4RXFA

Fructose-6-phosphate aldolase y131f from e.coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
220
Chain Sequence
b'HELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPFVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-6-phosphate aldolase 1
publication title Acid Base Catalyst Discriminates between a Fructose 6-Phosphate Aldolase and a Transaldolase
doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 77
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rxfA00
4WJEA 3NOEA 3DENA 3LCXA 1VR6A 2WOQA 2WSQA 1FWNA 4NX0A 3PG8A 4FX7A 4K37A 1P0KA 5HINA 3T55A 2NLIA 3F4NA 2ZRVA 4FNRA 3I68A 1UB3A 5DCEA 1ALDA 4LRTA 1H7XA 4O15A 1F73A 1LRQA 3TW6A 2C3ZA 2QKFA 3UWWA 1O60A 3PBWA 2A0NA 3B06A 3N19B 5KZEA 1KW1A 2H6RA 3CQ0A 1LBMA 4UIOA 5LGXA 4XKYA 3L0NA 3O6YX 3T44A 3MJYA 2VFHA 1R2SA 4UTTC 5F4SA 4K7YA 1PV8A 1KM5A 3DFSA 3HG2A 4S2BA 3DFTA 5KMYA 3DI0A 1RQHA 3TMQA 5J5RA 2HMCA 4O54A 2FPYA 4UFMA 1N55A 1GVFA 1N8FA 3R89A 1LOSA 4AXKA 1OFAA 2Y70A 3LTSA 3GXTA 1L6SA 1GOXA 5I3GA 2DJXA 3WFAA 2W79A 3R12A 3ABOA 4FNTA 4N9CA 2FDSA 1G7VA 1QDSA 3PUEA 4LVAA 3QMSA 3MBDA 5D2YA 3W22A 5E0KA 1B9BA 3GDTA 2QF7A 3KVLA 4LNYA 5F2IA 3FYPA 2B4GA 3TIMA 1HO1A 1EB3A 1LROA 3SIZA 3NDOA 1AG1O 2Y7FA 1Z48A 1VCGA 3JRKA 4IOTA 3HPSA 3TFXA 3N3MA 1TYGA 4O1CA 1W0MA 1S3HA 4ZMGA 1LOLA 2VEMA 1H1YA 3W1QA 1D3GA 2VEPA 3C2EA 3T40A 4OQVA 4E2DA 2RDUA 3GR7A 1G4SA 1EP2A 3S1XA 1LDCA 2E6YA 2BWGA 3W88A 3Q94A 3JS3A 4TU1A 4DO6A 4JY8A 3HPXA 5U4NA 4Z08A 3HJZA 2FPVA 3S0CA 4QNEA 4JTLA 2C1HA 1JQXA 3A9IA 1NF7A 2ABBA 3GIYA 4JGDA 3LBMA 3L5MA 2ZZ1A 4Y96A 3CC1A 3CIXA 4DF2A 3HIJA 1KFEA 4MYXA 1LRNA 5D2XA 3WK0A 3EXTA 1A5CA 3C52A 3G1YA 4WY0F 5H91A 4O1AA 2QCDB 1ICPA 2CLEA 1OF6A 3B0PA 3HB9A 1IGSA 4L4LA 3W7LA 3QZEA 4QJ1A 1RQBA 1O5XA 3EB2A 1XDLA 1I2RA 3PBYA 1KM4A 3PS7A 3V75A 4JEQA 1G6CA 1XBVA 3M44A 3TUUA 1GZGA 4IXXA 3WK3A 2ZZ2A 4A2SA 4LVBA 3GKFA 1UBSA 3QMRA 3DAQA 4UTWA 1EUAA 3W2NA 1ZAJA 3W2JA 1GQNA 2JKEA 4P61A 4PEKA 1EWEA 2TSYA 1KFCA 3G0UA 1A53A 2UV8G 4G1KA 3F03K 1WBHA 2CWNA 2BXVA 2CLKA 3E0IA 3NQ6A 1L6YA 3QW4B 4QIUA 1OABA 5G2WA 1FDYA 1SW3A 3G1DA 3O8AA 3DFPA 2DZTA 2YW4A 2WNZA 4QITA 2I14A 4IMGA 3WJXA 3QQ1A 1SFJA 3W1UA 4JYEA 4N6FA 4JN6A 1SZNA 2V5LA 3TU9A 3UPWA 4DXVA 1MEHA 3C56A 3LXCA 3P5YA 3LI0A 4KFNA 5C5YA 2C18A 2EPHA 4K36A 3G24A 2Z1BA 2ZZ3A 3W2MA 2QUVA 2ZZ7A 2H3BA 3W23A 3LHWA 2QCFA 1GVRA 3OG3A 5DBUA 4DEFA 1CI1A 4X9SA 1TTQA 3NPXA 5DLCA 4EOUA 1B4EA 2RDWA 2HS6A 4O14A 1UJPA 3S1WA 1SSDA 1LP6A 1EX5A 4QAIA 4IX2A 4K8HA 5C55A 5SWUA 3QH2A 3FS2A 3EX2A 1FDJA 2QCDA 3M6YA 3W7OA 3B05A 2B7QA 3DHDA 1W3NA 4GUGA 3DBPA 3ATZA 1GTHA 3DFQA 2RHGA 2ABAA 1XDMA 3M1ZA 3MW7A 4IMDA 1JVNA 1JCMP 4HHPA 3W07A 2GJNA 3W70A 5CZ0A 4KFOA 3B04A 3P81A 3MWAA 4O57A 4CLMA 5FF4A 3BLFA 1O95A 2QCCA 3QYQA 3TAOA 4CCDA 1LRTA 1QPOA 3PUOA 2X2GA 2QCMA 2ZZ6A 1I2QA 2ATSA 1KM1A 2V2CA 4ORIA 3P5ZA 3PVFA 1TV5A 3TXZA 2C19A 4MZYA 3A21A 5LHEA 4PL2A 1YTDA 2ATMA 1C29A 5AHFA 3Q2DA 3M43A 3B0UX 4GBUA 3EWUA 2OJPA 1F7BA 1RZMA 3RU6A 2VEKA 5AC8A 3LCHA 4FNSA 3BO9A 1GWJA 4OV9A 1EP3A 1M6JA 4OT7A 4UUIA 3BG5A 5EPDA 2JGQA 1HG3A 1XUUA 3TK7A 1WDWA 1JR1A 1RV8A 1H7OA 3CT7A 1SQ7A 4LY8A 4O53A 2W0UA 5L9FA 4BFAA 1OX4A 1AL8A 3TXVA 2Y63A 3L0GA 2QAFA 1WV2A 2V5BA 1LZOA 2PC4A 3CU2A 4TR9A 4QSHA 4ZQPA 4RXGA 3M41A 1KTNA 1XC4A 3S5OA 5DBTA 2NUXA 2Y61A 3TR2A 4BF9A 3HPZA 4MIMA 1D9EA 5K4ZA 1J5TA 2DJLA 4RZ6A 3BGGA 4JS3A 1OFOA 3GDRA 1P1XA 1TJPA 1XUZA 3L21A 2QR6A 1DHPA 1KTCA 2ZRWA 4Z1AA 3LGEA 4AB4A 2G95A 3QSRA 2LLEA 3W75A 3GK0A 4IMCA 4LVGA 1AW1A 1MEWA 3IVSA 1O4UA 2NX3A 3GR8A 1I2NA 2A5HA 3UD6A 3LI1A 4JYDA 2E6FA 1DBTA 1PL9A 2Y7DA 3A5VA 4NVTA 3TC7A 4TMBA 5DELA 4O16A 3TNOA 2NV1A 3KVJA 1P4CA 2GVJA 1MO0A 3PM6A 5EBUA 2A1YA 4K38A 4EVZA 5F2LA 3NA8A 3W85A 4H6KA 3VFLA 3IIXA 3HMJG 3KOFA 5D03A 1WBJA 1WYIA 3G3MA 4N4PA 3NG3A 2P10A 3P67A 4N9DA 4I7WA 3C3NA 4JX6A 3S42A 3S6DA 3BG3A 1NEYA 4AF0B 4RZ4A 1T99A 3W71A 1QFEA 3SSJA 4Y90A 4Z1DA 1LYXA 1YDNA 4IPJA 3UZJA 1PCKA 3DKLA 1H51A 5DN1A 5LZLA 1GYLA 3W7GA 1CX9A 1SR9A 3O6CA 1XI3A 1GTEA 3P62A 3KHJA 3R5EA 3KAOA 3LRKA 1YDOA 1ZCOA 4FNQA 5LNVA 1LTDA 1JRCA 3LHVA 4HPJA 2VC6A 1TSIA 2PRMA 1LLZA 4X3ZA 2ZQ0A 3C0JA 2WKJA 2E6DA 2ZZ5A 2NXHA 1V5XA 1IIGA 5D2WA 3QW3A 4Y6GA 1VHNA 2A4AA 4XZ9A 4HPXA 4PFMA 3RK8A 1EA0A 1JCJA 1TPFA 3ZR4A 2H3DA 3R8RA 3NQEA 1B3OA 5IM51 3P82A 5CPLA 4JTFA 5KITA 3G1SA 2Q3RA 2VXNA 2WNNA 4O52A 3M5YA 3G1FA 4XBKA 2GVLA 3PULA 1KV8A 5FI8A 3LXAA 3RFAA 4HNNA 5FEXA 4UFKA 3UYCA 2P0OA 5D02A 4RK8A 3E96A 4O1DA 2QUUA 3QJAA 1YPFA 1K03A 4FEZA 4UFIA 4Z1BA 1K02A 5BMWA 4IXHA 4WY0B 2DZSA 4OBTA 1VH7A 4WX2A 3GB6A 3HG4A 1G69A 4NJGA 3PB2A 4BI7A 1X6UA 5EL1A 1V7YA 4UNLA 4YLWA 5G2HA 4K8EA 2QDGA 3MP4A 4K6AA 5AYXA 2A7PA 3STFA 3W7CA 3V1PA 4P2VA 3NL5A 2Y62A 1P5BA 5C2XA 1OYAA 1QPNA 4A22A 1FUYA 1I8JA 4ZVJA 5LNRA 2ZCGA 1ME7A 4NU7A 4BWLC 4NNAA 4AF0A 3VI2A 1W8SA 4UTJA 3W76A 4KWVA 4IQLA 1SFLA 4KKXA 2F7FA 3ANYA 2FIQA 1FCUA 3YPIA 1M7PA 4JR5A 2ZFAA 1JCXA 5LKYA 1N7KA 5E1QA 3W2LA 1RVGA 1VYPX 1SO6A 3RMJA 3EKZA 3LERA 1Q6RA 3L5AA 2ZRXA 1RD5A 1I2OA 1U83A 2EKCA 4YL2A 4JTUA 3UWQA 3W72A 3ZWTA 4E0CA 1F76A 5GVJA 4B5NA 2YDAA 4O18A 1ICQA 1H7NA 2XFWA 3QPYA 1H61A 4LTSA 3S1VA 3KVKA 4NZJA 2E1DA 2WSYA 1OFPA 3W7PA 4QM1A 5AFDA 2VELA 1ME9A 3N9RA 1IXNA 2YFNA 3UNDA 1C9DA 4EWND 2C16A 3IVUA 2QCGA 5T26A 1JJKA 4ADSA 5AB3A 3WJSA 3SGUA 3NQMA 3VKJA 1LBLA 1QOQA 4JNMA 5G1YA 1DOSA 3W1MA 2FFCA 3T7VA 2PRHA 2YSWA 4WY0A 3L67A 2E5CA 1BTMA 1KFKA 3P61A 1FBAA 3EWXA 3W7DA 5F4WA 5HNRA 4S1FA 2ZDRA 3U8GA 2I9EA 1OFDA 1RR2A 1ZJIA 3M5VA 1F5ZA 4FXRA 4O12A 5CPMA 3BW2A 1GYNA 5FEWA 4MJMA 3W7RA 3HF3A 4ZQMA 4NJKA 1P0NA 3UY7A 5G4WA 1ME8A 1ZAHA 2QDHA 3C2RA 5K2ZA 1FX6A 3SGZA 2J88A 4RX0A 1B57A 4LVDA 4RV8A 4Y9AA 4LV9A 2NZLA 6TIMA 5HWJA 3ZWSA 4FX8A 4HIBA 4XBSA 3NQFA 1KLYA 1THFD 5IBXA 4AWUA 3DU0A 2Z0IA 2NWSA 2O7SA 4M19A 1R2TA 4AMAA 4ALDA 5CPOA 3PSWA 3H54A 4NZFA 3W1LA 1HL2A 2FJKA 1OFBA 3BW3A 1YDVA 3W7MA 3W7HA 4LUJA 1YXDA 3TX9A 3EX6A 1UASA 1SO5A 1TPWA 2YYUA 5CKSA 4RKAA 4N02A 2PURA 3HGRA 4D2JA 1TPUA 2CLFA 4QISA 4R34A 5AC6A 4FNPA 4L4MA 2FB2A 4JYFA 1XXXA 3O6DA 3SR7A 4NQ1A 2QJIA 4YXGA 2FTPA 3NAVA 3HGOA 4Z1CA 3MBFA 1WAUA 3GKAA 3INPA 5TBOA 3DFNA 1X8FA 3LM7A 2HTMA 1L2UA 4I7UA 1G4EA 3M5ZA 1VZWA 4NJHA 3C4UA 3OA3A 3GDKA 4A3UA 3GX9A 1H50A 2CU0A 2E5DA 2XN1A 5F1VA 4MY1A 3RLVA 5FESA 3STCA 3SY5A 3NQCA 4U4MA 1MEIA 3PY2A 5FEPA 4YCOA 3TAKA 1FXPA 3TC6A 4AWTA 4LT9A 2I1OA 4R7JA 5G1TA 3P84A 1Z41A 2X1TA 2VEIA 5DCBA 2DZWA 1PVNA 4ADTA 2Y6ZA 3GAYA 1L9WA 4PH6A 5HR6A 5CG7A 4JY9A 1GG1A 2DP3A 1PIIA 1TREA 4JTSA 4XTDA 4S2CA 1NAL1 1M5WA 4AAJA 3BV4A 2JK2A 2Q8ZA 1FCVA 1SUXA 2WPBA 3NL2A 4UTWC 1SU5A 5LSMA 1O94A 4N9EA 5D2TA 4YWIA 2J6XA 3I6RA 3FYOA 2BX7A 3NO5A 1YTEA 5DY3A 3EEGA 3NPWA 1QO5A 3SZ8A 5EMUA 3C2FA 3NM3A 5MHBA 4UCGA 4DF1A 5BW6A 4JDBA 1RPXA 3P74A 4OE7A 4O28A 3THAA 1TMHA 3EX4A 3G1VA 2GOUA 4TO8A 3W7KA 3QQ0A 1W5OA 3NYZA 4A2RA 4UNKA 1KTBA 4CCEA 2C6QA 2O7QA 4HNUA 3W73A 1I4NA 3PSVA 2G97A 1PCWA 2ZTJA 4NJJA 1OYCA 2NUYA 5K3VA 1WOBA 2Y89A 5AOUA 4DBEA 1AMKA 3MYPA 4UTIA 5HMSA 3NEVA 4Q33A 5LNWA 1YADA 2J9ZA 3L5LA 1X1ZA 3IV3A 1LBFA 4GRSA 3O15A 4HSNA 4N6EA 1W56A 2TRSA 3LB0A 3MI6A 4UFJA 4JIPA 1FQ0A 1MXSA 1QPRA 4LS2A 5I3JA 1KM3A 5HWNA 3WK1A 2X30A 1QO2A 3M16A 4O8RA 3TH6A 3W7QA 1YTKA 3GDLA 4JTGA 4LC8A 1VJIA 1TTJA 5HUOA 2R8WA 3STEA 4ONVA 1W5MA 1VC4A 1KM6A 3E02A 4MVAA 1U5JA 1WX0A 1XBXA 3WJYA 1IXOA 3FKKA 3OVPA 2C14A 4GC4A 3NQ2A 4J9JA 1VQTA 3BVJA 6ALDA 3IVTA 2X1UA 2GJLA 3GNNA 1G4PA 3TW7A 1JULA 1TPH1 2E5BA 5BRBA 1K8YA 1DL3A 1FWTA 1BWLA 4JX5A 4FIRA 4UTKA 4O4VA 1EPXA 1H5YA 2P1FA 1KFJA 2X16A 2EAWA 1OFEA 3BPWA 3LXBA 4HKPA 3TJXA 1IXPA 4UR7A 4UTHA 3PB0A 3ABQA 4FXSA 5BNKA 3PBVA 4DPQA 5HJLA 4ORMA 3JR2A 3NXFA 3TSMA 2CLLA 3QMTA 2GPTA 4CNOA 1KV5A 3W3OA 4JTTA 2OX1A 3PWAA 4NX5A 2V8ZA 1G67A 2QJGA 1FXQA 4MYAA 3T4CA 3OVQA 3P60A 2QCLA 4AWSA 3IIVA 4UXDA 5I3IA 5HULA 3C2VA 4Q32A 2B7NA 4RJEA 3W7IA 1J4EA 2WO5A 2TMDA 2NUWA 4MFEA 2VFDA 3TMLA 4K7VA 3CB8A 1ML1A 4GUIA 1PHQA 4AHOA 2YX0A 2JBMA 3PG9A 3UZ5A 1RQEA 5F1UA 1AL7A 3BLEA 4MOZA 2PE4A 3W74A 4WOZA 1AW5A 3W6YA 1LLWA 1EP1A 3TJLA 2V30A 2RKXA 3P8IA 2GQ8A 4TMCA 3B4UA 4O1BA 1W5NA 3M7WA 2Z2UA 4NUWA 4OU1A 5D09A 3THQA 3CM4A 1TIMA 3LOTA 1OG0A 1A5SA 1OF8A 4R33A 4FIQA 4UFHA 4RR4A 1A5AA 3LX9A 1K8ZA 2CZDA 1UUMA 2RH9A 1TQJA 3DZ1A 3NPUA 2RDTA 1KBIA 4U28A 2H8ZA 4PODA 2ZRUA 1ZNNA 1H7WA 1S5VA 2Y88A 2GUUA 1R46A 3BG9A 4HN4A 2Q3OA 2VFGA 2NX9A 3HBLA 4BI5A 1Q6OA 3HG3A 3LHTA 2EHHA 4JTIA 5CZTA 1SO3A 5HR7A 3O05A 2ALDA 1ZENA 1SZFA 4AVFA 3KX6A 1H7RA 4H3DA 3G0XA 2IQTA 1JCLA 3S5YA 1S5WA 4MKNA 2FB3A 3NL6A 3L9CA 2EGZA 2A7RA 5CSSA 5CSRA 1LORA 1R30A 4IMFA 3W9ZA 2B7OA 2V82A 3E12A 1QNVA 4TX9A 3R2GA 4M5PA 3UWZA 3FFSA 4ZQCA 1SW7A 4LC6A 3LLDA 5J5DA 2A21A 2ZBTA 1VRDA 3UXDA 3S9YA 2GQ9A 3W2KA 3GVGA 1F6KA 1GJPA 4GFSA 1XKYA 4NNCA 3KRZA 4JX4A 5KTLA 2NXIA 3W87A 1JCYA 3A5FA 5DXXA 3LHUA 3K30A 5D04C 1K3UA 1K8XA 1Q45A 3NQ8A 3TSBA 1NFBA 3NQVA 3S5ZA 3EXSA 2R94A 4XTIA 5D37A 3HO8A 4XKYB 2YYTA 2DZUA 4FX6M 1LCOA 2DZVA 3MI3A 3LV6A 3HGSA 4AEOA 2VFFA 1R2RA 1T96A 4A29A 4UR8A 2NX1A 2V2HA 4GUHA 2VKZG 1PHWA 3DH7A 5AC7A 4PA8A 3A24A 1GT8A 4IWWA 2H90A 3EWWA 1TPDA 3OEXA 1GVQA 1KA9F 1SZEA 3ZFHA 3TA6A 1OX5A 2JKAA 4IX0A 3FKRA 1TB3A 4Z0JA 1NSJA 3I7SA 3NQ7A 5D38A 1NF0A 3LV5A 3TQVA 1KFLA 1AW2A 1XBYA 1Q6LA 3BW4A 4KWWA 1HFBA 3PR2A 3BK0A 4O0KA 4RXFA 3CEUA 1GVSA 3KVMA 4UC5A 4O0ZA 3G1AA 5K9DA 3G0SA 5D30A 4EF9A 4M7SA 1VYSX 1QMLA 1VGAA 1W5QA 3M47A 4LS0A 3TSDA 4W9TA 2J9YA 3WK2A 4C1KA 4IUOA 3KXQA 4ZZ9A 1F6PA 1TRIA 4Z0SA 3G3DA 1TRDA 3LCGA 3AO0A 3IGUA 5LHFA 3L68A 3WJWA 4BK9A 3CHVA 4N2YA 2ZA1A 4MLJA 4PCFA 4IPIA 1EIXA 2CFFA 3MHGA 3NPVA 3RF9A 1TTIA 4H4IA 1W5PA 4OWGA 3MHFA 2QCHA 4N9BA 3SFKA 3EXRA 4MY8A 1NVMA 2G5WA 4UTTA 1DJQA 3G8RA 1JUEA 3MP3A 3D0CA 3NR0A 1H62A 4FHAA 3N34A 5KINA 5DY2A 1A5BA 1FCBA 1FCQA 5ABTA 1DQXA 3AJXA 4TIMA 1TJRA 4AHPA 4IJBA 3LCIA 3N73A 4XUGA 1ZAIA 3G8EA 1T0OA 2XN2A 2WNQA 1VCVA 1GEQA 2YXGA 1FWRA 1QCWA 1SZGA 4MPQA 5FEZA 4HNVA 1R47A 3GZ3A 3VE9A 2F84A 1YLVA 2KZHA 4O17A 3C8FA 2ZRZA 4MY9A 5FF3A 2ZYFA 5CPNA 4HNTA 2EF9A 1ZFJA 3G22A 1VHCA 4MFDA 4WD0A 1WXJA 5KZMA 3MUXA 3EWZA 3UY8A 2OCZA 1MZHA 4GUFA 5G2IA 3RNDA 4DBDA 2A7NA 4WZHA 1M7OA 3VNDA 3LRLA 2D73A 2C0AA 2TPSA 1OHLA 5A5WA 3GYEA 3W83A 3MO7A 5D33A 4JTJA 3FA5A 1H7PA 3C2OA 3OBKA 5AYZA 1SPQA 4JD4A 3E9AA 3PC0A 4AHQA 5F2MA 1W37A 3LCFA 3LTPA 4LOCA 1UUOA 3HQ1A 5F4XA 3BARA 4EF8A 1K7XA 2NXGA 1G4TA 4PC8A 3SJ3A 5IBXC 4CNPA 1BEUA 1FDZA 5TQLA 1DKWA 5BMXA 3CPRA 5KZDA 5DCDA 3IIZA 3USBA 5D32A 1BKSA 2X1SA 5AHLA 3KRUA 4LW7A 4M6PA 1L6WA 3LCLA 5G5IA 1OK4A 5C6MA 4DPPA 3UWUA 2G96A 4ML9A 4HSOA 2OZ0A 1GG0A 1TPEA 5AYYA 4FB7A 3NQAA 1YPIA 2ZRYA 2V2DA 4M6QA 1Q6QA 4BR1A 2CLHA 3TROA 2DORA 3FEMA 4GNJA 3GNDA 3QF0A 5D2VA 4CQ9A 2QJHA 1F74A 2Z6IA 5HQEA 1ONRA 2VENA 3B0VC 4YCPA 1FY6A 2A6NA 4O4WA 1KFBA 4POCA 1Y0EA 1JQVA 5E93A 3LHZA 4R53A 1EWDA 3QRHA 4ZQRA 4AH7A 4A21A 1TPB1 4BI6A 3A23A 4GJ1A 4WQ6A 4WOQA 1QR7A 2CZFA 4JDYA 5AHNA 4DO5A 3ABSA 3CTLA 3N14A 1F2JA 5A8GA 3GXNA 1Q3NA 5EA9A 2VFEA 5H2ZA 3SI9A 1HUVA 1W31A 5LGZA 3O06A 2X1RA 3O1NA 2C15A 2A2IA 1VYRA 3TV8A 5AHEA 3F4WA 4O50A 1Z44A 5LNUA 3P80A 5CZSA 5HWMA 1E51A 2QCEA 1OYBA 4DQWA 4JTKA 3S5NA 4WUIA 3W1RA 3N9SA 4CQAA 4O10A 1OX4B 3H55A 1OX6A 3PAJA 1A50A 3HG5A 4QQ3A 4I9AA 4LV4A 2Y7EA 1SW0A 4FNUA 2CLOA 1QWGA 4FF7A 1VS1A 2YGYA 3L2IA 4K39A 2Q8LA 3TFCA 4X22A 1W54A 4NXSA 2ZZ4A 1ZY9A 3NQDA 1H63A 3MMTA 5I3FA 2ZTKA 3CLMA 1WQ5A 1QAPA 1TPVA 1G7UA 2J24A 4GE8A 4LUIA 3RLUA 3ABRA 1H60A 3IIPA 3S1UA 1J2WA 4C1LA 3EWBX 1OFQA 3QFEA 1D3HA 3QC3A 2GQAA 2CLIA 1OK6A 2J27A 7TIMA 2B0MA 2AAMA 2B7PA 3U6WA 2DZPA 2PCQA 2AQWA 3HGJA 3ELFA 3BLIA 4JICA 2E6AA 8TIMA 3DKJA 3NL3A 1T8XA 3TCEA 1GVOA 3B03A 5AN7A 3T78A 4ICNA 1B4KA 4MJZA 4DELA 3CEPA 1OJXA 1VCFA 3WJZA 1W1ZA 1LM1A 3TQ0A 5C54A 3TQKA 3P8JA 2JKPA 5AHIA 1UCWA 2ISWA 4EIVA 3STGA 1HTIA 3MP5A 3W1PA 2WQPA 3SECA 4ZQNA 4WXZA 3MI2A 4LRSA 3SW6A 1TCDA 4HT3A 4CCCA 3NQGA 4Q4KA 1VPXA 1KM2A 1MSSA 2NWRA 1PS9A 3LBCA 3LCWA 4N4QA 3CWNA 3MHUA 5FF7A 3I7QA 1BWKA 5FF2A 1SO4A 4RZ5A 2GVGA 2ZA3A 4JXCA 2RFGA 4IGHA 4XWUA 2TYSA 1DV7A 2E77A 3KRSA 4YMZA 3DHFA 3VE7A 2QAPA 4UTLA 3W1NA 4M7TA 2PRLA 4CNNA 3GAKA 5AHMA 3C61A 4UTUA 4GUJA 4I7VA 3E49A 3OVRA 2WV8A 1DJNA 3R13A 3LHYA 4X2RA 2YCEA 2FQIA 2J9XA 1QPQA 3GXPA 2XN0A 2A85A 3O16A 2YFOA 3S8HA 4LU0A 1K7EA 3FLUA 4Y8FA 2C13A 1SSGA 3NM1A 5I3HA 5KSWA 2Z6JA 2WJZA 2JGYA 2VFIA 3KFTA 2CLMA 2DZXA 2BSLA 3PUDA 3NZRA 3NGJA 2CZ5A 1CW2A 5EYWA 4QNWA 4LS1A 3UPBA 1TTPA 2E09A 1EEPA 2YR1A 4MZ8A 3GDMA 1AK5A 1PE1A 5DXYA 2OT0A 4OHQA 1I2PA 3G18A 3O63A 3EX1A 2AGKA 3G1HA 1YXCA 3W7EA 2ZA2A 3Q58A 4LWWA 1DVJA 3NVTA 5K4XA 5L6UA 4PL1A 3F1QA 3W84A 4DF0A 1JUBA 1YYAA 3N2MA 4OGZA 3C6CA 1OVDA 1DORA 3U2OA 1O5KA 2Y85A 1VLWA 4JIQA 1WA3A 1IXQA 3LTYA 1LOQA 3DXIA 4WXYA 1KM0A 3EX3A 3M5XA 3QEZA 4E2BA 2A6LA 3W7NA 3DI1A 3ZS4A 1JRBA 4UTMA 3QM3A 3LRMA 1FWWA 1TQXA 1JUKA 1KLZA 4UFLA 5U7SA 2QUTA 3G1XA 3M9YA 4E38A 3BGJA 3VCRA 5CZJA 3QSTA 3W1AA 4MZ1A 3GLCA 4KFPA 2QEZA 1K7FA 1ADOA 4RLIA 4RCXA 4FO4A 3DFOA 3L65A 3UQNA 2VOMA 1HO4A 4XQ6A 2YW3A 2CZEA 2W6RA 3N2XA 5G4EA 3UXAA 5TIMA 2BTMA 5BOOA 1H1ZA 4PTNA 5K7JA 1TO3A 2V0TA 5FF0A 2BLEA 3QPZA 1JCNA 2CW6A 4UMCA 4NXKA 3CWOX 1YXYA 2HSAA 3A22A 3FJ6A 4UMBA 4ADUA 5HUPA 4ZQOA 3IRDA 3OHIA 4LVFA 1ZHAA 4OV4A 1I45A 1WOAA 1X7FA 3FJLA 2QCNA 1DQWA 1W3IA 3NZ1A 3O07A 2WSRA 4NNBA 1XM3A 3NNTA 2YPIA 4CQ8A 3W1XA 3I7RA 3L66A 3Q37A 3EKLA 3HOJA 1C8VA 5D05A 3W7JA 2DU2A 3P7YA 3I65A 2OT1A 5K9XA 1VLIA 4BWLA 1X1OA 5LNSA 1TPC1 1XL9A 1ZALA 2YZRA 3MYOA 4O13A 1S5TA 1OFRA 1QOPA 1TV7A 3M0ZA 2FPTA 4ZL1A 1KBJA 4M6VA 4JTHA 2BZNA 3TE9A 3UWVA 3W86A 3FIGA 3H53A 2NV2A 3LLFA 3PBUA 1F05A 2V81A 1XCFA 4MUZA 2Y7GA 4NJIA 4GXMA 4JTEA 4NT0A 1Z42A 2E68A 2R14A 3TDFA 3ATYA 2H8XA 5CGQA 4IMEA 4GWEA 2HS8A 5I3KA 3CIWA 3IGSA 2ISVA 1IF2A 5EKYA 1GPWA 1FWSA 3IGXA 1EUNA 3PF3A 3UWYA 1TV8A 3EWYA 3TKFA 4O19A 4UMAA 4O11A 5F2GA 2ISSA 4MLRA 2FLIA 2V9DA 1XFBA 3LDVA 1XBZA 1W3TA 5EY5A 5K9CA 3IIOA 3FOKA 2OMAA 3IEBA 3W1TA 4DO4A 3L0KA 1ICSA 3DGRA 3W2UA 1IIHA 2R91A 3OIXA 3B8DA
chains in the Genus database with same CATH superfamily
3DENA 3LCXA 1UKQA 3CJPA 4IFKA 6XIAA 4NX0A 3PG8A 5HINA 1P0KA 3GFYA 3F4NA 2ZRVA 3I68A 1EHAA 3Q45A 2ACSA 3VDCA 4Q4SA 4I3GA 1F73A 2C3ZA 1D7KA 3IJDA 2A0NA 1KW1A 2H6RA 4HCHA 4UIOA 3W82A 3MJYA 1CGYA 1EH9A 1KM5A 1PV8A 3HG2A 4K7YA 1K77A 2VX7A 3VU2A 3LLXA 1MW1A 1M7JA 4UFMA 1J9YA 1DWIM 1A5KC 2P0IA 3IUDA 4QXIA 3BJSA 3WBXA 3T0DA 4YJ5A 3WFAA 4E6MA 2FDSA 1G7VA 4UOZA 1B9BA 2HVOA 3D5HA 4AYSA 4F0RA 3UJ2A 3TIMA 1HO1A 3U2ZA 3QPEA 4H04A 3EYPA 1I9CB 1DWFM 5FJOA 5ECVA 1AG1O 2OODA 2VCCA 4IOTA 3HPSA 3N3MA 1TYGA 1X6LA 3GWQA 5LYRA 1MW3A 1D3GA 4PMUA 1GKQA 3BMXA 3C2EA 1FKWA 2BDQA 1YW1A 3ARZA 1U30A 4FZIA 3S1XA 3ARRA 2E6YA 4TU1A 5CC5A 2G4FA 1DWHM 2NQZA 3GIYA 3L5MA 3MUIA 5C9UA 3CC1A 4DF2A 3LNMA 4AIOA 4XD3A 3HQPA 5H91A 3ZJ8A 1OF6A 4L4LA 3PWGA 1XDLA 1I2RA 3PBYA 1KM4A 2SFPA 1R0MA 4TQTA 1E4IA 3M44A 4B4HA 4A2SA 4ZGYA 3KZPA 4WVXA 4UTWA 4J1OA 2GDQA 2JKEA 3CQHA 3A4XA 2TSYA 3G0UA 4G1KA 3UJEA 2OWXA 1H1NA 3BAYA 3LMZA 2CLKA 3E0IA 3NQ6A 1L6YA 3GNXA 5G2WA 1OABA 2WC4A 4M24A 1WUEA 3AYTA 1UD6A 2WNZA 4JYEA 3D6NA 5LIKX 3WLKX 1EDQA 1ZBCA 3MANA 1J8VA 1K70A 3ZJKA 2PGFA 4AIUA 3QHOA 3P5YA 3GU9A 1VRXA 4KFNA 1YBQB 2C18A 2EPHA 2Z1BA 4HZ8A 1XH2A 2XVGA 5E09A 3W23A 2YDRA 1Q4NX 1ISVA 1MUMA 4IG2B 3SUWA 2DSZA 1PZ0A 4G7EB 4AC7C 3U5YA 3CZ8A 2PBOA 1B4EA 5ABHA 2HS6A 2POTA 1UJPA 3T0TA 2QPSA 4H9YA 3GNOA 3FS2A 2WHKA 3B05A 1NP2A 2B7QA 3VXGA 5A8NA 3VX1A 3FN9A 1VBRA 3MW7A 4YWSA 1IT7A 3MWAA 4O57A 1IEXA 3OGSA 3QYQA 1UG6A 2ZICA 4IL0A 3WNPA 2QCMA 1D3CA 1I2QA 5A95A 4JL2A 2GJRA 2VZOA 4ORIA 3PVFA 3SRKA 2DPEA 4JAWA 1TV5A 4BKNA 1FWJC 1CYGA 1C29A 1B3XA 2C71A 3WMSA 2IMRA 2ZUUA 3BCJA 1AH3A 3SEPA 3AWOA 4J3VA 5EPDA 4QJ5B 1XUUA 1RA5A 4GBDA 5DMYA 1SQ7A 4O53A 2W0UA 3B8TA 1OX4A 5CSUA 4Z1YA 3GH7A 3VIMA 2VRKA 1AL8A 2Y63A 1U22A 5M03A 2QAFA 1WV2A 3HV8A 3CU2A 3QV9A 4ZQPA 4LH8A 4HA0A 2F38A 4JNYA 4P7OA 3M41A 1HL8A 3VOGA 1XC4A 3LG3A 3N2OA 3ZT5A 2J7HA 4J5NA 2Y61A 2JALA 4MIMA 2WNWA 4BZYA 3ZXWA 4RZ6A 4BEUA 1EZWA 1VEPA 1HNYA 4Z1AA 1ZJBA 3WL0A 3N2CA 3LGEA 3W75A 1FWCC 2V68A 5FJUA 3IVSA 3OQEA 2OKTA 1SJBA 2J7GA 3UD6A 5CAKA 5FL0A 4NVTA 2W27A 2C1GA 4O16A 5A8OA 4GVHA 3TQPA 1IEQA 1OSEA 3PM6A 2A1YA 3PZVA 4AQLA 4PBFA 3NA8A 3KL0A 3IIXA 2GGEA 1G1YA 1WYIA 3G3MA 2PCEA 1JZ3A 1WZLA 4N4PA 3P67A 1OT2A 4N9DA 4JX6A 1AA1B 3T8LA 1CECA 4PE8A 1J0KA 2OFJA 1YDNA 2WBGA 3UZJA 1UR9A 3CQIA 5DN1A 2DT3A 1SR9A 2XIOA 1TZZA 1ISZA 1XI3A 3M6DA 3IV8A 3KHJA 4EX4A 5CSYA 3CUZA 2XGIA 3N3TA 3ARSA 4B5VA 1TSIA 4H9VA 1M01A 1LLZA 2F6UA 3AZTA 1V5XA 3H21A 1QI3A 3B97A 3GTHA 4KWOA 1R8LA 3OZPA 1NOFA 4XZ9A 4I8DA 5H8MA 4AD5A 1EA0A 1JCJA 1RJQA 1D2KA 2H3DA 4JTFA 1U5VA 3G1SA 2Q3RA 2W5FA 2WNNA 4O52A 3PULA 5FI8A 3RFAA 1PDZA 3J7HA 3WQDA 5D02A 3PZTA 1YPFA 5TF0A 1K03A 1BYBA 1G69A 3CBWA 5EL1A 5JUVA 4NF7A 4K6AA 3H8AA 3I4EA 2A7PA 3UJSA 1UR1A 4P2VA 1PXGA 3VCCA 3UG3A 3SB0A 3NL5A 2IKJA 1KD0A 2Y62A 3A12A 2E4TA 2VEFA 2F6KA 4WCJA 1I8JA 4ZVJA 5LNRA 2ZCGA 4TVCA 1W8SA 3UCQA 3CO8A 3ARWA 4IQLA 3TC3A 1CGUA 5FSEC 3QKEA 4KKXA 1FCUA 1I6NA 3NZPA 2ZE3A 2D22A 1QHOA 3REQA 5CLWA 1ZJHA 2ZFAA 3DG7A 4AG0A 1JCXA 4MJ4A 4UQ9A 4R27A 5A6BD 3DG3A 1Q7ZA 1VYPX 3T81A 5EMYA 3RMJA 2YCKX 2Y24A 2XVNA 4FPSA 1EOMA 2G0WA 4WF7A 4W89A 3KS5A 1RD5A 2QXWA 1I2OA 4NG3A 3Q67A 3C0SA 1CB7B 4L7ZA 4E0CA 3FJNA 1OG6A 1W2VA 2XFWA 3QPYA 4DYEA 4QEHA 4QM1A 5AFDA 2D2HA 1IXNA 3A64A 5C9RA 1FWAC 2FMNA 1C9DA 5CPSA 1JJKA 1F3WA 3WJSA 2FZNA 4HHLA 1JYNA 4PB4A 3B40A 4GD0A 3TTEA 3WLTA 2FFCA 2DQXA 1KCXA 2GJXB 3ZYZA 5I0DA 3ZSSA 3W7DA 3JUGA 5F4WA 3APGA 4S1FA 5FAGA 2I9EA 1OFDA 2XM2A 1RR2A 1ZJIA 3LM3A 4FXRA 4O12A 2OGYA 5DRCA 1UUQA 2ZDSA 1QUMA 1C90A 4DZAA 3W7RA 5CC7A 4NJKA 1EL3A 4QCFA 6REQB 3RG6A 1W9UA 3VDHA 4IZGA 2INFA 3VINA 4RX0A 5HMFA 3KLLA 2INZA 1VBGA 3A3HA 6TIMA 1BQCA 3ZWSA 3GHUA 4XBSA 3BMVA 1IZKA 2BODX 3DU0A 3CZJA 4QE5A 3EDJA 2ZUNA 1F3EA 3NZQA 1OQFA 2YCLA 4AMAA 2J4GA 4LFYA 3NGFA 3TLQA 5GNZA 5I03A 5CPOA 1OT1A 4NZFA 1OFBA 1YDVA 2WMIB 1E43A 3GHTA 4LF2A 2DSWA 2V63A 2GVEA 3FVMA 3OLIA 4JHMA 1TPUA 2CLFA 3GVQA 1A5LC 3WLQA 3E2VA 1WKDA 4IIDA 4L4MA 1PKNA 3SCVA 1MYRA 3HGOA 4Z1CA 4ZXLA 1WAUA 5TBOA 4AVNA 1KCLA 4GGHA 4O0QA 3MMUA 4G7FA 2JF6A 1OC5A 4Q7BA 4PCSA 4DLMA 1JF5A 1JGMA 1UH2A 3EMQA 3EB4A 3C4UA 1H50A 4JTRA 3WNOA 1A5UA 2A3HA 5I77A 2AAAA 3OZYA 5FEPA 2I5GA 4YCOA 3TAKA 1CGVA 2GJXA 3N4FA 4F4RA 3TC6A 4LT9A 2I1OA 4QSFA 1Z41A 2X1TA 4RZBA 5DCBA 4ADTA 3JVAA 5HR6A 1BKHA 4Z2JA 4P5UA 4JY9A 5HMEA 4JTSA 1QT1A 1XLIA 3G1RA 3TVAA 3BV4A 2Q8ZA 3GH5A 1SUXA 5HAOA 1O94A 4N9EA 5D2TA 4YWIA 2G3MA 2J6XA 4IIEA 5DO8A 1U33A 1W1TA 3NO5A 5DY3A 4LJ3A 1QO5A 1TIWA 2XFFA 3UZZA 2HPIA 3E74A 1SZRA 3HURA 3PZUA 3P74A 4OE7A 4RPPA 3THAA 1UZ1A 1QW9A 3EX4A 1Y7VA 5E5CA 3QQ0A 4EPKA 4A2RA 2O55A 2WMIA 4W86A 4CCEA 3K8MA 4HNUA 2J7FA 1FH7A 4X9YA 2G97A 2NUYA 3RRXA 2FZDA 2VGIA 1E1FA 2GK1B 1V6UA 3WDHA 2OQHA 3L5LA 1LBFA 3WH9A 4HSNA 1BVWA 2AQVA 6PTDA 4IIBA 1J18A 2VGGA 4AD1A 2IQDA 2VRJA 3KM8A 4TUFA 2X30A 4LPCA 3TH6A 2P50A 1JCTA 2PGRA 3THDA 4LC8A 2O4MA 4E4FA 2R8WA 4MKVA 4ONVA 2GSJA 3E02A 3BCFA 2C14A 4URIA 4GC4A 5EU9A 1VQTA 3BVJA 1S2TA 6ALDA 5JH2A 1WE5A 4G6CA 4YVVA 1QI5A 4A3QA 1V77A 3QR1A 4JX5A 1MQQA 2EKGA 4O1EA 4RE3A 4FIRA 2DZBA 4O4VA 4L9XA 1JNEA 2DFAA 2B31A 2X0YA 3R10A 4DN1A 3CIVA 2X16A 1XLEA 5H8UA 1SJAA 4Z17A 2OG9A 1OFEA 1M9HA 2VZUA 4XX6A 2O9RA 1JDDA 3BPWA 5LXEA 1IXPA 2E28A 4UR7A 2YA2A 2X8RA 3DC0A 4LQ1A 3PBVA 2Q02A 2QJNA 3NVDA 2DIJA 2WMFA 5EMKA 1WNOA 3O6AA 2VDGA 1ZS2A 3UERA 5AZ0A 4H2HA 2PSNA 2V8ZA 2QJGA 3HTWA 3OVQA 4GI6A 4QE4A 5T9CE 1YRRA 3T2PA 1WCGA 4AWSA 4DWSC 5I24A 3C2VA 4Q32A 2B7NA 4FI4A 4MFEA 2VFDA 1DWAM 2G8ZA 2OZTA 3TMLA 5AZ1A 4YNGA 3CB8A 4MDPA 3GTIA 1PHQA 2YX0A 4PUDA 2JBMA 1NDYA 1POKA 1B90A 3FNDA 2PE4A 2ACRA 3ZZ1A 1J0JA 2WW5A 4HTBA 2GQ8A 3B4UA 1E3XA 4V33A 7ODCA 1OZMA 1GKRA 3M7WA 2Z2UA 4MNKA 4DI9A 4OU1A 5D09A 3THQA 3LOTA 4B2DD 4WGXA 1DHKA 4IGSA 2XG9A 2BY3A 1WKYA 2DUAA 2J79A 4L4PA 3VD7A 3KE0A 2YB1A 1UUMA 3DZ1A 2RDTA 3T0BA 1UKPA 3BGAA 5AC4A 1K9FA 1W8GA 1R7AA 1S5VA 5XIMA 3AIRA 4OOUA 1R46A 2HCVA 4AVOA 3BG9A 4HN4A 2Q3OA 3V16A 3HBLA 5BOFA 1BHGA 1UWAA 3TYDA 3VUPA 3UG4A 4L56A 2NSXA 3O05A 2ALDA 1W3LA 3IJLA 4HU4A 3FDGA 2OZ3A 1P7TA 4HPGA 3IJQA 2OLHA 2J78A 1XGDA 3VDAA 4PFHA 3AMDA 4ZOBA 1LORA 4QCEA 4XZMX 2CBIA 1R30A 1GPFA 4IMFA 1ITUA 1CEOA 4UZUA 5I7GA 2PC8A 2BOFX 4TV5A 3WQEA 2V82A 3E12A 3E2QA 4QG6A 1DJHA 4ZQCA 5I78A 2GQ9A 4IQDA 2XDFA 3JU2A 3MV01 4ZB5A 1SMDA 3VGGA 4DUOA 4JX4A 1UMLA 4CCZA 3GFXA 4QX4A 3A5FA 4GI8A 1YKWA 4YU1A 3ZT6A 1CB2A 3KWSA 1K8XA 1AH4A 1FWFC 4W8BA 1MW0A 1LUCB 1B9ZA 3EXSA 3VZZA 3VAVA 2R1PA 2VR5A 2YYTA 2DZUA 1Q5MA 3OP2A 4UR8A 2DW7A 3U7VA 4GJJA 4B3ZA 1KXQA 1PHWA 5AC7A 1Q6GA 2WWDA 5HDRA 3WLMA 4CN1A 4IWWA 5A6BA 1TMLA 1V02E 3LPFA 3VOJA 3OJGA 3DCPA 3TA6A 4IX0A 1QI0A 2INEA 4I5RA 1GZJA 2B81A 2OLSA 4FMVA 1NSJA 2AQOA 2REQB 3I7SA 1XYBA 4INFA 2V67A 1XBYA 3OYXA 4AY8A 1AFSA 3BK0A 3UVAA 4RXFA 8XIAA 4XB3A 2IKGA 4HQVA 3S6TA 4O0ZA 3G0SA 1VYSX 4RDYA 1W5QA 4LS0A 1UWRA 1DJGA 4LBUA 1TRDA 3LCGA 4RW3A 3KLKA 3AO0A 5J8LA 4NYUA 1RCQA 3CHVA 1UC4A 1RY0A 4PCFA 1EIXA 4XBJA 3RF9A 4LALA 1JF6A 4Q4RA 4H7VA 4OWGA 4M1RA 3EGJA 3NCOA 1DJQA 4Y9OA 3G8RA 2ZXQA 3L7RA 4C91A 3AJXA 4U10A 4F66A 2AL1A 4IJBA 4JHZA 3LCIA 3N73A 3WD2A 1LUCA 4XUGA 4GFIA 5GNYA 3GXFA 2QF8A 2WNQA 1UD2A 1VCVA 1BWVA 1FWRA 3B8VA 3UJRA 5H1WA 1GZ1A 4HNVA 3PBGA 2F84A 4ES4A 2OGJA 3C8FA 4O17A 4NP7A 4XIMA 3QTPA 4WHBA 4M81A 1TFVA 2QGHA 1XIIA 4HK7A 1HJXA 2Y8VA 3BJFA 2QJJA 3WMLA 4KPLA 3JZUA 2OCZA 1MZHA 3AS0A 4WZHA 4A05A 2TPSA 1EJ7L 3FY1A 3A4AA 2RGLA 4V15A 5D33A 4JTJA 4RNJA 3FA5A 4A35A 3C2OA 3OBKA 4XSMA 4JD4A 3E9AA 2XIBA 4PUNA 4PMVA 1BYCA 1E0XA 3EA2A 1W37A 3H6OA 1E1CB 5KETA 1WKEA 1Z7AA 4LOCA 1UUOA 3HQ1A 1B3VA 3M64A 4EF8A 1K7XA 2NXGA 3DYMA 2QNEA 1TZ9A 1GW1A 3RJYA 2O0TA 4AZGA 4YTTA 2ADAA 1BEUA 2PLCA 1DKWA 1GOOA 3PJUA 1N2VA 5DCDA 5D32A 2X1SA 3SN4A 1K8CA 5AHLA 4YVPA 2Y0FA 4M6PA 1ZRQA 1VBJA 1OK4A 5C6MA 5BWFA 3UWUA 5I09A 3WY1A 3QY8A 2OZ0A 2ZE0A 4M6QA 1KBKA 1Q6QA 3TROA 1E6RA 4QLJA 3SFWA 4YHGA 3SO7A 3VGDA 4LYRA 3M46A 2YZ5A 1F74A 3WF2A 5HANA 5IOBA 3LU2A 1ONXA 3QGKC 5HQEA 1V93A 1ONRA 1EYWA 1ZCCA 2YBTA 3TA9A 4YCPA 4O4WA 1KFBA 4POCA 1JQVA 1V0NA 2X7VA 1JPIA 3RX4A 5E93A 3LHZA 4J3SA 3WIJA 1V79A 3N9KA 4A21A 2WVVB 3UESA 4BI6A 1UQYA 2YB4A 4GX8A 4WOQA 4JDYA 4Z42C 3W00A 3H2AA 3MJMA 1XWYA 9XIMA 1HXJA 3VO0A 1UH4A 1QNQA 2OEKA 1HUVA 1TWZA 2QIWA 4AY1A 3SIMA 5LGZA 3O06A 3O1NA 2C15A 2QHAA 1R3SA 1KWKA 2CC0A 4HGXA 3R1ZA 2A2IA 1EJVC 4O50A 1Z44A 3VDBA 5LNUA 1QPKA 1NJJA 2WHLA 1UWUA 4DQWA 1E1CA 4JTKA 4U5KA 4WUIA 1JYXA 2G3FA 3KTCA 3P0XA 2WM1A 1A50A 1F3XA 4I9AA 1TWDA 2CLOA 1QWGA 2HJPA 4FF7A 4QLLA 3WF4A 3RM8A 3L2IA 4X22A 4HVXA 3L23A 5IRPA 1H63A 3RPMA 2DVXA 2YL9A 2NQLA 1TPVA 1G7UA 5M17A 1ZTVA 1D3HA 1MWOA 4IJRA 1BD0A 4Q8WA 1V0LA 3B9DA 4JFTA 4D8LA 4U33A 4DI8A 2HE5A 3B03A 4GJIA 3AICA 3T78A 4DELA 4QS6A 1OJXA 1VCFA 2FH6A 1LM1A 5FJJA 5C54A 4XSLA 1UCWA 2CZVA 1OC7A 4DBUA 2OYLA 4B3LA 3LSCA 2WCSA 2WC3A 3WQOA 4GZ7A 4TVDA 3IJ8A 4WXZA 4LRSA 1ADSA 3SW6A 4FOJA 1S2WA 4Q4KA 4CCCA 2G50A 1MSSA 1PS9A 3MHUA 4JTCA 3I7QA 5FF2A 4RZ5A 2GVGA 3GBEA 3ENLA 7REQA 1HJVA 4L64A 2J66A 1UZ4A 4IGHA 4XWUA 1Q2RA 2J7EA 2HXTA 3DHFA 3COTA 2QAPA 4UTLA 3W1NA 3UXIA 3GAKA 4DWSA 1HKJA 4GUJA 2EO7A 1BSLA 3OVRA 3E49A 4S3AA 3LHYA 4H9TA 4FLRA 2YCEA 1QPQA 4FS9A 2XN0A 4J27A 3MZNA 3O16A 4KF1A 3RUBL 3FLUA 4Y8EA 1ISYA 2C13A 1SSGA 3CV1A 1GQKA 5MKGA 3S9ZA 2CLMA 4YVXA 4XZIA 5BXTA 2D69A 3V1HA 5REQA 4QNWA 3G6MA 4J2PA 1XYLA 1XH1A 2ACUA 2YOCA 1EEXA 1XD1A 1QJWA 2X41A 4QQUA 4R7OA 3EX1A 1LWIA 3BLPX 2IKHA 2QIIA 4GY0A 4DIAA 4JCLA 1JXJA 5K4XA 1NU5A 5L6UA 2HVMA 1JUBA 1UPPA 3N2MA 4OGZA 1H11A 5FIPA 3EPOA 4C1NB 5A2CA 1XP3A 1O5KA 2Y85A 1R38A 5A6AA 1WA3A 1HP5A 2OQLA 1BAGA 3LGGA 3T8QA 4BEQA 4XV0A 1GW9A 3SY8A 3VPLA 2W61A 4PUJA 2J75A 4YS1A 3W7NA 3U5UA 3DI1A 1TV4A 3QM3A 3LRMA 1FWWA 3VD9A 3HFTA 4UFLA 2KAUC 5HNUA 4JTDA 2PWHA 3IS4A 4MZ1A 3U4AA 3VC5A 3VZYA 2VGBA 1DTNA 1ADOA 3OGVA 4RLIA 4RCXA 4FO4A 3R0UA 5IHRA 5IFPA 3PZQA 3H2MA 2W6RA 3RX2A 1H1ZA 2VDHA 1GOQA 5CBBA 2V0TA 1TWWA 2BLEA 4HNLA 1DE6A 4L9YA 4XVEA 1NARA 1ZU8A 2CW6A 2RGMA 2QDDA 3CV2A 3AXXA 1DEDA 1I0BA 4ADUA 3CAQA 2Z26A 4LVFA 1I45A 2HROA 3FJLA 1DQWA 1MRQA 3O07A 2YPIA 4CQ8A 3B9AA 3SCQA 2ZX6A 3EKLA 1VBUA 5D05A 3MZ2A 5K9XA 4J40A 4R85A 3LD5A 2YZRA 3MYOA 4DJED 1OFRA 3K4DA 1TV7A 1LWJA 3N4EA 3E0VA 1FP8A 2CPUA 4ZL1A 3CYJA 3TE9A 3W86A 4MM1A 3PBUA 1EQCA 1I1XA 2Y7GA 4NJIA 4JTEA 1AODA 2E68A 3ATYA 5CGQA 1XF0A 2W62A 1V03A 1FHLA 5I3KA 2HZGA 3CIWA 3N17A 3IGSA 1PZ1A 1EUNA 2VC7A 1CT5A 4XVDA 2PDUA 4MLRA 3WEOA 1W3TA 5EY5A 1T6MA 5K9CA 3PAOA 2OMAA 3VA8A 1LT8A 2GUYA 4WJXA 5DQPA 2YL8A 1GK8A 1IIHA 1WKFA 3TYAA 4PEEA 4XZHA 4AZ5A 3OIXA 3CAWA 2KX9A 4Q8OA 3V4BA 2XWDA 3QBUA 4M51A 4CD6A 1FWNA 2J8GA 4LCRA 4GQRA 2PP3A 4K37A 3GTFA 1EBHA 4XD6A 4E4UA 4FNRA 5BOEA 3SCNA 1XX1A 1ISWA 1UWSA 4B4FA 1V6WA 1ALDA 4C6OA 1H7XA 4UQBA 3OQ8A 1LRQA 4J3WA 3TW6A 3F4CA 1O60A 3PBWA 5AC5A 4DUVA 3UGVA 1LBMA 3CMJA 1N82A 3TOYA 4MADA 3I3EA 4AW7A 5JBEA 4H2CA 1NY1A 5KMYA 3U0HA 2OYKA 5J5RA 3DGBA 4AXNA 4O54A 4C6LA 2FPYA 1GVFA 2YCIX 1N8FA 3R0DA 5DX7A 2Y70A 3GXTA 1L6SA 2DJXA 4A8NA 2PEVA 1V51A 4WK9A 4KGLA 4N9CA 1B3ZA 2J25A 4LVAA 3QZAA 1ENUA 2QF7A 1ELSA 2PLMA 3LY0A 3FYPA 2MUCA 4IUGA 3SIZA 3AS3A 2VCBA 4PMNA 1VCGA 3N1AA 2QULA 1HT6A 3TFXA 3RO8A 3H24A 1GVEA 4ZMGA 5I2UA 1JDAA 1LOLA 2VEMA 3E6EA 4A3RA 4NILA 4DRSA 4MB4A 1CXKA 2VEPA 3T40A 5CQ1A 4AZ7A 4UTFA 3GR7A 2AKZA 4Z08A 3HJZA 1EGMA 5CC6A 2D1ZA 1ZZMA 1JQXA 2ABBA 2ZZ1A 4Y96A 3CIXA 2OELA 3H2OA 1LRNA 5D2XA 3PTDA 5D9OA 4O1AA 1BF6A 1E1EA 1JFXA 1ICPA 1KNWA 3B0PA 3HB9A 1IGSA 3QZEA 1O5XA 2GLKA 4CVWA 4R88A 3O2LA 3V75A 2HDJA 2VQUA 3AMKA 1LG1A 1GZGA 4IXXA 4UQEA 1L8PA 3GD6A 4LVBA 4CN4A 2CERA 4HOZA 1J93A 2I5IA 3KRBA 3VKDA 4DNMA 4V1YA 1AZ2A 2FMOA 1GQNA 4PEKA 3WKZA 1EWEA 2VC9A 1A53A 2UV8G 1RLDA 3WZ0E 1XD0A 5FAJA 3TWAA 1GHSA 1JNDA 2CWNA 3GC2A 2WBKA 4IH3A 4H01A 1R85A 4QIUA 2CHRA 1FDYA 1OM0A 4KH2A 2I17A 1G01A 4QITA 2G41A 1GVIA 2I14A 4IMGA 3WJXA 3QQ1A 1SFJA 1NFGA 2HPMA 2WPGA 3QFWA 4JN6A 3W6LA 1SZNA 5CC3A 2PDFA 4JFUA 2V5LA 3TU9A 3WNLA 3RXZA 1MEHA 3LXCA 3LI0A 5C5YA 2F8QA 2ZZ3A 2VDIA 5E0CA 3E38A 4H83A 4RNHA 3LPOA 3VC6A 3PP7A 1H41A 3QHNA 2QCFA 1GVRA 1R9YA 3OG3A 3L4VA 3AFBA 4LB4A 4X60A 5DBUA 2XIQA 1TTQA 3UT0A 4EANA 3ANUA 3N6HA 3P93A 1Y5XA 1QNPA 5C55A 3NURA 3QH2A 4CUCA 3EX2A 2ZUMA 4PMYA 1EJXC 2OO6A 2OKOA 1XRFA 1GTHA 1BG4A 3AXKA 2X42A 4C5ZA 2ABAA 1XDMA 3M1ZA 1JVNA 3BSGA 1JCMP 3VIKA 4HHPA 2GJNA 4YTQA 3K1GA 2BY2A 3P81A 3VOHA 1XDJA 1RJRA 3H2CA 3CTTA 3TAOA 1LRTA 1QPOA 1TA3B 4NZCA 2DT0A 2X2GA 1ZQ5A 1UD8A 2V2CA 3G77A 3P5ZA 4CD4A 1Q8JA 3P3BA 3A21A 5LHEA 4PL2A 1BF2A 1YTDA 2ATMA 3H7UA 3VKKA 2PWDA 3Q2DA 3M43A 3ZQ9A 2QPXA 2VEKA 1ITCA 5JU6A 3LCHA 4W87A 1PO9A 3BO9A 4Q6JA 3QXBA 1M6JA 2YJQA 3BG5A 3FCPA 1HG3A 2FGZA 2ESCA 1O5RA 4TX6A 2VX6A 1JDEA 4LY8A 1KXVA 2VMFA 4MWAE 3TXVA 4HMDA 4LEFA 4KCVA 5GPRA 4M6UA 2PC4A 4HA4A 4QSHA 1E72M 1RP9A 4GYKA 4JHOA 4JFVA 4GCXA 3S5OA 3DUGA 5DBTA 1SR0A 3TR2A 3RYSA 2J6VA 3QLLA 4MB5A 4B5WA 1FKXA 4HBKA 3KS6A 1TJPA 3L21A 3VKAA 4Y7EA 4DJDC 3QSRA 4AZCB 3IJ7A 5AVNA 5D9PA 2NX3A 3NWRA 1RBOB 4FLQA 1KFWA 2DVUA 4DBWA 1PJ9A 2Z25A 1PL9A 5D9MA 2E8ZA 5GQBA 4NASA 2EG6A 3APYA 1V6XA 3TNOA 2PDYA 1P4CA 2GVJA 3AHVA 3FAWA 4K2SA 1XCXA 3C0LA 4IIGA 4WR3A 1VJSA 2ZWZA 2XH7A 4GGBA 5HA7A 3KOFA 2PTZA 5D03A 5C2GA 2HXUA 4UCFA 1WBJA 4J7RA 3BLLA 1JZ8A 2BBFA 2P10A 5HJXA 1XIMA 3C3NA 1ZL1A 1NEYA 2WVUA 1VP5A 1QFEA 2CYGA 4Z1DA 1UD5A 5E0FA 4JN7A 2VI0A 3DKLA 1H51A 4DAFA 2XVLA 5LZLA 1GYLA 4Y9NA 4QR6A 2RJGA 1GTEA 3R5EA 1QU4A 3KAOA 4X0VA 3LHVA 3WEZA 2VC6A 2FHFA 3KBSA 1PKLA 2ZQ0A 3C0JA 4KS0A 3N12A 1NOWA 2NXHA 1XW8A 4C7GA 1X97A 4BQ5A 1AUSL 1UKTA 3ES7A 2BY0A 2QJMA 3QW3A 3LZ5A 4AYGA 5CBJA 3BAKA 3RK8A 3DC8A 1TPFA 3ZR4A 2G3NA 1E6ZA 1UR4A 2AL2B 5KITA 3VIHA 1EO5A 4FAMA 1H0IA 4PMXA 2VXNA 3PTMA 4HP5A 5E9AA 3LXAA 4JOMA 4ERIA 4HNNA 3PTQA 4DJEA 1O1HA 4I9TA 3E96A 3T0AA 2XYLA 3GU1A 5E6ZA 5H6HA 4UFIA 1K02A 4IXHA 2PWFA 1VH7A 2V69A 4WX2A 3GB6A 3HG4A 3ES8A 1X6UA 5C0QA 3RILA 3ITXA 5AYXA 4KIRA 3KL5A 2NQJA 1RXOB 1DP0A 1P5BA 5CBIA 2IXUA 2BOGX 4BWLC 3P14A 3C8NA 2PD5A 2FJUB 2F2KA 3W76A 3S1GA 3S2LA 3ANYA 3WLPA 2FIQA 1V02A 1M7PA 4US5A 1WXYA 2Z27A 1W1A1 2ZOXA 3AIVA 5E1QA 3NOYA 1RVGA 1W1B1 1SO6A 3VMPA 1VD6A 4MDOA 1IWAA 4LX4A 1Q6RA 1CCWB 2DEPA 3L5AA 1EA9C 3VYLA 2EKCA 3UWQA 1UOKA 3ZWTA 2VD8A 1F76A 5GVJA 4B5NA 3FHQA 4O18A 1PTGA 1ICQA 4KW2A 5FCZA 4LTSA 3KVKA 1LQ0A 2OPJA 2VELA 1ME9A 2HNHA 3N9RA 1WDQA 3I10A 3HJEA 4EWND 2C16A 1KR1A 1RUSA 1ITQA 4ADSA 3GVRA 1ECEA 5AB3A 2V3GA 1QOQA 2XM1A 1UIPA 2YDQA 3CS2A 1CGWA 3QN3A 4LUTA 2PRHA 2YSWA 4Q8UA 2D24A 3DG6A 3L67A 1UD4A 1BTMA 3P61A 4GIAA 4U2YA 2NVAA 5IFTA 5HNRA 4XAPA 1E70M 1V3KA 3BW2A 1GYNA 1LL6A 4EK7A 2BV9A 4RDVA 1A4MA 3HF3A 3MDWA 4ZQMA 1P0NA 3UY7A 1ME8A 1WPCA 1ZAHA 2QDHA 4IQJA 2UZ9A 3C2RA 5K2ZA 1XLGA 3V36A 4TXEA 1O12A 1QBAA 3MPGA 4RV8A 3ZJ6A 2D0FA 3WQFA 3V35A 2ICSA 3W38A 4HIBA 1B3WA 3NQFA 1J79A 2E9BA 3AIEA 1PX8A 4E4PA 4AWUA 1IZJA 2PI6A 3ONCA 3CYVA 2NWSA 2A3CA 3WD4A 5ENLA 2O7SA 1S2CA 2Z4GA 4ALDA 1PPIA 1Z3NA 1HL2A 2FVLA 4GACA 3W7MA 3W7HA 1YXDA 3ITLA 3TX9A 2OZ8A 1QXLA 3H70A 2YYUA 4RKAA 5I6SA 4B16A 4QISA 4W5UA 4X0NA 4R34A 1WXZA 2BFGA 4LYQA 4BQ2A 5AC6A 3LYEA 5G4HC 4GVIA 2FB2A 4JYFA 3OG2A 3GRIA 3DERA 4FP1A 3WFZA 3MBFA 3ALFA 3GKAA 3DHUA 3DFNA 5HNTA 4HCDA 1L2UA 1G4EA 2O92A 3R25A 4NJHA 1M7XA 2FTYA 4A3UA 2XN1A 5F1VA 1XCWA 2JIEA 3STCA 3UPMA 2GFTA 4PN2A 1MEIA 3PY2A 5JVLA 4GQQA 3H2FA 1FXPA 4DY1A 4H9ZA 3KDOA 3P84A 5GJNA 4IL2A 2VEIA 2DZWA 4FXJA 3GAYA 1L9WA 3POCA 1JGIA 2WZMA 1QI4A 4G2DA 1PIIA 3CZKA 3NTYA 4S2CA 2WANA 4HZ7A 3IPWA 3OA5A 3SCSA 3VIPA 3WF0A 4BF5A 1FCVA 4DUXA 1OY0A 1Z6KA 1ITXA 2WPBA 3AU6A 4UTWC 4ZA0A 3I6RA 3CL6A 2XTKA 5EMUA 3C2FA 5MHBA 4KETA 1ZP3A 4DF1A 3R8GA 4LYPA 5BW6A 4CGTA 3SUUA 1RPXA 3G1VA 1ZPTA 4G9PA 3BAIA 2GOUA 1MRAA 2J13A 4TO8A 4UOJA 1ZP4A 4QRNA 1W5OA 4GQGA 3AHZA 7TAAA 1E5NA 1KTBA 5C9XA 4AIEA 1I4NA 2VQTA 4LGXA 2GOKA 4AD3A 1XQKA 3GIQA 1OYCA 5K3VA 2FVKA 1HKKA 2Y89A 5AOUA 4I8YA 4IQEA 1AMKA 1EZ2A 1FWIC 3SUTA 3NEVA 2CLPA 2WB5A 4REQA 4HZ6A 1JPKA 2BS9A 1X1ZA 4QDMA 3IV3A 2ZWYA 3O15A 4LAKA 4N6EA 2TAAA 1IR2A 2GVYA 3FAXA 1MDLA 3G2GA 1Q6EA 5A6JA 1C3FA 3MI6A 4M8UA 2BASA 4JIPA 4R5EA 1MXSA 2CESA 4KERA 4MAZA 1KM3A 5GNXA 5HWNA 2HE8A 3IUIA 3Q65A 1Y65A 4P8VA 3WK1A 1QO2A 4GO8A 4O8RA 2DT1A 3W7QA 2W9MA 5JQ9A 3CPUA 3VVGA 4AD2A 1GNXA 1XR2A 1VJIA 3IAPA 1TTJA 1XLMA 2I5QA 2D0HA 3TN5A 5LA0A 2NT1A 4KQNA 2XGZA 5EB8A 3UVIA 1U5JA 1FRBA 3TONA 1WX0A 3LEPA 2W66A 2X05A 3KWXA 2ALRA 1WAWA 3NQ2A 3B8UA 3QOKA 4EAYA 3OYZA 4TV6A 2X1UA 3TW7A 3WD3A 1TPH1 2E5BA 5BRBA 1X98A 3VKBA 2WCGA 1BWLA 1A47A 2CETA 1EPXA 1H5YA 1SFTA 1KFJA 4DYKA 4JEJA 3MQTA 2EAWA 4KCWA 1V6VA 2OEMA 1QNRA 1RLCL 1W3HA 3ABQA 2DGAA 4DPQA 3KBWA 4NZ5A 1JYWA 2I9UA 2CLLA 1V08A 2PP1A 2X0SA 3AS2A 3W3OA 2Z28A 2XPKA 3SAZA 3B0YA 3B9OA 2NW0A 3BL3A 2BHUA 4UXDA 3TP4A 1HN1A 5HULA 4DBSA 1AZ1A 2WO5A 3PZMA 2NUWA 2BGQA 3T42A 1HW6A 2PD9A 3H4XA 3HM7A 1ML1A 1SJDA 1TZ7A 4GUIA 3TYUA 5A8MA 4MWAC 4DVOA 1R87A 3VTRA 2PS2A 2XIMA 4MOZA 1XLHA 1E40A 2EQDA 3L4TA 4WOZA 2V30A 2RKXA 3P8IA 1P0BA 4H8NA 1W5NA 4DB7A 1HJQA 4H00A 4E3TA 2A3EA 4GKTA 2C91A 1OG0A 5FOOA 2XFRA 3ZOAA 1A5SA 1OF8A 3DOPA 4UFHA 4QG9A 1KRBC 4GX9A 3LX9A 5T91A 2D0GA 1HL9A 1VIWA 2RH9A 3BICA 4PRTA 4PODA 4YPJA 2ZRUA 3VKCA 4BQ4A 1MXGA 5FKYA 1QBBA 2OSWA 4DXKA 4D8ZA 3N15A 4FOUA 1UWQA 4BI5A 1Q6OA 2POZA 4A8LA 1AQHA 2EHHA 3KW3A 5FJRA 1ZENA 1NIUA 2WVTA 4AVFA 2O9TA 4PMOA 2BHYA 1MMFA 4HMNA 1GEHA 4H3DA 1GQLA 1JCLA 3S5YA 3OLGA 4DM2A 2BVTA 2EGZA 4KIEA 4AD0A 1EJRC 4L1GA 2A7RA 2ANUA 2VUYA 2Z1VA 4F9JA 1HP4A 3ORWA 1WDSA 3CHEA 2PP0A 4EP8C 4WSHA 4WIWA 5IXEA 1IEVA 2NVDA 1QNVA 3WG6A 4M5PA 4YYCA 3SCRA 3N04A 1V8EA 1SW7A 1PYMA 4HD5A 2J47A 3GZAA 3LLDA 2A21A 2ZBTA 1VRDA 3ANVA 1E4NA 1CXEA 1YE4A 1F6KA 2WXDM 4LB3A 1XKYA 4NNCA 2CKRA 4US6A 3KRZA 1EFZA 4ZO6A 2NXIA 3W87A 2PWVA 1JCYA 4J3UA 3CWHA 1KWGA 3LHUA 5D04C 1Q45A 1NFBA 3K13A 3NQVA 1GUVA 4BCEA 4W88A 1LCOA 2DZVA 2EG7A 4B5UA 1GHRA 4AEOA 1T96A 3MCOA 2VKZG 1QW8A 4N0RA 2H90A 3EWWA 1MQRA 2PBGA 3OEXA 1UP2A 1SZEA 3ZFHA 1OX5A 4B91A 3TYEA 2O9PA 3FKRA 2O56A 1X38A 2DVTA 4Z0JA 2WLYA 1XRTA 3PNZA 3GG8A 5D38A 2GGGA 4S38A 1RALA 4O0KA 3CEUA 3AI0A 2PU0A 2DH3A 3C0QA 5IHSA 4EPDC 3G1AA 5K9DA 2IUZA 3SCWA 1HVXA 4F79A 4W9TA 4IUOA 2PDNA 4R9XA 4F0HA 4ZZ9A 5D8WA 1F6PA 4D1JA 3G3DA 2QVNA 3RMEA 2PDMA 3L68A 4QROA 1UA7A 3S3GA 3M7SA 3LA4A 1AD4A 2WWCA 4IPIA 3MHGA 2PFHA 3FYYA 3TR9A 4H4IA 5CLTA 2C1IA 2QCHA 4CKQA 3AC0A 4MY8A 4UTTA 3ARUA 3ITOA 1JUEA 4MTVA 3MP3A 1MW2A 4FHAA 5DY2A 4L65A 1A5BA 1ODUA 1VFTA 5A6SA 1DQXA 1XQLA 1TJRA 3NUKA 3EZ4A 5XIAA 3VD5A 4DZIA 4DAIA 1ZAIA 1JI1A 2XN2A 1GEQA 3R43A 1SZGA 1R47A 6A3HA 1DWGM 1E4MM 2UY3A 3WQCA 3RX3A 3TW9A 1XYMA 4HHHA 3QHMA 3G22A 3M0KA 2PDLA 4MFDA 5KZMA 3MUXA 3EWZA 1FVPA 2A7NA 1F3TA 4GIYA 4PTWA 2D73A 1D8WA 3CHDA 1OHLA 5A5WA 4AIBA 3GYEA 3W83A 4C6PA 3VOFA 4UBPC 3SCUA 3SRHA 3ID7A 1PIGA 4XUYA 1H7PA 3PC0A 4AUBA 3AMLA 1GOMA 3LCFA 1SM9A 4ZE4A 1EO7A 3KOYA 3R0KA 1A3XA 3WL1A 1G4TA 5ABFA 1RK6A 1X1NA 3SJ3A 3DYOA 4CNPA 5BMXA 3V5CA 2PZ0A 4ZODA 4Q7IA 3MKKA 3ITTA 4AZBA 1NQKA 1BKSA 4CNUA 1XYCA 3KRUA 4LW7A 1XRSA 1LJYA 3MCMA 2WMGA 4CD8A 1H49A 1P48A 2NQHA 1JAEA 2G96A 4ML9A 2P53A 1MI3A 1GG0A 1TPEA 2ZUVA 4FB7A 1YPIA 4WGHA 2ZRYA 2H9AA 2DIKA 3NSXA 4IP5A 2CEQA 3W4RA 4JQ3A 4W93A 1W1YA 2ONEA 2PWUA 2QJHA 2Z6IA 2HBVA 3U7BA 4ROPA 3IK2A 2E3ZA 1FY6A 1JZ6A 2A6NA 3CHFA 3QRHA 1XGZA 3DX5A 4AH7A 3A23A 4GJ1A 3N13A 2CITA 2CZFA 5I79A 1C91A 1E9YB 3UCDA 3CTLA 3N14A 1TE6A 1KRCC 3GO2A 3VZXA 2VFEA 5GJMA 5EGRA 1HKMA 1NTHA 3E0FA 1X96A 2FKPA 2X1RA 1P6WA 4JIHA 1VYRA 4S3KA 3F4WA 1E51A 2QCEA 4GXPA 1QHZA 4QGCA 4MB3A 1OYBA 3S5NA 3W1RA 4A4AA 1OX4B 4W5ZA 4LV4A 2CBVA 3CO4A 3W29A 4HU8A 4FNUA 1A5OC 4R9OA 3WUBA 3SRDA 3LS9A 2HNEA 3WQVA 3RITA 1FH8A 2ZZ4A 3BOLA 3NQDA 3WLOA 2D2GA 1WQ5A 3ABRA 2UBPC 3IIPA 1J2WA 1TWSA 3VOIA 3QFEA 3CB3A 1OK6A 3VIOA 2B0MA 2AAMA 4C6IA 1R3VA 1GOKA 2PCQA 2AQWA 3QKZA 3EA3A 4XZNX 3ELFA 4HNCA 3ZR5A 3N18A 3DDMA 3TCEA 1B4KA 3O0FA 4CQDA 2QUMA 3GNPA 2HISA 1TVNA 4H7ZA 2OQYA 3M0JA 1Q63A 3WH8A 1U2YA 4J28A 2ISWA 3VGEA 3AIUA 4EIVA 5BWAA 3STGA 3F2DA 1HKVA 3BCDA 3MP5A 2W63A 2WQPA 1Q85A 5TNVA 1TCDA 4HT3A 3NQGA 1S39A 1VPXA 3LBCA 4NI8A 4PTXA 5EMJA 1BWKA 4DJFD 4XISA 1W2PA 3PANA 3E2SA 4QS5A 1OCNA 3SN0A 3GG1A 2TYSA 1JFHA 1DV7A 2E77A 5DMLA 3VX0A 1EJWC 1C93A 1XSKA 2RUSA 4CNNA 3R79A 3UGRA 5AHMA 4UTUA 4E2OA 5HPOA 4KRTA 3F4VA 3EOEA 1DJNA 3R13A 3O0KA 4Q7NA 2HVNA 3WBEA 3SURA 2WJDA 4XAGA 2DQWA 8CGTA 4MWAA 4N7QA 4DZHA 5I3HA 3OPSA 5KSWA 3NYDA 3BZGA 1KRMA 2JGYA 3BOFA 1XHGA 3OU8A 2BSLA 3PUDA 1TR9A 3NGJA 2GGJA 3WH6A 4DJDD 1W1PA 3T08A 4DWDA 3ISIX 1DIOA 1UROA 4R7WA 5EFDA 2Y8KA 2V5CA 3UPBA 1V3LA 2XZ9A 1C92A 2YR1A 2YCJA 1PTDA 2Z1WA 4MZ8A 4WKHA 2PWGA 4D6CA 3VGFA 3T2OA 1UJQA 1I2PA 1B30A 1GORA 2AGKA 4FALA 3HFYA 4P8UA 3DFYA 3G1HA 1DVJA 1W17A 4EKJA 5CXPA 1K9TA 1S38A 4PL1A 1ESWA 3WENA 1YYAA 3UETA 4CNTA 4W84A 1OVDA 4IP4A 9RUBA 2NT0A 1DORA 2C7FA 4Q8NA 2Q01A 2EXOA 1EOKA 1XPYA 1M68A 3PTKA 3CUHA 4AISA 1H5VA 1OGSA 3LTYA 1LOQA 3U9IA 3DXIA 4O8AA 3SRFA 3ZJ7A 1EDTA 1JRBA 1QW7A 4UTMA 4LUSA 1PWLA 3M0XA 3WNKA 5U7SA 4MJ2A 4WDWA 3G1XA 3VCRA 5CZJA 5FJTA 3REQB 3QSTA 4K8GA 4CEXC 2Q09A 4KFPA 2QEZA 2WSPA 1K7FA 1EHNA 2BP1A 3BJTA 3U57A 3DFOA 3CASA 3L65A 4B92A 3UQNA 5BROA 3IGHX 3VM7A 2OU4A 3L4UA 2BTMA 5BOOA 3ZVIA 4P8WA 2ZVRA 3WUGA 2NLYA 3BAXA 3QPZA 2ZUSA 1UBPC 2O9OA 3MWCA 4JCMA 4ZQOA 3RO6A 3IRDA 1WB0A 3LQLA 3AYSA 1QWKA 1B5TA 1WOAA 2QCNA 1W3IA 4ATWA 3EDFA 5FL1A 3FW6A 3NNTA 4D71A 5JIPA 4PCTA 2RDXA 3W1XA 3CV7A 4PB5A 3WD0A 1F9CA 3C3UA 1X1OA 5LNSA 2WC7A 1JZ2A 1ZALA 2V6AA 4GZEA 3NIYA 1ADDA 4O13A 1S2AA 3CL8A 1QOPA 5HPCA 3M0ZA 2Q6ZA 4MMWA 4M6VA 4JTHA 2BZNA 2PDGA 3UWVA 3FIGA 1XGEA 1PIFA 1XCFA 4MUZA 4GXMA 1A3WA 4NT0A 4PBGA 2OYMA 1Z42A 4M56A 3FV9A 2H8XA 4GWEA 4UWMA 5CZKA 1E73M 3RPDA 1IF2A 3CZGA 1GPWA 5EKYA 3PF3A 3UWYA 3EWYA 2QUNA 4UMAA 4HOWA 4O11A 3S2MA 3SY1A 1S46A 2YCLB 1BTCA 3HN3A 3IIOA 1UZHA 6TAAA 1B54A 4K68A 3IEBA 3DHPA 4G8TA 3EMCA 4H6RA 1UWIA 2ZX7A 3W1QA 2WHMA 2YLAA 1R9XA 3PK7A 2WSQA 2PDJA 4EXQA 3E3HA 4FX7A 3U2EA 8XIMA 2A3BA 3P2VA 4P8XA 2J77A 1UKOA 1N8IA 1WZAA 4LRTA 4O15A 3W53A 3B06A 3AXMA 4XKYA 3O6YX 3VNLA 3T44A 2VFHA 4ACZB 3CGTA 3R11A 4S2BA 4GZJA 4S3EA 1PEZA 2FZ9A 2GGHA 4AFYA 4BY3A 1G0CA 1N55A 3R89A 1LOSA 1GYMA 4AXKA 4LXFA 1OFAA 1HJSA 1A0CA 3ARQA 3W27A 2FZMA 3II1A 4ZO9A 1GOXA 2WMJA 4HPHA 2DDXA 5I3GA 2W79A 3R12A 2CHOA 3ABXA 3ABOA 4FNTA 2VNCA 3PUEA 3H22A 5FACA 4PRRA 1HGWA 4LNYA 1EF2A 3V7PA 2B4GA 3AUOA 1LROA 4M29A 3NDOA 4J4KA 2Z7KA 2Y7FA 1Z48A 2VR4A 3JRKA 3PUGA 4JIEA 1J01A 2WKLA 3EAUA 3VUSA 1PBGA 1A4LA 1S3HA 5FJIA 3RM9A 4RDZA 3W24A 3CAKA 3HU7A 2DUXA 4OQVA 2RDUA 1G4SA 2BG5A 1EP2A 1LDCA 4IICA 3W88A 1DXIA 3GVWA 3JS3A 3Q94A 4GK8A 3MUZ1 3TYBA 1LWHA 5I06A 4DO6A 4JY8A 3HPXA 2OO0A 4OOZA 3V3WA 3S0CA 3A6OA 4JTLA 2C1HA 1NF7A 1MXDA 3LBMA 3B8SA 4FK9A 4V27A 2HEJA 3HIJA 4MYXA 9CGTA 3CNYA 1M65A 3VIFA 3IRSA 3EXTA 1A5CA 3MMDA 3G1YA 1XISA 4WY0F 1JD7A 1S2UA 1RQBA 1E6NA 2HK1A 4C6KA 4JEQA 4OZOA 3TUUA 4ACZA 3F5LA 3WK3A 3GKFA 3QR3A 4LSBA 1EUAA 3W2NA 3WLIA 3T0CA 5TD4A 3MVTA 4F0KA 2VWTA 4P61A 4L61A 3D46A 1KFCA 2FHCA 1DIEA 4ATDA 3ZLGA 5C7HA 4L9ZA 1WBHA 3HZ3A 4NI3A 1SFSA 1YQ2A 1BVZA 5FD0A 4F0LA 3HQNA 3LSBA 3PPCA 3QW4B 1FTXA 3MMWA 3V5OA 2YKKA 3DFPA 2YW4A 3BLOA 1I0DA 3W1UA 4N6FA 3GC5A 2EJAA 3PHAA 1XLKA 5HQLA 2BXZA 3W02A 1JD9A 1POJA 1J2BA 4JFWA 4DXVA 4GINA 4Q4PA 1SJCA 3UXKA 4ZSUA 3PZOA 1E0TA 1NWRA 3G24A 4H8HA 9XIAA 3W2MA 2QUVA 2ZZ7A 5PTDA 3G6LA 3I3DA 1X8CA 3LHWA 5I00A 1YE6A 3SSZA 4JBRA 3BZJA 4UB9A 4DEFA 1CI1A 4X9SA 5DEZA 5DLCA 4TOQA 4EOUA 1YNYA 5JH1A 2RDWA 5EBAA 1FA2A 3BWWA 3S1WA 1SSDA 3ZM8A 4QAIA 5SWUA 3WDJA 5A6TC 2Q8XA 1BYDA 1FDJA 2JQXA 3QVQA 3M6YA 3DESA 3ATZA 1VJZA 3DFQA 1NDZA 1IWBA 1LLOA 1CNVA 3UNTA 3W07A 5EFFA 1XLAA 2WCAA 1VFFA 4ZSTA 3VNYA 2EJ1A 4CLMA 5FF4A 3ZVHA 2GSHA 3PUOA 1Y8BA 4ROQA 2ZZ6A 1V6TA 4M82A 3NJ3A 1KM1A 4C6FA 1YEYA 3TXZA 4MZYA 2R6OA 4LAOA 4PSPA 5AHFA 4Q3MA 3QY6A 3B0UX 4GBUA 5JBFA 3ARXA 1RZMA 4PUEA 3UG8A 3PJTA 4FNSA 4RNFA 1EP3A 3ITGA 4UUIA 3TK7A 1WDWA 2E1WA 5JXQA 3T1GA 1H7OA 3SM0A 4PMZA 5L9FA 4BFAA 4EWJA 1RK5A 3L0GA 7PTDA 1P7TB 2V5BA 1N8WA 1VFOA 2VO5A 4NYYA 4TR9A 4QLKA 3K2GA 3QQWA 1XYAA 2P8CA 4OUEA 1J0HA 2ZIDA 3N2TA 1KTNA 3H7VA 1EC8A 2PUZA 4AX6A 2NUXA 3HPZA 1D9EA 5K4ZA 1J5TA 2DJLA 1HGYA 3BGGA 1OFOA 3S4TA 3WQ8A 3E5PA 3R6IA 1XUZA 4Y9PA 1DHPA 2ZRWA 2ZC1A 4NAEA 1PKMA 3S47A 2DSKA 2G95A 3GK0A 4IMCA 1AW1A 3CPGA 1MEWA 3GR8A 4W7VA 1I2NA 2IXVA 4LNCA 3WF3A 4C6EA 3LI1A 3A5VA 3TC7A 1BG9A 1F6YA 4TMBA 8A3HA 5DELA 1WDPA 2NV1A 5RUBA 1QVBA 3PZNA 5EBUA 3WH7A 2Y5JA 2OLAA 4EVZA 3MS8A 1SGJA 3W85A 4H6KA 3VFLA 3WDIA 4GVGA 5CJNA 3HMJG 4D6JA 2Z00A 2P3EA 3NG3A 4MB1A 4ZCWA 4PUMA 4P7RA 1DJXA 4I7WA 1R5YA 4MHBA 3S42A 3S6DA 3RHGA 2XVKA 4RZ4A 3GQYA 3SSJA 4LYKA 2NVCA 4IPJA 2F6XA 2GDVA 3KBMA 3CUIA 1HX0A 1K9DA 2R82A 1XYFA 3P62A 1MFUA 3QY7A 4A8IA 3LRKA 1ZCOA 4FNQA 5LNVA 3I6EA 3VNKA 1G94A 2PRMA 2VCAA 2XSBA 2WYSA 1G9HA 3WUFA 2BHZA 1IIGA 4E3VA 3QTGA 5D2WA 2A4AA 1QATA 3STPA 4PFMA 1DIKA 3R8RA 1LT7A 3NQEA 1B3OA 3T09A 5IM51 3P82A 1OWQA 3M5YA 3G1FA 2GVLA 3BV7A 4W8AA 5CGMA 4UFKA 3UYCA 3PPFA 2GDUA 3T4WA 4RK8A 2GJPA 1KO0A 1W1VA 4O1DA 4IGNA 2QUUA 3QJAA 2CIPA 3VCNA 4FEZA 2CNCA 5BMWA 3A3WA 4JKMA 1R9ZA 1DJZA 1OBAA 3SCOA 2G4JA 1IQ8A 4NJGA 3PB2A 2XIIA 3GBDA 4UNLA 4YLWA 5ABEA 5G2HA 1FHVA 4K8EA 2QDGA 3MP4A 3WELA 3H12A 3STFA 5T9BG 1CWYA 4D9PA 2PDCA 5BXPA 1JAKA 1S1RA 5C2XA 1E4LA 4QJ3B 2XJ7A 1QPNA 1FUYA 1ME7A 3W25A 1XLDA 4KRUA 3L2LA 2UWFA 3VIIA 3LBOA 4UTJA 4NIRA 1J5SA 1PDYA 4KWVA 1OADA 1AMYA 7A3HA 1SFLA 2F7FA 1L2QA 4D6FA 1M03A 3H4WA 5LKYA 1CPUA 3W2LA 5MF5A 4Q4MA 1XIGA 4HK5A 3H7RA 4NL1A 2ON3A 3LERA 4TX8A 3GHRA 3GU2A 4BS0A 4F9DA 2ZRXA 2UY2A 1UA3A 1U83A 4YL2A 4JTUA 2OWCA 3W72A 3CUFA 3H23A 4ILSA 2YDAA 1O1ZA 3S1VA 2DUZA 4NZJA 3W7PA 3E0LA 2Z29A 2A79A 2GQ3A 2WHJA 1EYEA 1VPYA 5B80A 2YFNA 3UNDA 4JPGA 4IMAA 1MUWA 1RPKA 4JIRA 5T26A 4ENLA 3TN3A 3UFYA 3SGUA 4NRSA 3BMWA 1LBLA 3K1DA 5G1YA 3R94A 3KZSA 1UZDA 5I07A 1KQZA 3T7VA 4JZ5A 2NSOA 2VEGA 2AKMA 1V4YA 2E5CA 3EB3A 4QBXA 3AZRA 3U8GA 1TJ2A 3M5VA 5CPMA 1VIZA 2IPFA 1PZ2A 4JKKA 2VOTA 4MJMA 4HU3A 1E6XM 4GC3A 3VNIA 3WQWA 5G4WA 5D4YA 2VM8A 1FX6A 1V3IA 3SGZA 4Y9AA 3UA3A 2NZLA 4LBSA 2Z1KA 2PTYA 2IPJA 1THFD 5IBXA 1UPMB 2R24A 4PCPA 3UP8A 1J6PA 3A9BA 3PN8A 3KHDA 4HTYA 1R2TA 5IDZA 4GYPA 4K1WA 1V7AA 3H54A 2FJKA 1TELA 3BW3A 3RU8X 4LUJA 3EX6A 1F4AA 1UASA 1UYQA 1GJWA 5CKSA 2PURA 3ITYA 4D2JA 2PU1A 3MSGA 1UR0A 4FNPA 1XXXA 3O6DA 3SR7A 4NQ1A 2HQAA 2QJIA 4YXGA 2FTPA 2AOSA 3NAVA 2ZXAA 3LUTA 3ARVA 4W85A 1X8FA 5CEWA 1PAMA 4WJ8A 3UR2A 3LM7A 1M04A 3ARPA 1XPGA 1VZWA 3OA3A 3GDKA 3GX9A 2CU0A 2E5DA 5J04A 4MY1A 3TWBA 2QMKA 4TVUA 5DANA 1UR8A 1DJWA 3NQCA 4HCLA 1UOZA 2G3IA 4AWTA 4R7JA 3L12A 1O66A 3A3XA 4QP0A 4H8UA 5HK4A 3AUJA 4MNMA 2XSAA 1KCKA 1RAKA 3KEHA 1S2VA 5CG7A 4HNOA 1GG1A 3H2NA 2DP3A 5BYWA 1MQPA 1AVAA 4KEUA 1TJ0A 3VNMA 4AAJA 1BXCA 3NL2A 3RDKA 1GQJA 2DW6A 4AZ6A 5CCZA 5LSMA