  2Q9N A;  3BFC A;  1GCE A;  5D3O A;  2HP5 A;  4OQH A;  4QY5 A;  1JWZ A;  1ZG4 A;  1IEL A;  1FQG A;  3OZH A;  1YLY A;  1LL9 A;  3ZHH A;  4R4R A;  5G18 A;  4DKI A;  3N6I A;  5CXW A;  3M2K A;  4UA7 A;  1K55 A;  2Y2N A;  5E2H A;  3NI9 A;  3G35 A;  3LO7 A;  1MWS A;  3UN7 A;  3IH8 A;  3IXD A;  4GDN A;  1I2W A;  4B88 A;  1E25 A;  2XH9 A;  2H0T A;  1Q2Q A;  4DE1 A;  1L0E A;  4X53 A;  1KGG A;  3Q7V A;  1ZC2 A;  5EVI D;  2Y2I A;  5HAI A;  1BZA A;  1FCN A;  2J8Y A;  3PTE A;  3UE0 A;  3ZG7 B;  5EVI A;  1PW1 A;  5KSH A;  4S2N C;  2Y2K A;  3ZDJ A;  2V1Z A;  4JKT A;  5F83 A;  1FSW A;  3C4P A;  3C7V A;  2C6W B;  3GMW A;  1NYY A;  3SH9 A;  3HLE A;  3RJU A;  1OME A;  2FFY A;  1ES4 A;  3E2K A;  3BYD A;  2J9O A;  4MLL A;  5FSR A;  4GD6 A;  2X02 A;  4WZ5 C;  1JWP A;  4XXR A;  3VOY A;  5AQ9 A;  2EX9 A;  1DJC A;  5DVA A;  3FV7 A;  1S0W A;  2G2U A;  4Z9Q A;  2Y55 A;  4OOY A;  3SH8 A;  4C3Q A;  4EBP A;  1KGE A;  4DRT A;  1K56 D;  3MKE A;  3VSL A;  2WAF A;  2XF3 A;  2ZC4 B;  3GV9 A;  3OPR A;  4UHU A;  5E2E A;  4E3K A;  2ZMA A;  1K56 A;  4LV1 A;  1IYQ A;  3OCN A;  3MBZ A;  1VM1 A;  3GVB A;  1E3U D;  1K6S A;  2XD5 A;  4UA9 A;  2ZQ9 A;  5FQI A;  1KE0 A;  1FSY A;  5CTN A;  2ZQ8 A;  2WAE A;  3BFF A;  3ITA A;  1GHP A;  1SKF A;  1XP4 A;  3IHB A;  3EQU A;  4X68 A;  3UY6 A;  2ZC5 B;  4OP5 A;  1L0D A;  4DF6 A;  5GL9 A;  1MBL A;  2V2F F;  3JYI A;  5CHU A;  1YQS A;  1ZKJ A;  1K54 A;  5JYP A;  4PM5 A;  1BLC A;  1S6R A;  1CEG A;  3E2L A;  4KZ5 A;  3G31 A;  2ZQA A;  4KZ8 A;  4MBK A;  4N1X A;  2XK1 A;  4U0T A;  2H5S A;  5EE8 A;  3UPN A;  3LY4 A;  1FR1 A;  1JWV A;  4Y0U A;  1KVL A;  2A3U A;  2XFT A;  4GD8 A;  2ZM0 A;  3B3X A;  4WM9 A;  1MWR A;  5F1F A;  1ONG A;  3A3I A;  4YIN A;  3UE1 A;  1PYY A;  1EWZ A;  5DTT A;  5EUA A;  4QY6 A;  3MKF A;  2Y2M A;  4KZ9 A;  5GLB A;  5U47 A;  2WYX A;  1Y54 A;  4WZ5 A;  4GNU A;  1O07 A;  2EX8 A;  1ES2 A;  1TVF A;  5FQK A;  4K0X A;  5HAR A;  1C3B A;  4MBH A;  3SOI A;  2BG1 A;  4HBT A;  4OLG A;  5HL1 A;  3IXB A;  2WGI A;  4GKU A;  4E3I A;  1K57 A;  1MY8 A;  3P09 A;  1YMS A;  1IYP A;  1ZG6 A;  3VP4 A;  4ID4 A;  2JE5 A;  3G30 A;  1DJA A;  4QU3 A;  4LV3 A;  1TDL A;  3LEZ A;  4OPZ A;  1YLJ A;  2OLU A;  3DW0 A;  3HLW A;  4WEL A;  3SS5 A;  5FQJ A;  1IYS A;  4S2I A;  3VFF A;  1I5Q A;  1WE4 A;  3M2J A;  5CEB A;  5TR7 A;  4YFM A;  4QJG A;  5M19 A;  3IQA A;  2HP9 A;  3HUM A;  3WRZ A;  5JYO A;  1Z6F A;  4JF4 A;  2G2W A;  3V5M A;  2XFS A;  1ES3 A;  2EX6 A;  2V20 A;  4OVD A;  1KE4 A;  3BFE A;  3TG9 A;  5F1G A;  4S2O A;  4XUZ A;  4RA7 A;  1PZO A;  2Y2J A;  2ZJ9 A;  3ZG5 A;  5IHV A;  4S2P A;  3MXR A;  3W4O A;  1MXO A;  3GTC A;  4R1G A;  3BLS A;  4RX2 A;  5CER A;  4R0Q A;  4PM8 A;  2ZM2 A;  4JF6 A;  2ZC3 B;  3NY4 A;  1BUE A;  4UA6 A;  1K57 C;  1MPL A;  4GB7 A;  4CJN A;  5A93 A;  1G68 A;  4EWF A;  3AGF A;  3PBS A;  4IBX A;  5I94 A;  3A3E A;  4R3J A;  4MNR A;  3FYZ A;  3GSG A;  2WZZ A;  5GLD A;  3A3J A;  3IXG A;  1KVM A;  4RVA A;  3UNW A;  3HBR A;  4OOM A;  4FSF A;  4R23 A;  1L0G A;  1W8Q A;  4S2J A;  4RYE A;  2P9V B;  3OPH A;  1LI0 A;  1RCJ A;  3Q82 A;  3VP0 A;  4BD0 A;  5HX9 A;  2Y2L A;  1XX2 A;  4OON A;  4P87 A;  1H5X A;  2WKI A;  2Y2G A;  4KQO A;  1E3U A;  5EEC A;  4HES A;  1Q2P A;  4DDS A;  3AGD A;  1QMF A;  3PAE A;  3MFD A;  4X56 A;  1IYO A;  1RGZ A;  2XLN A;  3BFG A;  4P0M A;  4S2K A;  4JXW A;  4OH0 A;  5FDH A;  2Y2P A;  4HEF A;  4ZJ2 A;  4D2O A;  3GRJ A;  1CI8 A;  2VGK A;  5EOE A;  1KDS A;  3G34 A;  3VMA A;  4ZDX A;  3MZD A;  4NK3 A;  1O7E A;  2JCH A;  1BLS A;  1TEM A;  1YT4 A;  1KE3 A;  3O86 A;  1JVJ A;  1ERO A;  1PI4 A;  4JLF A;  1N9B A;  4JXS A;  4KQR A;  4E3J A;  3UPO A;  2P74 A;  2WKE A;  1KGF A;  4PM9 A;  4DXC A;  1YLT A;  2ZM8 A;  1L2S A;  1NZO A;  1PIO A;  1W79 A;  5L2F A;  3HLF A;  4LCL A;  3LY3 A;  3HL9 A;  4R4S A;  1FCM A;  4DE3 A;  4PMA A;  4E3L A;  3WWX A;  1PWG A;  1J9M A;  2HDR A;  3CG5 A;  3IH9 A;  1LLB A;  4LCM A;  3ZG0 A;  3HVF A;  3O88 A;  1ES5 A;  5A91 A;  3UDF A;  4C6Y A;  1YLW A;  4Q8I A;  2Y2O A;  1CK3 A;  2DCF A;  1M40 A;  5DTS A;  3NC8 A;  4GN2 A;  2HDU A;  4JPM A;  4OLD A;  4QD4 A;  3UPP A;  1KDW A;  4KZB A;  4A5R A;  2XR0 A;  3N4I A;  4PPR A;  1BLP A;  2ZC6 B;  1ESU A;  3BEB A;  4E3O A;  4Y7P A;  2X71 A;  5CTM A;  5HW3 A;  2HPB A;  3I7J A;  5FAO A;  3OPL A;  4KEN B;  2Y4A A;  3IHA A;  4JF5 A;  5HFO A;  3S22 A;  3SS3 A;  3PBO A;  5CGS A;  3IWQ A;  5GHY A;  4GDB A;  3NIA A;  2EXB A;  3OPP A;  3M6B A;  3RXW A;  4EBN A;  4DXB A;  1FOF A;  1LHY A;  2EX2 A;  3Q81 A;  3SS4 A;  3ZG9 B;  3O3V A;  4X6T A;  3CZD A;  1E4D A;  4KZ4 A;  2QPN A;  5CGW A;  5EVL A;  3SH7 A;  1W7F A;  2Y91 A;  3G32 A;  3ITB A;  4KQQ A;  4XUX A;  4S2M A;  2PU4 A;  1G6A A;  3G4P A;  1K38 A;  4IVK A;  1CI9 A;  1YMX A;  1BLH A;  3ISG A;  2WZX A;  5KZH A;  4OQI A;  4LEN A;  4R3B A;  2XDM A;  3M6H A;  4QHC A;  4GZB A;  5GLA A;  4PM6 A;  1IKG A;  3HLC A;  4O7D A;  5FI2 A;  5BOH A;  3IF6 C;  3O87 A;  1BSG A;  3BFD A;  1PWC A;  4EUZ A;  5EOO A;  4K91 A;  5CHM A;  5M1A A;  3BLM A;  2UWX A;  4JXG A;  1BTL A;  3VP2 A;  1TDG A;  2C5W B;  2H0Y A;  4DE2 A;  4FCF A;  2WAD A;  5E2F A;  2X01 A;  1MKI A;  1N4O A;  1XKZ A;  4BEN A;  4E6X A;  5CEC A;  4ZAM A;  4CPK A;  4BL2 A;  5M18 A;  3ZCZ A;  2E8I A;  4JBF A;  3UDX A;  3PAG A;  5KMW A;  5AQB A;  1FCO A;  3WS5 A;  1CEF A;  3BM6 A;  2XEP A;  4WEJ A;  2I72 A;  4KZ7 A;  4X69 A;  2WUQ A;  5J8X A;  2HP6 A;  3IF5 A;  3P98 A;  4FH2 A;  5DTK A;  3W4Q A;  1MWT A;  4E6W A;  1L0F A;  1ONH A;  1BT5 A;  1U60 A;  3DWK A;  4OPR A;  1K4F A;  1W5D A;  1EI5 A;  1K25 A;  3LCE A;  4F94 A;  5DF8 A;  3ZFZ A;  4NET A;  1HTZ A;  3QNB A;  5FAQ A;  1PI5 A;  1DJB A;  3MZE A;  4P85 A;  3WS0 A;  4BD1 A;  3IWI A;  1VQQ A;  2PU2 A;  1DY6 A;  3DWZ A;  1XPB A;  5CGX A;  3WS2 A;  3UO9 A;  3HLG A;  1K4E A;  3OCL A;  4EV4 A;  3PBT A;  3GR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...