4RX3A

A triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMGTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRYYGELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Triple Mutant in the Omega-loop of TEM-1 beta-Lactamase Changes the Substrate Profile via a Large Conformational Change and an Altered General Base for Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4rx3A00
1BLHA 4KZ7A 4QY6A 4L0LA 2HDUA 3PBOA 1HVBA 4O7DA 3M2KA 5FATA 3NC8A 2IWCA 3UDXA 1KE4A 5KZHA 2B5RA 3UE3A 3FWLA 3TSGA 4X56A 4HBUA 4OP8A 4QHCA 3V5MA 2J7VA 1JTDA 4R3BA 3MXSA 4X55A 3LO7A 1FQGA 4WEKA 2JBFA 3ZGAB 3ZG9B 1FCOA 5CGWA 1K4FA 1YLWA 4DE0A 1I5QA 3IHAA 3IXBA 3SS5A 4WZ5C 2Y59A 1TDGA 4KQOA 3SH9A 2VGJA 1LLBA 2X71A 1RGZA 5CGSA 3OZHA 4M3KA 2ZQ8A 5E2EA 1PW8A 3RXWA 1L0FA 1ERQA 1LI0A 1MWUA 3VFHA 4BENA 4EUZA 1IKIA 1Q2QA 1KGFA 4BL3A 4ZTKA 3QNBA 5DTKA 1I2SA 1XGJA 1M40A 5I94A 3V3RA 4BL2A 3OPRA 3Q7VA 1DJCA 1FSYA 4RVAA 4UHUA 4S2JA 4N9KA 4LCMA 3BLSA 2WGWB 4MBKA 4S2NC 5FI7A 3AGDA 1IKGA 2Q9NA 3NIAA 3Q82A 3Q07A 1MWTA 4MNRA 2XEPA 3FZCA 4KZ9A 3W4OA 3BFFA 3S4XA 3GQZA 1KDWA 4BD0A 3TG9A 4OQHA 5L2FA 1YLZA 4JXWA 1YLTA 4DE3A 4QB8A 3VOZA 3WS4A 4E6XA 2OLUA 3Q1FA 1K6SA 2G2UA 1NYYA 3SS3A 2UWXA 5GL9A 3UPNA 4EBLA 2Y4AA 4KENB 4KG6A 2PU4A 4R4SA 1W8QA 3PTEA 3UPOA 1M6KA 3ZVWA 4LV1A 3VP3A 2ZQ9A 4NK3A 1YLJA 4WMCD 1KVLA 3G4PA 1TEMA 4XUXA 5GLDA 4CJNA 3IWIA 4FSFA 3W4PA 1FSWA 3HUMA 1S0WA 3N8LA 4IVKA 2WK0A 3NCKA 4GB7A 3MFDA 4KZ6A 3SH7A 1CEGA 4QY5A 4KZ3A 4WMCA 1HD8A 1NZUA 1ES2A 4GD6A 2ZM8A 1QMEA 3ZCZA 4BQMA 4UAAA 1NXYA 1YT4A 3PBNA 1K25A 3ZDJA 2EX8A 2J8YA 1E25A 2RL3A 4ZJ1A 4GD8A 2Y2MA 1YQSA 1XA1A 2ZQAA 3IF5A 1IYOA 1L0DA 1PWDA 5CHMA 3HLGA 5EVIC 5HAIA 5CRFA 3UO9A 2ZC4B 4OPQA 2PU2A 1PZPA 4OLDA 1PWCA 4KZ8A 1EROA 5AQAA 3NDGA 1ZG4A 2ZC3B 4K91A 5FI2A 4R23A 3O3VA 2J9PA 4HBTA 1K57C 4KQRA 2Y2NA 3MKFA 4PM6A 4S2KA 2P74A 3HUNA 2Y2HA 5FQKA 5BOHA 1BT5A 1ES4A 1MXOA 1PYYA 4OVDA 5DTSA 5EOOA 1GHPA 5IHVA 5F1FA 2BLSA 4KZAA 4C75A 2OLVA 3DWKA 4DE1A 4OQIA 2ZC7A 3GTCA 1FCNA 1VM1A 1L2SA 3O87A 5A93A 5DVAA 2Y2OA 4C6YA 3WS2A 4S2NA 4FCFA 5GLBA 3HLBA 3VFFA 3IHBA 3BECA 5FAQA 3G35A 2QPNA 2XGNA 4Q8IA 2Y2PA 4WZ4A 3M6BA 4LENA 4GDBA 4UA9A 3M6HA 1Z6FA 4DDSA 4R3JA 5EUAA 3P09A 1DY6A 3E2KA 1GCEA 4S2IA 3UPPA 5JYOA 1ESIA 3GVBA 1MWSA 3DWZA 4GKUA 4GNUA 4DF6A 4JKTA 2R9WA 3IXHA 3Q7ZA 4P0MA 3VSLA 4E3MA 3ZNTA 1WYBA 2HP9A 2V20A 2ZM2A 4OKPA 4WZ5A 3IH8A 4OLGA 2HPBA 4YFMA 3RXXA 1SHVA 1ZC2A 5CHUA 3MXRA 1L0EA 3SS4A 1DJBA 4QU3A 4C3QA 3D4FA 2Y55A 4OONA 4PPRA 4N9LA 2EXBA 5CERA 3OPHA 3V3SA 1O7EA 2WUQA 1KDSA 3QNCA 3G31A 4S2LA 1W79A 3IXGA 3IF6A 4B88A 4RA7A 3ZG5A 1SCWA 4PM5A 3C5AA 3BRMA 5FQIA 4S2OA 1PI4A 3HLCA 1WYCA 4IEDA 4ID4A 5DF9A 1PWGA 2EFUA 1K57A 1XXMA 3SOIA 2ZC5B 5EE8A 1K54A 3A3DA 4ZJ3A 3VP0A 3WRTA 5KSCA 3UNWA 1YMSA 1IYPA 3LY3A 4JF6A 3HLDA 1XA7A 4CPKA 2H5SA 4MLLA 4X68A 4ZAMA 3EQVA 1GHIA 3N8SA 2XFSA 1XP4A 3B3XA 5EVIA 1JTGA 1MBLA 4OOMA 3UE0A 1BSGA 5CTNA 2Y91A 1ZG6A 1QMFA 4JXSA 3PAGA 4WELA 4YINA 4OOLA 1CK3A 2GDNA 1TDLA 2WADA 3ZVTA 4N1XA 4PM7A 4MEZA 2WZXA 5F83A 3VMAA 4DXBA 3I7JA 1TVFA 2ZC6B 1RGYA 2V1ZA 3PAEA 1KE3A 5M1AA 4OOYA 2QMIA 5GHXA 3CZDA 5CHJA 3VP1A 2WAEA 3A3IA 5FAOA 3MZEA 3ZFZA 2A3UA 3PBQA 2ZQDA 3IF6B 2R9XA 1BLCA 1SDEA 2HP5A 3E2LA 1GHMA 4IVIA 4N1HA 4X6TA 1ERMA 2WAFA 4Z9QA 1ONHA 4U3TA 4P87A 3OPPA 4WM9A 4U0XA 2WGWA 1CI9A 5A91A 4EV4A 1AXBA 5EVLA 3C7UA 4EQIA 1ONGA 3HUOA 3G34A 1KGGA 3BFDA 4E6WA 1PW1A 2EXAA 1K38A 4S2MA 3C4PA 1EI5A 3BLMA 4LV3A 5TGFA 4IBRA 4D2OA 3IWQA 4OQGA 2JE5A 2E8IA 5FA7A 4H8RA 1IEMA 1U60A 1NYMA 2ZQ7A 4JLFA 2A49A 2X01A 5FQJA 5E2HA 1YLPA 3BFGA 4ZDXA 3OCNA 1ALQA 3FYZA 1NZOA 1W5DA 3N4IA 3N7WA 5JYPA 1MY8A 4RX3A 5D3OA 5A90A 4F94A 3ZG0A 1MPLA 2XQZA 3V50A 2P9VA 3BYDA 5AQ7A 3S1YA 4NETA 3G2YA 3IXDA 5HX9A 1ESUA 1I2WA 4X53A 1E3UD 1GA9A 1IYQA 1G6AA 1FR1A 1RCJA 4Y7PA 4KG5A 2XDMA 3BEBA 2CC1A 4P85A 3ITBA 3OCLA 2H10A 3BFCA 2FFFB 3VP4A 4JXVA 4PM9A 1HZOA 1YM1A 5FQQA 1E4DA 3LY4A 3BFEA 2IWDA 3WS5A 1MWRA 3LCEA 4E3NA 1L0GA 4Y0UA 1BULA 5F82A 3W8KA 2OSUA 1YLYA 3IF6C 1H8YA 2DNSA 2DCFA 1JWVA 2PBYA 4KQQA 3ITAA 3NI9A 1BTLA 1N9BA 3PBRA 4GN2A 1CEFA 4R0QA 1BLSA 2ZQCA 4GDNA 5EECA 4LV2A 5GHZA 5M19A 5TFQA 3G2ZA 1BZAA 2Q9MA 4OQ0A 2Y2IA 5DF7A 1W7FA 2HDSA 5EVID 4ZBEA 1H8ZA 3ZG7B 2VGKA 3CJMA 1RP5A 4WBGA 1XPBA 3GRJA 4Y0TA 3FKWA 3HLWA 1N4OA 4ZJ2A 4EWFA 4RYEA 4FH2A 1YMXA 3IWOA 3P98A 2EX9A 3ZNYA 1KVMA 4R4RA 3CG5A 2EX6A 3TOIA 3EQUA 1NRFA 4KG2A 4XUZA 5EPHA 2I72A 4X69A 2IWBA 2WZZA 1LL9A 3AGEA 4KZBA 1PIOA 5TR7A 3WRZA 2RCXA 1EWZA 4UA6A 4EBNA 3HLFA 3NY4A 2Y2LA 3W4QA 5FAPA 3ZHHA 3IQAA 3N6IA 1K56D 3LEZA 5CEBA 3PBTA 5E2FA 4OPYA 4E3KA 1O07A 1G68A 1LL5A 3C4OA 5KMWA 3CMZA 3GR2A 1K6RA 2JC7A 1LHYA 3O86A 4PMAA 4PM8A 2WGIA 1KGEA 1GA0A 4QD4A 1CI8A 3QHYA 4R1GA 4WYYA 4HEFA 2V2FF 4JF5A 5HFOA 4UA7A 3GMWA 2WKEA 1BUEA 2X02A 3MZFA 3SH8A 3HVFA 3MZDA 4XXRA 5FI6A 5GLAA 5FDHA 4Y0OA 5GHYA 2OV5A 4E3IA 4OPZA 4K0XA 3GV9A 5HAPA 3G32A 3UN7A 4LV0A 3UE1A 1S6RA 5EVIB 4EBPA 2ZLYA 3OPLA 3A3FA 5DTTA 1HTZA 1VQQA 3O88A 2XD1A 4LCLA 1ES3A 5CXWA 5CTMA 3FKVA 4U0TA 4BJPA 2ZJ9A 5KSHA 4S2PA 2H0TA 1NY0A 2Y2QA 4GOGA 1KE0A 4GZBA 4OP5A 3HREA 2WKIA 1E3UA 1BLPA 4E3OA 5F1GA 3DW0A 2BG1A 4MBHA 4E3LA 4QJGA 5FASA 5AQBA 1K55C 1ES5A 3AGFA 2C6WB 1XX2A 4N92A 2XK1A 5U47A 1H5XA 4P6BA 2Z2LB 1IYSA 3IH9A 3WS0A 4JF4A 4BD1A 2ZMAA 1SDNA 3Q81A 4DDYA 5EOEA 1C3BA 1FR6A 5A92A 2XR0A 2P9VB 1Q2PA 1FOFA 4JXGA 4B4XA 2XLNA 3IT9A 3RJUA 4KZ5A 5HL1A 1JWZA 3NDEA 2XF3A 1SKFA 3Q7VB 1XKZA 4HESA 4A5RA 5M18A 1K4EA 5AQ9A 2J9OA 3OC2A 4MBFA 4JPMA 3M2JA 1JVJA 2G2WA 2EFXA 5E2GA 2HP6A 3G30A 5J8XA 2H0YA 5FSRA 5HARA 2WYXA 2DRWA 1K55A 4OPRA 3WWXA 2HDQA 3PBSA 4FD8A 1DJAA 2XFTA 2ZD8A 1XGIA 1J9MA 3JYIA 5CGXA 4BLMA 2ZM0A 5GLCA 4WEJA 5DF8A 3VSKA 4DKIA 3V39A 1JWPA 2EX2A 4IBXA 1Y54A 1FCMA 3BM6A 3GSGA 5E43A 3S22A 3VP2A 5CECA 5CEDA 4JBFA 3FV7A 5HAQA 4DRTA 1PZOA 1IELA 3N8RA 2JCHA 3MBZA 2FFYA 3MKEA 3UDIA 3WS1A 2XH9A 3ZG8B 2WGVA 4KZ4A 5HW3A 1ZKJA 3DTMA 2Z2MB 3HL9A 1WE4A 4K0WA 3UY6A 4B4ZA 1LI9A 2Y2JA 3NBLA 5FQMA 4E3JA 4FH4A 1MKIA 1NJ4A 3HLEA 4RX2A 2XD5A 3ISGA 1K56A 4DXCA 3VOYA 4DE2A 5FQ9A 3A3EA 3HBRA 1PI5A 2Y2KA 2Y2GA 2C5WB 2HDRA 1W8YA 3A3JA 1K54C 5G18A 3UDFA 1OMEA 3C7VA 2QZ6A 2WKHA 4OH0A
chains in the Genus database with same CATH superfamily
3UB5P 5L07A 1BLHA 4KZ7A 4II7A 2WKPA 1HVBA 4O7DA 5FATA 1KE4A 2XSSA 2ZMVA 1L3LA 1GSWA 2JKFA 4R3BA 4I3JA 3P7NA 2JBFA 5CGWA 1K4FA 3JPUA 1I5QA 3IHAA 2O9BA 2A24A 5HD3A 1PW8A 1CF0A 1LI0A 1IKIA 1Q2QA 1KGFA 4BL3A 5I94A 1VB6A 3V3RA 1DJCA 4RVAA 4EESA 4S2JA 4I3AA 2WGWB 4MBKA 1SKOA 4EXOA 3AGDA 2Q9NA 3NIAA 3Q82A 2XEPA 3SZTA 2K2NA 4JXWA 3LIBA 3WS4A 1DRMA 4X1LA 3Q1FA 3SS3A 5HD5A 5GL9A 3UPNA 4KENB 3LIEA 4LV1A 4NK3A 1YLJA 4FSFA 4F3LA 1FSWA 4IVKA 4LLOB 3NCKA 4GB7A 1G28A 3MFDA 3EGDC 2WKRA 1CEGA 3F1PB 4GS9A 4KZ3A 4QY5A 2ZM8A 4R38A 1K25A 1E25A 1PWDA 3T4OA 3HLGA 3VV4A 1DP6A 3OLOA 4OPQA 4OLDA 4KZ8A 4K91A 2QHKA 4R23A 3O3VA 4KQRA 4ZRRA 3MKFA 2ZL1B 2P74A 5HWVA 1OT6A 3LI8A 1MXOA 3S7NA 4OVDA 3U2AA 2QJ5A 2ZC7A 3CUEA 3O87A 3NOUC 5DVAA 3VFFA 5GLBA 3HLBA 5HSQA 3A0RA 1GSVA 2B18A 2A2LA 2Y2PA 3M6BA 4LENA 1T1BA 2VA0A 4UA9A 3T1SA 1G5UA 4R3JA 5EUAA 2JHEA 1ESIA 3GVBA 1MWSA 3DWZA 4GKUA 4DF6A 4JKTA 2HF6A 2JN7A 2O9CA 4P0MA 3R7WA 1J3WA 1N9LA 1WYBA 4EETB 2ZM2A 4OKPA 4R6LA 4OLGA 3H7WB 1SHVA 4WN5A 4NEED 4C3QA 4PPRA 2W1RA 2EXBA 4N9LA 4CQHA 2V1BA 3QNCA 1W79A 3IF6A 1SCWA 3C5AA 3K3CA 3LIFA 2PAVP 3HLCA 4NG2A 1K57A 1XXMA 2M7VA 5EE8A 3KSIA 1Y4OA 3UNWA 1S4SA 4I5SA 2H5SA 4ZAMA 3EQVA 4RQ9A 1GHIA 3N8SA 1V9YA 1JTGA 5CTNA 2Y91A 1ZG6A 3H82B 1AWIA 1VETA 5HWWA 5L09A 4WELA 4YINA 1TDLA 3A0SA 1GSXA 3I7JA 3PAEA 5M1AA 5EM1A 3VP1A 3R4KA 3TRCA 3MZEA 4MDZA 1D7EA 2HP5A 2G7UA 5FL3A 2PYPA 2QWSA 4P87A 2VK3A 4U0XA 5AJGA 2WGWA 4EV4A 1AXBA 2QYBA 3C7UA 5EVLA 2QJ7A 3OBFA 1KGGA 4E6WA 3UB8A 3H9WA 3B33A 1K38A 3U4LP 4LV3A 1OJ5A 4OQGA 1K0KA 3F1NB 2E8IA 2ZL1A 2PHYA 4JLFA 2A49A 5TJJA 3S7PA 5JYPA 3N4IA 2YKHA 1MY8A 4RX3A 5D3OA 2PBDP 1MPLA 2P9VA 4NETA 1XJ2A 3G2YA 3IXDA 5HX9A 1FILA 1I2WA 1E3UD 1G6AA 3VE4A 3LR0A 4Y7PA 2XDMA 3BEBA 3UMEA 1OTDA 3VOLA 1HZOA 5FQQA 3LY4A 2IWDA 5AVFA 4Y0UA 1YLYA 3FPVA 1JWVA 4KQQA 4P6ZS 1ZTUA 3ITAA 3PBRA 3UB7A 2WKQA 1BLSA 2Z6DA 2KX6A 5DF7A 4L9FA 3GRJA 4ZJ2A 3S7QA 4RYEA 4FH2A 3BQ8A 2JKRM 1P9RA 3ZNYA 5IT5A 4XUZA 5EPHA 2I72A 2IWBA 4IUKA 3WRZA 1IOUA 1TF1A 1KOUA 3W4QA 1T1CA 3IQAA 3T4KA 4HY8A 5G4YA 3UB9A 4OPYA 3MFXA 2PD7A 3FG8A 2JC7A 4QD4A 3K3DA 2V2FF 4UA7A 1WA9A 2HZ5A 3MZDA 1H3QA 4XXRA 5FI6A 3EWKA 3G32A 3UN7A 4LV0A 4O01A 1S6RA 5EVIB 2L0WA 3CITA 3HJIA 2UV0E 3OPLA 5DTTA 4Y13A 3ULFA 5CXWA 3FKVA 5FDSA 1KE0A 4OP5A 2WKIA 1E3UA 5AQBA 3AGFA 4G3VA 4H6JA 3IBJA 3CI6A 1XX2A 1H5XA 3T4JA 4HH3A 3Q81A 5EOEA 3FC7A 2GJ3A 4FUWA 1FOFA 4NXEA 3IT9A 4KZ5A 4A5RA 1K4EA 5AQ9A 4Y17A 2M1CA 2Z6CA 5CX7A 4Q0HA 3G30A 2O0YA 3F1NA 1N9OA 4HP9A 4FD8A 2V9AA 4CLCA 3VSKA 1JWPA 1FCMA 3BM6A 3VP2A 5CECA 3N8RA 3MBZA 2FFYA 3PR6A 4YWZA 3WS1A 2PD8A 3ZG8B 2WGVA 3DTMA 3UY6A 3NBLA 1NJ4A 4O8GA 2JKRI 4ARZB 4RX2A 3ISGA 3T1QB 4XT2A 2PU4A 2ZQ9A 5DFYA 4QY6A 2ACGA 3M2KA 3T4TA 3NC8A 3UDXA 2B5RA 4X56A 4OP8A 1F98A 1JTDA 3EGXC 1UGUA 4WEKA 1FCOA 1YLWA 4WZ5C 4BMWA 1TDGA 4KQOA 3SH9A 2GZAA 4WL9A 3OZHA 2ZQ8A 3RXWA 1L0FA 3QNBA 1I2SA 3G6OA 2W1TA 3Q7VA 4UHUA 3C2WA 4WLAA 3B47A 3RH8B 5A8BA 4LCMA 4MNRA 3Q07A 3CUEC 2BTFP 4KZ9A 3W4OA 3BFFA 3S4XA 3GQZA 1KDWA 4DE3A 4GW9A 2UWXA 4EBLA 2Y4AA 4KG6A 5TBMA 3HCYA 1M6KA 1KVLA 4XUXA 1TEMA 5GLDA 4CJNA 2VLGA 3HUMA 2J3TD 2WK0A 4AFIA 2KLIA 4DJ2A 5HPIA 4KZ6A 3SH7A 1HD8A 1NZUA 2OAP1 3IS2A 3BQAA 1QMEA 4GD6A 1UWNX 5EM0A 1YT4A 2EX8A 4ZJ1A 4GD8A 1L0DA 5EVIC 5CRFA 4WUJA 2PU2A 2W3FA 3H7WA 4LRZE 3VE3A 4S2KA 2P7JA 5FQKA 1BT5A 2PYRA 5EOOA 1GHPA 3DWKA 2J80A 1VM1A 3DBAA 4UEYA 2FZ0A 5FAQA 2QPNA 2XGNA 4WZ4A 2VV8A 3PHYA 1Z6FA 4DDSA 1YSQA 4S2IA 3E2KA 1GCEA 5JYOA 1N9NA 2ZMFA 4GNUA 5J3WA 2OOLA 3VSLA 3IXHA 4E3MA 3Q7ZA 3ZNTA 4X25A 3RXXA 2HPBA 4G3KA 5F69A 4NXGA 3SS4A 3NOTC 3KSGA 4QU3A 4L9EA 4KQDA 1ODVA 1KDSA 4S2LA 4B88A 3IXGA 3BRMA 5FQIA 4LGWA 1NWZA 4ID4A 5DF9A 3SOIA 3LEQA 3B42A 3A3DA 3WRTA 2W1TB 3LY3A 2XFSA 1XP4A 5EVIA 4OOMA 3UE0A 1QMFA 3A0VA 5HDSA 3E4PA 3T12B 3LI9A 3ZVTA 5EVEA 2WZXA 5F83A 4DXBA 3NJAA 3CZDA 5CHJA 2A3UA 3PBQA 2NUTC 1BLCA 1SDEA 1GHMA 1TD5A 4IVIA 4X6TA 1ERMA 4Z9QA 4U3TA 4WM9A 5A91A 1MKMA 1ONGA 2PR6A 2O9AA 3BFDA 1PW1A 4HJ6A 5DKLA 1P0ZA 4S2MA 4DN0A 4IBRA 4QWOA 4EQ1A 1T19A 2FH5A 5FA7A 1H8MA 2ZQ7A 5FQJA 1YLPA 4ZDXA 4ETXA 3OCNA 1F2KA 3V50A 1GA9A 4DJ3A 3LIDA 1RCJA 4FOFA 3ITBA 3RTYA 2FFFB 4JXVA 2O99A 2ZBBA 2V1AA 4IUHA 3L7HA 1MWRA 4E3NA 1BULA 1T1AA 3OOVA 2DNSA 2PBYA 2PR5A 4GN2A 2VGLS 1CEFA 4R0QA 5F5YA 5EFWA 5GHZA 5EECA 4LV2A 5M19A 5TFQA 3G2ZA 2VZWA 1H8ZA 3CJMA 1RP5A 2EWVA 3FKWA 3HLWA 1V9ZA 4EWFA 5AVEA 3P98A 2EX9A 3MJQA 1S1YA 3MQ0A 3LYXA 3TOIA 4KG2A 5TR7A 1VETB 3S7OA 2Y2LA 3DTEA 3N6IA 1K56D 5CEBA 3C4OA 5L10A 4R1GA 4HEFA 1ACFA 1BUEA 2X02A 5GLAA 3IX4A 1F5MA 4OPZA 4K0XA 4CLCE 3GV9A 4EBPA 3LIAA 1VQQA 2VKSA 3O88A 1ES3A 2VV6A 3LFVA 1NY0A 2Y2QA 4GZBA 5LBRA 5F1GA 3DW0A 5FASA 3KYQA 5DKKA 2DMWA 1TS7A 4N92A 2XK1A 4P6BA 1XJ6A 4BD1A 2ZMAA 4BBVA 4R3AA 2W3GA 1FR6A 2P9VB 1Q2PA 1EW0A 3RJUA 3LR4A 1JWZA 1YSPA 1SKFA 5M18A 2ZOHA 3OC2A 4MBFA 4JPMA 3M2JA 5MC7A 4R70A 2W0NA 5DJTA 5E2GA 1VEUB 5FSRA 2DRWA 1K55A 1W63Q 3JYIA 5GLCA 4WEJA 4DKIA 3V39A 2K31A 3KYEA 4JBFA 2JKTI 5G4ZA 1IELA 2YKFA 3CPTB 3F1OA 4KZ4A 5HW3A 2Z2MB 4K0WA 4E3JA 4FH4A 4GS9B 2VJWA 4X1MA 2XD5A 1K56A 3LR5A 4MCWA 2CMNA 3A3EA 3HBRA 2C5WB 3UE6A 2HDRA 3C7VA 2QZ6A 1OTIA 1YAXA 4HJ4A 4JGOA 3NECA 3PBOA 2IWCA 3UE3A 4BBUA 3FWLA 4HP4A 1OTAA 3GDIA 4HBUA 3V5MA 2J7VA 3MXSA 1DP9A 1FQGA 3ZGAB 3ZG9B 2LB5A 3QP8A 4MN6A 4DE0A 4MMNA 3SS5A 3O5YA 2Y59A 2VGJA 3F1PA 4EUVA 5CGSA 4M3KA 5E2EA 1XJ4A 1MWUA 2LB9A 4EUZA 4BENA 4ZTKA 1FIKA 1TS8A 3RFBA 4BL2A 2E8JA 2XROA 4PKYG 4KUKA 4N9KA 3BLSA 4I38A 4S2NC 5DJUA 5FI7A 2INWA 1MWTA 5HWTA 4BD0A 3TG9A 5L2FA 2OWHA 4QB8A 2HJ9C 3C30A 2Q0OA 1K6SA 2G2UA 3UPOA 4CLCB 4R4SA 1W8QA 3GECA 3N8LA 4WMCA 3ZCZA 4ARZA 4BQMA 2V8CA 1NXYA 3PBNA 4L9GA 2Y2MA 1YQSA 1IYOA 1S67L 5HAIA 1PWCA 1EROA 5AQAA 3NDGA 1ZG4A 1JNUA 2ZOIA 2J9PA 4LPZA 1K57C 4ME4A 2Y2NA 3HUNA 1ES4A 5DTSA 3F1OB 3K2NA 4C75A 3GTCA 1FCNA 5HDDA 4UQIM 5J7EA 4C6YA 4FCFA 3IHBA 3BECA 3G35A 4LRXC 4G3WA 3PXPA 4Q8IA 2XA7M 3CWFA 1VEUA 3P09A 1DY6A 3UPPA 2R9WA 1OPXA 4YOFA 2HP9A 2V20A 4WZ5A 3IH8A 4KUOA 3D72A 3PYPA 5CHUA 1DP8A 1L0EA 1DJBA 2Y55A 3V3SA 3OPHA 3CPTA 2WUQA 4PAUA 4EEPA 4F3LB 1H0MA 4S2OA 1G6OA 2V0UA 1WYCA 4IEDA 1PWGA 5FEGA 3IS2B 2ZC5B 1LSWA 2PRFA 4ZJ3A 1OTEA 1VHMA 4JF6A 3HLDA 3QP6A 4IHQA 1XA7A 4CPKA 3B3XA 1XFNA 1D06A 1MBLA 3MMHA 4JXSA 4OOLA 3E4QA 4Z1WA 4N1XA 4PM7A 4MEZA 1MC0A 1LSVA 2V1ZA 1KE3A 2QMIA 5GHXA 5FEFA 3NOPC 2QKPA 3A3IA 3ZFZA 4PKYA 3EEAA 2J3TC 4HH2A 2ZQDA 4EEUA 3IF6B 2HGVA 3E2LA 1A0KA 4N1HA 2MJ6A 1ONHA 2W27A 3OPPA 1XFQA 3HUOA 4MN7A 1NLYA 1NLZA 3MSHA 3MQQA 3KX0X 5HL6A 2EXAA 3C4PA 3IWQA 4GHIB 2JE5A 1IEMA 1XJ3A 2X01A 5E2HA 3BFGA 1NZOA 1W5DA 3N7WA 4F94A 3ZG0A 2XQZA 5AQ7A 4HHDA 3BJNA 1D1JA 4I39A 3ZQ5A 1P97A 1E4DA 2XA7S 3WS5A 5HPFA 3LCEA 3KO6A 3IX8A 3FPWA 4JGQA 2DCFA 1BTLA 1N9BA 4M4XA 3E0YA 5F6AA 4GDNA 1W7FA 2HDSA 4ZBEA 3ZG7B 2NUPC 2VGKA 3W2ZA 5K5BA 4Y0TA 2GX5A 1Z09A 3CHWP 1YMXA 3IWOA 3T50A 1LL8A 4R4RA 3CG5A 2EX6A 1NRFA 1PRQA 4X69A 2WZZA 1LL9A 2RCXA 1EWZA 3HLFA 5FAPA 1S1ZA 4YNRA 2BASA 5E2FA 4E3KA 1G68A 3CMZA 1K6RA 1LHYA 4Y2FA 1KGEA 1GA0A 4O0PA 4B9OA 3QHYA 4WYYA 4JF5A 5HFOA 3GMWA 4FTXA 2WKEA 1STZA 3BWLA 3SH8A 3HVFA 3DAVA 5GHYA 2OV5A 2ZLYA 2D02A 5HZHA 2VGLM 4HOIA 5L8MA 4BJPA 5KSHA 4S2PA 2H0TA 4GOGA 4HQAA 2Y8HA 4MBHA 2BG1A 4E3LA 4QJGA 1K55C 2C6WB 4BWIA 5U47A 3QP2A 2Z2LB 3NULA 3KYZA 1TS0A 5A92A 2XR0A 1P9WA 2GNXA 4B4XA 4HI4A 3Q7VB 4HESA 1SKOB 2M7UA 2H28A 2R78A 2G2WA 3T1RA 5I5LA 2H0YA 5HARA 4HNBA 4OPRA 3WWXA 4ESPA 2EA9A 2HDQA 2ZD8A 5CGXA 1XGIA 4BLMA 4IBXA 2EX2A 3GSGA 2K7SA 4Q0JA 2KDKA 5CEDA 3FV7A 1PZOA 4Y3IA 2JCHA 2XH9A 3LR3A 4WF0A 1ZKJA 1WE4A 5FQMA 5EV0A 1MKIA 3HLEA 3LICA 4JGPA 3CLOA 1PI5A 2Y2GA 5G18A 3UDFA 1OMEA 3KSHA 1YPRA 2WKHA 2VEAA 4L0LA 2HDUA 5KZHA 3TSGA 3D3OA 4QHCA 4X55A 3LO7A 3IXBA 1LLBA 2X71A 3UMDA 1RGZA 3MF0A 1ERQA 2XRNA 3VFHA 4HIAA 3T4QA 5DTKA 1XGJA 1LT0A 1M40A 1X0OA 3KSFA 3OPRA 1FSYA 2B02A 1IKGA 5HDCA 1ZHHB 3FZCA 1PNEA 1MZUA 2KOIA 1YKDA 4OQHA 1YLZA 1YLTA 4E04A 3VOZA 4E6XA 2OLUA 4K08A 3LGOA 2L4RA 1NYYA 4GCZA 5J4EA 3PTEA 3ZVWA 3VP3A 4WMCD 2B95A 3G4PA 3IWIA 3W4PA 1S0WA 2A24B 3MXQA 1ES2A 4UAAA 3ZDJA 1UWPX 2J8YA 2RL3A 1XA1A 2ZQAA 3IF5A 5CHMA 3QP4A 3DTIA 3UO9A 2ZC4B 2P04A 1PZPA 3EEHA 3E4OA 3MR0A 1BYWA 2ZC3B 5FI2A 5IS1A 4HBTA 4LRYC 4PM6A 2AVXA 4B93A 2Y2HA 5BOHA 1PYYA 4I3IA 5F1FA 1S4RA 5IHVA 2BLSA 4KZAA 3DTKA 2OLVA 3BY8A 2W3HA 4DE1A 4OQIA 4CLCD 1NRJA 2OAQ1 1L2SA 5A93A 2I9VA 3IBRA 2Y2OA 3WS2A 4GJ4A 4S2NA 3ZYTA 5KIZA 4PHTA 4GLQA 4GDBA 3M6HA 4JGRA 3HJKA 3BW6A 4YFMA 2VV7A 1ZC2A 3MXRA 3BY9A 3D4FA 4OONA 5CERA 3SW1A 2IA2A 1O7EA 3G31A 2EWWA 3ICYA 2HJEA 4RA7A 3ZG5A 4PM5A 1PFLA 1PI4A 3QP1A 2EFUA 3V67A 1K54A 2HV1A 3VP0A 3NHQA 5KSCA 1YMSA 1IYPA 1SZVA 1IFQA 3T4SA 4MLLA 4X68A 1T18A 1S66L 1BSGA 3PAGA 4EERA 3JVUA 3MQOA 1CK3A 2GDNA 4MN5A 2WADA 3VMAA 4ETZA 1TVFA 2ZC6B 1RGYA 4OOYA 1OJGA 2WAEA 4LFUA 5FAOA 2R9XA 2OWJA 1CJFA 3QP5A 2WAFA 3LUQA 3CAXA 4EQIA 5C5KA 3G34A 1EI5A 3BLMA 5TGFA 2D01A 2J3WA 4D2OA 4H8RA 1U60A 4DMZA 4EW7A 4IJGA 1NYMA 4H6JB 3EOIA 1ALQA 4QPRA 3FYZA 1LSXA 5A90A 3E98A 2Y79A 3T4LA 3BYDA 3S1YA 4NKPA 1ESUA 4X53A 2W3DA 1IYQA 1FR1A 3C8CA 4KG5A 4P85A 2CC1A 3OCLA 2H10A 3BFCA 3VP4A 3T1XA 4PM9A 1YM1A 3BFEA 1L0GA 5F82A 3W8KA 2OSUA 3IF6C 1H8YA 3NI9A 1OT9A 3TE8A 2ZQCA 1BZAA 2Q9MA 4OQ0A 2Y2IA 5EVID 2JKTM 4P6ZM 4WBGA 1XPBA 1Y28A 4BBTA 1N4OA 5IU1A 4Q0IA 4UQIS 4XT2B 2P08A 1OTBA 1KVMA 3EQUA 3AGEA 4KZBA 1PIOA 3P01A 4EBNA 4UA6A 3NY4A 3D9YA 3ZHHA 3UB6A 2PDRA 3LEZA 1HLUP 3PBTA 4Y15A 5DFXA 1O07A 1LL5A 5KMWA 1TS6A 3GR2A 3O86A 4PMAA 4PM8A 2W3EA 2WGIA 4Y5FA 1CI8A 2PT7A 3IX3A 1W63M 4D60A 3MZFA 5FDHA 4Y0OA 4E3IA 5HAPA 3UE1A 3TW8A 3A3FA 1HTZA 3H82A 2XD1A 4LCLA 5CTMA 4U0TA 2ZJ9A 4CLCC 4GHIA 3HREA 4E3OA 1BLPA 3MS6A 1ES5A 1F9IA 5TBMB 3L9KA 1IYSA 3IH9A 2V0WA 4JF4A 3WS0A 1SDNA 1C3BA 2V8FA 4JXGA 2XLNA 5HL1A 3NDEA 2XF3A 1XKZA 4NXBA 2J9OA 1JVJA 2EFXA 2HP6A 2L1MA 5J8XA 4HJ3A 3R7WB 2WYXA 3PBSA 1DJAA 2XFTA 1J9MA 2ZM0A 5DF8A 1Y54A 5E43A 3S22A 5HAQA 4DRTA 3MKEA 3UDIA 5F68A 1CQAA 2VX8A 3HL9A 4B4ZA 1LI9A 2Y2JA 4NXFA 4EU0A 3TJZC 2JKGA 4DXCA 3VOYA 4DE2A 5FQ9A 3C38A 2Y2KA 1W8YA 3A3JA 1K54C 3JVVA 4DDYA 1CI9A 4OH0A
chains in the Genus database with same CATH topology
1BLHA 4KZ7A 4QY6A 4L0LA 2HDUA 3PBOA 1HVBA 4O7DA 3M2KA 5FATA 3NC8A 2IWCA 3UDXA 1KE4A 5KZHA 2B5RA 3UE3A 3FWLA 3TSGA 4X56A 4HBUA 4OP8A 4QHCA 3V5MA 2J7VA 1JTDA 4R3BA 3MXSA 4X55A 3LO7A 1FQGA 4WEKA 2JBFA 3ZGAB 3ZG9B 1FCOA 5CGWA 1K4FA 1YLWA 4DE0A 1I5QA 3IHAA 3IXBA 3SS5A 4WZ5C 2Y59A 1TDGA 4KQOA 3SH9A 2VGJA 1LLBA 2X71A 1RGZA 5CGSA 3OZHA 4M3KA 2ZQ8A 5E2EA 1PW8A 3RXWA 1L0FA 1ERQA 1LI0A 1MWUA 3VFHA 4BENA 4EUZA 1IKIA 1Q2QA 1KGFA 4BL3A 4ZTKA 3QNBA 5DTKA 1I2SA 1XGJA 1M40A 5I94A 3V3RA 4BL2A 3OPRA 3Q7VA 1DJCA 1FSYA 4RVAA 4UHUA 4S2JA 4N9KA 4LCMA 3BLSA 2WGWB 4MBKA 4S2NC 5FI7A 3AGDA 1IKGA 2Q9NA 3NIAA 3Q82A 3Q07A 1MWTA 4MNRA 2XEPA 3FZCA 4KZ9A 3W4OA 3BFFA 3S4XA 3GQZA 1KDWA 4BD0A 3TG9A 4OQHA 5L2FA 1YLZA 4JXWA 1YLTA 4DE3A 4QB8A 3VOZA 3WS4A 4E6XA 2OLUA 3Q1FA 1K6SA 2G2UA 1NYYA 3SS3A 2UWXA 5GL9A 3UPNA 4EBLA 2Y4AA 4KENB 4KG6A 2PU4A 4R4SA 1W8QA 3PTEA 3UPOA 1M6KA 3ZVWA 4LV1A 3VP3A 2ZQ9A 4NK3A 1YLJA 4WMCD 1KVLA 3G4PA 1TEMA 4XUXA 5GLDA 4CJNA 3IWIA 4FSFA 3W4PA 1FSWA 3HUMA 1S0WA 3N8LA 4IVKA 2WK0A 3NCKA 4GB7A 3MFDA 4KZ6A 3SH7A 1CEGA 4QY5A 4KZ3A 4WMCA 1HD8A 1NZUA 1ES2A 4GD6A 2ZM8A 1QMEA 3ZCZA 4BQMA 4UAAA 1NXYA 1YT4A 3PBNA 1K25A 3ZDJA 2EX8A 2J8YA 1E25A 2RL3A 4ZJ1A 4GD8A 2Y2MA 1YQSA 1XA1A 2ZQAA 3IF5A 1IYOA 1L0DA 1PWDA 5CHMA 3HLGA 5EVIC 5HAIA 5CRFA 3UO9A 2ZC4B 4OPQA 2PU2A 1PZPA 4OLDA 1PWCA 4KZ8A 1EROA 5AQAA 3NDGA 1ZG4A 2ZC3B 4K91A 5FI2A 4R23A 3O3VA 2J9PA 4HBTA 1K57C 4KQRA 2Y2NA 3MKFA 4PM6A 4S2KA 2P74A 3HUNA 2Y2HA 5FQKA 5BOHA 1BT5A 1ES4A 1MXOA 1PYYA 4OVDA 5DTSA 5EOOA 1GHPA 5IHVA 5F1FA 2BLSA 4KZAA 4C75A 2OLVA 3DWKA 4DE1A 4OQIA 2ZC7A 3GTCA 1FCNA 1VM1A 1L2SA 3O87A 5A93A 5DVAA 2Y2OA 4C6YA 3WS2A 4S2NA 4FCFA 5GLBA 3HLBA 3VFFA 3IHBA 3BECA 5FAQA 3G35A 2QPNA 2XGNA 4Q8IA 2Y2PA 4WZ4A 3M6BA 4LENA 4GDBA 4UA9A 3M6HA 1Z6FA 4DDSA 4R3JA 5EUAA 3P09A 1DY6A 3E2KA 1GCEA 4S2IA 3UPPA 5JYOA 1ESIA 3GVBA 1MWSA 3DWZA 4GKUA 4GNUA 4DF6A 4JKTA 2R9WA 3IXHA 3Q7ZA 4P0MA 3VSLA 4E3MA 3ZNTA 1WYBA 2HP9A 2V20A 2ZM2A 4OKPA 4WZ5A 3IH8A 4OLGA 2HPBA 4YFMA 3RXXA 1SHVA 1ZC2A 5CHUA 3MXRA 1L0EA 3SS4A 1DJBA 4QU3A 4C3QA 3D4FA 2Y55A 4OONA 4PPRA 4N9LA 2EXBA 5CERA 3OPHA 3V3SA 1O7EA 2WUQA 1KDSA 3QNCA 3G31A 4S2LA 1W79A 3IXGA 3IF6A 4B88A 4RA7A 3ZG5A 1SCWA 4PM5A 3C5AA 3BRMA 5FQIA 4S2OA 1PI4A 3HLCA 1WYCA 4IEDA 4ID4A 5DF9A 1PWGA 2EFUA 1K57A 1XXMA 3SOIA 2ZC5B 5EE8A 1K54A 3A3DA 4ZJ3A 3VP0A 3WRTA 5KSCA 3UNWA 1YMSA 1IYPA 3LY3A 4JF6A 3HLDA 1XA7A 4CPKA 2H5SA 4MLLA 4X68A 4ZAMA 3EQVA 1GHIA 3N8SA 2XFSA 1XP4A 3B3XA 5EVIA 1JTGA 1MBLA 4OOMA 3UE0A 1BSGA 5CTNA 2Y91A 1ZG6A 1QMFA 4JXSA 3PAGA 4WELA 4YINA 4OOLA 1CK3A 2GDNA 1TDLA 2WADA 3ZVTA 4N1XA 4PM7A 4MEZA 2WZXA 5F83A 3VMAA 4DXBA 3I7JA 1TVFA 2ZC6B 1RGYA 2V1ZA 3PAEA 1KE3A 5M1AA 4OOYA 2QMIA 5GHXA 3CZDA 5CHJA 3VP1A 2WAEA 3A3IA 5FAOA 3MZEA 3ZFZA 2A3UA 3PBQA 2ZQDA 3IF6B 2R9XA 1BLCA 1SDEA 2HP5A 3E2LA 1GHMA 4IVIA 4N1HA 4X6TA 1ERMA 2WAFA 4Z9QA 1ONHA 4U3TA 4P87A 3OPPA 4WM9A 4U0XA 2WGWA 1CI9A 5A91A 4EV4A 1AXBA 5EVLA 3C7UA 4EQIA 1ONGA 3HUOA 3G34A 1KGGA 3BFDA 4E6WA 1PW1A 2EXAA 1K38A 4S2MA 3C4PA 1EI5A 3BLMA 4LV3A 5TGFA 4IBRA 4D2OA 3IWQA 4OQGA 2JE5A 2E8IA 5FA7A 4H8RA 1IEMA 1U60A 1NYMA 2ZQ7A 4JLFA 2A49A 2X01A 5FQJA 5E2HA 1YLPA 3BFGA 4ZDXA 3OCNA 1ALQA 3FYZA 1NZOA 1W5DA 3N4IA 3N7WA 5JYPA 1MY8A 4RX3A 5D3OA 5A90A 4F94A 3ZG0A 1MPLA 2XQZA 3V50A 2P9VA 3BYDA 5AQ7A 3S1YA 4NETA 3G2YA 3IXDA 5HX9A 1ESUA 1I2WA 4X53A 1E3UD 1GA9A 1IYQA 1G6AA 1FR1A 1RCJA 4Y7PA 4KG5A 2XDMA 3BEBA 2CC1A 4P85A 3ITBA 3OCLA 2H10A 3BFCA 2FFFB 3VP4A 4JXVA 4PM9A 1HZOA 1YM1A 5FQQA 1E4DA 3LY4A 3BFEA 2IWDA 3WS5A 1MWRA 3LCEA 4E3NA 1L0GA 4Y0UA 1BULA 5F82A 3W8KA 2OSUA 1YLYA 3IF6C 1H8YA 2DNSA 2DCFA 1JWVA 2PBYA 4KQQA 3ITAA 3NI9A 1BTLA 1N9BA 3PBRA 4GN2A 1CEFA 4R0QA 1BLSA 2ZQCA 4GDNA 5EECA 4LV2A 5GHZA 5M19A 5TFQA 3G2ZA 1BZAA 2Q9MA 4OQ0A 2Y2IA 5DF7A 1W7FA 2HDSA 5EVID 4ZBEA 1H8ZA 3ZG7B 2VGKA 3CJMA 1RP5A 4WBGA 1XPBA 3GRJA 4Y0TA 3FKWA 3HLWA 1N4OA 4ZJ2A 4EWFA 4RYEA 4FH2A 1YMXA 3IWOA 3P98A 2EX9A 3ZNYA 1KVMA 4R4RA 3CG5A 2EX6A 3TOIA 3EQUA 1NRFA 4KG2A 4XUZA 5EPHA 2I72A 4X69A 2IWBA 2WZZA 1LL9A 3AGEA 4KZBA 1PIOA 5TR7A 3WRZA 2RCXA 1EWZA 4UA6A 4EBNA 3HLFA 3NY4A 2Y2LA 3W4QA 5FAPA 3ZHHA 3IQAA 3N6IA 1K56D 3LEZA 5CEBA 3PBTA 5E2FA 4OPYA 4E3KA 1O07A 1G68A 1LL5A 3C4OA 5KMWA 3CMZA 3GR2A 1K6RA 2JC7A 1LHYA 3O86A 4PMAA 4PM8A 2WGIA 1KGEA 1GA0A 4QD4A 1CI8A 3QHYA 4R1GA 4WYYA 4HEFA 2V2FF 4JF5A 5HFOA 4UA7A 3GMWA 2WKEA 1BUEA 2X02A 3MZFA 3SH8A 3HVFA 3MZDA 4XXRA 5FI6A 5GLAA 5FDHA 4Y0OA 5GHYA 2OV5A 4E3IA 4OPZA 4K0XA 3GV9A 5HAPA 3G32A 3UN7A 4LV0A 3UE1A 1S6RA 5EVIB 4EBPA 2ZLYA 3OPLA 3A3FA 5DTTA 1HTZA 1VQQA 3O88A 2XD1A 4LCLA 1ES3A 5CXWA 5CTMA 3FKVA 4U0TA 4BJPA 2ZJ9A 5KSHA 4S2PA 2H0TA 1NY0A 2Y2QA 4GOGA 1KE0A 4GZBA 4OP5A 3HREA 2WKIA 1E3UA 1BLPA 4E3OA 5F1GA 3DW0A 2BG1A 4MBHA 4E3LA 4QJGA 5FASA 5AQBA 1K55C 1ES5A 3AGFA 2C6WB 1XX2A 4N92A 2XK1A 5U47A 1H5XA 4P6BA 2Z2LB 1IYSA 3IH9A 3WS0A 4JF4A 4BD1A 2ZMAA 1SDNA 3Q81A 4DDYA 5EOEA 1C3BA 1FR6A 5A92A 2XR0A 2P9VB 1Q2PA 1FOFA 4JXGA 4B4XA 2XLNA 3IT9A 3RJUA 4KZ5A 5HL1A 1JWZA 3NDEA 2XF3A 1SKFA 3Q7VB 1XKZA 4HESA 4A5RA 5M18A 1K4EA 5AQ9A 2J9OA 3OC2A 4MBFA 4JPMA 3M2JA 1JVJA 2G2WA 2EFXA 5E2GA 2HP6A 3G30A 5J8XA 2H0YA 5FSRA 5HARA 2WYXA 2DRWA 1K55A 4OPRA 3WWXA 2HDQA 3PBSA 4FD8A 1DJAA 2XFTA 2ZD8A 1XGIA 1J9MA 3JYIA 5CGXA 4BLMA 2ZM0A 5GLCA 4WEJA 5DF8A 3VSKA 4DKIA 3V39A 1JWPA 2EX2A 4IBXA 1Y54A 1FCMA 3BM6A 3GSGA 5E43A 3S22A 3VP2A 5CECA 5CEDA 4JBFA 3FV7A 5HAQA 4DRTA 1PZOA 1IELA 3N8RA 2JCHA 3MBZA 2FFYA 3MKEA 3UDIA 3WS1A 2XH9A 3ZG8B 2WGVA 4KZ4A 5HW3A 1ZKJA 3DTMA 2Z2MB 3HL9A 1WE4A 4K0WA 3UY6A 4B4ZA 1LI9A 2Y2JA 3NBLA 5FQMA 4E3JA 4FH4A 1MKIA 1NJ4A 3HLEA 4RX2A 2XD5A 3ISGA 1K56A 4DXCA 3VOYA 4DE2A 5FQ9A 3A3EA 3HBRA 1PI5A 2Y2KA 2Y2GA 2C5WB 2HDRA 1W8YA 3A3JA 1K54C 5G18A 3UDFA 1OMEA 3C7VA 2QZ6A 2WKHA 4OH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLH A;  4KZ7 A;  4QY6 A;  4L0L A;  2HDU A;  3PBO A;  1HVB A;  4O7D A;  3M2K A;  5FAT A;  3NC8 A;  2IWC A;  3UDX A;  1KE4 A;  5KZH A;  2B5R A;  3UE3 A;  3FWL A;  3TSG A;  4X56 A;  4HBU A;  4OP8 A;  4QHC A;  3V5M A;  2J7V A;  1JTD A;  4R3B A;  3MXS A;  4X55 A;  3LO7 A;  1FQG A;  4WEK A;  2JBF A;  3ZGA B;  3ZG9 B;  1FCO A;  5CGW A;  1K4F A;  1YLW A;  4DE0 A;  1I5Q A;  3IHA A;  3IXB A;  3SS5 A;  4WZ5 C;  2Y59 A;  1TDG A;  4KQO A;  3SH9 A;  2VGJ A;  1LLB A;  2X71 A;  1RGZ A;  5CGS A;  3OZH A;  4M3K A;  2ZQ8 A;  5E2E A;  1PW8 A;  3RXW A;  1L0F A;  1ERQ A;  1LI0 A;  1MWU A;  3VFH A;  4BEN A;  4EUZ A;  1IKI A;  1Q2Q A;  1KGF A;  4BL3 A;  4ZTK A;  3QNB A;  5DTK A;  1I2S A;  1XGJ A;  1M40 A;  5I94 A;  3V3R A;  4BL2 A;  3OPR A;  3Q7V A;  1DJC A;  1FSY A;  4RVA A;  4UHU A;  4S2J A;  4N9K A;  4LCM A;  3BLS A;  2WGW B;  4MBK A;  4S2N C;  5FI7 A;  3AGD A;  1IKG A;  2Q9N A;  3NIA A;  3Q82 A;  3Q07 A;  1MWT A;  4MNR A;  2XEP A;  3FZC A;  4KZ9 A;  3W4O A;  3BFF A;  3S4X A;  3GQZ A;  1KDW A;  4BD0 A;  3TG9 A;  4OQH A;  5L2F A;  1YLZ A;  4JXW A;  1YLT A;  4DE3 A;  4QB8 A;  3VOZ A;  3WS4 A;  4E6X A;  2OLU A;  3Q1F A;  1K6S A;  2G2U A;  1NYY A;  3SS3 A;  2UWX A;  5GL9 A;  3UPN A;  4EBL A;  2Y4A A;  4KEN B;  4KG6 A;  2PU4 A;  4R4S A;  1W8Q A;  3PTE A;  3UPO A;  1M6K A;  3ZVW A;  4LV1 A;  3VP3 A;  2ZQ9 A;  4NK3 A;  1YLJ A;  4WMC D;  1KVL A;  3G4P A;  1TEM A;  4XUX A;  5GLD A;  4CJN A;  3IWI A;  4FSF A;  3W4P A;  1FSW A;  3HUM A;  1S0W A;  3N8L A;  4IVK A;  2WK0 A;  3NCK A;  4GB7 A;  3MFD A;  4KZ6 A;  3SH7 A;  1CEG A;  4QY5 A;  4KZ3 A;  4WMC A;  1HD8 A;  1NZU A;  1ES2 A;  4GD6 A;  2ZM8 A;  1QME A;  3ZCZ A;  4BQM A;  4UAA A;  1NXY A;  1YT4 A;  3PBN A;  1K25 A;  3ZDJ A;  2EX8 A;  2J8Y A;  1E25 A;  2RL3 A;  4ZJ1 A;  4GD8 A;  2Y2M A;  1YQS A;  1XA1 A;  2ZQA A;  3IF5 A;  1IYO A;  1L0D A;  1PWD A;  5CHM A;  3HLG A;  5EVI C;  5HAI A;  5CRF A;  3UO9 A;  2ZC4 B;  4OPQ A;  2PU2 A;  1PZP A;  4OLD A;  1PWC A;  4KZ8 A;  1ERO A;  5AQA A;  3NDG A;  1ZG4 A;  2ZC3 B;  4K91 A;  5FI2 A;  4R23 A;  3O3V A;  2J9P A;  4HBT A;  1K57 C;  4KQR A;  2Y2N A;  3MKF A;  4PM6 A;  4S2K A;  2P74 A;  3HUN A;  2Y2H A;  5FQK A;  5BOH A;  1BT5 A;  1ES4 A;  1MXO A;  1PYY A;  4OVD A;  5DTS A;  5EOO A;  1GHP A;  5IHV A;  5F1F A;  2BLS A;  4KZA A;  4C75 A;  2OLV A;  3DWK A;  4DE1 A;  4OQI A;  2ZC7 A;  3GTC A;  1FCN A;  1VM1 A;  1L2S A;  3O87 A;  5A93 A;  5DVA A;  2Y2O A;  4C6Y A;  3WS2 A;  4S2N A;  4FCF A;  5GLB A;  3HLB A;  3VFF A;  3IHB A;  3BEC A;  5FAQ A;  3G35 A;  2QPN A;  2XGN A;  4Q8I A;  2Y2P A;  4WZ4 A;  3M6B A;  4LEN A;  4GDB A;  4UA9 A;  3M6H A;  1Z6F A;  4DDS A;  4R3J A;  5EUA A;  3P09 A;  1DY6 A;  3E2K A;  1GCE A;  4S2I A;  3UPP A;  5JYO A;  1ESI A;  3GVB A;  1MWS A;  3DWZ A;  4GKU A;  4GNU A;  4DF6 A;  4JKT A;  2R9W A;  3IXH A;  3Q7Z A;  4P0M A;  3VSL A;  4E3M A;  3ZNT A;  1WYB A;  2HP9 A;  2V20 A;  2ZM2 A;  4OKP A;  4WZ5 A;  3IH8 A;  4OLG A;  2HPB A;  4YFM A;  3RXX A;  1SHV A;  1ZC2 A;  5CHU A;  3MXR A;  1L0E A;  3SS4 A;  1DJB A;  4QU3 A;  4C3Q A;  3D4F A;  2Y55 A;  4OON A;  4PPR A;  4N9L A;  2EXB A;  5CER A;  3OPH A;  3V3S A;  1O7E A;  2WUQ A;  1KDS A;  3QNC A;  3G31 A;  4S2L A;  1W79 A;  3IXG A;  3IF6 A;  4B88 A;  4RA7 A;  3ZG5 A;  1SCW A;  4PM5 A;  3C5A A;  3BRM A;  5FQI A;  4S2O A;  1PI4 A;  3HLC A;  1WYC A;  4IED A;  4ID4 A;  5DF9 A;  1PWG A;  2EFU A;  1K57 A;  1XXM A;  3SOI A;  2ZC5 B;  5EE8 A;  1K54 A;  3A3D A;  4ZJ3 A;  3VP0 A;  3WRT A;  5KSC A;  3UNW A;  1YMS A;  1IYP A;  3LY3 A;  4JF6 A;  3HLD A;  1XA7 A;  4CPK A;  2H5S A;  4MLL A;  4X68 A;  4ZAM A;  3EQV A;  1GHI A;  3N8S A;  2XFS A;  1XP4 A;  3B3X A;  5EVI A;  1JTG A;  1MBL A;  4OOM A;  3UE0 A;  1BSG A;  5CTN A;  2Y91 A;  1ZG6 A;  1QMF A;  4JXS A;  3PAG A;  4WEL A;  4YIN A;  4OOL A;  1CK3 A;  2GDN A;  1TDL A;  2WAD A;  3ZVT A;  4N1X A;  4PM7 A;  4MEZ A;  2WZX A;  5F83 A;  3VMA A;  4DXB A;  3I7J A;  1TVF A;  2ZC6 B;  1RGY A;  2V1Z A;  3PAE A;  1KE3 A;  5M1A A;  4OOY A;  2QMI A;  5GHX A;  3CZD A;  5CHJ A;  3VP1 A;  2WAE A;  3A3I A;  5FAO A;  3MZE A;  3ZFZ A;  2A3U A;  3PBQ A;  2ZQD A;  3IF6 B;  2R9X A;  1BLC A;  1SDE A;  2HP5 A;  3E2L A;  1GHM A;  4IVI A;  4N1H A;  4X6T A;  1ERM A;  2WAF A;  4Z9Q A;  1ONH A;  4U3T A;  4P87 A;  3OPP A;  4WM9 A;  4U0X A;  2WGW A;  1CI9 A;  5A91 A;  4EV4 A;  1AXB A;  5EVL A;  3C7U A;  4EQI A;  1ONG A;  3HUO A;  3G34 A;  1KGG A;  3BFD A;  4E6W A;  1PW1 A;  2EXA A;  1K38 A;  4S2M A;  3C4P A;  1EI5 A;  3BLM A;  4LV3 A;  5TGF A;  4IBR A;  4D2O A;  3IWQ A;  4OQG A;  2JE5 A;  2E8I A;  5FA7 A;  4H8R A;  1IEM A;  1U60 A;  1NYM A;  2ZQ7 A;  4JLF A;  2A49 A;  2X01 A;  5FQJ A;  5E2H A;  1YLP A;  3BFG A;  4ZDX A;  3OCN A;  1ALQ A;  3FYZ A;  1NZO A;  1W5D A;  3N4I A;  3N7W A;  5JYP A;  1MY8 A;  4RX3 A;  5D3O A;  5A90 A;  4F94 A;  3ZG0 A;  1MPL A;  2XQZ A;  3V50 A;  2P9V A;  3BYD A;  5AQ7 A;  3S1Y A;  4NET A;  3G2Y A;  3IXD A;  5HX9 A;  1ESU A;  1I2W A;  4X53 A;  1E3U D;  1GA9 A;  1IYQ A;  1G6A A;  1FR1 A;  1RCJ A;  4Y7P A;  4KG5 A;  2XDM A;  3BEB A;  2CC1 A;  4P85 A;  3ITB A;  3OCL A;  2H10 A;  3BFC A;  2FFF B;  3VP4 A;  4JXV A;  4PM9 A;  1HZO A;  1YM1 A;  5FQQ A;  1E4D A;  3LY4 A;  3BFE A;  2IWD A;  3WS5 A;  1MWR A;  3LCE A;  4E3N A;  1L0G A;  4Y0U A;  1BUL A;  5F82 A;  3W8K A;  2OSU A;  1YLY A;  3IF6 C;  1H8Y A;  2DNS A;  2DCF A;  1JWV A;  2PBY A;  4KQQ A;  3ITA A;  3NI9 A;  1BTL A;  1N9B A;  3PBR A;  4GN2 A;  1CEF A;  4R0Q A;  1BLS A;  2ZQC A;  4GDN A;  5EEC A;  4LV2 A;  5GHZ A;  5M19 A;  5TFQ A;  3G2Z A;  1BZA A;  2Q9M A;  4OQ0 A;  2Y2I A;  5DF7 A;  1W7F A;  2HDS A;  5EVI D;  4ZBE A;  1H8Z A;  3ZG7 B;  2VGK A;  3CJM A;  1RP5 A;  4WBG A;  1XPB A;  3GRJ A;  4Y0T A;  3FKW A;  3HLW A;  1N4O A;  4ZJ2 A;  4EWF A;  4RYE A;  4FH2 A;  1YMX A;  3IWO A;  3P98 A;  2EX9 A;  3ZNY A;  1KVM A;  4R4R A;  3CG5 A;  2EX6 A;  3TOI A;  3EQU A;  1NRF A;  4KG2 A;  4XUZ A;  5EPH A;  2I72 A;  4X69 A;  2IWB A;  2WZZ A;  1LL9 A;  3AGE A;  4KZB A;  1PIO A;  5TR7 A;  3WRZ A;  2RCX A;  1EWZ A;  4UA6 A;  4EBN A;  3HLF A;  3NY4 A;  2Y2L A;  3W4Q A;  5FAP A;  3ZHH A;  3IQA A;  3N6I A;  1K56 D;  3LEZ A;  5CEB A;  3PBT A;  5E2F A;  4OPY A;  4E3K A;  1O07 A;  1G68 A;  1LL5 A;  3C4O A;  5KMW A;  3CMZ A;  3GR2 A;  1K6R A;  2JC7 A;  1LHY A;  3O86 A;  4PMA A;  4PM8 A;  2WGI A;  1KGE A;  1GA0 A;  4QD4 A;  1CI8 A;  3QHY A;  4R1G A;  4WYY A;  4HEF A;  2V2F F;  4JF5 A;  5HFO A;  4UA7 A;  3GMW A;  2WKE A;  1BUE A;  2X02 A;  3MZF A;  3SH8 A;  3HVF A;  3MZD A;  4XXR A;  5FI6 A;  5GLA A;  5FDH A;  4Y0O A;  5GHY A;  2OV5 A;  4E3I A;  4OPZ A;  4K0X A;  3GV9 A;  5HAP A;  3G32 A;  3UN7 A;  4LV0 A;  3UE1 A;  1S6R A;  5EVI B;  4EBP A;  2ZLY A;  3OPL A;  3A3F A;  5DTT A;  1HTZ A;  1VQQ A;  3O88 A;  2XD1 A;  4LCL A;  1ES3 A;  5CXW A;  5CTM A;  3FKV A;  4U0T A;  4BJP A;  2ZJ9 A;  5KSH A;  4S2P A;  2H0T A;  1NY0 A;  2Y2Q A;  4GOG A;  1KE0 A;  4GZB A;  4OP5 A;  3HRE A;  2WKI A;  1E3U A;  1BLP A;  4E3O A;  5F1G A;  3DW0 A;  2BG1 A;  4MBH A;  4E3L A;  4QJG A;  5FAS A;  5AQB A;  1K55 C;  1ES5 A;  3AGF A;  2C6W B;  1XX2 A;  4N92 A;  2XK1 A;  5U47 A;  1H5X A;  4P6B A;  2Z2L B;  1IYS A;  3IH9 A;  3WS0 A;  4JF4 A;  4BD1 A;  2ZMA A;  1SDN A;  3Q81 A;  4DDY A;  5EOE A;  1C3B A;  1FR6 A;  5A92 A;  2XR0 A;  2P9V B;  1Q2P A;  1FOF A;  4JXG A;  4B4X A;  2XLN A;  3IT9 A;  3RJU A;  4KZ5 A;  5HL1 A;  1JWZ A;  3NDE A;  2XF3 A;  1SKF A;  3Q7V B;  1XKZ A;  4HES A;  4A5R A;  5M18 A;  1K4E A;  5AQ9 A;  2J9O A;  3OC2 A;  4MBF A;  4JPM A;  3M2J A;  1JVJ A;  2G2W A;  2EFX A;  5E2G A;  2HP6 A;  3G30 A;  5J8X A;  2H0Y A;  5FSR A;  5HAR A;  2WYX A;  2DRW A;  1K55 A;  4OPR A;  3WWX A;  2HDQ A;  3PBS A;  4FD8 A;  1DJA A;  2XFT A;  2ZD8 A;  1XGI A;  1J9M A;  3JYI A;  5CGX A;  4BLM A;  2ZM0 A;  5GLC A;  4WEJ A;  5DF8 A;  3VSK A;  4DKI A;  3V39 A;  1JWP A;  2EX2 A;  4IBX A;  1Y54 A;  1FCM A;  3BM6 A;  3GSG A;  5E43 A;  3S22 A;  3VP2 A;  5CEC A;  5CED A;  4JBF A;  3FV7 A;  5HAQ A;  4DRT A;  1PZO A;  1IEL A;  3N8R A;  2JCH A;  3MBZ A;  2FFY A;  3MKE A;  3UDI A;  3WS1 A;  2XH9 A;  3ZG8 B;  2WGV A;  4KZ4 A;  5HW3 A;  1ZKJ A;  3DTM A;  2Z2M B;  3HL9 A;  1WE4 A;  4K0W A;  3UY6 A;  4B4Z A;  1LI9 A;  2Y2J A;  3NBL A;  5FQM A;  4E3J A;  4FH4 A;  1MKI A;  1NJ4 A;  3HLE A;  4RX2 A;  2XD5 A;  3ISG A;  1K56 A;  4DXC A;  3VOY A;  4DE2 A;  5FQ9 A;  3A3E A;  3HBR A;  1PI5 A;  2Y2K A;  2Y2G A;  2C5W B;  2HDR A;  1W8Y A;  3A3J A;  1K54 C;  5G18 A;  3UDF A;  1OME A;  3C7V A;  2QZ6 A;  2WKH A;  4OH0 A; 
#chains in the Genus database with same CATH topology
 3UB5 P;  5L07 A;  1BLH A;  4KZ7 A;  4II7 A;  2WKP A;  1HVB A;  4O7D A;  5FAT A;  1KE4 A;  2XSS A;  2ZMV A;  1L3L A;  1GSW A;  2JKF A;  4R3B A;  4I3J A;  3P7N A;  2JBF A;  5CGW A;  1K4F A;  3JPU A;  1I5Q A;  3IHA A;  2O9B A;  2A24 A;  5HD3 A;  1PW8 A;  1CF0 A;  1LI0 A;  1IKI A;  1Q2Q A;  1KGF A;  4BL3 A;  5I94 A;  1VB6 A;  3V3R A;  1DJC A;  4RVA A;  4EES A;  4S2J A;  4I3A A;  2WGW B;  4MBK A;  1SKO A;  4EXO A;  3AGD A;  2Q9N A;  3NIA A;  3Q82 A;  2XEP A;  3SZT A;  2K2N A;  4JXW A;  3LIB A;  3WS4 A;  1DRM A;  4X1L A;  3Q1F A;  3SS3 A;  5HD5 A;  5GL9 A;  3UPN A;  4KEN B;  3LIE A;  4LV1 A;  4NK3 A;  1YLJ A;  4FSF A;  4F3L A;  1FSW A;  4IVK A;  4LLO B;  3NCK A;  4GB7 A;  1G28 A;  3MFD A;  3EGD C;  2WKR A;  1CEG A;  3F1P B;  4GS9 A;  4KZ3 A;  4QY5 A;  2ZM8 A;  4R38 A;  1K25 A;  1E25 A;  1PWD A;  3T4O A;  3HLG A;  3VV4 A;  1DP6 A;  3OLO A;  4OPQ A;  4OLD A;  4KZ8 A;  4K91 A;  2QHK A;  4R23 A;  3O3V A;  4KQR A;  4ZRR A;  3MKF A;  2ZL1 B;  2P74 A;  5HWV A;  1OT6 A;  3LI8 A;  1MXO A;  3S7N A;  4OVD A;  3U2A A;  2QJ5 A;  2ZC7 A;  3CUE A;  3O87 A;  3NOU C;  5DVA A;  3VFF A;  5GLB A;  3HLB A;  5HSQ A;  3A0R A;  1GSV A;  2B18 A;  2A2L A;  2Y2P A;  3M6B A;  4LEN A;  1T1B A;  2VA0 A;  4UA9 A;  3T1S A;  1G5U A;  4R3J A;  5EUA A;  2JHE A;  1ESI A;  3GVB A;  1MWS A;  3DWZ A;  4GKU A;  4DF6 A;  4JKT A;  2HF6 A;  2JN7 A;  2O9C A;  4P0M A;  3R7W A;  1J3W A;  1N9L A;  1WYB A;  4EET B;  2ZM2 A;  4OKP A;  4R6L A;  4OLG A;  3H7W B;  1SHV A;  4WN5 A;  4NEE D;  4C3Q A;  4PPR A;  2W1R A;  2EXB A;  4N9L A;  4CQH A;  2V1B A;  3QNC A;  1W79 A;  3IF6 A;  1SCW A;  3C5A A;  3K3C A;  3LIF A;  2PAV P;  3HLC A;  4NG2 A;  1K57 A;  1XXM A;  2M7V A;  5EE8 A;  3KSI A;  1Y4O A;  3UNW A;  1S4S A;  4I5S A;  2H5S A;  4ZAM A;  3EQV A;  4RQ9 A;  1GHI A;  3N8S A;  1V9Y A;  1JTG A;  5CTN A;  2Y91 A;  1ZG6 A;  3H82 B;  1AWI A;  1VET A;  5HWW A;  5L09 A;  4WEL A;  4YIN A;  1TDL A;  3A0S A;  1GSX A;  3I7J A;  3PAE A;  5M1A A;  5EM1 A;  3VP1 A;  3R4K A;  3TRC A;  3MZE A;  4MDZ A;  1D7E A;  2HP5 A;  2G7U A;  5FL3 A;  2PYP A;  2QWS A;  4P87 A;  2VK3 A;  4U0X A;  5AJG A;  2WGW A;  4EV4 A;  1AXB A;  2QYB A;  3C7U A;  5EVL A;  2QJ7 A;  3OBF A;  1KGG A;  4E6W A;  3UB8 A;  3H9W A;  3B33 A;  1K38 A;  3U4L P;  4LV3 A;  1OJ5 A;  4OQG A;  1K0K A;  3F1N B;  2E8I A;  2ZL1 A;  2PHY A;  4JLF A;  2A49 A;  5TJJ A;  3S7P A;  5JYP A;  3N4I A;  2YKH A;  1MY8 A;  4RX3 A;  5D3O A;  2PBD P;  1MPL A;  2P9V A;  4NET A;  1XJ2 A;  3G2Y A;  3IXD A;  5HX9 A;  1FIL A;  1I2W A;  1E3U D;  1G6A A;  3VE4 A;  3LR0 A;  4Y7P A;  2XDM A;  3BEB A;  3UME A;  1OTD A;  3VOL A;  1HZO A;  5FQQ A;  3LY4 A;  2IWD A;  5AVF A;  4Y0U A;  1YLY A;  3FPV A;  1JWV A;  4KQQ A;  4P6Z S;  1ZTU A;  3ITA A;  3PBR A;  3UB7 A;  2WKQ A;  1BLS A;  2Z6D A;  2KX6 A;  5DF7 A;  4L9F A;  3GRJ A;  4ZJ2 A;  3S7Q A;  4RYE A;  4FH2 A;  3BQ8 A;  2JKR M;  1P9R A;  3ZNY A;  5IT5 A;  4XUZ A;  5EPH A;  2I72 A;  2IWB A;  4IUK A;  3WRZ A;  1IOU A;  1TF1 A;  1KOU A;  3W4Q A;  1T1C A;  3IQA A;  3T4K A;  4HY8 A;  5G4Y A;  3UB9 A;  4OPY A;  3MFX A;  2PD7 A;  3FG8 A;  2JC7 A;  4QD4 A;  3K3D A;  2V2F F;  4UA7 A;  1WA9 A;  2HZ5 A;  3MZD A;  1H3Q A;  4XXR A;  5FI6 A;  3EWK A;  3G32 A;  3UN7 A;  4LV0 A;  4O01 A;  1S6R A;  5EVI B;  2L0W A;  3CIT A;  3HJI A;  2UV0 E;  3OPL A;  5DTT A;  4Y13 A;  3ULF A;  5CXW A;  3FKV A;  5FDS A;  1KE0 A;  4OP5 A;  2WKI A;  1E3U A;  5AQB A;  3AGF A;  4G3V A;  4H6J A;  3IBJ A;  3CI6 A;  1XX2 A;  1H5X A;  3T4J A;  4HH3 A;  3Q81 A;  5EOE A;  3FC7 A;  2GJ3 A;  4FUW A;  1FOF A;  4NXE A;  3IT9 A;  4KZ5 A;  4A5R A;  1K4E A;  5AQ9 A;  4Y17 A;  2M1C A;  2Z6C A;  5CX7 A;  4Q0H A;  3G30 A;  2O0Y A;  3F1N A;  1N9O A;  4HP9 A;  4FD8 A;  2V9A A;  4CLC A;  3VSK A;  1JWP A;  1FCM A;  3BM6 A;  3VP2 A;  5CEC A;  3N8R A;  3MBZ A;  2FFY A;  3PR6 A;  4YWZ A;  3WS1 A;  2PD8 A;  3ZG8 B;  2WGV A;  3DTM A;  3UY6 A;  3NBL A;  1NJ4 A;  4O8G A;  2JKR I;  4ARZ B;  4RX2 A;  3ISG A;  3T1Q B;  4XT2 A;  2PU4 A;  2ZQ9 A;  5DFY A;  4QY6 A;  2ACG A;  3M2K A;  3T4T A;  3NC8 A;  3UDX A;  2B5R A;  4X56 A;  4OP8 A;  1F98 A;  1JTD A;  3EGX C;  1UGU A;  4WEK A;  1FCO A;  1YLW A;  4WZ5 C;  4BMW A;  1TDG A;  4KQO A;  3SH9 A;  2GZA A;  4WL9 A;  3OZH A;  2ZQ8 A;  3RXW A;  1L0F A;  3QNB A;  1I2S A;  3G6O A;  2W1T A;  3Q7V A;  4UHU A;  3C2W A;  4WLA A;  3B47 A;  3RH8 B;  5A8B A;  4LCM A;  4MNR A;  3Q07 A;  3CUE C;  2BTF P;  4KZ9 A;  3W4O A;  3BFF A;  3S4X A;  3GQZ A;  1KDW A;  4DE3 A;  4GW9 A;  2UWX A;  4EBL A;  2Y4A A;  4KG6 A;  5TBM A;  3HCY A;  1M6K A;  1KVL A;  4XUX A;  1TEM A;  5GLD A;  4CJN A;  2VLG A;  3HUM A;  2J3T D;  2WK0 A;  4AFI A;  2KLI A;  4DJ2 A;  5HPI A;  4KZ6 A;  3SH7 A;  1HD8 A;  1NZU A;  2OAP 1;  3IS2 A;  3BQA A;  1QME A;  4GD6 A;  1UWN X;  5EM0 A;  1YT4 A;  2EX8 A;  4ZJ1 A;  4GD8 A;  1L0D A;  5EVI C;  5CRF A;  4WUJ A;  2PU2 A;  2W3F A;  3H7W A;  4LRZ E;  3VE3 A;  4S2K A;  2P7J A;  5FQK A;  1BT5 A;  2PYR A;  5EOO A;  1GHP A;  3DWK A;  2J80 A;  1VM1 A;  3DBA A;  4UEY A;  2FZ0 A;  5FAQ A;  2QPN A;  2XGN A;  4WZ4 A;  2VV8 A;  3PHY A;  1Z6F A;  4DDS A;  1YSQ A;  4S2I A;  3E2K A;  1GCE A;  5JYO A;  1N9N A;  2ZMF A;  4GNU A;  5J3W A;  2OOL A;  3VSL A;  3IXH A;  4E3M A;  3Q7Z A;  3ZNT A;  4X25 A;  3RXX A;  2HPB A;  4G3K A;  5F69 A;  4NXG A;  3SS4 A;  3NOT C;  3KSG A;  4QU3 A;  4L9E A;  4KQD A;  1ODV A;  1KDS A;  4S2L A;  4B88 A;  3IXG A;  3BRM A;  5FQI A;  4LGW A;  1NWZ A;  4ID4 A;  5DF9 A;  3SOI A;  3LEQ A;  3B42 A;  3A3D A;  3WRT A;  2W1T B;  3LY3 A;  2XFS A;  1XP4 A;  5EVI A;  4OOM A;  3UE0 A;  1QMF A;  3A0V A;  5HDS A;  3E4P A;  3T12 B;  3LI9 A;  3ZVT A;  5EVE A;  2WZX A;  5F83 A;  4DXB A;  3NJA A;  3CZD A;  5CHJ A;  2A3U A;  3PBQ A;  2NUT C;  1BLC A;  1SDE A;  1GHM A;  1TD5 A;  4IVI A;  4X6T A;  1ERM A;  4Z9Q A;  4U3T A;  4WM9 A;  5A91 A;  1MKM A;  1ONG A;  2PR6 A;  2O9A A;  3BFD A;  1PW1 A;  4HJ6 A;  5DKL A;  1P0Z A;  4S2M A;  4DN0 A;  4IBR A;  4QWO A;  4EQ1 A;  1T19 A;  2FH5 A;  5FA7 A;  1H8M A;  2ZQ7 A;  5FQJ A;  1YLP A;  4ZDX A;  4ETX A;  3OCN A;  1F2K A;  3V50 A;  1GA9 A;  4DJ3 A;  3LID A;  1RCJ A;  4FOF A;  3ITB A;  3RTY A;  2FFF B;  4JXV A;  2O99 A;  2ZBB A;  2V1A A;  4IUH A;  3L7H A;  1MWR A;  4E3N A;  1BUL A;  1T1A A;  3OOV A;  2DNS A;  2PBY A;  2PR5 A;  4GN2 A;  2VGL S;  1CEF A;  4R0Q A;  5F5Y A;  5EFW A;  5GHZ A;  5EEC A;  4LV2 A;  5M19 A;  5TFQ A;  3G2Z A;  2VZW A;  1H8Z A;  3CJM A;  1RP5 A;  2EWV A;  3FKW A;  3HLW A;  1V9Z A;  4EWF A;  5AVE A;  3P98 A;  2EX9 A;  3MJQ A;  1S1Y A;  3MQ0 A;  3LYX A;  3TOI A;  4KG2 A;  5TR7 A;  1VET B;  3S7O A;  2Y2L A;  3DTE A;  3N6I A;  1K56 D;  5CEB A;  3C4O A;  5L10 A;  4R1G A;  4HEF A;  1ACF A;  1BUE A;  2X02 A;  5GLA A;  3IX4 A;  1F5M A;  4OPZ A;  4K0X A;  4CLC E;  3GV9 A;  4EBP A;  3LIA A;  1VQQ A;  2VKS A;  3O88 A;  1ES3 A;  2VV6 A;  3LFV A;  1NY0 A;  2Y2Q A;  4GZB A;  5LBR A;  5F1G A;  3DW0 A;  5FAS A;  3KYQ A;  5DKK A;  2DMW A;  1TS7 A;  4N92 A;  2XK1 A;  4P6B A;  1XJ6 A;  4BD1 A;  2ZMA A;  4BBV A;  4R3A A;  2W3G A;  1FR6 A;  2P9V B;  1Q2P A;  1EW0 A;  3RJU A;  3LR4 A;  1JWZ A;  1YSP A;  1SKF A;  5M18 A;  2ZOH A;  3OC2 A;  4MBF A;  4JPM A;  3M2J A;  5MC7 A;  4R70 A;  2W0N A;  5DJT A;  5E2G A;  1VEU B;  5FSR A;  2DRW A;  1K55 A;  1W63 Q;  3JYI A;  5GLC A;  4WEJ A;  4DKI A;  3V39 A;  2K31 A;  3KYE A;  4JBF A;  2JKT I;  5G4Z A;  1IEL A;  2YKF A;  3CPT B;  3F1O A;  4KZ4 A;  5HW3 A;  2Z2M B;  4K0W A;  4E3J A;  4FH4 A;  4GS9 B;  2VJW A;  4X1M A;  2XD5 A;  1K56 A;  3LR5 A;  4MCW A;  2CMN A;  3A3E A;  3HBR A;  2C5W B;  3UE6 A;  2HDR A;  3C7V A;  2QZ6 A;  1OTI A;  1YAX A;  4HJ4 A;  4JGO A;  3NEC A;  3PBO A;  2IWC A;  3UE3 A;  4BBU A;  3FWL A;  4HP4 A;  1OTA A;  3GDI A;  4HBU A;  3V5M A;  2J7V A;  3MXS A;  1DP9 A;  1FQG A;  3ZGA B;  3ZG9 B;  2LB5 A;  3QP8 A;  4MN6 A;  4DE0 A;  4MMN A;  3SS5 A;  3O5Y A;  2Y59 A;  2VGJ A;  3F1P A;  4EUV A;  5CGS A;  4M3K A;  5E2E A;  1XJ4 A;  1MWU A;  2LB9 A;  4EUZ A;  4BEN A;  4ZTK A;  1FIK A;  1TS8 A;  3RFB A;  4BL2 A;  2E8J A;  2XRO A;  4PKY G;  4KUK A;  4N9K A;  3BLS A;  4I38 A;  4S2N C;  5DJU A;  5FI7 A;  2INW A;  1MWT A;  5HWT A;  4BD0 A;  3TG9 A;  5L2F A;  2OWH A;  4QB8 A;  2HJ9 C;  3C30 A;  2Q0O A;  1K6S A;  2G2U A;  3UPO A;  4CLC B;  4R4S A;  1W8Q A;  3GEC A;  3N8L A;  4WMC A;  3ZCZ A;  4ARZ A;  4BQM A;  2V8C A;  1NXY A;  3PBN A;  4L9G A;  2Y2M A;  1YQS A;  1IYO A;  1S67 L;  5HAI A;  1PWC A;  1ERO A;  5AQA A;  3NDG A;  1ZG4 A;  1JNU A;  2ZOI A;  2J9P A;  4LPZ A;  1K57 C;  4ME4 A;  2Y2N A;  3HUN A;  1ES4 A;  5DTS A;  3F1O B;  3K2N A;  4C75 A;  3GTC A;  1FCN A;  5HDD A;  4UQI M;  5J7E A;  4C6Y A;  4FCF A;  3IHB A;  3BEC A;  3G35 A;  4LRX C;  4G3W A;  3PXP A;  4Q8I A;  2XA7 M;  3CWF A;  1VEU A;  3P09 A;  1DY6 A;  3UPP A;  2R9W A;  1OPX A;  4YOF A;  2HP9 A;  2V20 A;  4WZ5 A;  3IH8 A;  4KUO A;  3D72 A;  3PYP A;  5CHU A;  1DP8 A;  1L0E A;  1DJB A;  2Y55 A;  3V3S A;  3OPH A;  3CPT A;  2WUQ A;  4PAU A;  4EEP A;  4F3L B;  1H0M A;  4S2O A;  1G6O A;  2V0U A;  1WYC A;  4IED A;  1PWG A;  5FEG A;  3IS2 B;  2ZC5 B;  1LSW A;  2PRF A;  4ZJ3 A;  1OTE A;  1VHM A;  4JF6 A;  3HLD A;  3QP6 A;  4IHQ A;  1XA7 A;  4CPK A;  3B3X A;  1XFN A;  1D06 A;  1MBL A;  3MMH A;  4JXS A;  4OOL A;  3E4Q A;  4Z1W A;  4N1X A;  4PM7 A;  4MEZ A;  1MC0 A;  1LSV A;  2V1Z A;  1KE3 A;  2QMI A;  5GHX A;  5FEF A;  3NOP C;  2QKP A;  3A3I A;  3ZFZ A;  4PKY A;  3EEA A;  2J3T C;  4HH2 A;  2ZQD A;  4EEU A;  3IF6 B;  2HGV A;  3E2L A;  1A0K A;  4N1H A;  2MJ6 A;  1ONH A;  2W27 A;  3OPP A;  1XFQ A;  3HUO A;  4MN7 A;  1NLY A;  1NLZ A;  3MSH A;  3MQQ A;  3KX0 X;  5HL6 A;  2EXA A;  3C4P A;  3IWQ A;  4GHI B;  2JE5 A;  1IEM A;  1XJ3 A;  2X01 A;  5E2H A;  3BFG A;  1NZO A;  1W5D A;  3N7W A;  4F94 A;  3ZG0 A;  2XQZ A;  5AQ7 A;  4HHD A;  3BJN A;  1D1J A;  4I39 A;  3ZQ5 A;  1P97 A;  1E4D A;  2XA7 S;  3WS5 A;  5HPF A;  3LCE A;  3KO6 A;  3IX8 A;  3FPW A;  4JGQ A;  2DCF A;  1BTL A;  1N9B A;  4M4X A;  3E0Y A;  5F6A A;  4GDN A;  1W7F A;  2HDS A;  4ZBE A;  3ZG7 B;  2NUP C;  2VGK A;  3W2Z A;  5K5B A;  4Y0T A;  2GX5 A;  1Z09 A;  3CHW P;  1YMX A;  3IWO A;  3T50 A;  1LL8 A;  4R4R A;  3CG5 A;  2EX6 A;  1NRF A;  1PRQ A;  4X69 A;  2WZZ A;  1LL9 A;  2RCX A;  1EWZ A;  3HLF A;  5FAP A;  1S1Z A;  4YNR A;  2BAS A;  5E2F A;  4E3K A;  1G68 A;  3CMZ A;  1K6R A;  1LHY A;  4Y2F A;  1KGE A;  1GA0 A;  4O0P A;  4B9O A;  3QHY A;  4WYY A;  4JF5 A;  5HFO A;  3GMW A;  4FTX A;  2WKE A;  1STZ A;  3BWL A;  3SH8 A;  3HVF A;  3DAV A;  5GHY A;  2OV5 A;  2ZLY A;  2D02 A;  5HZH A;  2VGL M;  4HOI A;  5L8M A;  4BJP A;  5KSH A;  4S2P A;  2H0T A;  4GOG A;  4HQA A;  2Y8H A;  4MBH A;  2BG1 A;  4E3L A;  4QJG A;  1K55 C;  2C6W B;  4BWI A;  5U47 A;  3QP2 A;  2Z2L B;  3NUL A;  3KYZ A;  1TS0 A;  5A92 A;  2XR0 A;  1P9W A;  2GNX A;  4B4X A;  4HI4 A;  3Q7V B;  4HES A;  1SKO B;  2M7U A;  2H28 A;  2R78 A;  2G2W A;  3T1R A;  5I5L A;  2H0Y A;  5HAR A;  4HNB A;  4OPR A;  3WWX A;  4ESP A;  2EA9 A;  2HDQ A;  2ZD8 A;  5CGX A;  1XGI A;  4BLM A;  4IBX A;  2EX2 A;  3GSG A;  2K7S A;  4Q0J A;  2KDK A;  5CED A;  3FV7 A;  1PZO A;  4Y3I A;  2JCH A;  2XH9 A;  3LR3 A;  4WF0 A;  1ZKJ A;  1WE4 A;  5FQM A;  5EV0 A;  1MKI A;  3HLE A;  3LIC A;  4JGP A;  3CLO A;  1PI5 A;  2Y2G A;  5G18 A;  3UDF A;  1OME A;  3KSH A;  1YPR A;  2WKH A;  2VEA A;  4L0L A;  2HDU A;  5KZH A;  3TSG A;  3D3O A;  4QHC A;  4X55 A;  3LO7 A;  3IXB A;  1LLB A;  2X71 A;  3UMD A;  1RGZ A;  3MF0 A;  1ERQ A;  2XRN A;  3VFH A;  4HIA A;  3T4Q A;  5DTK A;  1XGJ A;  1LT0 A;  1M40 A;  1X0O A;  3KSF A;  3OPR A;  1FSY A;  2B02 A;  1IKG A;  5HDC A;  1ZHH B;  3FZC A;  1PNE A;  1MZU A;  2KOI A;  1YKD A;  4OQH A;  1YLZ A;  1YLT A;  4E04 A;  3VOZ A;  4E6X A;  2OLU A;  4K08 A;  3LGO A;  2L4R A;  1NYY A;  4GCZ A;  5J4E A;  3PTE A;  3ZVW A;  3VP3 A;  4WMC D;  2B95 A;  3G4P A;  3IWI A;  3W4P A;  1S0W A;  2A24 B;  3MXQ A;  1ES2 A;  4UAA A;  3ZDJ A;  1UWP X;  2J8Y A;  2RL3 A;  1XA1 A;  2ZQA A;  3IF5 A;  5CHM A;  3QP4 A;  3DTI A;  3UO9 A;  2ZC4 B;  2P04 A;  1PZP A;  3EEH A;  3E4O A;  3MR0 A;  1BYW A;  2ZC3 B;  5FI2 A;  5IS1 A;  4HBT A;  4LRY C;  4PM6 A;  2AVX A;  4B93 A;  2Y2H A;  5BOH A;  1PYY A;  4I3I A;  5F1F A;  1S4R A;  5IHV A;  2BLS A;  4KZA A;  3DTK A;  2OLV A;  3BY8 A;  2W3H A;  4DE1 A;  4OQI A;  4CLC D;  1NRJ A;  2OAQ 1;  1L2S A;  5A93 A;  2I9V A;  3IBR A;  2Y2O A;  3WS2 A;  4GJ4 A;  4S2N A;  3ZYT A;  5KIZ A;  4PHT A;  4GLQ A;  4GDB A;  3M6H A;  4JGR A;  3HJK A;  3BW6 A;  4YFM A;  2VV7 A;  1ZC2 A;  3MXR A;  3BY9 A;  3D4F A;  4OON A;  5CER A;  3SW1 A;  2IA2 A;  1O7E A;  3G31 A;  2EWW A;  3ICY A;  2HJE A;  4RA7 A;  3ZG5 A;  4PM5 A;  1PFL A;  1PI4 A;  3QP1 A;  2EFU A;  3V67 A;  1K54 A;  2HV1 A;  3VP0 A;  3NHQ A;  5KSC A;  1YMS A;  1IYP A;  1SZV A;  1IFQ A;  3T4S A;  4MLL A;  4X68 A;  1T18 A;  1S66 L;  1BSG A;  3PAG A;  4EER A;  3JVU A;  3MQO A;  1CK3 A;  2GDN A;  4MN5 A;  2WAD A;  3VMA A;  4ETZ A;  1TVF A;  2ZC6 B;  1RGY A;  4OOY A;  1OJG A;  2WAE A;  4LFU A;  5FAO A;  2R9X A;  2OWJ A;  1CJF A;  3QP5 A;  2WAF A;  3LUQ A;  3CAX A;  4EQI A;  5C5K A;  3G34 A;  1EI5 A;  3BLM A;  5TGF A;  2D01 A;  2J3W A;  4D2O A;  4H8R A;  1U60 A;  4DMZ A;  4EW7 A;  4IJG A;  1NYM A;  4H6J B;  3EOI A;  1ALQ A;  4QPR A;  3FYZ A;  1LSX A;  5A90 A;  3E98 A;  2Y79 A;  3T4L A;  3BYD A;  3S1Y A;  4NKP A;  1ESU A;  4X53 A;  2W3D A;  1IYQ A;  1FR1 A;  3C8C A;  4KG5 A;  4P85 A;  2CC1 A;  3OCL A;  2H10 A;  3BFC A;  3VP4 A;  3T1X A;  4PM9 A;  1YM1 A;  3BFE A;  1L0G A;  5F82 A;  3W8K A;  2OSU A;  3IF6 C;  1H8Y A;  3NI9 A;  1OT9 A;  3TE8 A;  2ZQC A;  1BZA A;  2Q9M A;  4OQ0 A;  2Y2I A;  5EVI D;  2JKT M;  4P6Z M;  4WBG A;  1XPB A;  1Y28 A;  4BBT A;  1N4O A;  5IU1 A;  4Q0I A;  4UQI S;  4XT2 B;  2P08 A;  1OTB A;  1KVM A;  3EQU A;  3AGE A;  4KZB A;  1PIO A;  3P01 A;  4EBN A;  4UA6 A;  3NY4 A;  3D9Y A;  3ZHH A;  3UB6 A;  2PDR A;  3LEZ A;  1HLU P;  3PBT A;  4Y15 A;  5DFX A;  1O07 A;  1LL5 A;  5KMW A;  1TS6 A;  3GR2 A;  3O86 A;  4PMA A;  4PM8 A;  2W3E A;  2WGI A;  4Y5F A;  1CI8 A;  2PT7 A;  3IX3 A;  1W63 M;  4D60 A;  3MZF A;  5FDH A;  4Y0O A;  4E3I A;  5HAP A;  3UE1 A;  3TW8 A;  3A3F A;  1HTZ A;  3H82 A;  2XD1 A;  4LCL A;  5CTM A;  4U0T A;  2ZJ9 A;  4CLC C;  4GHI A;  3HRE A;  4E3O A;  1BLP A;  3MS6 A;  1ES5 A;  1F9I A;  5TBM B;  3L9K A;  1IYS A;  3IH9 A;  2V0W A;  4JF4 A;  3WS0 A;  1SDN A;  1C3B A;  2V8F A;  4JXG A;  2XLN A;  5HL1 A;  3NDE A;  2XF3 A;  1XKZ A;  4NXB A;  2J9O A;  1JVJ A;  2EFX A;  2HP6 A;  2L1M A;  5J8X A;  4HJ3 A;  3R7W B;  2WYX A;  3PBS A;  1DJA A;  2XFT A;  1J9M A;  2ZM0 A;  5DF8 A;  1Y54 A;  5E43 A;  3S22 A;  5HAQ A;  4DRT A;  3MKE A;  3UDI A;  5F68 A;  1CQA A;  2VX8 A;  3HL9 A;  4B4Z A;  1LI9 A;  2Y2J A;  4NXF A;  4EU0 A;  3TJZ C;  2JKG A;  4DXC A;  3VOY A;  4DE2 A;  5FQ9 A;  3C38 A;  2Y2K A;  1W8Y A;  3A3J A;  1K54 C;  3JVV A;  4DDY A;  1CI9 A;  4OH0 A; 
#chains in the Genus database with same CATH homology
 1BLH A;  4KZ7 A;  4QY6 A;  4L0L A;  2HDU A;  3PBO A;  1HVB A;  4O7D A;  3M2K A;  5FAT A;  3NC8 A;  2IWC A;  3UDX A;  1KE4 A;  5KZH A;  2B5R A;  3UE3 A;  3FWL A;  3TSG A;  4X56 A;  4HBU A;  4OP8 A;  4QHC A;  3V5M A;  2J7V A;  1JTD A;  4R3B A;  3MXS A;  4X55 A;  3LO7 A;  1FQG A;  4WEK A;  2JBF A;  3ZGA B;  3ZG9 B;  1FCO A;  5CGW A;  1K4F A;  1YLW A;  4DE0 A;  1I5Q A;  3IHA A;  3IXB A;  3SS5 A;  4WZ5 C;  2Y59 A;  1TDG A;  4KQO A;  3SH9 A;  2VGJ A;  1LLB A;  2X71 A;  1RGZ A;  5CGS A;  3OZH A;  4M3K A;  2ZQ8 A;  5E2E A;  1PW8 A;  3RXW A;  1L0F A;  1ERQ A;  1LI0 A;  1MWU A;  3VFH A;  4BEN A;  4EUZ A;  1IKI A;  1Q2Q A;  1KGF A;  4BL3 A;  4ZTK A;  3QNB A;  5DTK A;  1I2S A;  1XGJ A;  1M40 A;  5I94 A;  3V3R A;  4BL2 A;  3OPR A;  3Q7V A;  1DJC A;  1FSY A;  4RVA A;  4UHU A;  4S2J A;  4N9K A;  4LCM A;  3BLS A;  2WGW B;  4MBK A;  4S2N C;  5FI7 A;  3AGD A;  1IKG A;  2Q9N A;  3NIA A;  3Q82 A;  3Q07 A;  1MWT A;  4MNR A;  2XEP A;  3FZC A;  4KZ9 A;  3W4O A;  3BFF A;  3S4X A;  3GQZ A;  1KDW A;  4BD0 A;  3TG9 A;  4OQH A;  5L2F A;  1YLZ A;  4JXW A;  1YLT A;  4DE3 A;  4QB8 A;  3VOZ A;  3WS4 A;  4E6X A;  2OLU A;  3Q1F A;  1K6S A;  2G2U A;  1NYY A;  3SS3 A;  2UWX A;  5GL9 A;  3UPN A;  4EBL A;  2Y4A A;  4KEN B;  4KG6 A;  2PU4 A;  4R4S A;  1W8Q A;  3PTE A;  3UPO A;  1M6K A;  3ZVW A;  4LV1 A;  3VP3 A;  2ZQ9 A;  4NK3 A;  1YLJ A;  4WMC D;  1KVL A;  3G4P A;  1TEM A;  4XUX A;  5GLD A;  4CJN A;  3IWI A;  4FSF A;  3W4P A;  1FSW A;  3HUM A;  1S0W A;  3N8L A;  4IVK A;  2WK0 A;  3NCK A;  4GB7 A;  3MFD A;  4KZ6 A;  3SH7 A;  1CEG A;  4QY5 A;  4KZ3 A;  4WMC A;  1HD8 A;  1NZU A;  1ES2 A;  4GD6 A;  2ZM8 A;  1QME A;  3ZCZ A;  4BQM A;  4UAA A;  1NXY A;  1YT4 A;  3PBN A;  1K25 A;  3ZDJ A;  2EX8 A;  2J8Y A;  1E25 A;  2RL3 A;  4ZJ1 A;  4GD8 A;  2Y2M A;  1YQS A;  1XA1 A;  2ZQA A;  3IF5 A;  1IYO A;  1L0D A;  1PWD A;  5CHM A;  3HLG A;  5EVI C;  5HAI A;  5CRF A;  3UO9 A;  2ZC4 B;  4OPQ A;  2PU2 A;  1PZP A;  4OLD A;  1PWC A;  4KZ8 A;  1ERO A;  5AQA A;  3NDG A;  1ZG4 A;  2ZC3 B;  4K91 A;  5FI2 A;  4R23 A;  3O3V A;  2J9P A;  4HBT A;  1K57 C;  4KQR A;  2Y2N A;  3MKF A;  4PM6 A;  4S2K A;  2P74 A;  3HUN A;  2Y2H A;  5FQK A;  5BOH A;  1BT5 A;  1ES4 A;  1MXO A;  1PYY A;  4OVD A;  5DTS A;  5EOO A;  1GHP A;  5IHV A;  5F1F A;  2BLS A;  4KZA A;  4C75 A;  2OLV A;  3DWK A;  4DE1 A;  4OQI A;  2ZC7 A;  3GTC A;  1FCN A;  1VM1 A;  1L2S A;  3O87 A;  5A93 A;  5DVA A;  2Y2O A;  4C6Y A;  3WS2 A;  4S2N A;  4FCF A;  5GLB A;  3HLB A;  3VFF A;  3IHB A;  3BEC A;  5FAQ A;  3G35 A;  2QPN A;  2XGN A;  4Q8I A;  2Y2P A;  4WZ4 A;  3M6B A;  4LEN A;  4GDB A;  4UA9 A;  3M6H A;  1Z6F A;  4DDS A;  4R3J A;  5EUA A;  3P09 A;  1DY6 A;  3E2K A;  1GCE A;  4S2I A;  3UPP A;  5JYO A;  1ESI A;  3GVB A;  1MWS A;  3DWZ A;  4GKU A;  4GNU A;  4DF6 A;  4JKT A;  2R9W A;  3IXH A;  3Q7Z A;  4P0M A;  3VSL A;  4E3M A;  3ZNT A;  1WYB A;  2HP9 A;  2V20 A;  2ZM2 A;  4OKP A;  4WZ5 A;  3IH8 A;  4OLG A;  2HPB A;  4YFM A;  3RXX A;  1SHV A;  1ZC2 A;  5CHU A;  3MXR A;  1L0E A;  3SS4 A;  1DJB A;  4QU3 A;  4C3Q A;  3D4F A;  2Y55 A;  4OON A;  4PPR A;  4N9L A;  2EXB A;  5CER A;  3OPH A;  3V3S A;  1O7E A;  2WUQ A;  1KDS A;  3QNC A;  3G31 A;  4S2L A;  1W79 A;  3IXG A;  3IF6 A;  4B88 A;  4RA7 A;  3ZG5 A;  1SCW A;  4PM5 A;  3C5A A;  3BRM A;  5FQI A;  4S2O A;  1PI4 A;  3HLC A;  1WYC A;  4IED A;  4ID4 A;  5DF9 A;  1PWG A;  2EFU A;  1K57 A;  1XXM A;  3SOI A;  2ZC5 B;  5EE8 A;  1K54 A;  3A3D A;  4ZJ3 A;  3VP0 A;  3WRT A;  5KSC A;  3UNW A;  1YMS A;  1IYP A;  3LY3 A;  4JF6 A;  3HLD A;  1XA7 A;  4CPK A;  2H5S A;  4MLL A;  4X68 A;  4ZAM A;  3EQV A;  1GHI A;  3N8S A;  2XFS A;  1XP4 A;  3B3X A;  5EVI A;  1JTG A;  1MBL A;  4OOM A;  3UE0 A;  1BSG A;  5CTN A;  2Y91 A;  1ZG6 A;  1QMF A;  4JXS A;  3PAG A;  4WEL A;  4YIN A;  4OOL A;  1CK3 A;  2GDN A;  1TDL A;  2WAD A;  3ZVT A;  4N1X A;  4PM7 A;  4MEZ A;  2WZX A;  5F83 A;  3VMA A;  4DXB A;  3I7J A;  1TVF A;  2ZC6 B;  1RGY A;  2V1Z A;  3PAE A;  1KE3 A;  5M1A A;  4OOY A;  2QMI A;  5GHX A;  3CZD A;  5CHJ A;  3VP1 A;  2WAE A;  3A3I A;  5FAO A;  3MZE A;  3ZFZ A;  2A3U A;  3PBQ A;  2ZQD A;  3IF6 B;  2R9X A;  1BLC A;  1SDE A;  2HP5 A;  3E2L A;  1GHM A;  4IVI A;  4N1H A;  4X6T A;  1ERM A;  2WAF A;  4Z9Q A;  1ONH A;  4U3T A;  4P87 A;  3OPP A;  4WM9 A;  4U0X A;  2WGW A;  1CI9 A;  5A91 A;  4EV4 A;  1AXB A;  5EVL A;  3C7U A;  4EQI A;  1ONG A;  3HUO A;  3G34 A;  1KGG A;  3BFD A;  4E6W A;  1PW1 A;  2EXA A;  1K38 A;  4S2M A;  3C4P A;  1EI5 A;  3BLM A;  4LV3 A;  5TGF A;  4IBR A;  4D2O A;  3IWQ A;  4OQG A;  2JE5 A;  2E8I A;  5FA7 A;  4H8R A;  1IEM A;  1U60 A;  1NYM A;  2ZQ7 A;  4JLF A;  2A49 A;  2X01 A;  5FQJ A;  5E2H A;  1YLP A;  3BFG A;  4ZDX A;  3OCN A;  1ALQ A;  3FYZ A;  1NZO A;  1W5D A;  3N4I A;  3N7W A;  5JYP A;  1MY8 A;  4RX3 A;  5D3O A;  5A90 A;  4F94 A;  3ZG0 A;  1MPL A;  2XQZ A;  3V50 A;  2P9V A;  3BYD A;  5AQ7 A;  3S1Y A;  4NET A;  3G2Y A;  3IXD A;  5HX9 A;  1ESU A;  1I2W A;  4X53 A;  1E3U D;  1GA9 A;  1IYQ A;  1G6A A;  1FR1 A;  1RCJ A;  4Y7P A;  4KG5 A;  2XDM A;  3BEB A;  2CC1 A;  4P85 A;  3ITB A;  3OCL A;  2H10 A;  3BFC A;  2FFF B;  3VP4 A;  4JXV A;  4PM9 A;  1HZO A;  1YM1 A;  5FQQ A;  1E4D A;  3LY4 A;  3BFE A;  2IWD A;  3WS5 A;  1MWR A;  3LCE A;  4E3N A;  1L0G A;  4Y0U A;  1BUL A;  5F82 A;  3W8K A;  2OSU A;  1YLY A;  3IF6 C;  1H8Y A;  2DNS A;  2DCF A;  1JWV A;  2PBY A;  4KQQ A;  3ITA A;  3NI9 A;  1BTL A;  1N9B A;  3PBR A;  4GN2 A;  1CEF A;  4R0Q A;  1BLS A;  2ZQC A;  4GDN A;  5EEC A;  4LV2 A;  5GHZ A;  5M19 A;  5TFQ A;  3G2Z A;  1BZA A;  2Q9M A;  4OQ0 A;  2Y2I A;  5DF7 A;  1W7F A;  2HDS A;  5EVI D;  4ZBE A;  1H8Z A;  3ZG7 B;  2VGK A;  3CJM A;  1RP5 A;  4WBG A;  1XPB A;  3GRJ A;  4Y0T A;  3FKW A;  3HLW A;  1N4O A;  4ZJ2 A;  4EWF A;  4RYE A;  4FH2 A;  1YMX A;  3IWO A;  3P98 A;  2EX9 A;  3ZNY A;  1KVM A;  4R4R A;  3CG5 A;  2EX6 A;  3TOI A;  3EQU A;  1NRF A;  4KG2 A;  4XUZ A;  5EPH A;  2I72 A;  4X69 A;  2IWB A;  2WZZ A;  1LL9 A;  3AGE A;  4KZB A;  1PIO A;  5TR7 A;  3WRZ A;  2RCX A;  1EWZ A;  4UA6 A;  4EBN A;  3HLF A;  3NY4 A;  2Y2L A;  3W4Q A;  5FAP A;  3ZHH A;  3IQA A;  3N6I A;  1K56 D;  3LEZ A;  5CEB A;  3PBT A;  5E2F A;  4OPY A;  4E3K A;  1O07 A;  1G68 A;  1LL5 A;  3C4O A;  5KMW A;  3CMZ A;  3GR2 A;  1K6R A;  2JC7 A;  1LHY A;  3O86 A;  4PMA A;  4PM8 A;  2WGI A;  1KGE A;  1GA0 A;  4QD4 A;  1CI8 A;  3QHY A;  4R1G A;  4WYY A;  4HEF A;  2V2F F;  4JF5 A;  5HFO A;  4UA7 A;  3GMW A;  2WKE A;  1BUE A;  2X02 A;  3MZF A;  3SH8 A;  3HVF A;  3MZD A;  4XXR A;  5FI6 A;  5GLA A;  5FDH A;  4Y0O A;  5GHY A;  2OV5 A;  4E3I A;  4OPZ A;  4K0X A;  3GV9 A;  5HAP A;  3G32 A;  3UN7 A;  4LV0 A;  3UE1 A;  1S6R A;  5EVI B;  4EBP A;  2ZLY A;  3OPL A;  3A3F A;  5DTT A;  1HTZ A;  1VQQ A;  3O88 A;  2XD1 A;  4LCL A;  1ES3 A;  5CXW A;  5CTM A;  3FKV A;  4U0T A;  4BJP A;  2ZJ9 A;  5KSH A;  4S2P A;  2H0T A;  1NY0 A;  2Y2Q A;  4GOG A;  1KE0 A;  4GZB A;  4OP5 A;  3HRE A;  2WKI A;  1E3U A;  1BLP A;  4E3O A;  5F1G A;  3DW0 A;  2BG1 A;  4MBH A;  4E3L A;  4QJG A;  5FAS A;  5AQB A;  1K55 C;  1ES5 A;  3AGF A;  2C6W B;  1XX2 A;  4N92 A;  2XK1 A;  5U47 A;  1H5X A;  4P6B A;  2Z2L B;  1IYS A;  3IH9 A;  3WS0 A;  4JF4 A;  4BD1 A;  2ZMA A;  1SDN A;  3Q81 A;  4DDY A;  5EOE A;  1C3B A;  1FR6 A;  5A92 A;  2XR0 A;  2P9V B;  1Q2P A;  1FOF A;  4JXG A;  4B4X A;  2XLN A;  3IT9 A;  3RJU A;  4KZ5 A;  5HL1 A;  1JWZ A;  3NDE A;  2XF3 A;  1SKF A;  3Q7V B;  1XKZ A;  4HES A;  4A5R A;  5M18 A;  1K4E A;  5AQ9 A;  2J9O A;  3OC2 A;  4MBF A;  4JPM A;  3M2J A;  1JVJ A;  2G2W A;  2EFX A;  5E2G A;  2HP6 A;  3G30 A;  5J8X A;  2H0Y A;  5FSR A;  5HAR A;  2WYX A;  2DRW A;  1K55 A;  4OPR A;  3WWX A;  2HDQ A;  3PBS A;  4FD8 A;  1DJA A;  2XFT A;  2ZD8 A;  1XGI A;  1J9M A;  3JYI A;  5CGX A;  4BLM A;  2ZM0 A;  5GLC A;  4WEJ A;  5DF8 A;  3VSK A;  4DKI A;  3V39 A;  1JWP A;  2EX2 A;  4IBX A;  1Y54 A;  1FCM A;  3BM6 A;  3GSG A;  5E43 A;  3S22 A;  3VP2 A;  5CEC A;  5CED A;  4JBF A;  3FV7 A;  5HAQ A;  4DRT A;  1PZO A;  1IEL A;  3N8R A;  2JCH A;  3MBZ A;  2FFY A;  3MKE A;  3UDI A;  3WS1 A;  2XH9 A;  3ZG8 B;  2WGV A;  4KZ4 A;  5HW3 A;  1ZKJ A;  3DTM A;  2Z2M B;  3HL9 A;  1WE4 A;  4K0W A;  3UY6 A;  4B4Z A;  1LI9 A;  2Y2J A;  3NBL A;  5FQM A;  4E3J A;  4FH4 A;  1MKI A;  1NJ4 A;  3HLE A;  4RX2 A;  2XD5 A;  3ISG A;  1K56 A;  4DXC A;  3VOY A;  4DE2 A;  5FQ9 A;  3A3E A;  3HBR A;  1PI5 A;  2Y2K A;  2Y2G A;  2C5W B;  2HDR A;  1W8Y A;  3A3J A;  1K54 C;  5G18 A;  3UDF A;  1OME A;  3C7V A;  2QZ6 A;  2WKH A;  4OH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...