4RXFA

Fructose-6-phosphate aldolase y131f from e.coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
220
Chain Sequence
HELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPFVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-6-phosphate aldolase 1
publication title Acid Base Catalyst Discriminates between a Fructose 6-Phosphate Aldolase and a Transaldolase
doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 77
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rxfA00
1BTMA 3W72A 2JGYA 2ZRXA 3LXAA 3C2OA 3STCA 3PC0A 3IIOA 2CLMA 2JKPA 1QO2A 3PBUA 1I4NA 1RQEA 5SWUA 4UTIA 4IXHA 1GG0A 3ZWSA 4LVDA 3RLVA 3G8EA 5FEXA 1H1YA 1VS1A 3W22A 3EWWA 3W6YA 1HUVA 2ABAA 3D0CA 3WK0A 4GWEA 1YLVA 1H62A 3DHDA 3O15A 3LHVA 4O15A 4JN6A 5K9XA 3C3NA 2VEPA 4JXCA 3CTLA 3EX1A 1EPXA 1SW3A 4JX4A 2OT0A 3B0VC 5F2GA 3P60A 4UMAA 3SZ8A 3JS3A 4YL2A 1L6WA 3GXNA 3O6CA 2ZTKA 3VNDA 1WQ5A 4JTUA 1Z44A 3HMJG 1ME8A 4UTJA 3C8FA 4NXSA 3DI1A 3GDMA 1M7PA 4CQ9A 5K2ZA 1Q3NA 4UTMA 4W9TA 1I2NA 4LRTA 1LRTA 1GEQA 4GFSA 1SO5A 3U6WA 2YCEA 5LNUA 4OV9A 5G2IA 2X1TA 3TDFA 2HS6A 3WJSA 5KINA 3GX9A 4RK8A 1AMKA 4KWWA 3HOJA 2ZRVA 1SO4A 1TTQA 4LVAA 3QJAA 2B4GA 1B57A 4UUIA 2WJZA 3TH6A 4ONVA 5E0KA 3INPA 1LORA 4DO5A 1JVNA 1XUUA 1S5TA 3PULA 3M5VA 2JKAA 1WBHA 3P61A 2V2DA 4OE7A 4ZZ9A 4QIUA 4M6VA 3TQ0A 1GPWA 4X3ZA 5AN7A 5C2XA 2GJLA 4EOUA 4UXDA 1VYPX 3LCLA 5DLCA 1NAL1 5G2HA 1TV7A 2QCNA 2A6LA 3N14A 4O8RA 2WO5A 1ZFJA 2CLOA 1QWGA 5E1QA 5FEZA 3B06A 2A7NA 2NUXA 5TQLA 4UTWA 1JCNA 2DZVA 3G1AA 3W7LA 4AMAA 5I3KA 1B9BA 4IX0A 2J88A 5HR7A 1T96A 5DCDA 3S1UA 3M6YA 3SW6A 3STFA 1JUBA 1LOLA 2H8ZA 5L9FA 4D2JA 3UQNA 1TV5A 1ZHAA 2EHHA 3NEVA 5F4SA 1LYXA 4NXKA 2J9XA 4PH6A 4K36A 3LLDA 4MJZA 3W71A 4BI6A 3W2LA 4I7UA 1FWNA 1EP1A 2Y85A 4LUJA 5H91A 1DV7A 4JX5A 3A9IA 3TSBA 5TBOA 3EB2A 1WV2A 1QPNA 4ADSA 4QAIA 3O6DA 1JQXA 3QM3A 5LNVA 3IIZA 3IVUA 4UFJA 3LTYA 4H4IA 3GDTA 4MKNA 4O13A 4Y8FA 3UWWA 1EP2A 5KZMA 2NWSA 1ICPA 1F7BA 1LCOA 3I68A 3B8DA 1TQXA 3MP5A 2CFFA 1H61A 4OHQA 3T78A 4MY8A 3TMQA 3PVFA 2GQ8A 2H90A 4HNTA 4JTSA 4Y90A 3KFTA 4M5PA 2ZFAA 3GNNA 4CLMA 1PCKA 1ME9A 2QDHA 3B0PA 4UIOA 5C6MA 4AEOA 3R12A 1W5OA 4RZ5A 3KVLA 2C3ZA 3PBVA 1JR1A 4ZMGA 2VKZG 2GPTA 3L21A 4WY0B 2QCDA 2JBMA 3S5YA 2W6RA 4LY8A 1FCVA 3UPWA 2E1DA 4IPIA 4OT7A 3NL3A 3ATYA 3P5ZA 3FIGA 3UXAA 3G1FA 2F7FA 3ABOA 3GDKA 1F76A 1DKWA 2ISWA 2RKXA 3MI2A 1BWKA 4OWGA 3N34A 1D9EA 1KTBA 1W5MA 2ATMA 5LKYA 4GUFA 3TCEA 5J5RA 4N02A 2Q3RA 2DJLA 2LLEA 1XDLA 5K3VA 4YLWA 3T40A 3TAKA 4JR5A 1PL9A 3TA6A 1XCFA 3M9YA 4IQLA 3NQ2A 5H2ZA 3TXVA 3W85A 3NZ1A 1JQVA 1VYRA 4JS3A 3PWAA 1EA0A 4MFEA 4Y96A 3W83A 3BGJA 3TW7A 3E96A 3IIXA 4RCXA 1GYNA 2QUUA 4OBTA 2QCMA 2GJNA 1NFBA 3H53A 4X22A 4XBKA 5LGXA 3KRSA 4FIRA 3YPIA 1NEYA 4NUWA 1K03A 3UXDA 1P0NA 5D2TA 1D3GA 2BTMA 1QOQA 3TQVA 3IGXA 4O1BA 4RX0A 1P5BA 3STGA 2B0MA 1YXCA 2WSQA 1SSGA 2FPTA 2Z1BA 4X9SA 3C2FA 3LV5A 5BMXA 2ZRUA 3MP4A 2NUYA 3QMTA 5D2XA 3S1XA 3C2EA 3NM1A 5KSWA 1G4SA 1K7XA 4N9EA 4PL1A 3PG8A 1YPIA 4KFOA 4QM1A 3U8GA 1HG3A 5G1TA 4XTDA 1AG1O 2NX9A 3GK0A 3P84A 3PBYA 1IXOA 2ATSA 1H7OA 3GXPA 2Q3OA 4O4VA 3S9YA 3O6YX 3E0IA 3W2JA 1TIMA 2FJKA 3GNDA 2P1FA 1EIXA 2WOQA 4MOZA 4GE8A 3LM7A 2I1OA 3E9AA 3E02A 1X1OA 1I8JA 1GVSA 1GTHA 1LBLA 1NF0A 3WK3A 5FF4A 3PY2A 5KITA 4LVGA 1VH7A 1FWRA 2FQIA 4HIBA 1O5KA 3NQFA 3I7SA 4GUJA 4YCPA 1TPC1 3VKJA 5LNWA 4O11A 3W74A 2G5WA 4UTTA 3TV8A 2HSAA 3Q2DA 1OFEA 1AL8A 2B7NA 1M5WA 2ISVA 5IBXA 3CPRA 3KHJA 3L9CA 2VEKA 3F4NA 4Z0JA 5F1UA 4NNBA 1GVRA 2WV8A 1O60A 1SR9A 3BV4A 4IWWA 3EWZA 3E12A 2NZLA 3EWBX 4MLJA 4AHOA 1IXQA 5CPNA 2YFNA 1FCUA 4BR1A 4TMBA 2CU0A 2Z2UA 3PB0A 1U83A 1DL3A 1RD5A 1DOSA 2CWNA 3KRZA 2TYSA 3EX6A 4K7YA 4JTTA 3G22A 1R2TA 3O16A 1ZNNA 4ICNA 2ISSA 3UWVA 1SUXA 4BK9A 1QCWA 3R5EA 1PS9A 4Y9AA 1YDVA 3W1UA 3CC1A 4BF9A 1TREA 3PF3A 3OHIA 2QUVA 2R14A 3W9ZA 1X7FA 3HG3A 4N4PA 2KZHA 4UFHA 1ICQA 3GAKA 4FNUA 1LTDA 4YCOA 2H3DA 1FUYA 3HF3A 3QYQA 4RV8A 2FDSA 4B5NA 3FJLA 1ADOA 2PRLA 1QO5A 5D02A 2PE4A 4J9JA 3NPVA 3PM6A 3W7CA 1RQBA 3IIVA 3GZ3A 4NJJA 3NNTA 3OVPA 5IM51 1FCBA 4JTEA 4E38A 4CQAA 3SGUA 3BW2A 3TJXA 1XL9A 5D09A 4XZ9A 3A22A 3L66A 3LX9A 3HPSA 4NX0A 4XWUA 3OG3A 3QQ1A 4JGDA 2ZBTA 3P81A 1VLIA 1X6UA 4E2BA 3NQMA 4O57A 2PRHA 5HWMA 4PCFA 3DI0A 4K37A 5EBUA 4A29A 3M7WA 3W7NA 1DVJA 3U2OA 3PUOA 1KM1A 2GVJA 4R7JA 2DZXA 4PC8A 3TFCA 1KFBA 3G0SA 4WD0A 5CSRA 4UFMA 3NOEA 1F2JA 3HPZA 5C5YA 1W37A 1W56A 1MZHA 4TO8A 3UY7A 3UWQA 1GTEA 1M7OA 3KVKA 3NZRA 4CNNA 3PSWA 1JUKA 5BRBA 1E51A 4AWTA 3S8HA 4JTKA 4U28A 1H50A 4NJIA 1TTPA 4QISA 3BLIA 3STEA 1SSDA 4RLIA 4JYFA 4JTJA 1KV8A 2YX0A 4I7WA 3OEXA 3Q37A 5D03A 1K8XA 4R33A 3G8RA 5E93A 3HQ1A 1LOSA 4Q4KA 4HNUA 1EUAA 3LLFA 2WNQA 4U4MA 4AWUA 4JY8A 1KM6A 1JUEA 3TSDA 3GDRA 4RJEA 3N3MA 5K4ZA 1GG1A 3MBDA 3W86A 2CZ5A 2QCDB 3JRKA 3TFXA 2Y7DA 1JRBA 4JD4A 2IQTA 3C0JA 1T0OA 4OQVA 3VE9A 3MMTA 1SZEA 5ABTA 3RLUA 1KBIA 4JX6A 4GNJA 1M6JA 5CZJA 2QCHA 2V5LA 2YYTA 2V2CA 1I2OA 1G7UA 4C1LA 3W7KA 4ZQOA 1H1ZA 4UNLA 1HL2A 5LGZA 2R8WA 2YGYA 1Y0EA 1K02A 1H7XA 1X8FA 1ONRA 3KRUA 4HN4A 4RZ6A 2VFFA 4JTLA 1OFOA 2CLHA 3W2MA 1TPFA 1R2SA 3UYCA 4S1FA 1OFBA 1WX0A 1KFJA 1A5AA 1FWSA 1TQJA 1JCLA 1WOBA 1O94A 3CT7A 2TPSA 5CPLA 2R94A 1MO0A 3S1WA 2GQ9A 3W7EA 1TJRA 2G95A 2EPHA 3PUDA 3LXBA 3S1VA 2NXGA 4BI7A 2I14A 3RK8A 3LCHA 5HWJA 5I3FA 3G1VA 2VEMA 1EX5A 4GXMA 2ZQ0A 4GJ1A 4DELA 2VFIA 1GYLA 3L5AA 5D32A 3QPYA 1SFLA 1AW1A 2ZRZA 3R89A 1QPQA 5AC7A 1MXSA 1KW1A 1H7WA 4UNKA 3ZR4A 3QPZA 4MLRA 4E2DA 3HG5A 4K8HA 1GJPA 4XQ6A 2FLIA 3L5LA 3KVJA 3QZEA 4UR8A 1LRNA 3C61A 4LTSA 1BEUA 3F03K 5AYYA 3MUXA 4IXXA 5CGQA 3W1MA 2QDGA 3NYZA 3HPXA 2Y63A 2E5CA 1XBZA 1VPXA 3VE7A 3IGUA 1G4PA 3BLFA 5HNRA 1C29A 3MBFA 5TIMA 1SZGA 3TAOA 2V8ZA 3DKLA 3CIWA 3NQDA 1LP6A 5AOUA 2WSRA 1ZENA 4P2VA 1GQNA 5K9DA 4LC6A 2H8XA 4ADTA 4I7VA 4MUZA 4FNPA 3UPBA 2PC4A 5DELA 1JRCA 2RFGA 3W7QA 4GC4A 5G4WA 4ALDA 1SO3A 3P8JA 1VR6A 3BLEA 2VOMA 5D2YA 2HTMA 1KM2A 3ABQA 2X16A 3R2GA 4GUHA 4QQ3A 2EGZA 3P67A 3TQKA 5FI8A 3PS7A 5AC8A 4IMFA 4S2CA 3MI3A 3C2VA 3OA3A 1K3UA 1W31A 2X1UA 1L2UA 5LZLA 1OX6A 2QAPA 4X2RA 4DO6A 4UCGA 3UD6A 2Y88A 4RXFA 1PIIA 3MHFA 2W79A 4CCEA 5GVJA 2NLIA 3B4UA 4DEFA 4IMEA 1OFAA 1V7YA 5D33A 2CZEA 4IMGA 3CM4A 4FXSA 4Z1DA 3F4WA 1RZMA 3B05A 3DH7A 1VYSX 4MFDA 2ALDA 4LV4A 3TC6A 1R47A 2Q8LA 2CLKA 1VCFA 3C6CA 3DXIA 4WY0F 5HULA 3W7OA 1LZOA 3MJYA 3DFQA 1I2QA 2CLEA 3VFLA 1P4CA 3O8AA 4NZJA 3FLUA 4ORIA 3SIZA 1YTDA 2DORA 3NQVA 3N9SA 3SSJA 2Z6JA 3EEGA 3EKZA 1UBSA 1KBJA 3QW3A 2PRMA 1GWJA 1DJQA 2RH9A 3KAOA 2UV8G 3MHGA 3V1PA 1OG0A 3MWAA 2YXGA 3L65A 3P7YA 1F73A 3W7GA 3GDLA 3G1XA 3WJZA 3BW3A 1TTJA 1YDOA 4O4WA 3EWUA 2NV1A 1W5PA 4Z1CA 3SY5A 3THQA 2V0TA 3P82A 4FF7A 2DZTA 1ZALA 1OFRA 1W5NA 5K9CA 3HJZA 1IXNA 3HGRA 5I3GA 1MEHA 2JGQA 5LSMA 4EIVA 4FX8A 1VJIA 5D37A 1V5XA 1VZWA 1Q6QA 4HNNA 1RR2A 3KVMA 5CPMA 5DXYA 5HR6A 1K8ZA 2V82A 4HSNA 3HG4A 5D2VA 3LCXA 2CLIA 1OYBA 4DF1A 4JDBA 5DY2A 3GIYA 1YTKA 1Z48A 4DPQA 1R2RA 4Q33A 4EWND 1ALDA 3W7PA 3LRLA 4DPPA 1CI1A 3DKJA 3OBKA 3BARA 2GOUA 3W7MA 4RXGA 3DAQA 1JCXA 1G4EA 3LHWA 1FXQA 4E0CA 4O1CA 3K30A 3HO8A 1R46A 3NPWA 1MEIA 1XM3A 1FX6A 1H7RA 4O53A 1UUMA 3MI6A 4AAJA 1C8VA 2WNZA 5AC6A 1TPB1 4QNWA 4QJ1A 1ZCOA 2QUTA 3NM3A 1NF7A 2C13A 1UJPA 3H55A 3W23A 2BWGA 1L6YA 1JCMP 1EWEA 5AHFA 3C4UA 1S3HA 4FNRA 4AXKA 1FQ0A 3V75A 1R30A 3ATZA 3ZS4A 1J4EA 2DZPA 3QEZA 3WJYA 2RDUA 2DP3A 1FDJA 4P61A 4LRSA 4ZQRA 3N2XA 3IVTA 4MY9A 4HPXA 4DO4A 3ABRA 4FXRA 4WXZA 2E6DA 3THAA 4WJEA 5DCBA 4RZ4A 4Z1BA 1SZNA 4M7TA 3QQ0A 2RDTA 3EKLA 2NXHA 1QPOA 3GR8A 4IOTA 2ZZ1A 5KZEA 2VEIA 2J27A 1WDWA 2WSYA 3NQEA 3TX9A 1ML1A 2OX1A 3A23A 5EL1A 1EEPA 2ZZ6A 3NQ7A 5DBTA 5HQEA 4TIMA 1LBMA 3TSMA 4JIQA 3QH2A 5CZ0A 5DN1A 3BPWA 3FFSA 3LTSA 3MO7A 2OCZA 4CNPA 1KTCA 1SQ7A 2X1SA 3ZWTA 4UTUA 4JIPA 4ZL1A 2YR1A 4YWIA 4QNEA 3O63A 1OF8A 4K6AA 3LCIA 2WNNA 2ZZ4A 3EX3A 1S5VA 4HPJA 3M43A 1TYGA 2E5BA 2ZCGA 2E09A 3LHUA 5BMWA 4AF0A 3TK7A 1W3IA 3DFNA 3RNDA 1B4EA 4O54A 1I2PA 2YDAA 3CHVA 4O16A 1KM5A 2C19A 5LNRA 1G4TA 2FPYA 5AHMA 1OK4A 1XUZA 4A21A 3LV6A 2AAMA 4M6PA 2QCLA 4Y6GA 5EY5A 1I2RA 3W1LA 5I3JA 1HFBA 1VHNA 1WOAA 4BFAA 3W2UA 3GKAA 5KMYA 2OT1A 4O10A 1W3TA 4MIMA 5EA9A 2J9ZA 2YPIA 4MYAA 5LNSA 1YYAA 5CSSA 5D30A 4N4QA 3M41A 1W3NA 1KM3A 2YW3A 1RV8A 3MYOA 4K7VA 5EMUA 5D2WA 3NQAA 5F2MA 3W87A 2OZ0A 1JULA 5F2LA 1DORA 4OGZA 2C14A 2V2HA 2CZDA 2TSYA 1KLZA 2O7SA 2QJIA 4UTWC 3W1PA 1TTIA 3CB8A 1FWWA 1CX9A 3WJXA 2TRSA 4KKXA 4FNQA 3VI2A 3M0ZA 5AHLA 2JKEA 2A2IA 3G1YA 1TV8A 4LUIA 4O17A 5DCEA 4UTLA 4Z1AA 4NVTA 4FO4A 4QSHA 2Y7EA 3BG3A 5CZTA 3TIMA 1RVGA 4O18A 4IUOA 7TIMA 4LNYA 4LWWA 3MP3A 2ZA2A 1D3HA 3NPXA 4H6KA 5MHBA 2FIQA 5BOOA 1QR7A 1KFLA 4OU1A 2FPVA 4FEZA 2BSLA 3GLCA 2HS8A 3TNOA 1TPEA 2A0NA 1EB3A 3S0CA 1OX4B 2FB2A 4JTFA 5F1VA 3NA8A 3GB6A 5EYWA 1VHCA 4IMDA 1PHWA 2E6FA 1KM4A 1OVDA 3M5ZA 4HNVA 4GRSA 1WAUA 3P80A 2QJHA 2YW4A 4MY1A 3EWYA 3Q94A 1LROA 4DF0A 1Q6OA 3I7QA 5A5WA 2ZZ5A 4PA8A 5FF3A 3A24A 1HO4A 1ZY9A 1Z42A 3EXTA 4G1KA 1F6PA 3WK2A 2ZTJA 2W0UA 1Q6RA 4WOQA 3DBPA 1PE1A 3G1HA 2E6YA 3AO0A 4WOZA 4O12A 4JYEA 4O1AA 3DENA 3O06A 3NQCA 4ADUA 3M44A 3W07A 4NJKA 3ZFHA 3M5YA 3B03A 3I7RA 4K8EA 4KWVA 5HWNA 1P1XA 3R13A 2DU2A 4I9AA 2ZRYA 1N55A 3USBA 4C1KA 3FKKA 3KX6A 3PAJA 4UFKA 4XKYA 2CZFA 3UWYA 1SPQA 2DZWA 3W2KA 2P10A 1N7KA 3MW7A 3LBMA 3I65A 5FESA 4CCCA 1ZAJA 3ELFA 2Y7FA 3LHZA 4LS1A 3C56A 1OYAA 1H5YA 4ZQPA 1EUNA 2OMAA 3WK1A 2Z6IA 3E49A 2FTPA 2VFHA 1T99A 1WBJA 1QMLA 1O4UA 4CNOA 4AHQA 2B7PA 2C0AA 2OJPA 5AYXA 1TCDA 2C6QA 3UWZA 4CQ8A 1FY6A 5KTLA 4WUIA 2FFCA 5CPOA 1YDNA 2ZZ7A 3LHYA 4MVAA 3LOTA 4IMCA 2F84A 2BZNA 2XN0A 3LERA 3W3OA 5A8GA 4LOCA 4LT9A 1KFCA 5CKSA 3NG3A 4MZ1A 5HINA 1A50A 3N19B 3GKFA 3S5OA 1B4KA 1PHQA 1TMHA 3OVQA 3N9RA 2ZYFA 1XC4A 4FX7A 3UNDA 2J24A 3UY8A 4R53A 4MZYA 2QJGA 3L0KA 2Z0IA 3NO5A 3FS2A 3BK0A 2QCGA 1Z41A 3PUEA 1WA3A 3LCFA 1AW5A 1GVOA 1TPH1 4N6EA 1QAPA 1GVFA 4UR7A 4NNAA 3TROA 4ZVJA 2QCFA 2X1RA 1YXYA 3LB0A 1JCJA 1SW7A 2GUUA 3LGEA 4L4MA 2FB3A 1VC4A 2Y62A 3LI1A 1IIHA 1Q45A 3TU9A 4M7SA 1O5XA 2Y89A 1IIGA 3T55A 2VELA 5AHIA 1RQHA 2C16A 4N6FA 5K4XA 1QFEA 4LC8A 1XKYA 1JJKA 2WPBA 1AK5A 2JK2A 1KLYA 4UTTC 4O1DA 5T26A 1SW0A 3TW6A 1KFKA 4PL2A 3AJXA 5IBXC 2VFEA 1A5SA 1LLZA 1G7VA 4IX2A 4DBEA 1K7FA 1W8SA 4IPJA 3SJ3A 3WFAA 3A5VA 3FOKA 3IEBA 3N73A 3UZ5A 1DJNA 2WKJA 1TJPA 4MYXA 3FEMA 4XBSA 1OFPA 1TSIA 2QR6A 4LW7A 3QW4B 3DFPA 3W1AA 2HMCA 3O05A 3SR7A 3LDVA 2E6AA 1QDSA 3G1SA 3QMSA 4AF0B 1DBTA 1U5JA 2R91A 3OVRA 2ABBA 3CIXA 3NDOA 3P62A 4ZQNA 3SFKA 3L5MA 1MEWA 1LDCA 1TO3A 1TPUA 2E5DA 4OV4A 3W88A 3NAVA 4GUGA 2BX7A 3O1NA 4N2YA 3KOFA 3NPUA 1SO6A 3LHTA 2QF7A 3N2MA 4MPQA 2D73A 1EP3A 5I3HA 5I3IA 1K8YA 3CU2A 3T4CA 1DQWA 5FEWA 1OX4A 1GT8A 1PV8A 1YADA 4EVZA 3IRDA 1GZGA 3IIPA 3C2RA 1TRDA 1AW2A 3W75A 3EWXA 3S5ZA 3B0UX 1KM0A 2EF9A 3LI0A 2QEZA 3P5YA 4NQ1A 3B04A 3QMRA 3L0NA 5G2WA 3WJWA 4JNMA 1KFEA 1H7NA 4POCA 4HT3A 2NV2A 1UCWA 2V5BA 1KTNA 4WZHA 1OX5A 3TMLA 1GVQA 4BWLA 2A5HA 1FBAA 3QFEA 3P74A 1K7EA 4O0KA 3W2NA 2GVLA 1FDZA 4HKPA 2CLLA 4K38A 5U7SA 3HGSA 3NL6A 4LV9A 3EX4A 4ZQCA 3T7VA 3TKFA 4M6QA 1H60A 3SI9A 3G24A 3W1QA 1LBFA 3G1DA 4FNSA 1HO1A 2YSWA 1G69A 2A4AA 2B7OA 1RPXA 5D05A 1WXJA 1UUOA 1F5ZA 3O07A 3CEPA 1LOQA 3EXRA 2V9DA 2A21A 3JR2A 3LBCA 1X1ZA 4S2BA 4PODA 4NZFA 2VENA 1XBVA 4PTNA 3GXTA 1A53A 4YMZA 3BG9A 3LCWA 4O19A 1TB3A 2AGKA 2YFOA 1OYCA 3M5XA 1IGSA 2QCCA 2ZZ3A 1CW2A 4JTGA 4UMCA 5J5DA 4ML9A 3LTPA 3NR0A 5HJLA 5HMSA 1QOPA 2A7PA 4NX5A 1ZAIA 3QSTA 4FX6M 3TR2A 3HG2A 4JY9A 2CLFA 3G0XA 2C18A 5F4WA 1H51A 3QF0A 4RR4A 2Y6ZA 4LVFA 1VCGA 5BNKA 3EX2A 4HHPA 1G6CA 2QCEA 1FCQA 3GR7A 1S5WA 2XFWA 2CW6A 3DFTA 1YTEA 4AVFA 2H6RA 3NVTA 3DHFA 4M19A 1HTIA 6ALDA 3BGGA 4N9CA 3PG9A 1OHLA 4A22A 1J5TA 3NQ6A 3FYOA 1G67A 3HB9A 5HUPA 4DXVA 3TXZA 1KA9F 4XKYB 2J6XA 3OIXA 1LM1A 2Q8ZA 1XXXA 1XDMA 4FHAA 5FF2A 3L67A 1DHPA 3W1RA 3UZJA 1EWDA 1QPRA 2NUWA 1BWLA 4TR9A 2RHGA 3Q58A 4K39A 4A2RA 2G97A 1N8FA 3FJ6A 1TPDA 2YYUA 2C15A 5DBUA 3W84A 4EF9A 3W1NA 3DU0A 3W7JA 8TIMA 3L2IA 3VCRA 4BI5A 3S6DA 2DZSA 4KFPA 4YXGA 4AH7A 5EPDA 4DF2A 2GVGA 5AHNA 1TRIA 4O14A 4PEKA 3FA5A 4LVBA 5G1YA 4XTIA 4O50A 2BLEA 3W7IA 1PCWA 3W1XA 2XN1A 1NVMA 1A5CA 5EKYA 5FF7A 1F6KA 1ME7A 3PBWA 3G3MA 4ZQMA 4RKAA 1OJXA 3L0GA 5AFDA 2NWRA 4PFMA 3MHUA 3G18A 5CG7A 1ZAHA 3NL5A 4UFLA 5L6UA 1L9WA 4UC5A 1OK6A 1YXDA 4LS2A 3FYPA 4JYDA 1SFJA 2RDWA 4XUGA 3LCGA 2V30A 2P0OA 2NX3A 2TMDA 1ICSA 3QSRA 3CWNA 1GOXA 2B7QA 4HSOA 1OFQA 3W73A 4FIQA 4Z08A 2A6NA 4NJHA 4LS0A 4NJGA 1UB3A 5LHEA 3G0UA 5D04C 2GQAA 2EKCA 5G4EA 4ORMA 5LHFA 1VRDA 1SZFA 4NT0A 1T8XA 4UTKA 5FF0A 3W7DA 2EAWA 4MZ8A 1XFBA 3PSVA 1FDYA 1PVNA 2NXIA 1XBXA 5HUOA 2VFGA 2E77A 3QRHA 3LRMA 1VQTA 4QITA 3I6RA 1J2WA 1LLWA 3W70A 1NSJA 5F2IA 3W7RA 3GYEA 2V81A 5AHEA 1FXPA 1LRQA 2BXVA 2VC6A 1F05A 1IXPA 1YPFA 1IF2A 4GBUA 1W0MA 2ZA1A 1DQXA 1TPWA 4JDYA 4L4LA 2X30A 3M1ZA 3BW4A 4EF8A 5CZSA 2DJXA 4LU0A 2NX1A 3NGJA 4AB4A 1OABA 3R8RA 1F74A 4WQ6A 5KZDA 3C52A 2AQWA 4NNCA 2A85A 4UFIA 2I9EA 3GAYA 3RF9A 2G96A 3A5FA 2ZA3A 4Q32A 5K7JA 3DGRA 1MSSA 3KXQA 3FKRA 3LXCA 1THFD 2VXNA 3CWOX 5G5IA 3W1TA 3TUUA 3HIJA 2Y70A 4H3DA 5AB3A 5FEPA 3SECA 3F1QA 4N9BA 3DFSA 3NQ8A 3PB2A 1C9DA 3HGOA 1I45A 3T44A 3HGJA 3RFAA 1SU5A 3DFOA 3IGSA 4JTHA 4BWLC 4TX9A 4GUIA 4JICA 5U4NA 4A3UA 1H7PA 3SGZA 3NL2A 2YZRA 3A21A 2QKFA 4N9DA 4WY0A 3PR2A 2A7RA 3RU6A 4TMCA 3M47A 1AL7A 3MYPA 1Q6LA 4KFNA 3RMJA 4O52A 3HBLA 6TIMA 5AYZA 5DY3A 1O95A 2E68A 2PCQA 1W1ZA 3ABSA 1H63A 5D38A 1XI3A 3NXFA 1WYIA 1FWTA 1TPVA 1JCYA 3BVJA 1OFDA 3S5NA 1P0KA 5F4XA 2ZDRA 2C1HA 3GVGA 4NU7A 2Y61A 1ZJIA 2VFDA 2PURA 3M16A 3ANYA 4TU1A 1A5BA 1VLWA 4R34A 4MJMA 1QNVA 2A1YA 3QC3A 4UTHA 4O28A 3L68A 4DQWA 3IVSA 4FB7A 1UASA 4O0ZA 1OF6A 2DZUA 2O7QA 3S42A 3IV3A 2J9YA 4AHPA 3LRKA 1VCVA 3P8IA 1BKSA 3DZ1A 2ZZ2A 4WX2A 4JEQA 5BW6A 2WQPA 2QAFA 4FNTA 3CLMA 3NQGA 5C55A 3CEUA 2X2GA 2Y7GA 3EXSA 3G3DA 1L6SA 4IGHA 4Z0SA 3UWUA 4A2SA 4JTIA 4AWSA 2ZRWA 1W5QA 3TJLA 3TC7A 4CCDA 4IJBA 3BG5A 3TE9A 3H54A 1XBYA 5DXXA 5C54A 1B3OA 3W7HA 1KV5A 4DBDA 3W76A 3BO9A 3CQ0A 1VGAA 1W54A 2H3BA 4WXYA 2XN2A 4UMBA
chains in the Genus database with same CATH superfamily
1BTMA 3C86A 2ZRXA 3LXAA 2HNEA 1RD6A 1I60A 2Z1KA 3PZQA 4KEVA 1A80A 2HRWA 3ZWSA 4FZIA 5EMJA 5FEXA 2CHOA 3GC2A 2OEKA 3EWWA 5I79A 2ABAA 4Z1YA 1W8GA 4ACYA 4IH3A 5A6TC 3AMLA 2HXUA 3C3NA 3PWIA 1R5YA 3CTLA 3KCOA 1V3KA 1A5NC 2OT0A 3CV2A 4B5UA 1BHGA 3P60A 3PPCA 2VEGA 2D20A 4YL2A 3VK5A 1E3XA 4AW7A 3MU7A 4R27A 1KFWA 3SDOA 4WHBA 1S38A 2JQXA 3VNDA 4LCQA 3WKZA 4AD2A 3HMJG 3PN8A 2HZGA 3DI1A 3I3BA 3WDIA 1F3WA 1M01A 2CBIA 4JIEA 4CQ9A 5K2ZA 4UTMA 2WCAA 2DVUA 4LRTA 3RPMA 4GH1A 4Q4PA 1GEQA 3Q4DA 1ZJBA 1CLVA 2V6AA 3U6WA 4OV9A 1BTCA 3WJSA 4IG2B 6XIMA 4RK8A 1AMKA 5BWFA 3IWPA 5JBDA 3TTOA 4LVAA 5GJPA 4UUIA 4ONVA 2NQHA 4UQDA 3INPA 1K9TA 3UR5A 4LYQA 4XV0A 4W85A 4NG3A 1XUUA 1S5TA 4GX8A 1UH2A 1WBHA 1KR0A 2JEPA 4LAKA 3LCLA 3WMBA 3U0HA 2A6LA 4O8RA 1LF1A 1V08A 1ZFJA 3G1AA 3IJ9A 3TQPA 2ON3A 4IX0A 2J88A 1AJZA 1T96A 5DCDA 4XKMA 2XPKA 1B2YA 1PX3A 3STFA 3AROA 3QPEA 1XLHA 2IPJA 1ZHAA 2EHHA 5F4SA 5DMLA 4LQ1A 1F9CA 4EAYA 3VMNA 4PCSA 3RX3A 3W71A 4I7UA 4JQ4A 2V63A 2Z24A 2Y85A 5H91A 3R0DA 4PGLA 3TSBA 2ZKMX 3EB2A 3O6DA 2XVKA 1UZ1A 1YE6A 3IIZA 4E8GA 2OQLA 4UFJA 3LTYA 3CTTA 1VFHA 4MKNA 3UWWA 1EP2A 1TVLA 2PF0A 1TQXA 2BY3A 3W81A 4G9PA 2XZ9A 1DWIM 1V6UA 4MY8A 3TMQA 2OGJA 3PVFA 1IGWA 1XYLA 2H90A 2RAGA 2FGZA 3KFTA 2ZFAA 2DEPA 3BCJA 3H4XA 1XW8A 3B0PA 5C6MA 2ASHA 2P5NA 2QLYA 4GD0A 4LB3A 4AEOA 3MKVA 2VR5A 3KVLA 2ZUUA 1DWJM 4ZMGA 7ENLA 1RHCA 2QCDA 2BGQA 4F2UA 4LY8A 3URBA 1FCVA 4OT7A 4QS5A 1DHKA 4NF7A 3UXAA 4C6CA 2VUNA 1OGBA 1TZZA 1W5MA 1XCWA 2ATMA 4GUFA 5MKGB 2LLEA 5K3VA 4YLWA 2HVMA 4JR5A 1PL9A 3U5YA 4P8UA 4IP7A 4P7QA 4GX9A 3FSTA 3TXVA 3S47A 1XYAA 1VYRA 5I0DA 6A3HA 1K6AA 4HYWA 4RCXA 1GW1A 2QCMA 5I7GA 4XBKA 1WP6A 3EB3A 5D2TA 4XISA 3MTWA 1D3GA 4UZUA 2PAJA 1KR1A 2XFFA 2GQ3A 2V38A 1P5BA 1NFPA 1U1UA 2FPTA 3RN6A 3T4WA 2Z1BA 4O1EA 3LV5A 1BVWA 3SB0A 1E0XA 3WLLA 2NUYA 2YCKX 4IFKA 5KSWA 3KL3A 3LQLA 1VBHA 3PG8A 4HP5A 4HOWA 1TWSA 4QM1A 4MAVA 1OADA 3GNRA 3E38A 3CV7A 1KQZA 2NX9A 2V5JA 3PBYA 4DWDA 1XLKA 1H7OA 5CBBA 2ZICA 3CT2A 3RX2A 1EIXA 3MQTA 4GE8A 3LM7A 1IT7A 2CXGA 3E9AA 3E02A 1Q66A 4IL0A 1GTHA 1LBLA 1JZ6A 4LVGA 1VH7A 4Q3MA 3GDBA 4ERIA 1XIHA 4BKNA 4C7FA 4Q7IA 5GNXA 1VJZA 1XYMA 1TJ1A 4JFWA 4DZ5A 4HK5A 3W74A 2G3NA 4UTTA 3TV8A 2OYKA 4JN8A 1AL8A 2B7NA 4KBXA 2ISVA 1CT5A 3KHJA 4KEUA 3OVGA 2VEKA 4E2VA 3F4NA 3WMLA 2XDFA 5F1UA 3TTEA 3WMCA 5A6BA 3RPDA 4I5XA 1PIGA 3UZXA 3R11A 1O60A 1XRFA 1JD7A 3E12A 1LG1A 4WF7A 5HATA 1FCUA 3AQUA 1UH4A 4K3ZA 3VKAA 3DERA 4QDPA 2CWNA 2TYSA 3RG6A 5A8PA 3EDEA 4DZAA 4LEQA 2XGZA 4ICNA 3UWVA 4BK9A 2YCIX 1QCWA 3R5EA 1J93A 2YB4A 1YDVA 3W1UA 1V02E 2IKGA 1TREA 1O5QA 4F0KA 1P43A 1HX0A 1KO0A 4CN4A 1X7FA 1ICQA 1LTDA 2OQYA 2H3DA 2AQVA 5XINA 3QYQA 4JKLA 5I02A 1HIZA 4B5NA 3VIJA 4IIHA 2PE4A 1XYZA 3PM6A 3W7CA 2NSXA 3SCWA 2C91A 4CQAA 4KW2A 3N6JA 3TJXA 1J12A 2WZIA 1EX1A 4J7RA 5E9XA 5DEZA 1UR9A 5LIXX 1E1EA 1FFQA 2VRKA 4NL1A 1GNXA 3P2VA 3UJRA 4ZXOA 4NX0A 4HU3A 1E9YB 3NDYA 3OG3A 3RX4A 1I0DA 4LB4A 2BHYA 3NQMA 2GGHA 2PRHA 2AMGA 3CS2A 3GBEA 1EL3A 4E4PA 3USZA 4M29A 3M7WA 1NP0A 1DVJA 2GVJA 4IMAA 3KS6A 1KRAC 3MWCA 4L6OA 5CJ5A 3STPA 3CHDA 4Q8PA 2O9TA 1KFBA 5A6AA 3ERPA 4GIAA 3AI0A 1JIBA 4OBSA 3UY7A 3UWQA 2DSWA 4HD5A 1OCNA 3KVKA 2QV5A 4UOQA 5BRBA 1H3GA 4XAFA 2P8BA 4XBJA 1RY0A 3LPOA 1R9YA 3CLWA 3UG8A 4GNVA 1CXFA 1OCQA 4RLIA 2YX0A 3OEXA 1H0IA 1IZKA 3Q37A 4PUJA 1K8XA 3O3RA 3G8RA 2F61A 3ZSTA 4IGSA 2XVLA 3G6MA 4BF7A 3PJTA 3RO6A 3VA8A 3TN5A 4C6QA 3S4TA 4XG1A 3A4JA 2XIIA 3N3MA 2HISA 5K4ZA 3W86A 2Z2BA 2CZ5A 2QCDB 1EHAA 2Y7DA 1JRBA 4JD4A 2OLAA 4INFA 3GTFA 4U31A 1LL4A 2UY4A 2INFA 3PZVA 1GOMA 2QCHA 4U3CA 4JTQA 1KBKA 1CB2A 3ME3A 3W7KA 1H1ZA 1R6WA 4QCFA 2R8WA 3CWHA 1A5UA 3IUDA 1K02A 1P0EA 3ITOA 3IJ7A 3I6TA 1E9IA 5HOSA 2BP1A 1LUCA 3ZLGA 1GZJA 1EYEA 3SGGA 1TQJA 1JCLA 1WOBA 3CT7A 2XTKA 4AD5A 1NARA 2HQAA 3PUDA 2ZC8A 2I14A 3NSMA 1T8QA 3LCHA 5HWJA 4IISA 2C1GA 5FJJA 5JVLA 3NSNA 2ZQ0A 2BY0A 2VFIA 3UW6A 3QVQA 4ATWA 3FN9A 2D0HA 5HK4A 1U1HA 1PYMA 4GBDA 5TNVA 1ZS2A 3E74A 2WKLA 3QPZA 3CUXA 2TAAA 5HMEA 4K8HA 1GJPA 1GQJA 2FLIA 5IFPA 3QZEA 1K9DA 3C8NA 3AHYA 3C61A 4LTSA 1BEUA 3GWQA 3HPAA 1JZ4A 3HPXA 1HL9A 2IW0A 1XBZA 3MKKA 2J47A 1G4PA 3BLFA 5TIMA 2ICSA 3FV9A 2WMFA 3CIWA 1LP6A 1VFTA 1AODA 1ZENA 3GTXA 4P2VA 1GQNA 5HANA 4LC6A 1UWQA 2H8XA 4MUZA 2DT2A 3V3WA 4FNPA 1FWEC 3AXKA 2PC4A 3U7BA 5DELA 4QTGA 2IQ0A 2RFGA 3W7QA 3UCDA 4GC4A 4V15A 4YVXA 5A6JA 2R1KA 2XZ7A 3N1AA 3BLEA 2VOMA 5D2YA 4Q8OA 2HTMA 1EJTC 4W84A 3N2CA 3P67A 5FI8A 3SUVA 1V7AA 3C2VA 4V28A 2QAPA 3UD6A 3OPSA 3CL6A 4JKMA 6XIAA 1CXIA 2W5FA 1M7XA 1WDSA 4U2ZA 4FXSA 4GIRA 5JIPA 1RZMA 3W4RA 2OKTA 3B05A 3DH7A 4MFDA 1R47A 2Q8LA 1KCKA 2PPGA 2WM0A 3C6CA 3DXIA 4F66A 4D8AA 2HXTA 1F4HA 3GQYA 1GOQA 1I2QA 3L7RA 4NY2A 4AC7C 5JUVA 2PDLA 4NZJA 5AZ0A 3O0FA 1PWLA 4MWAD 3EEGA 3LPGA 1IQ8A 1KBJA 3ABXA 3L23A 2Y8KA 1KRBC 2PWEA 2RH9A 3KAOA 2UV8G 4GABA 3MWAA 3P7YA 5A2BA 3GDLA 2PTWA 3CQIA 4KEMA 3VKDA 2B81A 3BW3A 4LJ3A 1YDOA 3SURA 2IPWA 2HPMA 4O4WA 1CGTA 2NV1A 1W5PA 3F5JA 4S3EA 4Z1CA 3THQA 1M41A 3RXZA 3P82A 4FF7A 3FW6A 4YWSA 4ZO8A 5K9CA 1FP9A 3HJZA 1IXNA 1CTNA 5I3GA 1MEHA 1EXPA 4FX8A 2Q09A 1FWGC 2P76A 4JFTA 2Q01A 1O5RA 1VZWA 2BVDA 5CG0A 2YIHA 1RR2A 5CBIA 3C0SA 4QEHA 5FACA 1ITXA 2PWDA 3KRBA 2VEFA 2BY2A 3DG7A 2HVNA 4L9YA 4Q33A 5M17A 2R1PA 4DPPA 3SCNA 4DJDD 1EZWA 5JIWA 2YLAA 3QR1A 4RXGA 2IMRA 1O7AA 1DJHA 2E40A 3PTDA 3SQSA 3NPWA 3PFRA 1XM3A 1H7RA 1XLBA 4W87A 3B9EA 4IQDA 1A0CA 3H70A 1H2JA 4QJ1A 2C13A 2BWGA 4OJYA 1Z8AA 1EOMA 1EWEA 4FNRA 1VEMA 2WVVA 2XH0A 4PTDA 3RM4A 4AVOA 4DJFD 4DJEA 2D24A 4YTRA 3FNDA 3ZS4A 4MTVA 3WUBA 4IIGA 4P61A 2QXWA 4LRSA 2PWVA 3T0TA 3B8UA 3IVTA 1UG6A 1NDYA 1OWQA 5A69A 2E6DA 3M7SA 1EH9A 1SM9A 3QXBA 3M0YA 5DCBA 2BXYA 1K1DA 3OYXA 3QQ0A 2RDTA 1QI4A 1ZL1A 1BVNP 3GTIA 1Z6KA 4LFYA 2CBVA 3H4GA 3HN3A 4PULA 3NQEA 1QW8A 2OX1A 2W66A 1V3IA 5EL1A 4TIMA 1LBMA 5E0CA 2G0WA 4JIQA 3QH2A 2ZE3A 2BASA 1AZ2A 5I6SA 2OZTA 3OZPA 3LTSA 5FJPA 4PRRA 4CNPA 4S3GA 1LUCB 3U2ZA 1QVBA 3VKKA 4UTUA 2UY3A 3JVAA 4YWIA 2PDYA 1OF8A 3ID7A 2PU0A 4K6AA 3LCIA 2WNNA 3BZJA 4L5ZA 3M43A 1TYGA 2E5BA 3LHUA 1NWSA 5BMWA 3RO8A 4XO7A 1HJQA 3ITTA 4O16A 2C19A 1HJSA 3AS0A 2BVTA 5DX7A 4RDZA 3VU2A 4YIWA 2J8FA 1A3XA 1HFBA 1M3UA 3T07A 5KMYA 2OT1A 1FKWA 5EA9A 4ZO9A 2YPIA 3GXFA 5LNSA 1GVYA 1KM3A 2YW3A 4G8TA 4K7VA 5D2WA 3NQAA 1X96A 5F2MA 3MVIA 1JULA 2TSYA 4NI3A 5EMYA 1CX9A 2FVLA 2RJGA 4BS0A 4DZHA 3M0ZA 1UKSA 2A2IA 2VM8A 1TV8A 3VUPA 1LQAA 1DWFM 1US0A 3PFMA 3TIMA 4J1OA 2QW5A 4I9JA 1I0BA 4DXKA 1IT0A 4LWWA 1XLGA 4CQCA 4U10A 2MANA 4P8WA 3KUMA 1D3HA 5FKYA 3B8IA 3WLNA 4OU1A 3OODA 5T8GA 3L4TA 5CEWA 5F1VA 1VRXA 1J01A 3WNNA 1AMYA 4JFSA 3WQ6A 3XISA 2EPMX 1W1IE 3T09A 1XLAA 1K8CA 4UOJA 3PJUA 3PK7A 1CZ1A 3WCZA 4RE4A 2ZUTA 2EJ1A 3I7QA 1GKPA 1QOXA 2VC7A 4PA8A 5A5WA 5B80A 3EXTA 1J5SA 2ZTJA 2W0UA 1Q6RA 1S2WA 3H2FA 2E6YA 4F0MA 3G6LA 4H9TA 1B54A 4JHZA 4JYEA 4O1AA 3O06A 4HQVA 4ADUA 3ZFHA 1V8EA 4PR4A 3R13A 2J6VA 4I9AA 3ZZ1A 1N55A 3RM9A 4C1KA 3FKKA 3PAJA 3VCNA 4XKYA 1JXKA 4EX4A 4LUYA 3W2KA 4AFYA 1Y65A 3LBMA 1H49A 1PKMA 2ZUVA 5FESA 1ZAJA 1UWAA 1OYAA 3GSMA 2D23A 1HVQA 1EUNA 4A05A 1M65A 1VF8A 1FH9A 3H2CA 4C6IA 3IJLA 3MUIA 2X0SA 1QMLA 1O4UA 3H2MA 4AHQA 3VD7A 2OJPA 1TCDA 4LYPA 2H9AB 3SN0A 4PMZA 3PBGA 4CQ8A 3UZYA 4B91A 3XINA 3S6TA 5C8BB 1AUSL 2ZZ7A 3LHYA 2F84A 2BZNA 1TMLA 2OQHA 1WE5A 4LOCA 1Q2SA 5CKSA 3R25A 3RR1A 2PI6A 4XIAA 5HINA 1NELA 3WDRA 3PZUA 3S5OA 3IJQA 2Z7KA 3EKGA 1X7IA 2ZYFA 3DC0A 4RNFA 4R53A 4MZYA 2EXOA 4DHGA 2WVVB 1ITCA 2QCGA 1Z41A 3PUEA 3PJWA 3R1ZA 4CU7A 3KBNA 3TYCA 1GVFA 4WK9A 4NNAA 1V3LA 1YXYA 2HEJA 3S46A 1Q85A 5J8LA 4D6EA 2BNJA 3UU0A 1DYSA 3LGEA 1QTWA 1IIHA 1CDGA 1O5XA 4HNCA 4DIAA 1IIGA 1IWPA 3ZMRA 3T8LA 5AHIA 1RQHA 4N6FA 4J2PA 4DWSA 4LC8A 2OZ8A 1UD6A 4RL3A 1US2A 1V51A 5AC5A 2WPBA 4JQ2A 1AK5A 3GH5A 3V0UA 4ZSUA 2HNHA 5IBXC 4PL2A 4CNSA 2YCLA 2Y8VA 1SFSA 7REQA 1ODZA 3WL0A 4Q8MA 1W3LA 2GSEA 3QV7A 4B4HA 3SJ3A 3WFAA 3N73A 1DJNA 4UZSA 3BURA 2BODX 3DFPA 3W1AA 4E8CA 5DQPA 1YMYA 2CXEA 4AZ7A 3N13A 3G1SA 3EBVA 1CIUA 1GHSA 4J40A 3WELA 4X0NA 5JQ9A 2XU2A 3SFKA 2G37A 1TPUA 3LSBA 4H9MA 3SFWA 1W32A 3T6CA 4GUGA 3VVGA 1XLCA 3KOFA 3UBPC 3NPUA 1S5MA 3LHTA 3LZ3A 2J79A 5I3HA 1K8YA 1C7SA 2V5DA 1DQWA 1UOZA 4MNLA 1OX4A 3VNIA 3WMSA 2FYMA 4HMCA 2WQDA 1RBAA 1V93A 9RUBA 3QHOA 5TD4A 3WF2A 4L65A 4J3ZA 1HZYA 4GQRA 1PZ1A 1KNWA 1KM0A 3H12A 2QEZA 3B04A 2F38A 3L0NA 2VP8A 1H7NA 2Q71A 4KMQA 3S9ZA 3WDQA 2NQ9A 2F6KA 4J2MA 4BWLA 1FBAA 3L4WA 3P74A 1FH8A 4O0KA 3DX5A 3RAOA 4K38A 3WBEA 1Z3NA 2I9UA 1G5AA 3FX4A 1R86A 3KBJA 1XISA 2QYGA 3SI9A 2AKZA 3GFXA 2VDHA 3G24A 4LPCA 1BGAA 1VBJA 1LBFA 3G1DA 4FNSA 3ZVIA 3HM7A 3OHMB 1VFLA 2JEQA 4L1GA 2A4AA 3NQBA 2OOGA 2OYLA 1S2AA 1SR0A 1F5ZA 1QK2A 1SMDA 2FHFA 3CEPA 1LOQA 1L8PA 2V9DA 4U2YA 2DSKA 3UG3A 1A5MC 1X1ZA 4YNGA 4PTNA 5GQBA 1A53A 1E6NA 4YMZA 3LCWA 2AGKA 2YFOA 1OYCA 4AYSA 4ROPA 2E1WA 3SCVA 2QCCA 5ABFA 5J5DA 4GZEA 3LTPA 4TTGA 5BXRA 5HJLA 1QOPA 4Q8TA 4AWEA 3GO2A 4NX5A 1ZAIA 4EWJA 2CLFA 3EZ4A 4TVCA 2C18A 5F4WA 4HTBA 1IR1A 5BNKA 1EC9A 2E4TA 2QCEA 3GR7A 2Z1VA 3DFTA 4W5UA 3BGGA 1OHLA 1J5TA 3NQ6A 1G67A 4DXVA 2CC0A 4XKYB 1PZ3A 3TJIA 1DE5A 2C8NA 2J6XA 1EIBA 1LM1A 2YCJA 5FF2A 1Q8AA 3EOSA 1IWBA 3AS1A 2W91A 2ZC1A 2A3HA 4AZ5A 3CZKA 1Q7MA 1BWLA 2IUZA 4K39A 1PIFA 3IS4A 3GRIA 1N8FA 4FPSA 4JTRA 3W1NA 1ECEA 3VC5A 1IZJA 3VCRA 4HHLA 4WRHA 2DZSA 3H7VA 3V0SA 1EOKA 3OGVA 4Q7BA 4PMDA 1CENA 3R7MA 2PDMA 3A3XA 1XSJA 1KCXA 5FD0A 5FIPA 3FK4A 1GEHA 3QV8A 1ECQA 3WDJA 1BAGA 2Z1WA 2OSXA 1ME7A 3PBWA 3VMPA 4GYPC 3V36A 3I4KA 1OC6A 4PFMA 1CB7B 4Y8EA 1RSCA 4W7VA 1NWRA 4Y9NA 3MVTA 1OK6A 5HAOA 4CD5A 3FYPA 3LCGA 2TMDA 1ICSA 3TLLA 3SRFA 4ZENA 4AU0A 1OFQA 3HQPA 4HTYA 4LS0A 3H24A 5I23A 5LHFA 4ORMA 2WPGA 3T42A 3RLHA 5FF0A 1SYTA 2VCBA 1FRBA 4MZ8A 5IHSA 3PSVA 2BGNE 5HUOA 1SJBA 2VFGA 1AQHA 3ITVA 3OIHA 3CHEA 1AH0A 1LLWA 4RNHA 2YCLB 3W70A 3AHXA 3ZJ7A 3U7VA 5AHEA 7REQB 3SRKA 4UQBA 3EA1A 3A4WA 4MKVA 1F05A 1QRQA 1TX0A 1BF6A 3CUZA 4GGBA 2XIOA 1DQXA 1TUXA 1ZJHA 3H7RA 4R5EA 4F8XA 2C7FA 2NX1A 1UPMB 4AB4A 1F74A 1LWHA 3MV11 1E4IA 1E5NA 4PMYA 4KIRA 3A5FA 3N29A 4Q32A 3VIHA 3DGRA 3PZIA 3AXHA 1UP3A 2HPIA 3M6DA 3NQ8A 5FJOA 1I45A 2GWGA 1CNVA 1FWDC 1HF6A 3BZGA 3NCOA 1XV8A 1EKOA 4JTHA 3SN4A 4TX9A 5U4NA 1BYDA 1Q4WA 4MJ2A 1DTUA 2WBKA 3ARUA 2BS9A 4W7WA 4WY0A 1RBLA 5FOOA 1UWTA 1X98A 2V3DA 1TWZA 2UY2A 2FZBA 4HPNA 3UWEA 1BXBA 3N12A 4O52A 5I78A 1O95A 3CUGA 1M1BA 3ABSA 4CNUA 1TMQA 2Z00A 1MW3A 2ZIDA 3GNPA 1J6PA 1WYIA 1FWTA 1OC7A 3LNPA 1P0KA 3CZGA 5KZ6A 2C1HA 1ZJIA 2PURA 1J0ZA 3PTKA 4KRUA 4PYSA 4D8ZA 3PPGA 3VGDA 1QNVA 4C6KA 4O28A 4HZ8A 4US5A 4DJDC 1OF6A 2CERA 3MSYA 5LIKX 4H19A 1VCVA 1BKSA 3DZ1A 2ZZ2A 4WX2A 4K8GA 4O8AA 3NQGA 5JBEA 4K68A 3CEUA 4Y2WA 4QEEA 3V4BA 5ABFB 4DUOA 3D3AA 4IGHA 4A2SA 4HU4A 5HA7A 3TC7A 4IJBA 3TE9A 3VIGA 2MUCA 5DXXA 4MG4A 4DBSA 4DJFC 2FZNA 3KDNA 5CC6A 4E3VA 1V3HA 1DJZA 1MRAA 3ARYA 2VX4A 3NSXA 2A3AA 3STCA 3CQJA 3ARSA 1QO2A 4H2CA 3W29A 4GYKA 3WLOA 1I4NA 4IXHA 4NZCA 1GG0A 1XSKA 2DSZA 4LVDA 4FOUA 3G8EA 3V1HA 2O0TA 1H1YA 3W22A 4S39A 4OBRA 4HYVA 3TYBA 3DHDA 3GY1A 1JZ7A 5IRPA 3ICJA 1CXKA 2VEPA 4JXCA 2YL5A 1Q7QA 4QE5A 1OIMA 5F2GA 4S3FA 1NOUA 4AY8A 4YJ5A 4BQ2A 4FOJA 1WB0A 1LL6A 1K70A 2EG6A 2P3EA 3VDAA 2OZ3A 3W01A 3TWBA 3QYSA 2C79A 1WQ5A 1U2YA 1Z44A 4PCPA 3OO2A 1F3EA 4XIMA 1ME8A 2G4FA 1VB9A 3GDMA 1Q3NA 3I4EA 1LRTA 1CBGA 3BWWA 4REQA 1SO5A 2QULA 2YCEA 5G2IA 1BPLB 2AAAA 3S2NA 4KWWA 2WMJA 1OBAA 2ZRVA 2B4GA 3TVAA 4LF2A 4WKHA 3RITA 2VRQA 3JUGA 3VX1A 3TWAA 3M5VA 3H6OA 3P61A 1JNEA 4ZZ9A 3T0AA 4QIUA 4M6VA 1GPWA 4X3ZA 2NLYA 3HV8A 4M8UA 4EOUA 3WD0A 2PS2A 4DUVA 5DLCA 2DUZA 1NAL1 2GOKA 3N14A 2WBGA 1S2UA 2WO5A 2CLOA 2NUXA 1E6QM 5I3KA 4C65A 4O1FA 1DEDA 4M1BA 3LD5A 3PWGA 1UOKA 3N11A 2Z7GA 4YVPA 3UQNA 2VVNA 1V77A 3EPOA 5FJUA 1JZ2A 1R3SA 2X1IA 3WLPA 1FWNA 1ZJAA 1EP1A 2Y2WA 2PDNA 4JX5A 2QGHA 3VCCA 3RM8A 3DOPA 3WQ8A 1QI0A 3AIWA 1QI5A 5LNVA 2J7FA 5DMNA 2UBPC 3IVUA 3WEOA 3BLKA 2I5QA 3NURA 4WEVX 2EPNA 2WWCA 4S38A 3UNTA 1ICPA 1F7BA 1X6LA 3I68A 4Q4QA 6CGTA 4BY3A 3MP5A 3N17A 3EDFA 1ISVA 3L4YA 1NJJA 4NAEA 3KZSA 2O9OA 2XGIA 5AVNA 2GQ8A 1UKTA 1JI2A 4Y90A 3IJ8A 3MT1A 1Q2RA 1PCKA 3QY8A 2QV4A 1HXJA 4UIOA 3UERA 3QN3A 1YE4A 4Z2GA 1WZKA 4JNYA 3L21A 3KL0A 4WY0B 5HMDA 2VC9A 5J04A 2W6RA 3SO7A 3UPWA 4RPPA 3FIGA 5EGRA 4WDXA 2F7FA 3ABOA 3GDKA 3MI2A 2RKXA 4NIRA 1BWKA 1D9EA 5LKYA 1E3ZA 4DUXA 1ZP3A 2DJLA 1QK0A 1XDLA 2J77A 3TA6A 2XVPA 1Q6EA 1TA3A 3BLOA 4KS0A 4Y7EA 3M46A 3NZ1A 4JS3A 1G01A 3SN1A 3UZWA 1EA0A 4MFEA 3W83A 4AIUA 3V18A 3BGJA 3TW7A 3E96A 5HXMA 1TR1A 1F61A 1GYNA 5JH1A 4X22A 1J0JA 4I5RA 4FIRA 1CGVA 4NUWA 3UXDA 4PBEA 2BTMA 3IGXA 2B0MA 5PTDA 2NVCA 1D8WA 1YXCA 2WSQA 1SSGA 3WH7A 1GOKA 2DIJA 3GVQA 5CPSA 5BMXA 2AL2A 3AIUA 5D2XA 3S1XA 3F4CA 3NM1A 1XS2A 4PL1A 3BAJA 4KFOA 1WNOA 1HG3A 3MMDA 5G1TA 1DJGA 3UA4A 3GK0A 1IXOA 2ATSA 4ATLA 3GXPA 4A8IA 2O9PA 4LANA 4UR9A 5CGTA 2BXZA 3FCPA 1J6OA 2HK1A 1Z69A 2WOQA 2I1OA 3WH6A 1I8JA 1GVSA 1NF0A 4P7OA 3WK3A 5FF4A 3PY2A 5KITA 1FWRA 3GVVA 2FQIA 4F4RA 4B16A 4HIBA 3H21A 1O5KA 3KHDA 4XO6A 2D2HA 4YCPA 2J8TA 3U2CA 5LNWA 1HVXA 4O11A 4K1WA 4PRTA 2HSAA 3R79A 4JHOA 4YPJA 4CGTA 4GACA 3LBOA 4KESA 4XZNX 1PO9A 3R8HA 3HV9A 3BV4A 4GFIA 3AWNA 5A6BD 4EXBA 2WJEA 2XH7A 4AHOA 4MLJA 1IXQA 5CPNA 2WANA 1ADSA 2GJXA 4I5UA 2VGIA 3SUTA 3WLSA 1XRTA 1U83A 4FXFA 4FAMA 3EMZA 3EDKA 3ES8A 3R43A 4JTTA 3OGSA 3VM5A 3O16A 3QLDA 3SAZA 2ISSA 1V0LA 2OYMA 2VZSA 3AU6A 4XZWA 1JYVA 3LGDA 2BHUA 5FA5A 3FSUA 3PF3A 3VFCA 4F3HA 3AUOA 2R14A 2RGMA 2PZNA 4V27A 2Y5JA 3WBAA 4UFHA 3GAKA 4FNUA 1JYXA 1V03A 3HF3A 2DIKA 1FVPA 3WF4A 1GQIA 3H2EA 4NKCA 1ADOA 1VKFA 2DH3A 2PTDA 1CGYA 1RQBA 3GZ3A 3NNTA 1Q4NX 4S3DA 9CGTA 3QR0A 3L4ZA 3VTRA 2IKJA 3WNOA 3MZ2A 4H04A 1XLJA 3AMGA 3VPLA 3SCUA 3UYIA 3HPSA 4PMOA 4EXQA 4P8VA 4XWUA 2XIQA 3QQ1A 1NM9A 3LM3A 4JCLA 3RJXA 4JGDA 4E2BA 3S2CA 1E56A 1RA5A 3N4EA 4PCFA 2Y8UA 2D69A 4R7WA 5EBUA 4A29A 3W7NA 1K4GA 1PYFA 2WSPA 4R7JA 2D22A 4PC8A 4Q8UA 3WLKX 3G0SA 1LWJA 1Q65A 3FHQA 1EGZA 3MS8A 2WK2A 3EMCA 1ISYA 4UFMA 3NOEA 5C5YA 4IQEA 1RAKA 1MZHA 4H7VA 1IR2A 4F79A 3NZRA 4CNNA 4AZCB 3OLGA 4AWTA 3S8HA 4U28A 3EB4A 1JXJA 1TTPA 4BCEA 3STEA 3SCSA 4NAEB 2GYIA 4JTJA 1KV8A 4HU8A 5D03A 3TONA 4HA4A 3CIVA 4R33A 1TZ9A 5E93A 3HQ1A 1LOSA 3LK6A 4HNUA 1EUAA 3CJPA 4U4MA 5CC7A 4JY8A 2CHNA 1S39A 5LIUX 1XH2A 3NZQA 3B9OA 2X7VA 2F9RA 1UJQA 3GDRA 4M56A 2XHYA 1GG1A 1FA2A 1NFGA 3MBDA 1FP8A 1YW1A 3TFXA 3AC0A 4MSSA 1IE7C 3VE9A 1AZ1A 4C6JA 3QGVA 1SZEA 5ABTA 4NRRA 3ANUA 4GNJA 5CZJA 2V5LA 1OEPA 3NZPA 3AS2A 5C0QA 2ZUNA 1G7UA 4ZQOA 1G1YA 5A6MA 1PJ9A 4P5UA 2QF8A 1HL2A 4MB5A 3CL8A 5LGZA 1NY1A 1TA3B 3PP7A 1ONRA 3KRUA 3S3GA 4HN4A 2PB1A 2V5CA 1Q6FA 1H11A 1KWKA 1OFOA 2CLHA 3W2MA 1R2SA 2Q6ZA 4S1FA 1KFJA 1A5AA 5CPLA 2TPSA 1R87A 3V16A 4JKKA 2J74A 3W7EA 2G95A 2EPHA 1LLOA 1PB0A 1BYCA 1UW9A 3BGAA 3FAWA 4HMNA 3G1VA 2VEMA 1EX5A 3UT0A 4GXMA 4US6A 2ACQA 3L5AA 5D32A 3TR9A 1SFLA 4PTWA 2ZRZA 2VX6A 1UA7A 4PB4A 1POJA 4UNKA 3ALGA 4X60A 1JF5A 4XQ6A 2XJ7A 3KVJA 4GNKB 4UR8A 3BLLA 1LRNA 1RP9A 1KC7A 4D6CA 3PNZA 4YTSA 1EJRC 2YDSA 2OSWA 3W1MA 5A8QA 2F2KA 3MDWA 3ZR6A 2Y63A 4QLLA 2QMKA 3BUVA 3VE7A 5HNRA 1OINA 4UOZA 2V8ZA 1BWVA 5KEZA 5AOUA 4XD5A 3W6MA 3WN6A 4QGCA 5K9DA 4I7VA 2WCSA 5HPCA 4ALDA 3UXLA 3P8JA 4FR1A 4C6EA 5I5RA 4ES4A 2PLJA 3R2GA 3TQKA 4TX8A 4S2CA 3MI3A 1BD0A 4BEUA 3OA3A 1UIPA 1W31A 5LZLA 4X2RA 4DO6A 2Y88A 2W79A 5GVJA 2GJXB 4D1JA 5IHRA 4IMEA 1HNYA 1OFAA 3N9KA 4U5IA 2EJAA 4IMGA 4NRSA 3IJ6A 1RCQA 1UIOA 1IHIA 3FJNA 2E8YA 2ALDA 4LV4A 5M1TA 1B5TA 4GCXA 4EPDC 4HB7A 3KZPA 1Q8JA 5HULA 3VFLA 2ADAA 3O8AA 4ORIA 4I9MA 3NQVA 1TX2A 2GGEA 2YOCA 2IKHA 1B90A 4RW3A 1WXZA 1UBSA 2PRMA 1GWJA 2WHLA 2DSVA 1V6TA 5TAOA 1F73A 3HJEA 4B5VA 3G1XA 4PUDA 4HCLA 1XIFA 2O4QA 1TTJA 3SIMA 4HN8A 4UBPC 3K1DA 2V0TA 1ZALA 2DQXA 3FHAA 4W5ZA 4XB3A 3W25A 4UQEA 4XUYA 1VJIA 5AC4A 2FH6A 3OLIA 4XAGA 3CPGA 4HNNA 1XD1A 4S23A 1A0DA 3N4AA 3KVMA 2FH8A 3WNKA 2V82A 5IXEA 1OGGA 5D2VA 3F5KA 1OB0A 2CLIA 3CV1A 4DF1A 1YQ2A 1P6BA 1ALDA 3SCRA 1ENUA 1XYBA 3H4WA 3LRLA 4ZFCA 7CGTA 1CI1A 3W00A 3AYTA 3WH8A 1PUDA 3W7MA 2QVNA 3DAQA 1JCXA 3HTWA 2CYGA 3G2GA 4O1CA 1C8YA 5E70A 2FGBA 2PDBA 2X05A 4E3TA 5AY7A 4C6PA 1K9EA 1UUMA 3ALFA 2X40A 1ZBVA 1C8VA 2O55A 4QNWA 1ZCOA 1JCMP 3FY1A 3WLHA 1ZP4A 3C4UA 1EEXA 1S3HA 3MSGA 3BLPX 1Z7AA 4I8YA 4QLJA 2YBTA 4AXKA 3C0QA 3GG0A 1FQ0A 4IFRA 3QC0A 4WLCA 1J4EA 3WJYA 3QEZA 4U3AA 4MNMA 4DJED 3NZGA 4MY9A 2FGLA 1TCMA 4HPXA 3ABRA 4WXZA 3VIFA 4H01A 4H8HA 3EA3A 4BJHA 2XIJA 1R3RA 4WJEA 4LUSA 1SZNA 4MHBA 3GR8A 2ZZ1A 1IV8A 2VEIA 2YA0A 2WSYA 1OT2A 4CCZA 2PODA 1L2QA 1EEPA 2ZZ6A 3MMWA 5HQEA 4QRNA 3V7PA 5DN1A 4H6EA 3RILA 4AD4A 1B31A 1CEOA 3U2EA 2YA2A 1DPMA 4DYEA 5TF0A 2YA1A 1ZPTA 4ZB5A 4UQ9A 1VJSA 3GZAA 1RP8A 4ZL1A 3ECQA 1EZ2A 2ZCGA 1IEIA 2GDQA 4AF0A 3TK7A 1Q6CA 3EEZA 1WKDA 2YDAA 3GTNA 2W4XA 3LY0A 3CUJA 2CPUA 3EOEA 3GHSA 5LNRA 4Y9OA 3LEPA 3B4YA 2WAGA 4L6DA 3EOUA 4A4AA 2YZ5A 2F8QA 3TP4A 3A47A 3M0KA 3VINA 5H8UA 2AAMA 3ITGA 2QCLA 4Y6GA 1I2RA 3MA8A 1W1VA 3D6NA 1DJIA 3EDJA 3GKAA 3NJ3A 3TTQA 3WBXA 1W3TA 4MIMA 5A94A 4B5TA 4TVDA 1YYAA 1E6RA 3MYOA 4WJXA 4HGXA 1BQGA 2OZ0A 5F2LA 1DORA 1R3QA 4OGZA 2C14A 2V2HA 1UP2A 1KLZA 4X9YA 4M3PA 3W1PA 1FWWA 3DHPA 4KCVA 2EEXA 2NW0A 1C7TA 5DCEA 3CHFA 2PDHA 2E67A 5CZTA 5C7HA 4MWAE 1BYBA 3UR8A 1RJRA 7TIMA 4LNYA 2DT0A 3MP3A 3PAOA 4ERGA 4XD4A 1S1PA 3NPXA 4MPKA 4LYKA 1XRVA 2DZAA 4ACZA 1QR7A 1KFLA 2FPVA 2WMGA 1JYWA 1W2VA 2R1LA 2BSLA 4F2BA 3E0WA 3NIYA 2HS8A 1TPEA 1R3VA 2V3EA 1HW6A 5I3DA 4JTFA 4RNIA 4AZ6A 4HOXA 1VHCA 4IMDA 5RUBA 3DG6A 2E6FA 3PTMA 2D2JA 4ZR8A 2E9LA 3M5ZA 4HNVA 1WAUA 2D2OA 4A3YA 1JYNA 4MY1A 3BICA 1QJWA 1G94A 3Q94A 4DF0A 2OWXA 3GM8A 1WKEA 1Q6OA 5FF3A 1ZY9A 4RDVA 5D9PA 1Z42A 4NP7A 3WK2A 1N8IA 4GJIA 4W89A 1LWIA 1QNPA 1Y8BA 1A5OC 3W07A 3M5YA 4K8EA 3FGCA 5HWNA 1JPMA 1MUMA 1P1XA 2CCRA 1EQCA 3USBA 3VIMA 3KX6A 5ENLA 3UWYA 1SPQA 1N7KA 4IJRA 5FAGA 3XIMA 3MDUA 1Y5XA 3ELFA 3LHZA 3C56A 4ZQPA 2GZXA 3T2OA 4KWUA 3WK1A 2FTPA 3LQGA 2HDJA 4QJ3B 1AA1B 5DT7A 4GYJA 2YLLA 4CNOA 2B7PA 4KCTA 5IDIA 1EPVA 4PZVA 1E40A 2HJPA 3WNLA 2V69A 1NQKA 3WQ5A 1FY6A 2C71A 4Q4SA 5KTLA 1VD6A 1H5VA 6TAAA 4WUIA 1YDNA 3RCYA 2FKPA 3JZUA 4F40A 1NTHA 2QPSA 4GQ0A 1KKOA 3LERA 3R4IA 5A8GA 4LT9A 3V0TA 3WUEA 2QNEA 5DRIA 3H2AA 4XAYA 3N19B 3GKFA 3KOZA 1E4MM 1EO7A 4KRZA 2BB0A 2J24A 2GLKA 2Z0IA 3FS2A 3BK0A 1PAMA 1I1XA 5JH2A 2QCFA 3UESA 1B3XA 2WZEA 1SW7A 2PP3A 2GUUA 4IPPA 3HURA 3UP8A 5CGMA 1VC4A 3TU9A 1Q45A 4M7SA 4LUSB 3KCJA 2Y89A 5JMUA 3T55A 4MADA 3KEHA 5K4XA 1XKYA 1D2KA 1O68A 1OD8A 1UZDA 2G3IA 3NVDA 2JK2A 2YL9A 4UTTC 3V5OA 5T26A 1A3WA 4LCRA 1KFKA 3QY7A 1TWDA 5D8WA 4JZ5A 2BBFA 2VFEA 5D9NA 4QDWA 1A5SA 2PWFA 4GXPA 5MF5A 2VCAA 1G7VA 4IX2A 1AQ0A 3WBYA 3MANA 5A2AA 4IPJA 2WLYA 3FEMA 1W9PA 4M0XA 4LCSA 4LW7A 3ZLHA 4PTMA 5C2GA 4E8DA 1QBAA 1UWUA 4ZEPA 3LDVA 1JCTA 4ZB0A 4AF0B 1U5JA 1V6XA 2IS7A 3NYDA 2PSNA 2R91A 4TUFA 1XD0A 3OVRA 2OTDA 3NDOA 4ZQNA 1MEWA 2W92A 1KXQA 1TO3A 2E5DA 3K46A 4KRTA 5B7ZA 3HMCA 3SUSA 3QBUA 4AX7A 3JZEA 3NTYA 2QF7A 2VYOA 2YDRA 2D73A 2XUCA 3TYZA 1P1MA 3CU2A 3TYAA 1O1ZA 8CGTA 2E28A 3BQ6A 5FEWA 1GT8A 4IL2A 1R3TA 5DFAA 4PMQA 1XIIA 3AZTA 3IRDA 3DUGA 1GZGA 1WKFA 3C2RA 5M2FX 1TRDA 2QJNA 1YHTA 3LI0A 4NQ1A 3QR3A 3QMRA 4KT2A 5G2WA 3WJWA 4JNMA 1KFEA 4Y9MA 2G3MA 4EANA 5I2UA 1R7AA 4MNKA 1KTNA 3TMLA 1GVQA 3B8WA 4S3BA 1V6VA 1K7EA 3U9IA 1UWIA 3MCOA 4ZQCA 3UJEA 4H41A 4QS6A 3A13A 1L8NA 1AH3A 2EPKX 2XSAA 3T2QA 2NSOA 2XFRA 4DBUA 2B7OA 3ZIZA 1RPXA 5D05A 3CO8A 1O12A 3O07A 3AICA 4I90A 3BTNA 4PSPA 1R85A 2VENA 1XBVA 1AJ2A 1MXGA 3PPHA 1VPQA 3BANA 1J10A 2GJRA 4LAMA 1TB3A 1QT1A 4DJDA 2GDUA 1G0CA 3NR0A 3OBAA 1WUFA 1A49A 1NDVA 1KGXA 3SCPA 2A3BA 4FX6M 3HG2A 3BH4A 3TC3A 1GUVA 3G0XA 3O6AA 1XICA 3TZFA 1H51A 1PKNA 4J5NA 3QF0A 3A3HA 1ZZMA 4LVFA 3L4VA 4KWOA 1VCGA 1P6CA 2W62A 2REQA 3B8SA 4E2OA 4TXEA 2INZA 2CW6A 5HNNA 4CEXC 3T1GA 1YTEA 2OG9A 4JNZA 4C5ZA 4GKTA 3FGCB 1HTIA 1OY0A 1BLIA 1EBGA 2BDQA 4N9CA 5CAHA 5GNYA 1QNOA 4A22A 2XSXA 4IT1A 3HB9A 2PWGA 2BVYA 3OIXA 4XX6A 2Q8ZA 1XXXA 2XYLA 1QNRA 3S2MA 5C9UA 1BFNA 4GI6A 3VNJA 3F5LA 3WF1A 4TR9A 1IYXA 3CUIA 4A2RA 3B8TA 1RJQA 1TPDA 2YKKA 1OSEA 2YYUA 2C15A 4EF9A 1PTGA 8TIMA 2ANUA 1IEXA 3ARPA 1WDQA 2DIEA 2YDQA 4KFPA 4YXGA 4GVGA 5EPDA 3CGTA 5AHNA 2I7GA 1QUMA 2E9BA 4G2DA 3G3MA 3SCOA 4AXNA 3S1GA 3H2OA 3O0KA 4A8RA 2PGRA 1VBUA 4J28A 3VM7A 3L2LA 4UC5A 3PZTA 4LS2A 2VZUA 2V30A 2P0OA 4B2DA 4L4PA 5GJMA 2QT3A 5LYRA 1C91A 2P8CA 4I8DA 3W73A 3M07A 4Z08A 4NJGA 2GQAA 2IPFA 2W61A 3ITYA 1UR4A 2EKCA 5G4EA 2PTYA 4DN1A 4UTKA 1XFBA 4G7FA 1JPHA 2NXIA 2YL6A 1V0KA 3GFYA 1Z89A 3QRHA 3F2DA 1N82A 3BV7A 1V4YA 3UJ2A 4S3KA 1J2WA 1E4LA 3EOOA 1Q5MA 1Z32X 5F2IA 2ZWYA 2Z1SA 1J11A 1ZBKA 2BXVA 4IIFA 3KS5A 4GBUA 2DVTA 1TWIA 1T41A 2XINA 4JDYA 2X30A 4EF8A 5CZSA 3N2TA 3AZSA 4GHRA 1XJBA 3ITLA 3E5BA 4AD0A 3NGJA 3R8RA 4GINA 4WQ6A 3BJSA 3KLLA 4WIWA 2G96A 5BXTA 2WYSA 3VZZA 3BAIA 5FAJA 1MSSA 2G4JA 2EG7A 5BRQA 3POHA 1THFD 3WO8A 2NVDA 3CWOX 5G5IA 3ZXWA 1EDGA 3TUUA 1RBOB 4H3DA 3R0KA 3SECA 4GVFA 1MUWA 4N9BA 1NDZA 3T44A 3HZ3A 4PEEA 3HGJA 1SU5A 4YHEA 2G41A 5DO8A 3IGSA 3QGKC 1JEZA 1YDYA 4HPGA 1K77A 4A3UA 3UG4A 1US3A 1JI1A 3SGZA 2YZRA 2QKFA 3KWXA 3GE7A 5LA1A 4KEZA 3RU6A 1ZU8A 3A4AA 3M47A 1R7OA 3MYPA 4NZ5A 3UR7A 1W2PA 2FVKA 1P7TA 5CPQA 3N18A 2O56A 1XI3A 4ZOBA 1TPVA 1XYFA 1A3HA 3BVJA 3EPNA 3S5NA 3L12A 4W8BA 4MAZA 3GVGA 4NU7A 1ONEA 4D9PA 3GXDA 5EMMA 2VFDA 4DLMA 3ANYA 2HROA 1VLWA 4K1GA 3DGBA 4MJMA 1A4LA 5ABGA 3V35A 1XWYA 4DQWA 4NILA 3AXMA 3IVSA 3GXIA 1J18A 2DZUA 4US5D 3GG7A 3UF9A 2BGSA 3ZJKA 1GJUA 1UHVA 4LEFA 3P8IA 4J3VA 4HNLA 4LUTA 4MDPA 4C5YA 4IICA 3ZYZA 3CLMA 1REQA 5C55A 1CECA 3DYOA 1QXLA 2OX4A 3E5PA 3MCNA 4AWSA 3N6HA 1F07A 5T9CE 1W5QA 4DX3A 3BG5A 4PMJA 1XBYA 3W7HA 2PDKA 4YYCA 3W76A 3BO9A 3WEZA 4DM1A 1VGAA 3TCSA 2H3BA 1PKLA 3T0BA 3OBEA 2PDXA 3C2OA 1YBQA 3PC0A 1RH9A 3IIOA 4A35A 2JKPA 4J3SA 3W53A 2REQB 3E3HA 1Q6DA 3AIEA 2DT1A 2DZBA 1BXCA 5SWUA 3I6EA 3OQEA 1UH3A 3S2LA 4EACA 4ENLA 1HUVA 4GWEA 1H62A 4HHMA 1M03A 3RUBL 4O15A 5K9XA 1LJYA 3FVDA 3EX1A 5BRPA 1EPXA 3MC5A 5E9AA 1E70M 2PLMA 4JX4A 3WLIA 1BYAA 3B0VC 1SZRA 5E09A 2YL8A 3BC9A 4NSBA 1IWAA 2R6OA 4LGXA 4MNJA 1L6WA 1PDZA 1XFCA 2ZTKA 4ATDA 4IFKB 2INEA 4PUUA 3S83A 4XAPA 3CASA 2PDGA 3C8FA 2TODA 1JDEA 1W9BM 2ONEA 3KOXA 1XIEA 4FP1A 3P3BA 4W9TA 1MFVA 1I2NA 4GFSA 5LA0A 5A6SA 5LNUA 1PPIA 5I06A 4B9ZA 2X1TA 3TDFA 5A8NA 2HS6A 3Q45A 3GX9A 3GUGA 1SO4A 2J7HA 1B57A 2DPEA 2VL4A 4QR6A 1H09A 1LORA 3WQWA 4F0LA 3MKCA 2WWDA 1XLFA 3GFZA 4QJ5B 1QI2A 4ZOAA 1LL7A 3A64A 2V2DA 4Q22A 5AN7A 2GJLA 2CWXA 4UXDA 4I9TA 1VYPX 5G2HA 1XSIA 3KWSA 1XCXA 5I24A 2A7NA 2GWNA 5TQLA 4UTWA 4AMAA 3WG6A 1B9BA 5HR7A 3SBFA 2R24A 3PNUA 5I09A 1LOLA 3MUAA 3QTPA 3DDMA 1CGWA 4K36A 1XIMA 3LLDA 4MB3A 4MJZA 1PZ2A 3PZNA 4B5WA 3H7UA 3W2LA 4LAUA 3HFYA 1V3MA 4CKQA 3A9IA 1WV2A 4QAIA 3QM3A 1WXYA 1HT6A 1XLMA 2PDCA 3BMVA 4Y8FA 1FWBC 2P3ZA 1LCOA 2J75A 1GKRA 2BOFX 1CXHA 3LPFA 3ENLA 2CFFA 4OHQA 2HBXA 2FZMA 3DCPA 4AVNA 4RNJA 4HNTA 2X0HA 1RPKA 4DXXA 4CLMA 2QDHA 2EG8A 4C6FA 2V5KA 3GG8A 4RZ5A 3PBVA 2VKZG 2GPTA 4QP0A 1KBBA 2OXNA 1GW9A 3S5YA 1H1NA 2QHAA 4JOMA 4LX4A 5C70A 4IPIA 2A79A 3P5ZA 4P7RA 1J0YA 1EQPA 1S2TA 5GPRA 4OWGA 3TN3A 3N34A 3VNZA 1KTBA 4GOAA 1JG9A 1P7TB 3A9BA 3TCEA 1VFUA 4QROA 4N02A 2Q3RA 3K4WA 4QBXA 5A6LA 4ZB2A 1XP3A 2ACUA 1XCFA 4G5DA 4IQLA 2G3FA 3NQ2A 3WLJA 3RR4A 3W85A 4XD6A 3VKBA 2ZVRA 3BJTA 3PWAA 4HCDA 1FH7A 4AZBA 1ISWA 2IKIA 2QUUA 4OBTA 4B5SA 1NFBA 5LGXA 3KRSA 3DEQA 3EPMA 7TAAA 1NEYA 1K03A 1AD4A 1ZRQA 1QOQA 3JU2A 1HKVA 4O1BA 4RX0A 3STGA 2ZX7A 4LUTB 4UTFA 1WZAA 1U1JA 4DNMA 1REQB 1EJVC 3OU8A 1IEVA 4X9SA 2NV9A 3QKEA 3QMTA 4URIA 5T91A 3C2EA 4XD3A 1W3JA 1G4SA 4N9EA 3CZJA 3EYPA 4KF1A 1J9YA 2VI0A 6ENLA 4I6VA 4M51A 1PBGA 3P84A 3F7JA 1TJ0A 4BA0A 2D3NA 1YBQB 4F0SA 3UR2A 2Q3OA 3DFYA 3S9YA 4R9OA 3QFWA 3S9IA 1D7FA 1TIMA 3THDA 4CD7A 2FJKA 5BOEA 3GNDA 3CHCA 4H83A 3LSCA 2QS8A 1A47A 2W63A 4YS1A 1V6YA 1X1OA 2WZMA 5I03A 2OWWA 4E4UA 3LMYA 1IT8A 3NQFA 3I7SA 2AMXA 1DXEA 1RCXB 3Q2DA 1OFEA 2Z1XA 1M5WA 3CPRA 3L9CA 2QJMA 1GK8A 1XDJA 1GVRA 4IHCA 1R38A 4IWWA 3EWZA 2BVWA 3EWBX 1E9ZB 3H8AA 2CU0A 2Z2UA 3PB0A 1DL3A 3ARQA 1WPCA 1DOSA 1P6WA 4NASA 3KRZA 3SUWA 1R2TA 7XIMA 1DQUA 1ZNNA 1Y5WA 3VABA 4AIOA 4Y9AA 4D6JA 3CC1A 4BF9A 4AMCA 3OHIA 2QUVA 5CC5A 1BF2A 1JZ8A 4FF5A 4LBRA 3HG3A 3AFBA 4N4PA 1JPKA 3UA3A 4PN2A 4GMEA 1OD0A 4QFUA 3AMKA 2PRLA 1QO5A 5D02A 4J9JA 1MDRA 3NPVA 3IIVA 4PMUA 3OVPA 5D9MA 1IEWA 2VTFA 4IF2A 3SGUA 3BW2A 1WDPA 4KH2A 2DW6A 5D09A 4ZFMA 1E6XM 1PX4A 5B7YA 1A5LC 3LX9A 3GW3A 2PDIA 4HA3A 3LMZA 4TX6A 2VZOA 1VBRA 4QG8A 4JFUA 2ZBTA 3V5CA 1WZMA 2PGEA 4O57A 3E2VA 1S1RA 3DI0A 4K37A 3VIKA 3U2OA 3TNBA 2UZ9A 4DAFA 3CQHA 3O9NA 2DZXA 4W7UA 3TFCA 1DE6A 1XIDA 2WLZA 1JFHA 1F2JA 1W37A 1W56A 2Y24A 1GTEA 4PTXA 1E51A 1E9LA 4JTKA 5CPTA 3RRXA 1XGZA 3M0HA 1E1FA 2OGYA 1DTNA 3LZ5A 4H9UA 1SSDA 1YRRA 4I7WA 2VVSA 3VO0A 3E0LA 4QXIA 3PZGA 4GO9A 2VMFA 2WNQA 4AWUA 2F6UA 4TQTA 1JUEA 3TSDA 4F48A 4RJEA 1QNSA 3G77A 3CNYA 3R10A 2HE5A 4FMVA 3WQ4A 1UD8A 3WQPA 3LENA 3E6EA 3JRKA 4L4OA 1T0OA 1UQYA 4OQVA 3OZMA 3HU7A 1O66A 1CYGA 3RLUA 1KBIA 4JX6A 2YYTA 3OQ8A 1GKQA 3IUIA 3O7UA 4C1LA 4UNLA 4FLRA 4A3HA 3OB8A 2YGYA 2AGTA 1H7XA 1X8FA 2VWTA 3UGRA 2CIPA 3VDCA 1TWWA 2OR2A 3WH9A 2Q8XA 3IJDA 4JTLA 1TPFA 3UYCA 1OFBA 4E5TA 1TUFA 1O94A 1X8CA 2R94A 1TJRA 3LXBA 1VFSA 3WF3A 1NWUA 4GIEA 5I3FA 4D8LA 2FTYA 4P7NA 5HQLA 4GJ1A 4DELA 1YKWA 1GYLA 2FZDA 1VFMA 3WUGA 2ZX6A 2XM2A 4GIYA 1QBBA 1R8LA 3R89A 1QPQA 1MXSA 1TVPA 4JL1A 4RE2A 3DC8A 4MLRA 4E2DA 3HG5A 1PZ0A 3K13A 3GNXA 3SEPA 3L5LA 2VQUA 3F2BA 1KD0A 4JIRA 4QQUA 3F03K 4UCFA 4XVEA 3MUXA 3AHVA 1KKRA 4IXXA 4DUWA 1H41A 3I3EA 4ILSA 3NYZA 4M6UA 1TJ2A 2J7DA 1C29A 3H22A 2AKMA 3NQDA 1ISXA 2QIIA 3B0XA 2PA6A 1LT7A 5H6HA 4GPNA 4ADTA 3UPBA 1L0PA 1JRCA 2QDEA 1SO3A 4PRWA 1VR6A 3VOIA 4L9XA 4Q8WA 4YTUA 4WCJA 1FWAC 9XIMA 2X16A 4GUHA 3P14A 2PP1A 3PS7A 2PDJA 4IMFA 2DUAA 1K3UA 2X1UA 1L2UA 1OX6A 4UCGA 3UG5A 1PIIA 3MHFA 1UQZA 1HKWA 2NLIA 4PUNA 4PMRA 3K2GA 1V7YA 5D33A 4N42A 3W24A 2A3CA 4G56A 4JPGA 1XX1A 4Z1DA 1XPGA 3F4WA 4P7LA 1VYSX 1MNSA 4EXAA 3DYPA 3S5SA 3T08A 1LZOA 3MJYA 2DQWA 4ZXLA 3GIPA 3IK4A 1XG3A 2HK0A 1P4CA 5ABHA 3SIZA 1YTDA 2DORA 2QMJA 1M9HA 2Z6JA 3EKZA 8A3HA 4QE1A 3SCQA 3QW3A 3BCFA 1DJQA 3NGFA 3A3WA 3MHGA 4WGHA 2YXGA 4D6IA 3L65A 3W7GA 2D0FA 3QHMA 1XIJA 2PDQA 2G50A 3OOQA 3PZ9A 1QHZA 3EWUA 3AU2A 3SY5A 4J35A 1OFRA 3HGRA 1B9ZA 2WMKA 4OTKA 4UNIA 5BOFA 2JGQA 5LSMA 4EIVA 4ZE4A 3B0YA 1V5XA 4DAIA 1EHNA 1MW2A 2VJXA 3VOJA 4EP8C 1V0NA 2V3GA 1XHGA 2PGWA 5DXYA 2VC5A 1E15A 1F8IA 4HSNA 1E55A 5CSYA 3VNMA 3LCXA 5CCZA 1OYBA 4GQGA 2JE8A 4HPHA 3KM8A 4DPQA 2RDXA 2Y1HA 4EWND 3SQMA 1F6YA 3DKJA 1QW7A 4ZODA 3BARA 2GOUA 3CQKA 2W9MA 1HGYA 2PBGA 5D4YA 3LHWA 1FXQA 4E0CA 3CV6A 4E4FA 3HO8A 2FMOA 4MF4A 4C1NA 4C60A 3AYSA 4O53A 4AAJA 2J66A 4B15A 1I6NA 1KRMA 1TPB1 3GS6A 1D7KA 3ZT6A 3NM3A 2QUTA 1NF7A 3H55A 3W23A 1R3YA 2DV0A 2W27A 4X61A 3DN5A 3VD3A 4TV6A 5G1MA 5AHFA 2OKOA 3BXWA 4HCHA 1NWTA 3ATZA 1JF6A 1UWSA 2DZPA 2DP3A 4ZQRA 3N2