4RX3A

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMGTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rx3A00
3GVBA 2P9VB 3S1YA 4K0WA 4JXVA 4DE1A 3MXRA 2XR0A 3HLFA 4YINA 3TSGA 2FFFB 3V3RA 5GLDA 3PTEA 3MXSA 5FSRA 1QMEA 3P98A 1SDEA 1M6KA 4F94A 5JYOA 5A93A 3UE1A 4Y0UA 4A5RA 1IELA 2Q9NA 5FQ9A 4EBLA 4OH0A 4GB7A 1EI5A 5E2EA 4MEZA 4YFMA 3UY6A 2ZM8A 3UDXA 3S4XA 1FCMA 2J9PA 3OCLA 1BLSA 3CG5A 4WMCD 4H8RA 1ERQA 1ONHA 2V2FF 3M6BA 4JPMA 3ZG5A 1WYCA 4OQHA 5KMWA 4P85A 1S6RA 1CI8A 3SH8A 2WZXA 1MWUA 1U60A 4QY6A 3SS4A 2XEPA 3PBTA 5HL1A 4OPYA 4KZ4A 3LY4A 3HLDA 4JF4A 4RVAA 1PZOA 3DW0A 2Z2MB 1KDSA 1JTGA 3N7WA 1JWPA 2VGKA 3BEBA 1FR1A 5L2FA 3C4PA 5FI6A 3UDFA 4WM9A 1W8QA 2H5SA 2I72A 5EVIC 3ZVWA 3IXHA 5DVAA 1PI5A 2XGNA 3OPHA 3NI9A 3NDGA 3PAEA 4P0MA 1PWDA 5FDHA 4RX2A 3DWZA 2H0TA 4N9KA 4S2MA 4U0TA 1IYPA 3PBOA 4LV3A 4Q8IA 1MKIA 1MXOA 4QU3A 2Q9MA 1RGYA 3N6IA 1W8YA 5HAIA 1PW1A 5CHUA 3FKVA 4KZ7A 4WBGA 3GTCA 2H0YA 5FAOA 4IBXA 5F82A 4JXWA 1KDWA 2EXBA 3G2YA 1W5DA 1CEFA 3A3DA 4QHCA 3PBQA 3QNCA 5DF8A 4UA9A 5CERA 3NCKA 2X02A 1TDGA 4XXRA 3TG9A 3HLCA 1GA9A 1XGJA 1MWSA 1NYMA 2ZQ7A 3LCEA 5EVID 4JBFA 3NC8A 1CEGA 4OPZA 5U47A 3HUMA 2Y2IA 1YLWA 1NJ4A 1NXYA 4NK3A 1Z6FA 1I5QA 1FQGA 3CZDA 3DTMA 3IH8A 2XK1A 4EBNA 1SKFA 3I7JA 4D2OA 1GHPA 4RX3A 4EQIA 3DWKA 4LCMA 5FAQA 1K25A 3UE0A 3WS2A 3FYZA 3VOYA 3SH9A 5KZHA 4M3KA 4O7DA 4KQRA 1DY6A 3M2KA 3Q82A 1FCNA 1KE3A 1ZC2A 2VGJA 1H8YA 3ITAA 5FQKA 5FAPA 4S2KA 1ZKJA 4DXCA 1L0GA 4S2PA 2EFXA 4OOYA 2P9VA 1NRFA 1BLPA 1M40A 4Z9QA 3ZGAB 5BOHA 5FI2A 4E3IA 4GZBA 2J8YA 2EXAA 5CHJA 1GA0A 1EROA 3MKEA 4QY5A 4IVKA 4PPRA 3ZFZA 3MKFA 1KGGA 1FSYA 1ZG6A 3HVFA 1FOFA 4E3LA 1DJCA 2JBFA 4ZJ1A 5DTTA 1ZG4A 5F1FA 3VOZA 4GD6A 4OQ0A 4OVDA 3IXGA 3OZHA 1FCOA 4WEKA 4Y7PA 4PM7A 2B5RA 1K55A 1H5XA 3IQAA 4K91A 4GD8A 5GHZA 2EX2A 3V39A 4BD0A 4EV4A 5EPHA 3HUNA 4LCLA 3WRZA 5CRFA 4X69A 5CHMA 1KVMA 1AXBA 3RJUA 2G2UA 3JYIA 4WZ5A 4RA7A 3IF6C 4P87A 1BT5A 1LLBA 3BFFA 3BRMA 5A92A 4JKTA 1I2WA 2OV5A 2R9WA 5HX9A 4FD8A 1PI4A 3UNWA 4CPKA 1XPBA 2WGVA 4BJPA 1K57A 1MY8A 5CTMA 1ERMA 1KE0A 1YLTA 4S2JA 3VMAA 3IHBA 4N1HA 5TR7A 3BFCA 1PZPA 4X55A 4B4ZA 4S2NC 5CXWA 1HVBA 1K38A 4GNUA 1SCWA 4X68A 2XD5A 5CGSA 5A90A 1GHIA 3SOIA 3ZG0A 3V5MA 3C7UA 4WMCA 1K56D 4XUXA 3V50A 3ZNYA 1YLPA 2XFTA 4KZAA 1SHVA 4KZ3A 4MLLA 2DCFA 3VP3A 1N4OA 2HP5A 4JXGA 4R1GA 4KENB 4BQMA 2A3UA 4OPQA 1YT4A 2JE5A 1YQSA 3UPOA 1PWGA 1ONGA 2ZC6B 3IF5A 4FH2A 1FSWA 1Y54A 1LI0A 1IYQA 4KZ8A 2RCXA 3O86A 1E3UD 4WELA 5EUAA 2PU2A 5E43A 3UE3A 1W7FA 4B4XA 1JTDA 3G2ZA 1NY0A 1XA7A 5E2GA 5IHVA 1GCEA 3ZG9B 2XFSA 4GOGA 2Z2LB 1TEMA 4DF6A 3UPNA 1ESUA 4PMAA 3ZHHA 5JYPA 1J9MA 4R23A 5AQ9A 3ZG7B 3VFFA 3RXXA 1KGFA 4HBUA 5FQQA 3GV9A 4EUZA 3N8SA 4LV0A 4KQQA 3IH9A 1IKIA 2WKHA 5M18A 5AQAA 1K57C 3FKWA 1RCJA 3UO9A 1K4FA 2HP9A 2XF3A 5EVIB 2XDMA 4OOMA 5FATA 1BLCA 4KZBA 5GLCA 2ZM0A 2ZQ9A 1K4EA 3G31A 2J9OA 5KSHA 1JWZA 2HPBA 3IXDA 4S2NA 1S0WA 2EX6A 4OOLA 4U3TA 1G6AA 4L0LA 1YMXA 1EWZA 1E25A 2QPNA 3AGFA 2EX9A 4OLGA 5EE8A 1QMFA 1H8ZA 1PW8A 2GDNA 2Y59A 3IF6B 3ITBA 1Q2QA 5A91A 4R3BA 5EOOA 1NZOA 4KZ6A 2A49A 4PM5A 2ZM2A 3G30A 1CK3A 3VP1A 2Y4AA 4MBKA 4PM8A 2Y2LA 1PIOA 2HDSA 5HAQA 2H10A 1I2SA 1SDNA 5CEBA 1YLZA 1YM1A 4JF5A 1RGZA 4LENA 3BFDA 3M2JA 2WAFA 2XQZA 3WWXA 3RXWA 1E3UA 1PWCA 2R9XA 3EQVA 4RYEA 3G35A 4P6BA 4CJNA 3ZCZA 5GL9A 3BECA 3SS5A 5J8XA 4BL2A 4BENA 1K56A 4N92A 4GKUA 2G2WA 3HLGA 2Y55A 1GHMA 4S2LA 4GDNA 2P74A 4DDSA 4DKIA 1BULA 1JWVA 3OPRA 1K55C 1LHYA 2PBYA 5DF7A 5EECA 3HUOA 3VSLA 1VM1A 2ZC7A 3Q7VB 3A3FA 2Y2JA 3G4PA 3VP4A 1YMSA 1CI9A 1L0FA 3LO7A 4ID4A 4KG2A 2ZMAA 3ZDJA 4E3JA 2Y2GA 2QZ6A 3IWQA 2ZQ8A 4OPRA 4E3NA 3HL9A 2JC7A 4KZ5A 1KGEA 4C6YA 5CECA 4MBFA 3A3IA 2Y2QA 3BFGA 5D3OA 5EVLA 2XH9A 4OP5A 2PU4A 5E2HA 5M19A 3MZEA 4OP8A 4GN2A 3TOIA 3O3VA 3NBLA 4KG6A 4R0QA 4ZJ3A 3E2LA 1HTZA 1XX2A 3HREA 2Y2NA 3IWIA 4S2IA 3Q7VA 2Y2PA 2WGIA 3Q1FA 2RL3A 2OSUA 3Q7ZA 4DE2A 1O7EA 4JF6A 1HD8A 1IYOA 4OQGA 2WKEA 5FQJA 1PYYA 3NY4A 1KE4A 2J7VA 1FR6A 4X6TA 2XD1A 4JXSA 1YLYA 4QJGA 2C5WB 3WS4A 1MBLA 3N8LA 4UA6A 1HZOA 4ZTKA 4DE3A 3VSKA 4DRTA 4BL3A 1TVFA 5DTKA 1C3BA 5FI7A 4EWFA 3AGDA 2WGWA 3UPPA 3S22A 5DF9A 4WYYA 4N1XA 2X01A 4DXBA 3GQZA 4S2OA 5F83A 3A3JA 3CMZA 3HLBA 4C75A 3OPLA 1IKGA 5AQBA 1W79A 1XP4A 3SH7A 2Y2OA 4LV1A 2C6WB 2FFYA 4OONA 3V3SA 4GDBA 1DJAA 1XKZA 2UWXA 3OC2A 1K6SA 2WADA 3NDEA 4R3JA 5HFOA 3IF6A 1BUEA 1K54C 3W4OA 1G68A 1MWRA 3WS1A 1XXMA 4KG5A 3O87A 4OKPA 4IVIA 4R4SA 2ZJ9A 2HDRA 3NIAA 4IBRA 4OQIA 4E3OA 4FH4A 1Q2PA 3MBZA 4QD4A 1WE4A 2ZQCA 4FCFA 1MWTA 2JCHA 3FV7A 5DTSA 3P09A 1RP5A 2HDUA 1LI9A 5KSCA 5M1AA 5CGXA 1K54A 2V1ZA 2WUQA 5FASA 2CC1A 1L0DA 2QMIA 2ZC4B 4PM9A 3M6HA 4WEJA 4R4RA 2WK0A 1XA1A 3BYDA 3HLEA 4NETA 3GSGA 1BZAA 3MZDA 1ALQA 1ESIA 3B3XA 3Q07A 4HEFA 4BD1A 1BLHA 3WRTA 4OLDA 4UAAA 5E2FA 5HAPA 1TDLA 1MPLA 4K0XA 3VP0A 2OLVA 4WZ4A 4UHUA 3HBRA 4X53A 4ZAMA 2IWCA 3BLSA 1L2SA 3W4QA 3G34A 3LY3A 2DNSA 1O07A 3IT9A 5CTNA 2ZLYA 5FA7A 4FSFA 4KZ9A 3ZG8B 2Y91A 4E3KA 1IYSA 4KQOA 3E2KA 5GLBA 5GLAA 1WYBA 1KVLA 4PM6A 3BLMA 3C7VA 3Q81A 3HLWA 4MNRA 2OLUA 5EVIA 3SS3A 1BTLA 3BFEA 2IWDA 5GHXA 3IHAA 4Y0OA 3OCNA 2ZD8A 4ZJ2A 3FWLA 4LV2A 5FQMA 3O88A 4B88A 1E4DA 1DJBA 2HDQA 2WKIA 3BM6A 3FZCA 4BLMA 2E8IA 2ZC3B 5HW3A 1VQQA 5TGFA 3PBSA 3OPPA 1NYYA 3PAGA 3UDIA 3PBNA 3VP2A 5EOEA 2HP6A 3D4FA 4HESA 1ES2A 3QNBA 3WS5A 2WGWB 3W8KA 1NZUA 3GR2A 4C3QA 2WYXA 3GRJA 3MFDA 4HBTA 4X56A 4IEDA 3N8RA 1LL5A 2X71A 2Y2MA 3AGEA 4XUZA 2V20A 2Y2KA 2ZC5B 2BG1A 2WZZA 2Y2HA 1ES4A 3LEZA 3W4PA 3G32A 4N9LA 1OMEA 2BLSA 4MBHA 4E3MA 1YLJA 2IWBA 1ES3A 3GMWA 5GHYA 1LL9A 1XGIA 3QHYA 3UN7A 5F1GA 3WS0A 5CEDA 4EBPA 3VFHA 3MZFA 3ZNTA 1BSGA 1JVJA 1K6RA 2DRWA 4U0XA 4DE0A 3EQUA 3IXBA 1IEMA 5G18A 2EFUA 4E6XA 3IWOA 5HARA 5TFQA 3C5AA 2XLNA 2WAEA 4UA7A 5AQ7A 4ZDXA 5I94A 2ZQAA 1N9BA 1ES5A 3ISGA 4WZ5C 4DDYA 4E6WA 4QB8A 3PBRA 3CJMA 5CGWA 4ZBEA 3ZVTA 5FQIA 2EX8A 4Y0TA 3N4IA 2ZQDA 3C4OA 4JLFA 3A3EA 1L0EA
chains in the Genus database with same CATH superfamily
3GVBA 2P9VB 4K0WA 3SW1A 4DE1A 1VETA 4YINA 2FFFB 5GLDA 1UGUA 1QMEA 1SDEA 3QP4A 2JKRI 5A93A 4A5RA 3MQQA 3CPTB 4GB7A 5E2EA 4Z1WA 3S4XA 5TBMB 3OCLA 1FILA 4MMNA 2VX8A 2V2FF 5KMWA 1CI8A 1MWUA 5HL1A 4OPYA 4ARZA 4RVAA 2VGLM 3DW0A 2VZWA 3KYZA 1JTGA 3N7WA 5L2FA 1FR1A 2LB5A 3QP6A 3C2WA 3ZVWA 3OPHA 3PAEA 1XJ6A 4P0MA 4RX2A 3DAVA 3PBOA 4LV3A 4LFUA 3V67A 1W8YA 4RQ9A 5HAIA 4WBGA 3GTCA 4IBXA 3F1PB 1KDWA 2EXBA 3KO6A 3G2YA 3A3DA 2JKTI 3PBQA 4I5SA 5DF8A 4XXRA 1TDGA 3TG9A 1GA9A 1XGJA 4OPZA 1CEGA 5U47A 2YKFA 1Z6FA 1FQGA 3DTMA 2Y79A 4EBNA 1OJ5A 4EEPA 4RX3A 3DWKA 4LCMA 3UE0A 3FYZA 3SH9A 5KZHA 2V8CA 1VB6A 1DY6A 4KQRA 1ZC2A 1H8YA 5LBRA 5FAPA 4S2PA 2EFXA 5C5KA 2P9VA 3ZGAB 1M40A 5FI2A 4GZBA 5CHJA 1GA0A 3MKEA 4IVKA 3ZFZA 1FSYA 1FOFA 4M4XA 1ZG4A 1L3LA 5F68A 4GD6A 3T12B 4OVDA 3U2AA 4WEKA 4EERA 3CI6A 5IU1A 5GHZA 3IQAA 4K91A 2I9VA 3LYXA 4P6ZM 5CX7A 5TBMA 3HUNA 4LCLA 5CRFA 3RJUA 3JYIA 3MS6A 1BT5A 4UQIM 5A92A 4GJ4A 1I2WA 4EETB 4Y15A 2WGVA 1JNUA 1KOUA 4N1HA 4ESPA 4YOFA 2XD5A 4MN5A 3EGDC 3V50A 1SHVA 3QP1A 4BQMA 4KENB 2A3UA 3IF5A 2ZC6B 5EUAA 1IYQA 1E3UD 1T1CA 1JTDA 1XA7A 1NLYA 3LGOA 2Z2LB 4DF6A 2QWSA 1H3QA 4R23A 4JGQA 3RXXA 1KGFA 3GV9A 3QP5A 4LV0A 1K0KA 4HH3A 3FKWA 1CQAA 4HY8A 5DJTA 3T1QB 2XF3A 2XDMA 1F2KA 2B02A 2A24B 4EXOA 4DMZA 3DBAA 4OOLA 3E4QA 1E25A 5EE8A 1LT0A 4DJ3A 1H8ZA 3ITBA 5A91A 3IF6B 1Q2QA 4KZ6A 4PM5A 3G30A 3OLOA 3JVUA 1PIOA 2HDSA 5HAQA 1SDNA 1YLZA 5L10A 4JGOA 1RGZA 4LENA 2PT7A 3PHYA 3WWXA 5KIZA 1E3UA 5GL9A 4KUKA 4BENA 3P01A 4F3LB 2G2WA 3HLGA 3S7NA 2A2LA 2IA2A 4HJ3A 5EECA 1D06A 3VSLA 2ZC7A 3Q7VB 3MF0A 3NOTC 5G4ZA 3VP4A 3LI9A 1CI9A 2PRFA 4KG2A 2J3TD 2GZAA 4B9OA 3HL9A 2V0WA 4NXEA 1G5UA 4C6YA 3A3IA 2PU4A 3MZEA 4OP8A 4GN2A 2OWHA 2Z6DA 4R0QA 1HTZA 3IWIA 1UWNX 4JF6A 2J7VA 4X6TA 1YLYA 4II7A 1DRMA 3EGXC 1CF0A 4ZTKA 4GCZA 1TVFA 1C3BA 1MZUA 3AGDA 4N1XA 2X01A 3LUQA 3A3JA 3HLBA 1XP4A 2Y2OA 4HP4A 3V3SA 1ZHHB 4MCWA 2BTFP 2UWXA 2WADA 3NDEA 2GJ3A 4KG5A 3O87A 1D1JA 4BBUA 2W3GA 4OQIA 4NKPA 2V1BA 1MWTA 1V9ZA 1RP5A 1K54A 3T4QA 2CC1A 3M6HA 2VA0A 2HV1A 1BZAA 5TJJA 4HEFA 4BD1A 4UAAA 5E2FA 1J3WA 1PRQA 3ZQ5A 3HBRA 3BLSA 3W4QA 4Q0HA 3G34A 3LY3A 2DNSA 3EWKA 1O07A 5FA7A 3A0SA 1IYSA 4I3IA 3E2KA 1KVLA 4PM6A 2OLUA 2W1TA 4IUHA 3OCNA 2ZD8A 4Q0IA 5FQMA 3O88A 1E4DA 2HDQA 2WKIA 3BY9A 4O01A 1VQQA 3H82A 3PAGA 3VP2A 3T1SA 3D4FA 1Z09A 2WGWB 3EEHA 3W8KA 1NZUA 3CLOA 1S1YA 3GR2A 4X56A 1LL5A 3AGEA 4R6LA 1ES4A 3W4PA 3G32A 1OMEA 4MBHA 1YLJA 1DP9A 5GHYA 1LL9A 4NEED 4E04A 3ZNTA 1K6RA 3U4LP 5G18A 4E6XA 5HARA 3C5AA 2XLNA 5AQ7A 3FC7A 3IS2A 4MDZA 3ISGA 4WZ5C 4E6WA 3ZVTA 1N9LA 2OWJA 3KSFA 5FQIA 4Y0TA 3C4OA 1YSQA 4JLFA 3UE6A 2VV6A 4LRZE 1AWIA 1F98A 1XJ3A 3T1XA 3MXSA 5FSRA 4F94A 4Y0UA 3FG8A 1IELA 2Q9NA 5FQ9A 2HJ9C 4MEZA 3UY6A 3F1OB 3UDXA 3T4SA 2JKFA 3CG5A 4DJ2A 1ONHA 1YSPA 3M6BA 4JPMA 1WYCA 4OQHA 4P85A 4HNBA 3DTKA 2WZXA 3UMDA 2XEPA 2HJEA 4JF4A 3O5YA 3CAXA 2Z2MB 4FTXA 1GSVA 5F6AA 5FI6A 1V9YA 4WM9A 1P9WA 3K2NA 4KUOA 1T1AA 1PI5A 2H0TA 2GNXA 2QHKA 5HWWA 4YNRA 4Q8IA 3TW8A 1RGYA 3N6IA 5FAOA 2VJWA 3QNCA 5CERA 3NCKA 3LCEA 2ZQ7A 3NC8A 3CUEA 1YLWA 1NJ4A 1NXYA 4NK3A 3K3DA 2JKGA 5DFXA 1SKFA 4D2OA 4Y5FA 3E4PA 3VOYA 5G4YA 3M2KA 1BYWA 4K08A 4NXGA 1FCNA 1N9OA 3K3CA 1VEUB 3TJZC 5BOHA 3LIFA 1LL8A 1VHMA 2J8YA 3T4JA 4ZJ1A 3CWFA 5DTTA 2EWWA 3D72A 5L07A 2FZ0A 2OOLA 3VOZA 3C8CA 2W1RA 4Y7PA 5AVFA 1K55A 1H5XA 3V39A 3H82B 2J80A 1MKMA 4EV4A 5EPHA 1OTAA 3QP2A 1YKDA 3F1NB 1KVMA 2G2UA 3IF6C 3BFFA 1LLBA 1XPBA 1W63Q 1K57A 1MY8A 1ERMA 1KE0A 1YLTA 4S2JA 5TR7A 1PZPA 3KX0X 1H8MA 3MXQA 4X55A 5CXWA 3UB8A 1G28A 4GNUA 2HGVA 4WMCA 4XUXA 1YLPA 4KZ3A 1F9IA 1N4OA 5L8MA 3UPOA 1FSWA 1PNEA 1Y54A 2K2NA 3O86A 2PD8A 1W7FA 3BQAA 1GCEA 2XFSA 4L9FA 5AJGA 1ESUA 4PMAA 3ZHHA 5AQ9A 4IHQA 4L9EA 4IJGA 2Q0OA 3VFFA 5FQQA 1S66L 1N9NA 3LIDA 2WKHA 1K57C 5HL6A 3UO9A 2HP9A 5EVIB 4OOMA 4KZBA 5EM0A 3IBJA 4PAUA 2V1AA 1EWZA 1Y28A 2QPNA 3AGFA 3DTIA 1PW8A 2Y59A 5EOOA 2A49A 1CK3A 3VP1A 2Y4AA 4MBKA 2KX6A 2OAP1 4ME4A 2H10A 1XJ4A 3KSHA 1PWCA 2R9XA 2L1MA 1K56A 4GKUA 2QJ7A 2JKTM 4GDNA 3UMEA 4BBVA 4DKIA 1BULA 1SKOA 3HUOA 1VM1A 1TS8A 1YMSA 2ZMAA 3ZDJA 2Y2GA 3LFVA 2JC7A 4KZ5A 1S4RA 5CECA 3BFGA 4JGRA 4OP5A 5M19A 4BBTA 4EUVA 2PDRA 3TOIA 3O3VA 4PHTA 3NBLA 4KG6A 3E2LA 3C38A 3Q7VA 2Y2PA 2WGIA 3Q7ZA 1O7EA 4HHDA 4OQGA 3PYPA 3NY4A 2XD1A 4FUWA 3WS4A 1MBLA 2GX5A 3CUEC 4XT2A 1P0ZA 3A0VA 2W27A 5EFWA 2VLGA 2WGWA 5DF9A 3PXPA 5I5LA 3IBRA 4S2OA 3NULA 3OPLA 1IKGA 2ZOHA 2C6WB 4OONA 4GDBA 4D60A 3OC2A 5HFOA 4R3JA 4GS9A 3R4KA 3W4OA 4FOFA 3WS1A 1PFLA 3IX4A 3VV4A 3LIEA 4IVIA 4E3OA 3NIAA 4IBRA 3LR4A 1FIKA 5DFYA 1IOUA 5DTSA 5M1AA 4HH2A 4WEJA 1XA1A 3BYDA 3HJIA 3HLEA 1OTBA 4NETA 4EU0A 3QP8A 5HAPA 1MPLA 3MQOA 3VE3A 5DJUA 2OLVA 2VEAA 4WZ4A 4UHUA 3W2ZA 1OJGA 2ZLYA 4E3KA 5FL3A 2IWDA 1S1ZA 4Y0OA 4HIAA 4ZJ2A 2Z6CA 3LI8A 2Y8HA 4CQHA 1XJ2A 2W3FA 2XROA 5TGFA 3NJAA 3PBSA 1NYYA 2O9BA 3PBNA 4GLQA 5EOEA 2HP6A 4QWOA 1SZVA 1OPXA 3WS5A 2VGLS 4HBTA 1YPRA 2EA9A 2Y2MA 2Y2KA 5HWTA 4ETXA 4GW9A 4N9LA 3UB6A 2BLSA 4BMWA 3F1PA 1XGIA 4Y13A 1HLUP 3UN7A 5EV0A 3VFHA 3MZFA 1BSGA 4U0XA 4DE0A 4ZDXA 4UA7A 3T4LA 3ULFA 2VK3A 2ZQAA 1LSXA 2W3DA 4QB8A 3PBRA 3CJMA 2ZQDA 2QJ5A 1L0EA 3E4OA 2L4RA 4JXVA 1DP8A 4Q0JA 3TE8A 3V3RA 5FEFA 3JPUA 3VE4A 3LIBA 1VEUA 3MQ0A 3P98A 2DMWA 5JYOA 3UE1A 1EI5A 1FCMA 3F1NA 4EW7A 3BQ8A 4H8RA 3LR3A 1S6RA 3MSHA 3SH8A 4QY6A 3HLDA 2M7VA 1KDSA 3S7OA 3E0YA 1JWPA 2VGKA 3BEBA 1W8QA 4O0PA 2H5SA 5HDCA 3R7WA 3S7QA 4L9GA 2M1CA 3NI9A 1PWDA 3T4OA 3T4TA 3DWZA 4N9KA 1S67L 4S2MA 2J3TC 1MKIA 1MXOA 2Q9MA 5CHUA 3FKVA 4LPZA 4JXWA 1W5DA 4QHCA 4EEUA 3L9KA 2XRNA 5FDSA 4JBFA 2ZL1B 2XK1A 3I7JA 5FEGA 1GHPA 1A0KA 4EQIA 5FAQA 1K25A 3PR6A 4M3KA 4O7DA 1VETB 5A8BA 2VGJA 2PR6A 5FQKA 4MN6A 3MFXA 3KYQA 1ZKJA 1UWPX 5HDSA 4DXCA 3LEQA 4WUJA 4OOYA 1NRFA 1BLPA 1X0OA 3CPTA 1EW0A 1EROA 4QY5A 3JVVA 1KGGA 1ZG6A 4E3LA 1DJCA 2JBFA 4QPRA 3IXGA 3OZHA 1FCOA 2H28A 2B5RA 4BD0A 2EX2A 3T50A 5HDDA 1XFNA 3WRZA 2JKRM 2P7JA 2O0YA 2UV0E 4X69A 5CHMA 4P87A 4NXBA 5AVEA 3BRMA 3IX3A 4JKTA 2OV5A 2R9WA 1PI4A 3UNWA 5HPIA 3C30A 5CTMA 3BFCA 4Y17A 1HVBA 1K38A 3H7WB 5CGSA 3SOIA 1IFQA 3V5MA 3IX8A 2XA7M 3ZNYA 2XFTA 4KZAA 3GDIA 3BW6A 4MLLA 3EEAA 2W0NA 3VP3A 1GSWA 4OPQA 1YT4A 2EWVA 1YQSA 1PWGA 1ONGA 4HI4A 4KZ8A 3UE3A 5E43A 5IHVA 3ZG9B 5HD3A 4GOGA 3UPNA 2BASA 5JYPA 2XSSA 4HBUA 4EUZA 2ZBBA 2KOIA 1WA9A 3TRCA 5M18A 5DKLA 5AQAA 1RCJA 3D3OA 1F5MA 5GLCA 3S7PA 5KSHA 3IXDA 1S0WA 4U3TA 1G6AA 4L0LA 4O8GA 1QMFA 2GDNA 4GS9B 4R3BA 1NZOA 3HCYA 2W3HA 2ZM2A 4PM8A 1NRJA 2Y2LA 3R7WB 5CEBA 2PHYA 4JF5A 3BFDA 3M2JA 2WAFA 3RXWA 3EQVA 4CJNA 3ZCZA 2V0UA 3BECA 1P97A 2P74A 4DDSA 4I3JA 3OPRA 1K55C 1LHYA 2PBYA 4Y2FA 5DF7A 2ZL1A 3G4PA 3LO7A 4ID4A 2L0WA 4NG2A 4UEYA 5J7EA 4E3JA 2QZ6A 4PKYA 3IWQA 2WKQA 4E3NA 3KSIA 5DKKA 5D3OA 5EVLA 5E2HA 5J3WA 4HQAA 3ICYA 3SZTA 3MR0A 2VV8A 4ZJ3A 4S2IA 2D02A 2O9AA 2RL3A 4R38A 4X1MA 1G6OA 2W1TB 1IYOA 5FQJA 2MJ6A 4JXSA 2C5WB 2D01A 3UB5P 3N8LA 4UA6A 4HP9A 1TS6A 2QKPA 3VSKA 4I38A 2E8JA 5DTKA 4WYYA 4DXBA 4WN5A 3NOUC 3GQZA 3LR0A 5F83A 1W79A 2O9CA 3SH7A 4LV1A 2FFYA 1DP6A 1OTEA 1K6SA 2P08A 2VKSA 1K54C 4GHIB 1G68A 2YKHA 1YAXA 4R4SA 2HDRA 4FH4A 4CLCC 1WE4A 2ZQCA 4FCFA 2JCHA 2OAQ1 1ACFA 3P09A 2HDUA 4HOIA 4EQ1A 5KSCA 1D7EA 5CGXA 2V1ZA 2WUQA 5IT5A 2ZC4B 2WKPA 3MZDA 1ESIA 4YWZA 1BLHA 3T4KA 2NUPC 4K0XA 3GECA 3VP0A 4X53A 4ZAMA 2M7UA 2IWCA 1L2SA 2K7SA 5CTNA 3IT9A 4FSFA 4KZ9A 3ZG8B 4WL9A 5GLBA 1WYBA 2PAVP 3HLWA 5EVIA 3SS3A 4P6ZS 2PD7A 3BFEA 1OT9A 2CMNA 5GHXA 2B95A 3E98A 3FWLA 4LV2A 1DJBA 3BM6A 2E8IA 3UDIA 3OPPA 3LIAA 4AFIA 3QNBA 3H9WA 4C3QA 2WYXA 3GRJA 3MFDA 4H6JA 2AVXA 5F5YA 2X71A 4XUZA 2V20A 3KYEA 2BG1A 3A0RA 3P7NA 3LEZA 4E3MA 1ES3A 3BJNA 3WS0A 4EBPA 2G7UA 2EFUA 3IWOA 5I94A 1SKOB 1OTIA 5CGWA 4G3WA 2EX8A 3N4IA 3F1OA 2B18A 3S1YA 3MXRA 2XR0A 3HLFA 3TSGA 5HPFA 3PTEA 4CLCE 4WLAA 1M6KA 4JGPA 4EBLA 4OH0A 1LSVA 2PYPA 2J3WA 2XA7S 4YFMA 1T1BA 2ZM8A 2J9PA 1BLSA 4WMCD 1ERQA 3ZG5A 4XT2B 1TD5A 1U60A 3SS4A 3PBTA 1T19A 3ZYTA 4KZ4A 3LY4A 1PZOA 3CHWP 4CLCA 3D9YA 3C4PA 3UDFA 2KLIA 2I72A 4G3VA 5EVIC 3IXHA 5DVAA 2XGNA 3NDGA 5FDHA 4U0TA 1IYPA 4QU3A 3H7WA 1PW1A 4KZ7A 2H0YA 4LRXC 5F82A 3NHQA 1CEFA 4LRYC 4UA9A 2X02A 3HLCA 5EVID 1MWSA 1NYMA 3HUMA 2Y2IA 4ETZA 2W3EA 1I5QA 3CZDA 3IH8A 5HD5A 5L09A 3LR5A 4BWIA 4NXFA 3WS2A 2R78A 3Q82A 1KE3A 3ITAA 4S2KA 4KQDA 1L0GA 4Z9QA 5HZHA 4E3IA 1CJFA 2EXAA 2VV7A 4PPRA 2P04A 3MKFA 3HVFA 5F1FA 3T1RA 4OQ0A 1STZA 4PM7A 5EVEA 4GD8A 2ZOIA 4CLCD 4EESA 4ARZB 2O99A 1AXBA 3HJKA 4WZ5A 4RA7A 2HF6A 2PR5A 5HX9A 4FD8A 4DN0A 4CPKA 1H0MA 1W63M 4BJPA 3VMAA 3IHBA 2WKRA 4B4ZA 4S2NC 5K5BA 2LB9A 1SCWA 2HZ5A 4X68A 1TF1A 5A90A 1GHIA 4R70A 3ZG0A 3C7UA 1K56D 3L7HA 2K31A 3MJQA 3EOIA 3UB7A 2DCFA 2JN7A 1TS0A 2HP5A 4R1GA 4JXGA 2JE5A 4FH2A 4IUKA 1LI0A 4WELA 2RCXA 3DTEA 4B4XA 2PU2A 5HWVA 3G2ZA 1NY0A 5E2GA 4Y3IA 1TEMA 2PYRA 1J9MA 3ZG7B 3N8SA 4KQQA 3IH9A 3VOLA 1IKIA 1S4SA 3CITA 1K4FA 5FATA 1BLCA 4I3AA 2ZM0A 2ZQ9A 1K4EA 3G31A 2J9OA 1JWZA 2HPBA 4S2NA 2EX6A 1YMXA 4OLGA 2EX9A 1ODVA 4F3LA 4GHIA 4CLCB 3FPVA 1I2SA 1YM1A 3FPWA 1ZTUA 2XQZA 5HSQA 4RYEA 2ZMVA 1NWZA 4I39A 3G35A 4P6BA 4B93A 4HJ4A 3SS5A 5J8XA 4BL2A 4N92A 3RFBA 4WF0A 2Y55A 1GHMA 1GSXA 4S2LA 3LICA 1JWVA 3B33A 2JHEA 3IS2B 2V8FA 3A3FA 3NECA 2Y2JA 1L0FA 2ZQ8A 4OPRA 1KGEA 4MBFA 2Y2QA 2XH9A 2KDKA 4UQIS 3HREA 3KSGA 1XX2A 4X25A 2Y2NA 3Q1FA 2OSUA 4DE2A 1HD8A 2ACGA 2WKEA 3RTYA 1PYYA 1KE4A 1FR6A 4QJGA 3MMHA 2A24A 4G3KA 1HZOA 4DE3A 4DRTA 2QYBA 4BL3A 5J4EA 5FI7A 4EWFA 3UPPA 3S22A 5MC7A 3BWLA 4H6JB 4C75A 3CMZA 5AQBA 3BY8A 4X1LA 1DJAA 1XKZA 3IF6A 1BUEA 2FH5A 1MWRA 1XXMA 4OKPA 2ZJ9A 3NOPC 1Q2PA 3MBZA 4QD4A 3FV7A 2ZMFA 1LI9A 5FASA 1L0DA 2QMIA 1TS7A 4PM9A 4R4RA 2WK0A 1OTDA 3GSGA 1LSWA 1ALQA 3B3XA 3Q07A 3WRTA 4OLDA 1TDLA 1T18A 3OBFA 3B47A 1MC0A 2Y91A 5F69A 4PKYG 5EM1A 4KQOA 5GLAA 3BLMA 3C7VA 3Q81A 4MNRA 1BTLA 2PBDP 3OOVA 4R3AA 3IHAA 5IS1A 4ZRRA 2INWA 1NLZA 4B88A 3FZCA 4BLMA 2NUTC 2ZC3B 5HW3A 2V9AA 3B42A 4HESA 1ES2A 3UB9A 1P9RA 1XFQA 4IEDA 3G6OA 3N8RA 1OT6A 2ZC5B 3RH8B 2WZZA 2Y2HA 2IWBA 3GMWA 4LGWA 3QHYA 5F1GA 5CEDA 1Y4OA 4MN7A 1JVJA 2DRWA 4HJ6A 3EQUA 3IXBA 1IEMA 5TFQA 2WAEA 1N9BA 1ES5A 4DDYA 4ZBEA 4LLOB 3A3EA
chains in the Genus database with same CATH topology
3GVBA 2P9VB 3S1YA 4K0WA 4JXVA 4DE1A 3MXRA 2XR0A 3HLFA 4YINA 3TSGA 2FFFB 3V3RA 5GLDA 3PTEA 3MXSA 5FSRA 1QMEA 3P98A 1SDEA 1M6KA 4F94A 5JYOA 5A93A 3UE1A 4Y0UA 4A5RA 1IELA 2Q9NA 5FQ9A 4EBLA 4OH0A 4GB7A 1EI5A 5E2EA 4MEZA 4YFMA 3UY6A 2ZM8A 3UDXA 3S4XA 1FCMA 2J9PA 3OCLA 1BLSA 3CG5A 4WMCD 4H8RA 1ERQA 1ONHA 2V2FF 3M6BA 4JPMA 3ZG5A 1WYCA 4OQHA 5KMWA 4P85A 1S6RA 1CI8A 3SH8A 2WZXA 1MWUA 1U60A 4QY6A 3SS4A 2XEPA 3PBTA 5HL1A 4OPYA 4KZ4A 3LY4A 3HLDA 4JF4A 4RVAA 1PZOA 3DW0A 2Z2MB 1KDSA 1JTGA 3N7WA 1JWPA 2VGKA 3BEBA 1FR1A 5L2FA 3C4PA 5FI6A 3UDFA 4WM9A 1W8QA 2H5SA 2I72A 5EVIC 3ZVWA 3IXHA 5DVAA 1PI5A 2XGNA 3OPHA 3NI9A 3NDGA 3PAEA 4P0MA 1PWDA 5FDHA 4RX2A 3DWZA 2H0TA 4N9KA 4S2MA 4U0TA 1IYPA 3PBOA 4LV3A 4Q8IA 1MKIA 1MXOA 4QU3A 2Q9MA 1RGYA 3N6IA 1W8YA 5HAIA 1PW1A 5CHUA 3FKVA 4KZ7A 4WBGA 3GTCA 2H0YA 5FAOA 4IBXA 5F82A 4JXWA 1KDWA 2EXBA 3G2YA 1W5DA 1CEFA 3A3DA 4QHCA 3PBQA 3QNCA 5DF8A 4UA9A 5CERA 3NCKA 2X02A 1TDGA 4XXRA 3TG9A 3HLCA 1GA9A 1XGJA 1MWSA 1NYMA 2ZQ7A 3LCEA 5EVID 4JBFA 3NC8A 1CEGA 4OPZA 5U47A 3HUMA 2Y2IA 1YLWA 1NJ4A 1NXYA 4NK3A 1Z6FA 1I5QA 1FQGA 3CZDA 3DTMA 3IH8A 2XK1A 4EBNA 1SKFA 3I7JA 4D2OA 1GHPA 4RX3A 4EQIA 3DWKA 4LCMA 5FAQA 1K25A 3UE0A 3WS2A 3FYZA 3VOYA 3SH9A 5KZHA 4M3KA 4O7DA 4KQRA 1DY6A 3M2KA 3Q82A 1FCNA 1KE3A 1ZC2A 2VGJA 1H8YA 3ITAA 5FQKA 5FAPA 4S2KA 1ZKJA 4DXCA 1L0GA 4S2PA 2EFXA 4OOYA 2P9VA 1NRFA 1BLPA 1M40A 4Z9QA 3ZGAB 5BOHA 5FI2A 4E3IA 4GZBA 2J8YA 2EXAA 5CHJA 1GA0A 1EROA 3MKEA 4QY5A 4IVKA 4PPRA 3ZFZA 3MKFA 1KGGA 1FSYA 1ZG6A 3HVFA 1FOFA 4E3LA 1DJCA 2JBFA 4ZJ1A 5DTTA 1ZG4A 5F1FA 3VOZA 4GD6A 4OQ0A 4OVDA 3IXGA 3OZHA 1FCOA 4WEKA 4Y7PA 4PM7A 2B5RA 1K55A 1H5XA 3IQAA 4K91A 4GD8A 5GHZA 2EX2A 3V39A 4BD0A 4EV4A 5EPHA 3HUNA 4LCLA 3WRZA 5CRFA 4X69A 5CHMA 1KVMA 1AXBA 3RJUA 2G2UA 3JYIA 4WZ5A 4RA7A 3IF6C 4P87A 1BT5A 1LLBA 3BFFA 3BRMA 5A92A 4JKTA 1I2WA 2OV5A 2R9WA 5HX9A 4FD8A 1PI4A 3UNWA 4CPKA 1XPBA 2WGVA 4BJPA 1K57A 1MY8A 5CTMA 1ERMA 1KE0A 1YLTA 4S2JA 3VMAA 3IHBA 4N1HA 5TR7A 3BFCA 1PZPA 4X55A 4B4ZA 4S2NC 5CXWA 1HVBA 1K38A 4GNUA 1SCWA 4X68A 2XD5A 5CGSA 5A90A 1GHIA 3SOIA 3ZG0A 3V5MA 3C7UA 4WMCA 1K56D 4XUXA 3V50A 3ZNYA 1YLPA 2XFTA 4KZAA 1SHVA 4KZ3A 4MLLA 2DCFA 3VP3A 1N4OA 2HP5A 4JXGA 4R1GA 4KENB 4BQMA 2A3UA 4OPQA 1YT4A 2JE5A 1YQSA 3UPOA 1PWGA 1ONGA 2ZC6B 3IF5A 4FH2A 1FSWA 1Y54A 1LI0A 1IYQA 4KZ8A 2RCXA 3O86A 1E3UD 4WELA 5EUAA 2PU2A 5E43A 3UE3A 1W7FA 4B4XA 1JTDA 3G2ZA 1NY0A 1XA7A 5E2GA 5IHVA 1GCEA 3ZG9B 2XFSA 4GOGA 2Z2LB 1TEMA 4DF6A 3UPNA 1ESUA 4PMAA 3ZHHA 5JYPA 1J9MA 4R23A 5AQ9A 3ZG7B 3VFFA 3RXXA 1KGFA 4HBUA 5FQQA 3GV9A 4EUZA 3N8SA 4LV0A 4KQQA 3IH9A 1IKIA 2WKHA 5M18A 5AQAA 1K57C 3FKWA 1RCJA 3UO9A 1K4FA 2HP9A 2XF3A 5EVIB 2XDMA 4OOMA 5FATA 1BLCA 4KZBA 5GLCA 2ZM0A 2ZQ9A 1K4EA 3G31A 2J9OA 5KSHA 1JWZA 2HPBA 3IXDA 4S2NA 1S0WA 2EX6A 4OOLA 4U3TA 1G6AA 4L0LA 1YMXA 1EWZA 1E25A 2QPNA 3AGFA 2EX9A 4OLGA 5EE8A 1QMFA 1H8ZA 1PW8A 2GDNA 2Y59A 3IF6B 3ITBA 1Q2QA 5A91A 4R3BA 5EOOA 1NZOA 4KZ6A 2A49A 4PM5A 2ZM2A 3G30A 1CK3A 3VP1A 2Y4AA 4MBKA 4PM8A 2Y2LA 1PIOA 2HDSA 5HAQA 2H10A 1I2SA 1SDNA 5CEBA 1YLZA 1YM1A 4JF5A 1RGZA 4LENA 3BFDA 3M2JA 2WAFA 2XQZA 3WWXA 3RXWA 1E3UA 1PWCA 2R9XA 3EQVA 4RYEA 3G35A 4P6BA 4CJNA 3ZCZA 5GL9A 3BECA 3SS5A 5J8XA 4BL2A 4BENA 1K56A 4N92A 4GKUA 2G2WA 3HLGA 2Y55A 1GHMA 4S2LA 4GDNA 2P74A 4DDSA 4DKIA 1BULA 1JWVA 3OPRA 1K55C 1LHYA 2PBYA 5DF7A 5EECA 3HUOA 3VSLA 1VM1A 2ZC7A 3Q7VB 3A3FA 2Y2JA 3G4PA 3VP4A 1YMSA 1CI9A 1L0FA 3LO7A 4ID4A 4KG2A 2ZMAA 3ZDJA 4E3JA 2Y2GA 2QZ6A 3IWQA 2ZQ8A 4OPRA 4E3NA 3HL9A 2JC7A 4KZ5A 1KGEA 4C6YA 5CECA 4MBFA 3A3IA 2Y2QA 3BFGA 5D3OA 5EVLA 2XH9A 4OP5A 2PU4A 5E2HA 5M19A 3MZEA 4OP8A 4GN2A 3TOIA 3O3VA 3NBLA 4KG6A 4R0QA 4ZJ3A 3E2LA 1HTZA 1XX2A 3HREA 2Y2NA 3IWIA 4S2IA 3Q7VA 2Y2PA 2WGIA 3Q1FA 2RL3A 2OSUA 3Q7ZA 4DE2A 1O7EA 4JF6A 1HD8A 1IYOA 4OQGA 2WKEA 5FQJA 1PYYA 3NY4A 1KE4A 2J7VA 1FR6A 4X6TA 2XD1A 4JXSA 1YLYA 4QJGA 2C5WB 3WS4A 1MBLA 3N8LA 4UA6A 1HZOA 4ZTKA 4DE3A 3VSKA 4DRTA 4BL3A 1TVFA 5DTKA 1C3BA 5FI7A 4EWFA 3AGDA 2WGWA 3UPPA 3S22A 5DF9A 4WYYA 4N1XA 2X01A 4DXBA 3GQZA 4S2OA 5F83A 3A3JA 3CMZA 3HLBA 4C75A 3OPLA 1IKGA 5AQBA 1W79A 1XP4A 3SH7A 2Y2OA 4LV1A 2C6WB 2FFYA 4OONA 3V3SA 4GDBA 1DJAA 1XKZA 2UWXA 3OC2A 1K6SA 2WADA 3NDEA 4R3JA 5HFOA 3IF6A 1BUEA 1K54C 3W4OA 1G68A 1MWRA 3WS1A 1XXMA 4KG5A 3O87A 4OKPA 4IVIA 4R4SA 2ZJ9A 2HDRA 3NIAA 4IBRA 4OQIA 4E3OA 4FH4A 1Q2PA 3MBZA 4QD4A 1WE4A 2ZQCA 4FCFA 1MWTA 2JCHA 3FV7A 5DTSA 3P09A 1RP5A 2HDUA 1LI9A 5KSCA 5M1AA 5CGXA 1K54A 2V1ZA 2WUQA 5FASA 2CC1A 1L0DA 2QMIA 2ZC4B 4PM9A 3M6HA 4WEJA 4R4RA 2WK0A 1XA1A 3BYDA 3HLEA 4NETA 3GSGA 1BZAA 3MZDA 1ALQA 1ESIA 3B3XA 3Q07A 4HEFA 4BD1A 1BLHA 3WRTA 4OLDA 4UAAA 5E2FA 5HAPA 1TDLA 1MPLA 4K0XA 3VP0A 2OLVA 4WZ4A 4UHUA 3HBRA 4X53A 4ZAMA 2IWCA 3BLSA 1L2SA 3W4QA 3G34A 3LY3A 2DNSA 1O07A 3IT9A 5CTNA 2ZLYA 5FA7A 4FSFA 4KZ9A 3ZG8B 2Y91A 4E3KA 1IYSA 4KQOA 3E2KA 5GLBA 5GLAA 1WYBA 1KVLA 4PM6A 3BLMA 3C7VA 3Q81A 3HLWA 4MNRA 2OLUA 5EVIA 3SS3A 1BTLA 3BFEA 2IWDA 5GHXA 3IHAA 4Y0OA 3OCNA 2ZD8A 4ZJ2A 3FWLA 4LV2A 5FQMA 3O88A 4B88A 1E4DA 1DJBA 2HDQA 2WKIA 3BM6A 3FZCA 4BLMA 2E8IA 2ZC3B 5HW3A 1VQQA 5TGFA 3PBSA 3OPPA 1NYYA 3PAGA 3UDIA 3PBNA 3VP2A 5EOEA 2HP6A 3D4FA 4HESA 1ES2A 3QNBA 3WS5A 2WGWB 3W8KA 1NZUA 3GR2A 4C3QA 2WYXA 3GRJA 3MFDA 4HBTA 4X56A 4IEDA 3N8RA 1LL5A 2X71A 2Y2MA 3AGEA 4XUZA 2V20A 2Y2KA 2ZC5B 2BG1A 2WZZA 2Y2HA 1ES4A 3LEZA 3W4PA 3G32A 4N9LA 1OMEA 2BLSA 4MBHA 4E3MA 1YLJA 2IWBA 1ES3A 3GMWA 5GHYA 1LL9A 1XGIA 3QHYA 3UN7A 5F1GA 3WS0A 5CEDA 4EBPA 3VFHA 3MZFA 3ZNTA 1BSGA 1JVJA 1K6RA 2DRWA 4U0XA 4DE0A 3EQUA 3IXBA 1IEMA 5G18A 2EFUA 4E6XA 3IWOA 5HARA 5TFQA 3C5AA 2XLNA 2WAEA 4UA7A 5AQ7A 4ZDXA 5I94A 2ZQAA 1N9BA 1ES5A 3ISGA 4WZ5C 4DDYA 4E6WA 4QB8A 3PBRA 3CJMA 5CGWA 4ZBEA 3ZVTA 5FQIA 2EX8A 4Y0TA 3N4IA 2ZQDA 3C4OA 4JLFA 3A3EA 1L0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVB A;  2P9V B;  3S1Y A;  4K0W A;  4JXV A;  4DE1 A;  3MXR A;  2XR0 A;  3HLF A;  4YIN A;  3TSG A;  2FFF B;  3V3R A;  5GLD A;  3PTE A;  3MXS A;  5FSR A;  1QME A;  3P98 A;  1SDE A;  1M6K A;  4F94 A;  5JYO A;  5A93 A;  3UE1 A;  4Y0U A;  4A5R A;  1IEL A;  2Q9N A;  5FQ9 A;  4EBL A;  4OH0 A;  4GB7 A;  1EI5 A;  5E2E A;  4MEZ A;  4YFM A;  3UY6 A;  2ZM8 A;  3UDX A;  3S4X A;  1FCM A;  2J9P A;  3OCL A;  1BLS A;  3CG5 A;  4WMC D;  4H8R A;  1ERQ A;  1ONH A;  2V2F F;  3M6B A;  4JPM A;  3ZG5 A;  1WYC A;  4OQH A;  5KMW A;  4P85 A;  1S6R A;  1CI8 A;  3SH8 A;  2WZX A;  1MWU A;  1U60 A;  4QY6 A;  3SS4 A;  2XEP A;  3PBT A;  5HL1 A;  4OPY A;  4KZ4 A;  3LY4 A;  3HLD A;  4JF4 A;  4RVA A;  1PZO A;  3DW0 A;  2Z2M B;  1KDS A;  1JTG A;  3N7W A;  1JWP A;  2VGK A;  3BEB A;  1FR1 A;  5L2F A;  3C4P A;  5FI6 A;  3UDF A;  4WM9 A;  1W8Q A;  2H5S A;  2I72 A;  5EVI C;  3ZVW A;  3IXH A;  5DVA A;  1PI5 A;  2XGN A;  3OPH A;  3NI9 A;  3NDG A;  3PAE A;  4P0M A;  1PWD A;  5FDH A;  4RX2 A;  3DWZ A;  2H0T A;  4N9K A;  4S2M A;  4U0T A;  1IYP A;  3PBO A;  4LV3 A;  4Q8I A;  1MKI A;  1MXO A;  4QU3 A;  2Q9M A;  1RGY A;  3N6I A;  1W8Y A;  5HAI A;  1PW1 A;  5CHU A;  3FKV A;  4KZ7 A;  4WBG A;  3GTC A;  2H0Y A;  5FAO A;  4IBX A;  5F82 A;  4JXW A;  1KDW A;  2EXB A;  3G2Y A;  1W5D A;  1CEF A;  3A3D A;  4QHC A;  3PBQ A;  3QNC A;  5DF8 A;  4UA9 A;  5CER A;  3NCK A;  2X02 A;  1TDG A;  4XXR A;  3TG9 A;  3HLC A;  1GA9 A;  1XGJ A;  1MWS A;  1NYM A;  2ZQ7 A;  3LCE A;  5EVI D;  4JBF A;  3NC8 A;  1CEG A;  4OPZ A;  5U47 A;  3HUM A;  2Y2I A;  1YLW A;  1NJ4 A;  1NXY A;  4NK3 A;  1Z6F A;  1I5Q A;  1FQG A;  3CZD A;  3DTM A;  3IH8 A;  2XK1 A;  4EBN A;  1SKF A;  3I7J A;  4D2O A;  1GHP A;  4RX3 A;  4EQI A;  3DWK A;  4LCM A;  5FAQ A;  1K25 A;  3UE0 A;  3WS2 A;  3FYZ A;  3VOY A;  3SH9 A;  5KZH A;  4M3K A;  4O7D A;  4KQR A;  1DY6 A;  3M2K A;  3Q82 A;  1FCN A;  1KE3 A;  1ZC2 A;  2VGJ A;  1H8Y A;  3ITA A;  5FQK A;  5FAP A;  4S2K A;  1ZKJ A;  4DXC A;  1L0G A;  4S2P A;  2EFX A;  4OOY A;  2P9V A;  1NRF A;  1BLP A;  1M40 A;  4Z9Q A;  3ZGA B;  5BOH A;  5FI2 A;  4E3I A;  4GZB A;  2J8Y A;  2EXA A;  5CHJ A;  1GA0 A;  1ERO A;  3MKE A;  4QY5 A;  4IVK A;  4PPR A;  3ZFZ A;  3MKF A;  1KGG A;  1FSY A;  1ZG6 A;  3HVF A;  1FOF A;  4E3L A;  1DJC A;  2JBF A;  4ZJ1 A;  5DTT A;  1ZG4 A;  5F1F A;  3VOZ A;  4GD6 A;  4OQ0 A;  4OVD A;  3IXG A;  3OZH A;  1FCO A;  4WEK A;  4Y7P A;  4PM7 A;  2B5R A;  1K55 A;  1H5X A;  3IQA A;  4K91 A;  4GD8 A;  5GHZ A;  2EX2 A;  3V39 A;  4BD0 A;  4EV4 A;  5EPH A;  3HUN A;  4LCL A;  3WRZ A;  5CRF A;  4X69 A;  5CHM A;  1KVM A;  1AXB A;  3RJU A;  2G2U A;  3JYI A;  4WZ5 A;  4RA7 A;  3IF6 C;  4P87 A;  1BT5 A;  1LLB A;  3BFF A;  3BRM A;  5A92 A;  4JKT A;  1I2W A;  2OV5 A;  2R9W A;  5HX9 A;  4FD8 A;  1PI4 A;  3UNW A;  4CPK A;  1XPB A;  2WGV A;  4BJP A;  1K57 A;  1MY8 A;  5CTM A;  1ERM A;  1KE0 A;  1YLT A;  4S2J A;  3VMA A;  3IHB A;  4N1H A;  5TR7 A;  3BFC A;  1PZP A;  4X55 A;  4B4Z A;  4S2N C;  5CXW A;  1HVB A;  1K38 A;  4GNU A;  1SCW A;  4X68 A;  2XD5 A;  5CGS A;  5A90 A;  1GHI A;  3SOI A;  3ZG0 A;  3V5M A;  3C7U A;  4WMC A;  1K56 D;  4XUX A;  3V50 A;  3ZNY A;  1YLP A;  2XFT A;  4KZA A;  1SHV A;  4KZ3 A;  4MLL A;  2DCF A;  3VP3 A;  1N4O A;  2HP5 A;  4JXG A;  4R1G A;  4KEN B;  4BQM A;  2A3U A;  4OPQ A;  1YT4 A;  2JE5 A;  1YQS A;  3UPO A;  1PWG A;  1ONG A;  2ZC6 B;  3IF5 A;  4FH2 A;  1FSW A;  1Y54 A;  1LI0 A;  1IYQ A;  4KZ8 A;  2RCX A;  3O86 A;  1E3U D;  4WEL A;  5EUA A;  2PU2 A;  5E43 A;  3UE3 A;  1W7F A;  4B4X A;  1JTD A;  3G2Z A;  1NY0 A;  1XA7 A;  5E2G A;  5IHV A;  1GCE A;  3ZG9 B;  2XFS A;  4GOG A;  2Z2L B;  1TEM A;  4DF6 A;  3UPN A;  1ESU A;  4PMA A;  3ZHH A;  5JYP A;  1J9M A;  4R23 A;  5AQ9 A;  3ZG7 B;  3VFF A;  3RXX A;  1KGF A;  4HBU A;  5FQQ A;  3GV9 A;  4EUZ A;  3N8S A;  4LV0 A;  4KQQ A;  3IH9 A;  1IKI A;  2WKH A;  5M18 A;  5AQA A;  1K57 C;  3FKW A;  1RCJ A;  3UO9 A;  1K4F A;  2HP9 A;  2XF3 A;  5EVI B;  2XDM A;  4OOM A;  5FAT A;  1BLC A;  4KZB A;  5GLC A;  2ZM0 A;  2ZQ9 A;  1K4E A;  3G31 A;  2J9O A;  5KSH A;  1JWZ A;  2HPB A;  3IXD A;  4S2N A;  1S0W A;  2EX6 A;  4OOL A;  4U3T A;  1G6A A;  4L0L A;  1YMX A;  1EWZ A;  1E25 A;  2QPN A;  3AGF A;  2EX9 A;  4OLG A;  5EE8 A;  1QMF A;  1H8Z A;  1PW8 A;  2GDN A;  2Y59 A;  3IF6 B;  3ITB A;  1Q2Q A;  5A91 A;  4R3B A;  5EOO A;  1NZO A;  4KZ6 A;  2A49 A;  4PM5 A;  2ZM2 A;  3G30 A;  1CK3 A;  3VP1 A;  2Y4A A;  4MBK A;  4PM8 A;  2Y2L A;  1PIO A;  2HDS A;  5HAQ A;  2H10 A;  1I2S A;  1SDN A;  5CEB A;  1YLZ A;  1YM1 A;  4JF5 A;  1RGZ A;  4LEN A;  3BFD A;  3M2J A;  2WAF A;  2XQZ A;  3WWX A;  3RXW A;  1E3U A;  1PWC A;  2R9X A;  3EQV A;  4RYE A;  3G35 A;  4P6B A;  4CJN A;  3ZCZ A;  5GL9 A;  3BEC A;  3SS5 A;  5J8X A;  4BL2 A;  4BEN A;  1K56 A;  4N92 A;  4GKU A;  2G2W A;  3HLG A;  2Y55 A;  1GHM A;  4S2L A;  4GDN A;  2P74 A;  4DDS A;  4DKI A;  1BUL A;  1JWV A;  3OPR A;  1K55 C;  1LHY A;  2PBY A;  5DF7 A;  5EEC A;  3HUO A;  3VSL A;  1VM1 A;  2ZC7 A;  3Q7V B;  3A3F A;  2Y2J A;  3G4P A;  3VP4 A;  1YMS A;  1CI9 A;  1L0F A;  3LO7 A;  4ID4 A;  4KG2 A;  2ZMA A;  3ZDJ A;  4E3J A;  2Y2G A;  2QZ6 A;  3IWQ A;  2ZQ8 A;  4OPR A;  4E3N A;  3HL9 A;  2JC7 A;  4KZ5 A;  1KGE A;  4C6Y A;  5CEC A;  4MBF A;  3A3I A;  2Y2Q A;  3BFG A;  5D3O A;  5EVL A;  2XH9 A;  4OP5 A;  2PU4 A;  5E2H A;  5M19 A;  3MZE A;  4OP8 A;  4GN2 A;  3TOI A;  3O3V A;  3NBL A;  4KG6 A;  4R0Q A;  4ZJ3 A;  3E2L A;  1HTZ A;  1XX2 A;  3HRE A;  2Y2N A;  3IWI A;  4S2I A;  3Q7V A;  2Y2P A;  2WGI A;  3Q1F A;  2RL3 A;  2OSU A;  3Q7Z A;  4DE2 A;  1O7E A;  4JF6 A;  1HD8 A;  1IYO A;  4OQG A;  2WKE A;  5FQJ A;  1PYY A;  3NY4 A;  1KE4 A;  2J7V A;  1FR6 A;  4X6T A;  2XD1 A;  4JXS A;  1YLY A;  4QJG A;  2C5W B;  3WS4 A;  1MBL A;  3N8L A;  4UA6 A;  1HZO A;  4ZTK A;  4DE3 A;  3VSK A;  4DRT A;  4BL3 A;  1TVF A;  5DTK A;  1C3B A;  5FI7 A;  4EWF A;  3AGD A;  2WGW A;  3UPP A;  3S22 A;  5DF9 A;  4WYY A;  4N1X A;  2X01 A;  4DXB A;  3GQZ A;  4S2O A;  5F83 A;  3A3J A;  3CMZ A;  3HLB A;  4C75 A;  3OPL A;  1IKG A;  5AQB A;  1W79 A;  1XP4 A;  3SH7 A;  2Y2O A;  4LV1 A;  2C6W B;  2FFY A;  4OON A;  3V3S A;  4GDB A;  1DJA A;  1XKZ A;  2UWX A;  3OC2 A;  1K6S A;  2WAD A;  3NDE A;  4R3J A;  5HFO A;  3IF6 A;  1BUE A;  1K54 C;  3W4O A;  1G68 A;  1MWR A;  3WS1 A;  1XXM A;  4KG5 A;  3O87 A;  4OKP A;  4IVI A;  4R4S A;  2ZJ9 A;  2HDR A;  3NIA A;  4IBR A;  4OQI A;  4E3O A;  4FH4 A;  1Q2P A;  3MBZ A;  4QD4 A;  1WE4 A;  2ZQC A;  4FCF A;  1MWT A;  2JCH A;  3FV7 A;  5DTS A;  3P09 A;  1RP5 A;  2HDU A;  1LI9 A;  5KSC A;  5M1A A;  5CGX A;  1K54 A;  2V1Z A;  2WUQ A;  5FAS A;  2CC1 A;  1L0D A;  2QMI A;  2ZC4 B;  4PM9 A;  3M6H A;  4WEJ A;  4R4R A;  2WK0 A;  1XA1 A;  3BYD A;  3HLE A;  4NET A;  3GSG A;  1BZA A;  3MZD A;  1ALQ A;  1ESI A;  3B3X A;  3Q07 A;  4HEF A;  4BD1 A;  1BLH A;  3WRT A;  4OLD A;  4UAA A;  5E2F A;  5HAP A;  1TDL A;  1MPL A;  4K0X A;  3VP0 A;  2OLV A;  4WZ4 A;  4UHU A;  3HBR A;  4X53 A;  4ZAM A;  2IWC A;  3BLS A;  1L2S A;  3W4Q A;  3G34 A;  3LY3 A;  2DNS A;  1O07 A;  3IT9 A;  5CTN A;  2ZLY A;  5FA7 A;  4FSF A;  4KZ9 A;  3ZG8 B;  2Y91 A;  4E3K A;  1IYS A;  4KQO A;  3E2K A;  5GLB A;  5GLA A;  1WYB A;  1KVL A;  4PM6 A;  3BLM A;  3C7V A;  3Q81 A;  3HLW A;  4MNR A;  2OLU A;  5EVI A;  3SS3 A;  1BTL A;  3BFE A;  2IWD A;  5GHX A;  3IHA A;  4Y0O A;  3OCN A;  2ZD8 A;  4ZJ2 A;  3FWL A;  4LV2 A;  5FQM A;  3O88 A;  4B88 A;  1E4D A;  1DJB A;  2HDQ A;  2WKI A;  3BM6 A;  3FZC A;  4BLM A;  2E8I A;  2ZC3 B;  5HW3 A;  1VQQ A;  5TGF A;  3PBS A;  3OPP A;  1NYY A;  3PAG A;  3UDI A;  3PBN A;  3VP2 A;  5EOE A;  2HP6 A;  3D4F A;  4HES A;  1ES2 A;  3QNB A;  3WS5 A;  2WGW B;  3W8K A;  1NZU A;  3GR2 A;  4C3Q A;  2WYX A;  3GRJ A;  3MFD A;  4HBT A;  4X56 A;  4IED A;  3N8R A;  1LL5 A;  2X71 A;  2Y2M A;  3AGE A;  4XUZ A;  2V20 A;  2Y2K A;  2ZC5 B;  2BG1 A;  2WZZ A;  2Y2H A;  1ES4 A;  3LEZ A;  3W4P A;  3G32 A;  4N9L A;  1OME A;  2BLS A;  4MBH A;  4E3M A;  1YLJ A;  2IWB A;  1ES3 A;  3GMW A;  5GHY A;  1LL9 A;  1XGI A;  3QHY A;  3UN7 A;  5F1G A;  3WS0 A;  5CED A;  4EBP A;  3VFH A;  3MZF A;  3ZNT A;  1BSG A;  1JVJ A;  1K6R A;  2DRW A;  4U0X A;  4DE0 A;  3EQU A;  3IXB A;  1IEM A;  5G18 A;  2EFU A;  4E6X A;  3IWO A;  5HAR A;  5TFQ A;  3C5A A;  2XLN A;  2WAE A;  4UA7 A;  5AQ7 A;  4ZDX A;  5I94 A;  2ZQA A;  1N9B A;  1ES5 A;  3ISG A;  4WZ5 C;  4DDY A;  4E6W A;  4QB8 A;  3PBR A;  3CJM A;  5CGW A;  4ZBE A;  3ZVT A;  5FQI A;  2EX8 A;  4Y0T A;  3N4I A;  2ZQD A;  3C4O A;  4JLF A;  3A3E A;  1L0E A; 
#chains in the Genus database with same CATH topology
 3GVB A;  2P9V B;  4K0W A;  3SW1 A;  4DE1 A;  1VET A;  4YIN A;  2FFF B;  5GLD A;  1UGU A;  1QME A;  1SDE A;  3QP4 A;  2JKR I;  5A93 A;  4A5R A;  3MQQ A;  3CPT B;  4GB7 A;  5E2E A;  4Z1W A;  3S4X A;  5TBM B;  3OCL A;  1FIL A;  4MMN A;  2VX8 A;  2V2F F;  5KMW A;  1CI8 A;  1MWU A;  5HL1 A;  4OPY A;  4ARZ A;  4RVA A;  2VGL M;  3DW0 A;  2VZW A;  3KYZ A;  1JTG A;  3N7W A;  5L2F A;  1FR1 A;  2LB5 A;  3QP6 A;  3C2W A;  3ZVW A;  3OPH A;  3PAE A;  1XJ6 A;  4P0M A;  4RX2 A;  3DAV A;  3PBO A;  4LV3 A;  4LFU A;  3V67 A;  1W8Y A;  4RQ9 A;  5HAI A;  4WBG A;  3GTC A;  4IBX A;  3F1P B;  1KDW A;  2EXB A;  3KO6 A;  3G2Y A;  3A3D A;  2JKT I;  3PBQ A;  4I5S A;  5DF8 A;  4XXR A;  1TDG A;  3TG9 A;  1GA9 A;  1XGJ A;  4OPZ A;  1CEG A;  5U47 A;  2YKF A;  1Z6F A;  1FQG A;  3DTM A;  2Y79 A;  4EBN A;  1OJ5 A;  4EEP A;  4RX3 A;  3DWK A;  4LCM A;  3UE0 A;  3FYZ A;  3SH9 A;  5KZH A;  2V8C A;  1VB6 A;  1DY6 A;  4KQR A;  1ZC2 A;  1H8Y A;  5LBR A;  5FAP A;  4S2P A;  2EFX A;  5C5K A;  2P9V A;  3ZGA B;  1M40 A;  5FI2 A;  4GZB A;  5CHJ A;  1GA0 A;  3MKE A;  4IVK A;  3ZFZ A;  1FSY A;  1FOF A;  4M4X A;  1ZG4 A;  1L3L A;  5F68 A;  4GD6 A;  3T12 B;  4OVD A;  3U2A A;  4WEK A;  4EER A;  3CI6 A;  5IU1 A;  5GHZ A;  3IQA A;  4K91 A;  2I9V A;  3LYX A;  4P6Z M;  5CX7 A;  5TBM A;  3HUN A;  4LCL A;  5CRF A;  3RJU A;  3JYI A;  3MS6 A;  1BT5 A;  4UQI M;  5A92 A;  4GJ4 A;  1I2W A;  4EET B;  4Y15 A;  2WGV A;  1JNU A;  1KOU A;  4N1H A;  4ESP A;  4YOF A;  2XD5 A;  4MN5 A;  3EGD C;  3V50 A;  1SHV A;  3QP1 A;  4BQM A;  4KEN B;  2A3U A;  3IF5 A;  2ZC6 B;  5EUA A;  1IYQ A;  1E3U D;  1T1C A;  1JTD A;  1XA7 A;  1NLY A;  3LGO A;  2Z2L B;  4DF6 A;  2QWS A;  1H3Q A;  4R23 A;  4JGQ A;  3RXX A;  1KGF A;  3GV9 A;  3QP5 A;  4LV0 A;  1K0K A;  4HH3 A;  3FKW A;  1CQA A;  4HY8 A;  5DJT A;  3T1Q B;  2XF3 A;  2XDM A;  1F2K A;  2B02 A;  2A24 B;  4EXO A;  4DMZ A;  3DBA A;  4OOL A;  3E4Q A;  1E25 A;  5EE8 A;  1LT0 A;  4DJ3 A;  1H8Z A;  3ITB A;  5A91 A;  3IF6 B;  1Q2Q A;  4KZ6 A;  4PM5 A;  3G30 A;  3OLO A;  3JVU A;  1PIO A;  2HDS A;  5HAQ A;  1SDN A;  1YLZ A;  5L10 A;  4JGO A;  1RGZ A;  4LEN A;  2PT7 A;  3PHY A;  3WWX A;  5KIZ A;  1E3U A;  5GL9 A;  4KUK A;  4BEN A;  3P01 A;  4F3L B;  2G2W A;  3HLG A;  3S7N A;  2A2L A;  2IA2 A;  4HJ3 A;  5EEC A;  1D06 A;  3VSL A;  2ZC7 A;  3Q7V B;  3MF0 A;  3NOT C;  5G4Z A;  3VP4 A;  3LI9 A;  1CI9 A;  2PRF A;  4KG2 A;  2J3T D;  2GZA A;  4B9O A;  3HL9 A;  2V0W A;  4NXE A;  1G5U A;  4C6Y A;  3A3I A;  2PU4 A;  3MZE A;  4OP8 A;  4GN2 A;  2OWH A;  2Z6D A;  4R0Q A;  1HTZ A;  3IWI A;  1UWN X;  4JF6 A;  2J7V A;  4X6T A;  1YLY A;  4II7 A;  1DRM A;  3EGX C;  1CF0 A;  4ZTK A;  4GCZ A;  1TVF A;  1C3B A;  1MZU A;  3AGD A;  4N1X A;  2X01 A;  3LUQ A;  3A3J A;  3HLB A;  1XP4 A;  2Y2O A;  4HP4 A;  3V3S A;  1ZHH B;  4MCW A;  2BTF P;  2UWX A;  2WAD A;  3NDE A;  2GJ3 A;  4KG5 A;  3O87 A;  1D1J A;  4BBU A;  2W3G A;  4OQI A;  4NKP A;  2V1B A;  1MWT A;  1V9Z A;  1RP5 A;  1K54 A;  3T4Q A;  2CC1 A;  3M6H A;  2VA0 A;  2HV1 A;  1BZA A;  5TJJ A;  4HEF A;  4BD1 A;  4UAA A;  5E2F A;  1J3W A;  1PRQ A;  3ZQ5 A;  3HBR A;  3BLS A;  3W4Q A;  4Q0H A;  3G34 A;  3LY3 A;  2DNS A;  3EWK A;  1O07 A;  5FA7 A;  3A0S A;  1IYS A;  4I3I A;  3E2K A;  1KVL A;  4PM6 A;  2OLU A;  2W1T A;  4IUH A;  3OCN A;  2ZD8 A;  4Q0I A;  5FQM A;  3O88 A;  1E4D A;  2HDQ A;  2WKI A;  3BY9 A;  4O01 A;  1VQQ A;  3H82 A;  3PAG A;  3VP2 A;  3T1S A;  3D4F A;  1Z09 A;  2WGW B;  3EEH A;  3W8K A;  1NZU A;  3CLO A;  1S1Y A;  3GR2 A;  4X56 A;  1LL5 A;  3AGE A;  4R6L A;  1ES4 A;  3W4P A;  3G32 A;  1OME A;  4MBH A;  1YLJ A;  1DP9 A;  5GHY A;  1LL9 A;  4NEE D;  4E04 A;  3ZNT A;  1K6R A;  3U4L P;  5G18 A;  4E6X A;  5HAR A;  3C5A A;  2XLN A;  5AQ7 A;  3FC7 A;  3IS2 A;  4MDZ A;  3ISG A;  4WZ5 C;  4E6W A;  3ZVT A;  1N9L A;  2OWJ A;  3KSF A;  5FQI A;  4Y0T A;  3C4O A;  1YSQ A;  4JLF A;  3UE6 A;  2VV6 A;  4LRZ E;  1AWI A;  1F98 A;  1XJ3 A;  3T1X A;  3MXS A;  5FSR A;  4F94 A;  4Y0U A;  3FG8 A;  1IEL A;  2Q9N A;  5FQ9 A;  2HJ9 C;  4MEZ A;  3UY6 A;  3F1O B;  3UDX A;  3T4S A;  2JKF A;  3CG5 A;  4DJ2 A;  1ONH A;  1YSP A;  3M6B A;  4JPM A;  1WYC A;  4OQH A;  4P85 A;  4HNB A;  3DTK A;  2WZX A;  3UMD A;  2XEP A;  2HJE A;  4JF4 A;  3O5Y A;  3CAX A;  2Z2M B;  4FTX A;  1GSV A;  5F6A A;  5FI6 A;  1V9Y A;  4WM9 A;  1P9W A;  3K2N A;  4KUO A;  1T1A A;  1PI5 A;  2H0T A;  2GNX A;  2QHK A;  5HWW A;  4YNR A;  4Q8I A;  3TW8 A;  1RGY A;  3N6I A;  5FAO A;  2VJW A;  3QNC A;  5CER A;  3NCK A;  3LCE A;  2ZQ7 A;  3NC8 A;  3CUE A;  1YLW A;  1NJ4 A;  1NXY A;  4NK3 A;  3K3D A;  2JKG A;  5DFX A;  1SKF A;  4D2O A;  4Y5F A;  3E4P A;  3VOY A;  5G4Y A;  3M2K A;  1BYW A;  4K08 A;  4NXG A;  1FCN A;  1N9O A;  3K3C A;  1VEU B;  3TJZ C;  5BOH A;  3LIF A;  1LL8 A;  1VHM A;  2J8Y A;  3T4J A;  4ZJ1 A;  3CWF A;  5DTT A;  2EWW A;  3D72 A;  5L07 A;  2FZ0 A;  2OOL A;  3VOZ A;  3C8C A;  2W1R A;  4Y7P A;  5AVF A;  1K55 A;  1H5X A;  3V39 A;  3H82 B;  2J80 A;  1MKM A;  4EV4 A;  5EPH A;  1OTA A;  3QP2 A;  1YKD A;  3F1N B;  1KVM A;  2G2U A;  3IF6 C;  3BFF A;  1LLB A;  1XPB A;  1W63 Q;  1K57 A;  1MY8 A;  1ERM A;  1KE0 A;  1YLT A;  4S2J A;  5TR7 A;  1PZP A;  3KX0 X;  1H8M A;  3MXQ A;  4X55 A;  5CXW A;  3UB8 A;  1G28 A;  4GNU A;  2HGV A;  4WMC A;  4XUX A;  1YLP A;  4KZ3 A;  1F9I A;  1N4O A;  5L8M A;  3UPO A;  1FSW A;  1PNE A;  1Y54 A;  2K2N A;  3O86 A;  2PD8 A;  1W7F A;  3BQA A;  1GCE A;  2XFS A;  4L9F A;  5AJG A;  1ESU A;  4PMA A;  3ZHH A;  5AQ9 A;  4IHQ A;  4L9E A;  4IJG A;  2Q0O A;  3VFF A;  5FQQ A;  1S66 L;  1N9N A;  3LID A;  2WKH A;  1K57 C;  5HL6 A;  3UO9 A;  2HP9 A;  5EVI B;  4OOM A;  4KZB A;  5EM0 A;  3IBJ A;  4PAU A;  2V1A A;  1EWZ A;  1Y28 A;  2QPN A;  3AGF A;  3DTI A;  1PW8 A;  2Y59 A;  5EOO A;  2A49 A;  1CK3 A;  3VP1 A;  2Y4A A;  4MBK A;  2KX6 A;  2OAP 1;  4ME4 A;  2H10 A;  1XJ4 A;  3KSH A;  1PWC A;  2R9X A;  2L1M A;  1K56 A;  4GKU A;  2QJ7 A;  2JKT M;  4GDN A;  3UME A;  4BBV A;  4DKI A;  1BUL A;  1SKO A;  3HUO A;  1VM1 A;  1TS8 A;  1YMS A;  2ZMA A;  3ZDJ A;  2Y2G A;  3LFV A;  2JC7 A;  4KZ5 A;  1S4R A;  5CEC A;  3BFG A;  4JGR A;  4OP5 A;  5M19 A;  4BBT A;  4EUV A;  2PDR A;  3TOI A;  3O3V A;  4PHT A;  3NBL A;  4KG6 A;  3E2L A;  3C38 A;  3Q7V A;  2Y2P A;  2WGI A;  3Q7Z A;  1O7E A;  4HHD A;  4OQG A;  3PYP A;  3NY4 A;  2XD1 A;  4FUW A;  3WS4 A;  1MBL A;  2GX5 A;  3CUE C;  4XT2 A;  1P0Z A;  3A0V A;  2W27 A;  5EFW A;  2VLG A;  2WGW A;  5DF9 A;  3PXP A;  5I5L A;  3IBR A;  4S2O A;  3NUL A;  3OPL A;  1IKG A;  2ZOH A;  2C6W B;  4OON A;  4GDB A;  4D60 A;  3OC2 A;  5HFO A;  4R3J A;  4GS9 A;  3R4K A;  3W4O A;  4FOF A;  3WS1 A;  1PFL A;  3IX4 A;  3VV4 A;  3LIE A;  4IVI A;  4E3O A;  3NIA A;  4IBR A;  3LR4 A;  1FIK A;  5DFY A;  1IOU A;  5DTS A;  5M1A A;  4HH2 A;  4WEJ A;  1XA1 A;  3BYD A;  3HJI A;  3HLE A;  1OTB A;  4NET A;  4EU0 A;  3QP8 A;  5HAP A;  1MPL A;  3MQO A;  3VE3 A;  5DJU A;  2OLV A;  2VEA A;  4WZ4 A;  4UHU A;  3W2Z A;  1OJG A;  2ZLY A;  4E3K A;  5FL3 A;  2IWD A;  1S1Z A;  4Y0O A;  4HIA A;  4ZJ2 A;  2Z6C A;  3LI8 A;  2Y8H A;  4CQH A;  1XJ2 A;  2W3F A;  2XRO A;  5TGF A;  3NJA A;  3PBS A;  1NYY A;  2O9B A;  3PBN A;  4GLQ A;  5EOE A;  2HP6 A;  4QWO A;  1SZV A;  1OPX A;  3WS5 A;  2VGL S;  4HBT A;  1YPR A;  2EA9 A;  2Y2M A;  2Y2K A;  5HWT A;  4ETX A;  4GW9 A;  4N9L A;  3UB6 A;  2BLS A;  4BMW A;  3F1P A;  1XGI A;  4Y13 A;  1HLU P;  3UN7 A;  5EV0 A;  3VFH A;  3MZF A;  1BSG A;  4U0X A;  4DE0 A;  4ZDX A;  4UA7 A;  3T4L A;  3ULF A;  2VK3 A;  2ZQA A;  1LSX A;  2W3D A;  4QB8 A;  3PBR A;  3CJM A;  2ZQD A;  2QJ5 A;  1L0E A;  3E4O A;  2L4R A;  4JXV A;  1DP8 A;  4Q0J A;  3TE8 A;  3V3R A;  5FEF A;  3JPU A;  3VE4 A;  3LIB A;  1VEU A;  3MQ0 A;  3P98 A;  2DMW A;  5JYO A;  3UE1 A;  1EI5 A;  1FCM A;  3F1N A;  4EW7 A;  3BQ8 A;  4H8R A;  3LR3 A;  1S6R A;  3MSH A;  3SH8 A;  4QY6 A;  3HLD A;  2M7V A;  1KDS A;  3S7O A;  3E0Y A;  1JWP A;  2VGK A;  3BEB A;  1W8Q A;  4O0P A;  2H5S A;  5HDC A;  3R7W A;  3S7Q A;  4L9G A;  2M1C A;  3NI9 A;  1PWD A;  3T4O A;  3T4T A;  3DWZ A;  4N9K A;  1S67 L;  4S2M A;  2J3T C;  1MKI A;  1MXO A;  2Q9M A;  5CHU A;  3FKV A;  4LPZ A;  4JXW A;  1W5D A;  4QHC A;  4EEU A;  3L9K A;  2XRN A;  5FDS A;  4JBF A;  2ZL1 B;  2XK1 A;  3I7J A;  5FEG A;  1GHP A;  1A0K A;  4EQI A;  5FAQ A;  1K25 A;  3PR6 A;  4M3K A;  4O7D A;  1VET B;  5A8B A;  2VGJ A;  2PR6 A;  5FQK A;  4MN6 A;  3MFX A;  3KYQ A;  1ZKJ A;  1UWP X;  5HDS A;  4DXC A;  3LEQ A;  4WUJ A;  4OOY A;  1NRF A;  1BLP A;  1X0O A;  3CPT A;  1EW0 A;  1ERO A;  4QY5 A;  3JVV A;  1KGG A;  1ZG6 A;  4E3L A;  1DJC A;  2JBF A;  4QPR A;  3IXG A;  3OZH A;  1FCO A;  2H28 A;  2B5R A;  4BD0 A;  2EX2 A;  3T50 A;  5HDD A;  1XFN A;  3WRZ A;  2JKR M;  2P7J A;  2O0Y A;  2UV0 E;  4X69 A;  5CHM A;  4P87 A;  4NXB A;  5AVE A;  3BRM A;  3IX3 A;  4JKT A;  2OV5 A;  2R9W A;  1PI4 A;  3UNW A;  5HPI A;  3C30 A;  5CTM A;  3BFC A;  4Y17 A;  1HVB A;  1K38 A;  3H7W B;  5CGS A;  3SOI A;  1IFQ A;  3V5M A;  3IX8 A;  2XA7 M;  3ZNY A;  2XFT A;  4KZA A;  3GDI A;  3BW6 A;  4MLL A;  3EEA A;  2W0N A;  3VP3 A;  1GSW A;  4OPQ A;  1YT4 A;  2EWV A;  1YQS A;  1PWG A;  1ONG A;  4HI4 A;  4KZ8 A;  3UE3 A;  5E43 A;  5IHV A;  3ZG9 B;  5HD3 A;  4GOG A;  3UPN A;  2BAS A;  5JYP A;  2XSS A;  4HBU A;  4EUZ A;  2ZBB A;  2KOI A;  1WA9 A;  3TRC A;  5M18 A;  5DKL A;  5AQA A;  1RCJ A;  3D3O A;  1F5M A;  5GLC A;  3S7P A;  5KSH A;  3IXD A;  1S0W A;  4U3T A;  1G6A A;  4L0L A;  4O8G A;  1QMF A;  2GDN A;  4GS9 B;  4R3B A;  1NZO A;  3HCY A;  2W3H A;  2ZM2 A;  4PM8 A;  1NRJ A;  2Y2L A;  3R7W B;  5CEB A;  2PHY A;  4JF5 A;  3BFD A;  3M2J A;  2WAF A;  3RXW A;  3EQV A;  4CJN A;  3ZCZ A;  2V0U A;  3BEC A;  1P97 A;  2P74 A;  4DDS A;  4I3J A;  3OPR A;  1K55 C;  1LHY A;  2PBY A;  4Y2F A;  5DF7 A;  2ZL1 A;  3G4P A;  3LO7 A;  4ID4 A;  2L0W A;  4NG2 A;  4UEY A;  5J7E A;  4E3J A;  2QZ6 A;  4PKY A;  3IWQ A;  2WKQ A;  4E3N A;  3KSI A;  5DKK A;  5D3O A;  5EVL A;  5E2H A;  5J3W A;  4HQA A;  3ICY A;  3SZT A;  3MR0 A;  2VV8 A;  4ZJ3 A;  4S2I A;  2D02 A;  2O9A A;  2RL3 A;  4R38 A;  4X1M A;  1G6O A;  2W1T B;  1IYO A;  5FQJ A;  2MJ6 A;  4JXS A;  2C5W B;  2D01 A;  3UB5 P;  3N8L A;  4UA6 A;  4HP9 A;  1TS6 A;  2QKP A;  3VSK A;  4I38 A;  2E8J A;  5DTK A;  4WYY A;  4DXB A;  4WN5 A;  3NOU C;  3GQZ A;  3LR0 A;  5F83 A;  1W79 A;  2O9C A;  3SH7 A;  4LV1 A;  2FFY A;  1DP6 A;  1OTE A;  1K6S A;  2P08 A;  2VKS A;  1K54 C;  4GHI B;  1G68 A;  2YKH A;  1YAX A;  4R4S A;  2HDR A;  4FH4 A;  4CLC C;  1WE4 A;  2ZQC A;  4FCF A;  2JCH A;  2OAQ 1;  1ACF A;  3P09 A;  2HDU A;  4HOI A;  4EQ1 A;  5KSC A;  1D7E A;  5CGX A;  2V1Z A;  2WUQ A;  5IT5 A;  2ZC4 B;  2WKP A;  3MZD A;  1ESI A;  4YWZ A;  1BLH A;  3T4K A;  2NUP C;  4K0X A;  3GEC A;  3VP0 A;  4X53 A;  4ZAM A;  2M7U A;  2IWC A;  1L2S A;  2K7S A;  5CTN A;  3IT9 A;  4FSF A;  4KZ9 A;  3ZG8 B;  4WL9 A;  5GLB A;  1WYB A;  2PAV P;  3HLW A;  5EVI A;  3SS3 A;  4P6Z S;  2PD7 A;  3BFE A;  1OT9 A;  2CMN A;  5GHX A;  2B95 A;  3E98 A;  3FWL A;  4LV2 A;  1DJB A;  3BM6 A;  2E8I A;  3UDI A;  3OPP A;  3LIA A;  4AFI A;  3QNB A;  3H9W A;  4C3Q A;  2WYX A;  3GRJ A;  3MFD A;  4H6J A;  2AVX A;  5F5Y A;  2X71 A;  4XUZ A;  2V20 A;  3KYE A;  2BG1 A;  3A0R A;  3P7N A;  3LEZ A;  4E3M A;  1ES3 A;  3BJN A;  3WS0 A;  4EBP A;  2G7U A;  2EFU A;  3IWO A;  5I94 A;  1SKO B;  1OTI A;  5CGW A;  4G3W A;  2EX8 A;  3N4I A;  3F1O A;  2B18 A;  3S1Y A;  3MXR A;  2XR0 A;  3HLF A;  3TSG A;  5HPF A;  3PTE A;  4CLC E;  4WLA A;  1M6K A;  4JGP A;  4EBL A;  4OH0 A;  1LSV A;  2PYP A;  2J3W A;  2XA7 S;  4YFM A;  1T1B A;  2ZM8 A;  2J9P A;  1BLS A;  4WMC D;  1ERQ A;  3ZG5 A;  4XT2 B;  1TD5 A;  1U60 A;  3SS4 A;  3PBT A;  1T19 A;  3ZYT A;  4KZ4 A;  3LY4 A;  1PZO A;  3CHW P;  4CLC A;  3D9Y A;  3C4P A;  3UDF A;  2KLI A;  2I72 A;  4G3V A;  5EVI C;  3IXH A;  5DVA A;  2XGN A;  3NDG A;  5FDH A;  4U0T A;  1IYP A;  4QU3 A;  3H7W A;  1PW1 A;  4KZ7 A;  2H0Y A;  4LRX C;  5F82 A;  3NHQ A;  1CEF A;  4LRY C;  4UA9 A;  2X02 A;  3HLC A;  5EVI D;  1MWS A;  1NYM A;  3HUM A;  2Y2I A;  4ETZ A;  2W3E A;  1I5Q A;  3CZD A;  3IH8 A;  5HD5 A;  5L09 A;  3LR5 A;  4BWI A;  4NXF A;  3WS2 A;  2R78 A;  3Q82 A;  1KE3 A;  3ITA A;  4S2K A;  4KQD A;  1L0G A;  4Z9Q A;  5HZH A;  4E3I A;  1CJF A;  2EXA A;  2VV7 A;  4PPR A;  2P04 A;  3MKF A;  3HVF A;  5F1F A;  3T1R A;  4OQ0 A;  1STZ A;  4PM7 A;  5EVE A;  4GD8 A;  2ZOI A;  4CLC D;  4EES A;  4ARZ B;  2O99 A;  1AXB A;  3HJK A;  4WZ5 A;  4RA7 A;  2HF6 A;  2PR5 A;  5HX9 A;  4FD8 A;  4DN0 A;  4CPK A;  1H0M A;  1W63 M;  4BJP A;  3VMA A;  3IHB A;  2WKR A;  4B4Z A;  4S2N C;  5K5B A;  2LB9 A;  1SCW A;  2HZ5 A;  4X68 A;  1TF1 A;  5A90 A;  1GHI A;  4R70 A;  3ZG0 A;  3C7U A;  1K56 D;  3L7H A;  2K31 A;  3MJQ A;  3EOI A;  3UB7 A;  2DCF A;  2JN7 A;  1TS0 A;  2HP5 A;  4R1G A;  4JXG A;  2JE5 A;  4FH2 A;  4IUK A;  1LI0 A;  4WEL A;  2RCX A;  3DTE A;  4B4X A;  2PU2 A;  5HWV A;  3G2Z A;  1NY0 A;  5E2G A;  4Y3I A;  1TEM A;  2PYR A;  1J9M A;  3ZG7 B;  3N8S A;  4KQQ A;  3IH9 A;  3VOL A;  1IKI A;  1S4S A;  3CIT A;  1K4F A;  5FAT A;  1BLC A;  4I3A A;  2ZM0 A;  2ZQ9 A;  1K4E A;  3G31 A;  2J9O A;  1JWZ A;  2HPB A;  4S2N A;  2EX6 A;  1YMX A;  4OLG A;  2EX9 A;  1ODV A;  4F3L A;  4GHI A;  4CLC B;  3FPV A;  1I2S A;  1YM1 A;  3FPW A;  1ZTU A;  2XQZ A;  5HSQ A;  4RYE A;  2ZMV A;  1NWZ A;  4I39 A;  3G35 A;  4P6B A;  4B93 A;  4HJ4 A;  3SS5 A;  5J8X A;  4BL2 A;  4N92 A;  3RFB A;  4WF0 A;  2Y55 A;  1GHM A;  1GSX A;  4S2L A;  3LIC A;  1JWV A;  3B33 A;  2JHE A;  3IS2 B;  2V8F A;  3A3F A;  3NEC A;  2Y2J A;  1L0F A;  2ZQ8 A;  4OPR A;  1KGE A;  4MBF A;  2Y2Q A;  2XH9 A;  2KDK A;  4UQI S;  3HRE A;  3KSG A;  1XX2 A;  4X25 A;  2Y2N A;  3Q1F A;  2OSU A;  4DE2 A;  1HD8 A;  2ACG A;  2WKE A;  3RTY A;  1PYY A;  1KE4 A;  1FR6 A;  4QJG A;  3MMH A;  2A24 A;  4G3K A;  1HZO A;  4DE3 A;  4DRT A;  2QYB A;  4BL3 A;  5J4E A;  5FI7 A;  4EWF A;  3UPP A;  3S22 A;  5MC7 A;  3BWL A;  4H6J B;  4C75 A;  3CMZ A;  5AQB A;  3BY8 A;  4X1L A;  1DJA A;  1XKZ A;  3IF6 A;  1BUE A;  2FH5 A;  1MWR A;  1XXM A;  4OKP A;  2ZJ9 A;  3NOP C;  1Q2P A;  3MBZ A;  4QD4 A;  3FV7 A;  2ZMF A;  1LI9 A;  5FAS A;  1L0D A;  2QMI A;  1TS7 A;  4PM9 A;  4R4R A;  2WK0 A;  1OTD A;  3GSG A;  1LSW A;  1ALQ A;  3B3X A;  3Q07 A;  3WRT A;  4OLD A;  1TDL A;  1T18 A;  3OBF A;  3B47 A;  1MC0 A;  2Y91 A;  5F69 A;  4PKY G;  5EM1 A;  4KQO A;  5GLA A;  3BLM A;  3C7V A;  3Q81 A;  4MNR A;  1BTL A;  2PBD P;  3OOV A;  4R3A A;  3IHA A;  5IS1 A;  4ZRR A;  2INW A;  1NLZ A;  4B88 A;  3FZC A;  4BLM A;  2NUT C;  2ZC3 B;  5HW3 A;  2V9A A;  3B42 A;  4HES A;  1ES2 A;  3UB9 A;  1P9R A;  1XFQ A;  4IED A;  3G6O A;  3N8R A;  1OT6 A;  2ZC5 B;  3RH8 B;  2WZZ A;  2Y2H A;  2IWB A;  3GMW A;  4LGW A;  3QHY A;  5F1G A;  5CED A;  1Y4O A;  4MN7 A;  1JVJ A;  2DRW A;  4HJ6 A;  3EQU A;  3IXB A;  1IEM A;  5TFQ A;  2WAE A;  1N9B A;  1ES5 A;  4DDY A;  4ZBE A;  4LLO B;  3A3E A; 
#chains in the Genus database with same CATH homology
 3GVB A;  2P9V B;  3S1Y A;  4K0W A;  4JXV A;  4DE1 A;  3MXR A;  2XR0 A;  3HLF A;  4YIN A;  3TSG A;  2FFF B;  3V3R A;  5GLD A;  3PTE A;  3MXS A;  5FSR A;  1QME A;  3P98 A;  1SDE A;  1M6K A;  4F94 A;  5JYO A;  5A93 A;  3UE1 A;  4Y0U A;  4A5R A;  1IEL A;  2Q9N A;  5FQ9 A;  4EBL A;  4OH0 A;  4GB7 A;  1EI5 A;  5E2E A;  4MEZ A;  4YFM A;  3UY6 A;  2ZM8 A;  3UDX A;  3S4X A;  1FCM A;  2J9P A;  3OCL A;  1BLS A;  3CG5 A;  4WMC D;  4H8R A;  1ERQ A;  1ONH A;  2V2F F;  3M6B A;  4JPM A;  3ZG5 A;  1WYC A;  4OQH A;  5KMW A;  4P85 A;  1S6R A;  1CI8 A;  3SH8 A;  2WZX A;  1MWU A;  1U60 A;  4QY6 A;  3SS4 A;  2XEP A;  3PBT A;  5HL1 A;  4OPY A;  4KZ4 A;  3LY4 A;  3HLD A;  4JF4 A;  4RVA A;  1PZO A;  3DW0 A;  2Z2M B;  1KDS A;  1JTG A;  3N7W A;  1JWP A;  2VGK A;  3BEB A;  1FR1 A;  5L2F A;  3C4P A;  5FI6 A;  3UDF A;  4WM9 A;  1W8Q A;  2H5S A;  2I72 A;  5EVI C;  3ZVW A;  3IXH A;  5DVA A;  1PI5 A;  2XGN A;  3OPH A;  3NI9 A;  3NDG A;  3PAE A;  4P0M A;  1PWD A;  5FDH A;  4RX2 A;  3DWZ A;  2H0T A;  4N9K A;  4S2M A;  4U0T A;  1IYP A;  3PBO A;  4LV3 A;  4Q8I A;  1MKI A;  1MXO A;  4QU3 A;  2Q9M A;  1RGY A;  3N6I A;  1W8Y A;  5HAI A;  1PW1 A;  5CHU A;  3FKV A;  4KZ7 A;  4WBG A;  3GTC A;  2H0Y A;  5FAO A;  4IBX A;  5F82 A;  4JXW A;  1KDW A;  2EXB A;  3G2Y A;  1W5D A;  1CEF A;  3A3D A;  4QHC A;  3PBQ A;  3QNC A;  5DF8 A;  4UA9 A;  5CER A;  3NCK A;  2X02 A;  1TDG A;  4XXR A;  3TG9 A;  3HLC A;  1GA9 A;  1XGJ A;  1MWS A;  1NYM A;  2ZQ7 A;  3LCE A;  5EVI D;  4JBF A;  3NC8 A;  1CEG A;  4OPZ A;  5U47 A;  3HUM A;  2Y2I A;  1YLW A;  1NJ4 A;  1NXY A;  4NK3 A;  1Z6F A;  1I5Q A;  1FQG A;  3CZD A;  3DTM A;  3IH8 A;  2XK1 A;  4EBN A;  1SKF A;  3I7J A;  4D2O A;  1GHP A;  4RX3 A;  4EQI A;  3DWK A;  4LCM A;  5FAQ A;  1K25 A;  3UE0 A;  3WS2 A;  3FYZ A;  3VOY A;  3SH9 A;  5KZH A;  4M3K A;  4O7D A;  4KQR A;  1DY6 A;  3M2K A;  3Q82 A;  1FCN A;  1KE3 A;  1ZC2 A;  2VGJ A;  1H8Y A;  3ITA A;  5FQK A;  5FAP A;  4S2K A;  1ZKJ A;  4DXC A;  1L0G A;  4S2P A;  2EFX A;  4OOY A;  2P9V A;  1NRF A;  1BLP A;  1M40 A;  4Z9Q A;  3ZGA B;  5BOH A;  5FI2 A;  4E3I A;  4GZB A;  2J8Y A;  2EXA A;  5CHJ A;  1GA0 A;  1ERO A;  3MKE A;  4QY5 A;  4IVK A;  4PPR A;  3ZFZ A;  3MKF A;  1KGG A;  1FSY A;  1ZG6 A;  3HVF A;  1FOF A;  4E3L A;  1DJC A;  2JBF A;  4ZJ1 A;  5DTT A;  1ZG4 A;  5F1F A;  3VOZ A;  4GD6 A;  4OQ0 A;  4OVD A;  3IXG A;  3OZH A;  1FCO A;  4WEK A;  4Y7P A;  4PM7 A;  2B5R A;  1K55 A;  1H5X A;  3IQA A;  4K91 A;  4GD8 A;  5GHZ A;  2EX2 A;  3V39 A;  4BD0 A;  4EV4 A;  5EPH A;  3HUN A;  4LCL A;  3WRZ A;  5CRF A;  4X69 A;  5CHM A;  1KVM A;  1AXB A;  3RJU A;  2G2U A;  3JYI A;  4WZ5 A;  4RA7 A;  3IF6 C;  4P87 A;  1BT5 A;  1LLB A;  3BFF A;  3BRM A;  5A92 A;  4JKT A;  1I2W A;  2OV5 A;  2R9W A;  5HX9 A;  4FD8 A;  1PI4 A;  3UNW A;  4CPK A;  1XPB A;  2WGV A;  4BJP A;  1K57 A;  1MY8 A;  5CTM A;  1ERM A;  1KE0 A;  1YLT A;  4S2J A;  3VMA A;  3IHB A;  4N1H A;  5TR7 A;  3BFC A;  1PZP A;  4X55 A;  4B4Z A;  4S2N C;  5CXW A;  1HVB A;  1K38 A;  4GNU A;  1SCW A;  4X68 A;  2XD5 A;  5CGS A;  5A90 A;  1GHI A;  3SOI A;  3ZG0 A;  3V5M A;  3C7U A;  4WMC A;  1K56 D;  4XUX A;  3V50 A;  3ZNY A;  1YLP A;  2XFT A;  4KZA A;  1SHV A;  4KZ3 A;  4MLL A;  2DCF A;  3VP3 A;  1N4O A;  2HP5 A;  4JXG A;  4R1G A;  4KEN B;  4BQM A;  2A3U A;  4OPQ A;  1YT4 A;  2JE5 A;  1YQS A;  3UPO A;  1PWG A;  1ONG A;  2ZC6 B;  3IF5 A;  4FH2 A;  1FSW A;  1Y54 A;  1LI0 A;  1IYQ A;  4KZ8 A;  2RCX A;  3O86 A;  1E3U D;  4WEL A;  5EUA A;  2PU2 A;  5E43 A;  3UE3 A;  1W7F A;  4B4X A;  1JTD A;  3G2Z A;  1NY0 A;  1XA7 A;  5E2G A;  5IHV A;  1GCE A;  3ZG9 B;  2XFS A;  4GOG A;  2Z2L B;  1TEM A;  4DF6 A;  3UPN A;  1ESU A;  4PMA A;  3ZHH A;  5JYP A;  1J9M A;  4R23 A;  5AQ9 A;  3ZG7 B;  3VFF A;  3RXX A;  1KGF A;  4HBU A;  5FQQ A;  3GV9 A;  4EUZ A;  3N8S A;  4LV0 A;  4KQQ A;  3IH9 A;  1IKI A;  2WKH A;  5M18 A;  5AQA A;  1K57 C;  3FKW A;  1RCJ A;  3UO9 A;  1K4F A;  2HP9 A;  2XF3 A;  5EVI B;  2XDM A;  4OOM A;  5FAT A;  1BLC A;  4KZB A;  5GLC A;  2ZM0 A;  2ZQ9 A;  1K4E A;  3G31 A;  2J9O A;  5KSH A;  1JWZ A;  2HPB A;  3IXD A;  4S2N A;  1S0W A;  2EX6 A;  4OOL A;  4U3T A;  1G6A A;  4L0L A;  1YMX A;  1EWZ A;  1E25 A;  2QPN A;  3AGF A;  2EX9 A;  4OLG A;  5EE8 A;  1QMF A;  1H8Z A;  1PW8 A;  2GDN A;  2Y59 A;  3IF6 B;  3ITB A;  1Q2Q A;  5A91 A;  4R3B A;  5EOO A;  1NZO A;  4KZ6 A;  2A49 A;  4PM5 A;  2ZM2 A;  3G30 A;  1CK3 A;  3VP1 A;  2Y4A A;  4MBK A;  4PM8 A;  2Y2L A;  1PIO A;  2HDS A;  5HAQ A;  2H10 A;  1I2S A;  1SDN A;  5CEB A;  1YLZ A;  1YM1 A;  4JF5 A;  1RGZ A;  4LEN A;  3BFD A;  3M2J A;  2WAF A;  2XQZ A;  3WWX A;  3RXW A;  1E3U A;  1PWC A;  2R9X A;  3EQV A;  4RYE A;  3G35 A;  4P6B A;  4CJN A;  3ZCZ A;  5GL9 A;  3BEC A;  3SS5 A;  5J8X A;  4BL2 A;  4BEN A;  1K56 A;  4N92 A;  4GKU A;  2G2W A;  3HLG A;  2Y55 A;  1GHM A;  4S2L A;  4GDN A;  2P74 A;  4DDS A;  4DKI A;  1BUL A;  1JWV A;  3OPR A;  1K55 C;  1LHY A;  2PBY A;  5DF7 A;  5EEC A;  3HUO A;  3VSL A;  1VM1 A;  2ZC7 A;  3Q7V B;  3A3F A;  2Y2J A;  3G4P A;  3VP4 A;  1YMS A;  1CI9 A;  1L0F A;  3LO7 A;  4ID4 A;  4KG2 A;  2ZMA A;  3ZDJ A;  4E3J A;  2Y2G A;  2QZ6 A;  3IWQ A;  2ZQ8 A;  4OPR A;  4E3N A;  3HL9 A;  2JC7 A;  4KZ5 A;  1KGE A;  4C6Y A;  5CEC A;  4MBF A;  3A3I A;  2Y2Q A;  3BFG A;  5D3O A;  5EVL A;  2XH9 A;  4OP5 A;  2PU4 A;  5E2H A;  5M19 A;  3MZE A;  4OP8 A;  4GN2 A;  3TOI A;  3O3V A;  3NBL A;  4KG6 A;  4R0Q A;  4ZJ3 A;  3E2L A;  1HTZ A;  1XX2 A;  3HRE A;  2Y2N A;  3IWI A;  4S2I A;  3Q7V A;  2Y2P A;  2WGI A;  3Q1F A;  2RL3 A;  2OSU A;  3Q7Z A;  4DE2 A;  1O7E A;  4JF6 A;  1HD8 A;  1IYO A;  4OQG A;  2WKE A;  5FQJ A;  1PYY A;  3NY4 A;  1KE4 A;  2J7V A;  1FR6 A;  4X6T A;  2XD1 A;  4JXS A;  1YLY A;  4QJG A;  2C5W B;  3WS4 A;  1MBL A;  3N8L A;  4UA6 A;  1HZO A;  4ZTK A;  4DE3 A;  3VSK A;  4DRT A;  4BL3 A;  1TVF A;  5DTK A;  1C3B A;  5FI7 A;  4EWF A;  3AGD A;  2WGW A;  3UPP A;  3S22 A;  5DF9 A;  4WYY A;  4N1X A;  2X01 A;  4DXB A;  3GQZ A;  4S2O A;  5F83 A;  3A3J A;  3CMZ A;  3HLB A;  4C75 A;  3OPL A;  1IKG A;  5AQB A;  1W79 A;  1XP4 A;  3SH7 A;  2Y2O A;  4LV1 A;  2C6W B;  2FFY A;  4OON A;  3V3S A;  4GDB A;  1DJA A;  1XKZ A;  2UWX A;  3OC2 A;  1K6S A;  2WAD A;  3NDE A;  4R3J A;  5HFO A;  3IF6 A;  1BUE A;  1K54 C;  3W4O A;  1G68 A;  1MWR A;  3WS1 A;  1XXM A;  4KG5 A;  3O87 A;  4OKP A;  4IVI A;  4R4S A;  2ZJ9 A;  2HDR A;  3NIA A;  4IBR A;  4OQI A;  4E3O A;  4FH4 A;  1Q2P A;  3MBZ A;  4QD4 A;  1WE4 A;  2ZQC A;  4FCF A;  1MWT A;  2JCH A;  3FV7 A;  5DTS A;  3P09 A;  1RP5 A;  2HDU A;  1LI9 A;  5KSC A;  5M1A A;  5CGX A;  1K54 A;  2V1Z A;  2WUQ A;  5FAS A;  2CC1 A;  1L0D A;  2QMI A;  2ZC4 B;  4PM9 A;  3M6H A;  4WEJ A;  4R4R A;  2WK0 A;  1XA1 A;  3BYD A;  3HLE A;  4NET A;  3GSG A;  1BZA A;  3MZD A;  1ALQ A;  1ESI A;  3B3X A;  3Q07 A;  4HEF A;  4BD1 A;  1BLH A;  3WRT A;  4OLD A;  4UAA A;  5E2F A;  5HAP A;  1TDL A;  1MPL A;  4K0X A;  3VP0 A;  2OLV A;  4WZ4 A;  4UHU A;  3HBR A;  4X53 A;  4ZAM A;  2IWC A;  3BLS A;  1L2S A;  3W4Q A;  3G34 A;  3LY3 A;  2DNS A;  1O07 A;  3IT9 A;  5CTN A;  2ZLY A;  5FA7 A;  4FSF A;  4KZ9 A;  3ZG8 B;  2Y91 A;  4E3K A;  1IYS A;  4KQO A;  3E2K A;  5GLB A;  5GLA A;  1WYB A;  1KVL A;  4PM6 A;  3BLM A;  3C7V A;  3Q81 A;  3HLW A;  4MNR A;  2OLU A;  5EVI A;  3SS3 A;  1BTL A;  3BFE A;  2IWD A;  5GHX A;  3IHA A;  4Y0O A;  3OCN A;  2ZD8 A;  4ZJ2 A;  3FWL A;  4LV2 A;  5FQM A;  3O88 A;  4B88 A;  1E4D A;  1DJB A;  2HDQ A;  2WKI A;  3BM6 A;  3FZC A;  4BLM A;  2E8I A;  2ZC3 B;  5HW3 A;  1VQQ A;  5TGF A;  3PBS A;  3OPP A;  1NYY A;  3PAG A;  3UDI A;  3PBN A;  3VP2 A;  5EOE A;  2HP6 A;  3D4F A;  4HES A;  1ES2 A;  3QNB A;  3WS5 A;  2WGW B;  3W8K A;  1NZU A;  3GR2 A;  4C3Q A;  2WYX A;  3GRJ A;  3MFD A;  4HBT A;  4X56 A;  4IED A;  3N8R A;  1LL5 A;  2X71 A;  2Y2M A;  3AGE A;  4XUZ A;  2V20 A;  2Y2K A;  2ZC5 B;  2BG1 A;  2WZZ A;  2Y2H A;  1ES4 A;  3LEZ A;  3W4P A;  3G32 A;  4N9L A;  1OME A;  2BLS A;  4MBH A;  4E3M A;  1YLJ A;  2IWB A;  1ES3 A;  3GMW A;  5GHY A;  1LL9 A;  1XGI A;  3QHY A;  3UN7 A;  5F1G A;  3WS0 A;  5CED A;  4EBP A;  3VFH A;  3MZF A;  3ZNT A;  1BSG A;  1JVJ A;  1K6R A;  2DRW A;  4U0X A;  4DE0 A;  3EQU A;  3IXB A;  1IEM A;  5G18 A;  2EFU A;  4E6X A;  3IWO A;  5HAR A;  5TFQ A;  3C5A A;  2XLN A;  2WAE A;  4UA7 A;  5AQ7 A;  4ZDX A;  5I94 A;  2ZQA A;  1N9B A;  1ES5 A;  3ISG A;  4WZ5 C;  4DDY A;  4E6W A;  4QB8 A;  3PBR A;  3CJM A;  5CGW A;  4ZBE A;  3ZVT A;  5FQI A;  2EX8 A;  4Y0T A;  3N4I A;  2ZQD A;  3C4O A;  4JLF A;  3A3E A;  1L0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...