4RXFA

Fructose-6-phosphate aldolase y131f from e.coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
220
Chain Sequence
HELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPFVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-6-phosphate aldolase 1
publication title Acid Base Catalyst Discriminates between a Fructose 6-Phosphate Aldolase and a Transaldolase
doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 77
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rxfA00
3CWNA 3M5ZA 1GPWA 3UWUA 3PSVA 3W86A 1W5OA 1VYSX 5G2IA 3TSDA 3W9ZA 1ICPA 2ZZ6A 4GWEA 4CCDA 4LU0A 3CTLA 5G1TA 1TMHA 2A85A 2E6FA 3I65A 4UFLA 4UTIA 4K39A 3EWZA 4WX2A 4U4MA 1YTKA 5CGQA 4LVGA 2FPVA 1T96A 1DBTA 2RHGA 5J5DA 3DFQA 2V82A 3C2VA 3DH7A 3S8HA 5LNUA 4LWWA 3R8RA 3W84A 3PBVA 3W2LA 4PL2A 3SGUA 3A22A 4OBTA 2ZRYA 2Z1BA 1DQXA 3W22A 5C54A 1A53A 4LV9A 1RVGA 3CB8A 1XCFA 3FA5A 5DCBA 4DPPA 2G5WA 2QKFA 3TCEA 3V75A 2H8ZA 3PUOA 2YYUA 5F2MA 3TV8A 4RXGA 3G1VA 5AN7A 5G1YA 2RKXA 3FJ6A 3LRLA 4MZ8A 4HNVA 4LY8A 4GFSA 3THAA 2GOUA 4I9AA 1FCVA 3P67A 3W2KA 3RLUA 2YX0A 2YCEA 4ADTA 2J9YA 4BI7A 1W8SA 3N3MA 4M19A 2Y7DA 4JTKA 4LS2A 2WKJA 1KFKA 1XBZA 2JGYA 3C0JA 3DKLA 3H55A 1F7BA 4X2RA 4EF8A 3UZ5A 4E0CA 1FUYA 3TKFA 1B4EA 1VYRA 1KBJA 4UTHA 5K9CA 3LTPA 3EXRA 5EA9A 4FNTA 2RDUA 4ORIA 1KFLA 3PY2A 3SJ3A 3O1NA 2QCNA 3INPA 2ZZ2A 3WJSA 4M6QA 3BG5A 3L9CA 1W3TA 4EIVA 4AMAA 2P10A 1IXOA 4IMCA 3HMJG 3QSTA 3B06A 1I2OA 3W7IA 1FWWA 2NLIA 3E96A 1H7XA 4HPJA 3Q2DA 4QQ3A 4MLRA 4RZ4A 1WX0A 3FJLA 4MY8A 3W1XA 1NAL1 1ZAHA 3Q58A 4IMEA 1NEYA 2OT0A 1TO3A 4YWIA 3TQKA 5D38A 1JVNA 2AQWA 1GVRA 3MHFA 3ZFHA 3B03A 1R2SA 4LC6A 4JN6A 3HG3A 3LM7A 4ZL1A 2EHHA 1JCJA 1L9WA 1HFBA 2WNNA 4IPIA 5AHFA 5L9FA 1VCVA 2CLEA 2EGZA 5KSWA 4AEOA 1A50A 2R94A 3F1QA 5CPLA 5F2LA 4OWGA 2VENA 4Z1AA 2Y63A 4RK8A 1SZGA 4GUGA 2GJLA 3KOFA 4M7TA 5DN1A 1FXQA 1SZEA 2X1RA 3PSWA 1QDSA 4WQ6A 5G2WA 3ABRA 5AC8A 5F4XA 4BI5A 1VS1A 4WXYA 4NJHA 2BLEA 3P62A 3S0CA 4NJJA 3NM1A 3PG8A 5E1QA 1SZNA 1AG1O 2J24A 3IEBA 2O7QA 3FIGA 2JK2A 1OABA 1EA0A 4R34A 3QSRA 3M9YA 4JTSA 3CC1A 3TJLA 3A9IA 2DJXA 3ZWTA 4IGHA 2PE4A 4UC5A 1H62A 1K8YA 3W1AA 3F4WA 3W7NA 1TV8A 3B05A 4EVZA 4Z1DA 1I2NA 2P1FA 5H2ZA 3WK0A 1SW3A 2QCLA 4D2JA 4HNTA 4YLWA 3GNNA 2ZTJA 1LBMA 1Q6RA 2B4GA 2D73A 2ABAA 2Q3RA 2VXNA 1EX5A 4QITA 4O8RA 4NX0A 4WD0A 1X1ZA 3C3NA 3SZ8A 1GZGA 1NF0A 3G8RA 3NPVA 3L65A 3B0VC 3IIVA 2DU2A 4JXCA 4MZYA 4TX9A 4QAIA 3NR0A 1IIGA 2A7PA 4NXKA 3W7GA 3BV4A 4PH6A 4RLIA 5F1UA 5J5RA 3LBMA 1TIMA 3LX9A 2NV2A 3STGA 3O63A 2NXHA 1VHNA 5DELA 1EP1A 1WQ5A 5D03A 3SY5A 1VCFA 4XZ9A 5AYZA 3LCWA 3LXAA 2E1DA 1YDNA 4JTFA 2J27A 3SGZA 4PL1A 4A2RA 1SO5A 3HQ1A 4M6VA 5EKYA 4HNUA 1K03A 4RX0A 3CEUA 3MHGA 4JDBA 1K7FA 2Y7EA 1CX9A 3DFTA 4YMZA 3LV6A 1L6YA 3OVPA 1V5XA 3A21A 3N2XA 5LHFA 3B8DA 4OV4A 3L5AA 3PB0A 2C16A 2NXIA 5HULA 4DO4A 4ZQNA 3A23A 2A7NA 1PCWA 3LCXA 2DZPA 2V9DA 5LGXA 3ELFA 1KM3A 3PBUA 3AJXA 1E51A 3DGRA 5LZLA 1AL7A 1YPIA 3WK3A 1Y0EA 4GBUA 1J4EA 4MLJA 3NQDA 1UB3A 1LORA 1LZOA 4OGZA 2J6XA 3FEMA 3ZWSA 1MEHA 3LB0A 4HN4A 4PA8A 3EKZA 2FPTA 4X9SA 1BKSA 3HGRA 3QW3A 2VFFA 1H7RA 1OFOA 4XTDA 1EP2A 4JEQA 2WJZA 3W74A 3M41A 3ATYA 3A5VA 3P81A 4R7JA 3I68A 3SW6A 1A5CA 3W7OA 3MMTA 4A21A 3W2UA 4DF2A 5I3GA 3KX6A 2ATMA 1R2RA 4H4IA 1KTCA 1X6UA 3TW6A 2C6QA 3O07A 3NZRA 1XXXA 4IMFA 2Y7GA 3W2JA 2Y89A 1HG3A 5AHLA 4AWSA 4I7VA 3UWWA 1GG0A 4B5NA 3S9YA 3M5VA 3TNOA 1OK6A 1FDYA 4G1KA 4WXZA 5CZSA 3CQ0A 1KV8A 3BGJA 3DZ1A 1JCYA 5FF2A 3RFAA 5LNRA 1FQ0A 2QCDB 3DFPA 4FNSA 4NT0A 2WNZA 1OVDA 2FTPA 5I3IA 5LSMA 3UY8A 3JS3A 3IGUA 4MZ1A 1YTDA 2ZRVA 3KVKA 1HUVA 1UJPA 2V8ZA 3THQA 4CNPA 3PUEA 3VFLA 2QF7A 3HJZA 1G69A 4U28A 2NX1A 2VKZG 1QOQA 3HPSA 5C6MA 1C9DA 4Z0JA 1I2PA 1WA3A 2ZDRA 5EYWA 4CQ9A 3NL5A 3LHWA 5D2WA 5EL1A 3GXPA 2A6NA 1JJKA 1SSGA 4LS1A 3KHJA 4NJGA 1LBFA 5FF4A 1KM6A 4E2BA 1TSIA 4JDYA 4O52A 1SQ7A 2DJLA 3LCGA 4MJMA 1GOXA 5I3KA 2X1UA 3I7SA 2ZCGA 5G2HA 2H6RA 3O15A 3LCHA 1GG1A 1B9BA 2W0UA 4Y90A 3FLUA 3WK2A 2WV8A 3NDOA 3P7YA 3IV3A 1S5WA 4UR8A 3ATZA 1DVJA 4JTHA 4Y6GA 3KVJA 1SU5A 1FWNA 2F7FA 4PC8A 3MI2A 4UIOA 3HG4A 4I7WA 4RCXA 4QJ1A 4UTLA 4UUIA 3O6YX 1FDJA 1FXPA 1OYCA 3TMLA 2QEZA 3Q94A 5CKSA 1IF2A 2E68A 3LV5A 3NM3A 4MPQA 4N4QA 2OZ0A 4N4PA 2CLHA 5D37A 2CW6A 3W70A 5CPMA 2X16A 4DBDA 1VR6A 1B4KA 3NQAA 3OBKA 1OX4B 4FXRA 2Z2UA 5G5IA 1JQVA 1TPWA 1P4CA 3S6DA 4O57A 2DORA 3EX1A 3NQCA 1RQBA 3TDFA 1D3HA 2VOMA 3LHTA 3OIXA 1JUBA 1LDCA 2HS8A 2WSYA 3T78A 3PM6A 1YXCA 3QRHA 3QMTA 4JD4A 2V0TA 4XKYB 5FF3A 1AL8A 3KFTA 4IQLA 3UZJA 3FOKA 2ZRUA 1BWKA 3HGOA 1PHWA 3LHVA 4DF0A 1YADA 4GE8A 2Z6IA 1KM0A 1O5XA 3U6WA 1QFEA 4O11A 4W9TA 3LLFA 3DHDA 3KRZA 2TSYA 1OFRA 3KRSA 2IQTA 2ZBTA 4ALDA 3W1MA 3N34A 1LTDA 4KWVA 4RZ6A 1T8XA 3W7DA 2V5BA 4Z0SA 2TMDA 4UTWA 4WOZA 4UFKA 2E09A 1R2TA 4DPQA 3W7KA 5MHBA 3LI1A 5DBUA 1KFCA 3QPZA 5KMYA 3TA6A 4LOCA 3EX3A 2YSWA 4NJKA 3TK7A 4P2VA 3GNDA 3GVGA 4H3DA 1LOQA 2PRMA 1AW2A 5HR7A 1OFDA 2EF9A 4GNJA 2QJGA 5CPNA 3PBWA 1GTEA 4JIQA 3GK0A 3I7RA 4N9CA 1LRNA 5AC7A 3M5XA 1SO6A 3G0UA 2ZA1A 1FWSA 1LCOA 1IIHA 4NJIA 2Y62A 1G4SA 4PTNA 3EWBX 1ZJIA 1MXSA 4AWUA 2YW4A 1KFBA 3E0IA 2QJIA 2PRLA 2C3ZA 3TUUA 3C8FA 1TPDA 1KFJA 1HL2A 1XC4A 1LRQA 2WO5A 3NQVA 3C52A 2E6DA 1W3NA 5D04C 3W23A 2QCCA 3VE7A 1LOSA 4LC8A 2GQ9A 3KRUA 2H3BA 1KLZA 4GUJA 3F03K 4FO4A 2JKPA 1ZNNA 3HGJA 3MI6A 3KAOA 1PVNA 4QIUA 5K4ZA 2NWRA 4FB7A 1YPFA 3BVJA 4O4WA 3ABQA 3W7JA 2QAPA 3TQ0A 3S1XA 1IGSA 3N19B 3QPYA 4CNNA 3RMJA 1F6PA 2A7RA 1QPNA 5BRBA 2GJNA 5ABTA 3TSBA 1ZENA 3QF0A 3BPWA 4I7UA 1Q45A 3S5NA 5HWNA 3O6CA 4ADSA 4IX2A 1Q6OA 2F84A 1H7PA 1KA9F 5DCEA 3VKJA 1KTNA 3TX9A 1WOBA 3OEXA 3NGJA 1H61A 4AB4A 3L67A 1ZALA 1OJXA 5DY3A 2O7SA 1KM2A 1VH7A 2J9XA 4QNEA 5BMXA 2YW3A 4GUFA 2J88A 2CZ5A 4Z08A 5D2XA 1N7KA 1XKYA 4PODA 1G7VA 1KM5A 2G97A 2YR1A 3QQ1A 1GT8A 4CQAA 2PRHA 3LCLA 4OHQA 1FWTA 2BSLA 2OJPA 3MUXA 1FCBA 4NQ1A 3W83A 3W72A 4JGDA 4DF1A 1VPXA 3M0ZA 1M7PA 1GJPA 4UR7A 2TRSA 2NXGA 3JRKA 2C19A 4O4VA 3QQ0A 2YDAA 3IVUA 3CIXA 2V2HA 4RJEA 1DL3A 1X8FA 5CPOA 4PCFA 4KFNA 2FIQA 1ONRA 4O14A 1OF6A 1TB3A 2DZWA 1ZAJA 1S5VA 2FPYA 4R53A 1MEWA 3TFCA 1XDLA 4JTJA 2QJHA 4DEFA 3TSMA 4ZVJA 1SFLA 1G4PA 1KLYA 1TQJA 3MW7A 3NEVA 1W0MA 5CSSA 4O0KA 5LNVA 1N55A 4WY0A 1I2QA 3NNTA 3O16A 2GVLA 3PBYA 2CZEA 1UUOA 3HB9A 3VE9A 3P8JA 3W7PA 3N73A 2C15A 3L5MA 1Q6LA 1TPEA 3PG9A 5AB3A 2BZNA 4E2DA 1EIXA 3UNDA 3EX4A 1OFEA 1FBAA 4E38A 1F05A 1KW1A 3QYQA 4X3ZA 4BI6A 5BW6A 2GQ8A 3LDVA 3MYPA 5D02A 1QWGA 2DZXA 3LHYA 4ADUA 4FIQA 3W87A 1Z48A 4LVBA 1TRIA 4WUIA 5CZTA 5HWMA 3U8GA 2W79A 1H63A 3HG2A 1N8FA 4FF7A 4XQ6A 1JRBA 1OX5A 3PB2A 4JIPA 3EWXA 4QSHA 3P5ZA 5K2ZA 4YCPA 1H50A 2B7OA 1FWRA 2YFOA 2C13A 2QCGA 4Y96A 3BARA 2G96A 2C14A 1YYAA 3E02A 3G1AA 3LHZA 3R89A 3F4NA 2VEMA 3BW4A 1M7OA 3CHVA 4L4LA 3W7CA 1W56A 3FS2A 4UCGA 4Y8FA 4JY8A 3OG3A 2HMCA 4KWWA 1EEPA 2V2DA 3NL6A 3LBCA 3LXBA 2E77A 1BWLA 4N9DA 2ZZ1A 3S5OA 4C1KA 3DFNA 5CSRA 3MP5A 5I3JA 4UTWC 4IXHA 5DBTA 4A29A 3EB2A 3PWAA 1R47A 3T4CA 4AF0A 2B7QA 5TBOA 1KTBA 4HHPA 1LROA 1NVMA 4WJEA 3DFOA 3W88A 1KM4A 3JR2A 5AHEA 2Z0IA 1SSDA 3USBA 1K3UA 3E49A 3GDKA 4OU1A 1XFBA 3IGSA 2XFWA 4M5PA 3TFXA 5L6UA 3RU6A 4K6AA 1QOPA 4ZQOA 2ATSA 1S5TA 4TMBA 3GIYA 4AHPA 4UFIA 5AYXA 1JCMP 1GYNA 2GUUA 2YXGA 3U2OA 5TQLA 5G4WA 5K7JA 1W3IA 4O19A 1JCNA 3STCA 1DORA 3HOJA 1CI1A 1ME9A 3M47A 2FFCA 1XBYA 3E12A 3ANYA 2WSQA 5K3VA 1FDZA 4JYEA 1THFD 1KFEA 4AHQA 4M6PA 2C18A 3G3DA 4LS0A 1TPH1 1QO5A 3BO9A 5FF7A 2EPHA 4JX6A 4Y9AA 5HNRA 2YPIA 2YGYA 2ZRWA 4XWUA 1PCKA 1K02A 4JR5A 3DFSA 1BTMA 5D32A 4NZFA 3GR7A 3N9RA 4RV8A 2OCZA 4FXSA 3T40A 4JTLA 3G22A 2R91A 4LUJA 5KZMA 2WPBA 1ICSA 1NFBA 4O1CA 3DBPA 4UMBA 1P0KA 1K8XA 3P60A 3OVQA 1VHCA 1Z42A 2A1YA 4UTTA 3E9AA 5H91A 3W1QA 4MFEA 1UCWA 3PC0A 1SW7A 3HIJA 2W6RA 4AH7A 2VEPA 1H5YA 2ZZ7A 1GEQA 4FNRA 3PR2A 1PL9A 3S1UA 5DXYA 4UNLA 3EWWA 2NV1A 1D9EA 1IXPA 4O18A 4ZQMA 5K9DA 2B7NA 4FIRA 5BMWA 4LUIA 1F5ZA 3UYCA 3WJZA 2CLKA 2FQIA 3CWOX 2DZTA 3NQGA 4LRSA 4MIMA 3P74A 1GYLA 1TTQA 1DKWA 1DV7A 2VEIA 3IVTA 2CLLA 1RQHA 3TXVA 2VFEA 3SI9A 2NX3A 4MY9A 5U4NA 3BG3A 3IRDA 2ZTKA 3HPXA 1G7UA 2I9EA 1X7FA 1J5TA 3M6YA 1KBIA 2BTMA 3IIXA 3MBDA 1VYPX 3TROA 1UUMA 4FX6M 2ZRXA 3TQVA 2E5CA 3L68A 3W3OA 2QCEA 3W7LA 1WYIA 1GVQA 3W2NA 3SECA 1LBLA 3VI2A 3GKAA 1P0NA 3NA8A 1EPXA 2GQAA 5SWUA 4Q32A 3R2GA 3MBFA 1TPFA 3TJXA 1P5BA 4XBKA 2Q8ZA 3LI0A 4YL2A 3BLFA 1GWJA 2V81A 4A2SA 2FB3A 5IM51 3QM3A 1GTHA 3CLMA 4KFOA 3FYOA 4HNNA 2RH9A 3PULA 3R12A 5E93A 1I4NA 3C61A 1OYBA 1W5MA 1B3OA 1U83A 3HF3A 1O95A 3L0GA 3UWYA 4NNCA 3NQEA 5FI8A 4LT9A 5BOOA 2FLIA 4GJ1A 1JR1A 1ZAIA 2H90A 1XL9A 3NO5A 2FB2A 4JTGA 3P84A 3S1WA 3WK1A 5C5YA 3Q37A 5LGZA 3G0XA 3BGGA 4UFJA 1GVOA 1WOAA 4GC4A 4ZQPA 1H7NA 1OYAA 2X1SA 4IUOA 2NUYA 1S3HA 5FESA 3MHUA 3G1HA 4LW7A 2DZUA 5CZ0A 3O6DA 3WFAA 1VLIA 3FFSA 3I6RA 2E5BA 2ISVA 1VLWA 4OT7A 1I8JA 4JTUA 3IVSA 4QISA 2VFGA 3EKLA 2Y6ZA 4FHAA 4N6EA 4ICNA 1MSSA 3RK8A 1P1XA 1BEUA 1W37A 1JQXA 1OFQA 3NAVA 4UFMA 2OMAA 3GXNA 4TMCA 3I7QA 1SZFA 4JS3A 5D2TA 4JNMA 3R13A 4XUGA 4H6KA 1G4EA 1W54A 2H8XA 5LHEA 1ML1A 1YDOA 2ZA2A 1SO3A 4AWTA 4AXKA 2ZZ3A 3VNDA 1Z44A 3M5YA 1EP3A 5F4WA 3G0SA 1OK4A 3MI3A 4HT3A 4DBEA 3SR7A 3STFA 1FX6A 1G67A 2YYTA 2NWSA 4P61A 3OHIA 2CLIA 1M5WA 3HPZA 3R5EA 1TTPA 4TU1A 3MWAA 1VJIA 4MKNA 2VFHA 1YTEA 5HUPA 3G8EA 2Y88A 3DI1A 2QUTA 1G6CA 1K7XA 1VRDA 2V30A 2BWGA 2CU0A 1G4TA 3C2OA 3GAYA 3HGSA 3B04A 3O06A 5LNSA 3QMSA 1YDVA 3M7WA 8TIMA 3UD6A 3LXCA 3TH6A 5HWJA 2A2IA 3TIMA 2VEKA 1FY6A 3GXTA 1H7WA 1UASA 3UWVA 2A4AA 5T26A 4K38A 1AK5A 1QPQA 2BXVA 3CT7A 1I45A 2DP3A 1TPVA 1GVFA 3UWZA 1O5KA 1W5QA 2A0NA 1VGAA 4IJBA 2X30A 3A24A 1W5NA 3N9SA 4Z1CA 1RV8A 3HG5A 4DO6A 1JULA 5IBXA 5FEPA 3KVMA 5K9XA 2Y85A 1O94A 3C2RA 3NL3A 4POCA 3W2MA 3NQ7A 4IOTA 3GDTA 1QMLA 1TV7A 3DI0A 5K4XA 2A6LA 3HO8A 3KVLA 4R33A 2HTMA 5I3FA 3A5FA 4N9EA 3NOEA 5EPDA 1W31A 5LNWA 4Z1BA 4BF9A 3C6CA 4O50A 3TAOA 1XUZA 1R46A 4IXXA 5LKYA 3UPWA 3MP3A 4ML9A 3S1VA 3O8AA 2G95A 3L2IA 4UTTC 4O1AA 4HPXA 5C2XA 4IPJA 1PE1A 2PCQA 4UMAA 1F6KA 3QFEA 4JTEA 1WV2A 3S42A 1HO1A 3DAQA 4NXSA 5E0KA 5DXXA 4MOZA 1OHLA 1JCLA 4ORMA 4MYAA 3DKJA 2ZFAA 3EX2A 2QUUA 3PUDA 3DENA 4FNUA 2R8WA 1XBVA 3G1YA 3WJYA 3W7QA 1SR9A 1LLZA 5CZJA 4BWLA 2CFFA 5HJLA 2LLEA 3RLVA 1C29A 4WZHA 1AW5A 3OVRA 3LHUA 4K8EA 2PC4A 5AOUA 2UV8G 3M43A 1MEIA 3TR2A 3EWUA 3P8IA 4GXMA 1OX6A 4AAJA 3NPWA 1C8VA 5D09A 1TPUA 4O10A 5HUOA 1A5SA 2Y61A 4PFMA 4TIMA 1RQEA 3B4UA 1OF8A 4IX0A 3PS7A 2VC6A 2JKEA 2ALDA 1MO0A 3RNDA 3GYEA 3BK0A 2WNQA 4S1FA 3LERA 3L0NA 4TO8A 1DOSA 4NVTA 4LNYA 1O60A 3QEZA 3ABOA 5A8GA 4LVDA 1SW0A 5D30A 1I2RA 3O05A 5F2IA 1IXQA 3LRKA 1T99A 3W7RA 3UPBA 1H1YA 3T7VA 3SFKA 3WJXA 2X2GA 3QMRA 4ZZ9A 3BLEA 3EEGA 4AHOA 3QC3A 4XTIA 2XN2A 1K8ZA 2A5HA 4NZJA 3BW2A 2ISWA 3CPRA 1LM1A 3NQ6A 4NUWA 2CLOA 2JGQA 1EB3A 5HR6A 3PF3A 1F73A 1WBHA 1DHPA 1QPOA 4ZQRA 4O17A 4O13A 2EKCA 4DQWA 3NQ8A 1NF7A 5AHMA 2RFGA 5KTLA 4UFHA 1Q3NA 2B7PA 4EF9A 4HIBA 3NVTA 1PS9A 1ZCOA 2Q3OA 1QPRA 4QNWA 3C56A 4O53A 3CIWA 4EWND 1TPC1 2QDGA 5AFDA 4K7VA 3DXIA 3BW3A 3B0UX 3G24A 4RR4A 2PURA 2QR6A 1F74A 5F1VA 1XM3A 3LOTA 5D33A 2ISSA 4C1LA 4CNOA 1L6WA 5EMUA 1SPQA 1H7OA 3W85A 1J2WA 4NU7A 1DJNA 3W73A 4YCOA 2ZRZA 2Q8LA 1A5BA 4X22A 3T55A 4GRSA 1L2UA 3IIPA 1HO4A 1AW1A 2NZLA 3MO7A 1ICQA 4O1BA 5FF0A 1YLVA 2WOQA 2QCFA 2XN1A 4O15A 3GX9A 1WXJA 3RF9A 5KITA 1TYGA 4WY0B 4JYDA 1RPXA 1X1OA 2E6YA 3NZ1A 1QCWA 4JX4A 3N14A 3W1LA 5AC6A 3SSJA 3ZS4A 3UY7A 1PV8A 4IMGA 2QDHA 2I1OA 4BR1A 1VZWA 4K37A 3NPXA 4J9JA 4XBSA 1W1ZA 3CU2A 4YXGA 1EUAA 1TRDA 1TJPA 3NYZA 3GDMA 4RKAA 1XBXA 3MP4A 4OV9A 3V1PA 3NQFA 4N6FA 3ABSA 1SUXA 3W7EA 5I3HA 3M44A 3QJAA 4MUZA 4O1DA 2ZZ4A 4OE7A 2FDSA 1PHQA 3LGEA 3NPUA 4K36A 4MYXA 1B57A 2VFIA 3QW4B 1L6SA 3ZR4A 1EWDA 1LYXA 4JTIA 3LTSA 4GUHA 3P82A 5C55A 2CZDA 2KZHA 4MVAA 5IBXC 1XI3A 2QCDA 4LVFA 2RDTA 3FKRA 3BG9A 2FJKA 3GZ3A 3LTYA 4K7YA 5AYYA 4N02A 3GR8A 2HSAA 3P5YA 3W1UA 3DU0A 5G4EA 3PAJA 3NQMA 1TPB1 1VC4A 2ZQ0A 3W71A 4FX8A 5GVJA 1T0OA 1H51A 1F76A 3W7HA 2NUWA 4JYFA 2ZZ5A 3WJWA 4FEZA 5AHNA 4CQ8A 2HS6A 4O16A 3LCFA 4QM1A 5FEZA 3TXZA 4GUIA 2X1TA 4EOUA 3GDLA 5DLCA 4AF0B 1W5PA 6TIMA 5D05A 4LV4A 1LOLA 1TJRA 1OFAA 4NNAA 1QAPA 2Z6JA 4OQVA 1NSJA 3GLCA 5KINA 3K30A 3W76A 4JICA 3CM4A 4LTSA 3QH2A 5A5WA 1RR2A 1JUKA 1ME8A 1TQXA 2QCMA 4TR9A 3TW7A 3M1ZA 5EBUA 5BNKA 3G1FA 1ADOA 4L4MA 4UTUA 1A5AA 4AVFA 3AO0A 5KZEA 3LLDA 4CLMA 3L0KA 3T44A 3S5YA 2TYSA 2Y70A 2E5DA 3W07A 4FX7A 2R14A 2VFDA 4BWLC 1XDMA 4CCEA 1LLWA 1LP6A 2VELA 3H54A 1GQNA 1H1ZA 4RXFA 4LRTA 1ZFJA 1WAUA 5EY5A 4ZQCA 3TC6A 2NUXA 5KZDA 2ABBA 4HSNA 2CLMA 2JKAA 4K8HA 4KKXA 3PVFA 4WOQA 5DCDA 2V2CA 5DY2A 3UQNA 5D2YA 1IXNA 5F2GA 1SO4A 5FEWA 1AMKA 1OX4A 1ZY9A 1PIIA 1KV5A 1FCUA 4UXDA 1JUEA 2WSRA 3GB6A 2NX9A 4MJZA 3G1SA 1TV5A 1OFBA 2RDWA 4NNBA 3W7MA 3TMQA 5F4SA 4A3UA 3L66A 4RZ5A 3LRMA 4XKYA 2A21A 1JRCA 2CLFA 4UTMA 3W1RA 3KXQA 3TU9A 1ME7A 1V7YA 4S2BA 4UTJA 2OT1A 2BX7A 2Y7FA 3G3MA 4NX5A 1KM1A 3G18A 3GKFA 2E6AA 5TIMA 5CG7A 4UMCA 4JTTA 3W75A 2ZA3A 3EXTA 3MYOA 3FYPA 3OA3A 3C4UA 1ALDA 3NQ2A 2EAWA 4UTKA 2C0AA 3GDRA 1XUUA 2AAMA 2GVJA 4DELA 5U7SA 4LVAA 3C2EA 3H53A 3W1NA 1YXYA 1TCDA 4M7SA 1SFJA 4UNKA 4FNQA 2DZVA 1M6JA 1FCQA 4O12A 2DZSA 3EX6A 2JBMA 2XN0A 1RD5A 1TTJA 4BK9A 3DHFA 4KFPA 2YFNA 3L5LA 4O0ZA 1F2JA 2TPSA 3W1PA 5AHIA 4PEKA 3EXSA 3G1DA 3UWQA 3TC7A 4WY0F 3NG3A 4IMDA 1K7EA 2GVGA 3EWYA 1QR7A 1LRTA 1OFPA 3NL2A 3P80A 3FKKA 4DXVA 1VQTA 2CWNA 2ZYFA 3S5ZA 2AGKA 3M16A 2YZRA 4CCCA 1H60A 4DO5A 4N9BA 1YXDA 4JX5A 1TREA 5HMSA 2V5LA 1JCXA 5FEXA 1MZHA 3IIZA 4Q33A 3SIZA 3B0PA 3MJYA 3W6YA 3L21A 4O28A 2B0MA 1EUNA 2P0OA 1WBJA 3G1XA 1ZHAA 5D2VA 6ALDA 3CEPA 3UXAA 4S2CA 2GPTA 2H3DA 3N2MA 3STEA 4MFDA 4O54A 3TE9A 2OX1A 5HQEA 3P61A 4BFAA 5HINA 2I14A 3HBLA 3YPIA 4ZMGA 3D0CA 1R30A 3IGXA 3W1TA 1EWEA 4HKPA 4ONVA 2QCHA 3C2FA 1QNVA 1DQWA 3GAKA 1DJQA 3UXDA 3BLIA 7TIMA 1U5JA 1OG0A 1CW2A 1WDWA 4HSOA 1D3GA 1Z41A 2QUVA 3VCRA 1TTIA 1VCGA 3LCIA 4IWWA 2CZFA 3QZEA 3TAKA 1UBSA 1GVSA 1QO2A 4JY9A 2QAFA 4A22A 2J9ZA 3IIOA 4FNPA 1HTIA 2WQPA 1RZMA 4MY1A 4Q4KA 3NXFA 1Q6QA 1O4UA 4N2YA 2C1HA
chains in the Genus database with same CATH superfamily
2XM2A 3CWNA 4O8AA 3M5ZA 1PX8A 3UWUA 1TVLA 3N4FA 5CJ5A 3E2SA 3GBEA 4FSAA 1W9DM 1AZ2A 4LB3A 3OW1A 2E6FA 4UTIA 4AIUA 4RDWA 4C7GA 4GVFA 4C5YA 1UBPC 1OD8A 3CH0A 2BY2A 4U4MA 2DVTA 1UIPA 1T96A 2OGYA 1IR1A 4MTVA 5M17A 2XIMA 2Y1HA 4GZIA 4PTVA 4OVXA 3OO2A 2F6XA 2VC5A 4DI8A 3A22A 1FFQA 2Z1BA 3QHMA 1ZS2A 2UY4A 4NY2A 1MRAA 5C54A 1A53A 2J13A 3CB8A 4P8UA 2XIJA 3FA5A 4G7EB 1CT5A 1MNSA 3V75A 2YYUA 4C1NA 4RXGA 3G1VA 5REQA 2RKXA 3PZTA 4FPSA 3AICA 2GGJA 4HNVA 1DIDA 3CMJA 4AD3A 4GFSA 1UR1A 3THAA 3ZT7A 2VCAA 1ZSXA 1V6XA 2HWGA 1UR2A 2YX0A 4QE5A 4IMAA 3B9OA 3N3MA 5M2FX 1E4IA 3WLPA 4LS2A 3EDDA 3MMWA 4G8TA 2JGYA 1L8NA 2HZGA 1R3QA 1BF6A 3DKLA 1S1PA 4K2SA 1EGZA 1F7BA 3PZ9A 4X2RA 1CXKA 4D72A 3WX7A 2O56A 3AHZA 1H2JA 2VGGA 1KBJA 1M7JA 5EA9A 4FNTA 4B92A 1MI3A 1KFLA 3SJ3A 1DXEA 2ZZ2A 3RRAA 3FK4A 3L9CA 3ZVIA 1VRXA 5PTDA 4BA0A 2I5QA 4AMAA 1O5QA 3TQPA 4A8RA 3CYJA 5BXSA 4L80A 1WE5A 4P7QA 1FWWA 2B31A 3H2FA 3FYYA 4HPJA 3SY8A 1Q4WA 4RZ4A 4AYSA 1NAL1 4IMEA 1P6CA 2AAAA 5H8UA 1VBJA 3B03A 5C2CA 1R2SA 4LYRA 4LC6A 2X7WA 2RAGA 3LM7A 3TLLA 3VD4A 2A79A 4NAFB 4IPIA 1E1CB 1MW3A 4MNJA 1SGJA 1EA9C 1V0KA 1S2AA 3VDAA 2R94A 1A3XA 3FA3A 3AIVA 1X8CA 2ACSA 1XIFA 3F1QA 3K5XA 5F2LA 4ACYA 2VUNA 1XQKA 2GJLA 4WSKA 2PB1A 5DN1A 2X1RA 3PSWA 4BEQA 4J3UA 3FW6A 1MNZA 3ARRA 1NP0A 3ABRA 4I9JA 2AQOA 1REQB 4MG4A 2BLEA 3P62A 3TP4A 4AIBA 3NM1A 1AG1O 2Z25A 1S5NA 4J7RA 4UQEA 4S3BA 1VJSA 2CBUA 3WF4A 2BBFA 3QSRA 4AMCA 3M9YA 3U7VA 1UW9A 3DG3A 3TJLA 4B9YA 2JEQA 3A9IA 2BVYA 4JTQA 1L2QA 4UC5A 3F4WA 3W7NA 1QHOA 1R0MA 1DJIA 4EVZA 4US6A 1K8CA 4UQ9A 2CEQA 1SW3A 3T2QA 3GNNA 2D73A 2Q3RA 2VXNA 3BXWA 1UQZA 4O8RA 4ZOEA 1X1ZA 4OBSA 4HA1A 3IIVA 3DIPA 4QAIA 2PDXA 3KTSA 3W7GA 2Z00A 5J5RA 1E4NA 5DT7A 1NOFA 4LGXA 3STGA 3KCOA 2NXHA 4H7CA 4QE1A 3L2MA 1VEPA 3SADA 5D03A 3SY5A 4M56A 1E1FA 2E1DA 2ACRA 4A3YA 3TWBA 4A2RA 3TWAA 3HQ1A 1BRLB 4WCJA 3AOFA 2QXWA 5HAOA 4QSFA 3WBEA 3MHGA 4JDBA 1JYNA 3BICA 5A3HA 3R8HA 3GHUA 4JN8A 4EANA 3B8DA 4OV4A 3L5AA 2AMGA 3PB0A 2FHBA 3K46A 3PBUA 1JPHA 3DGRA 4ZO8A 1AL7A 1Q65A 3V5OA 3UXLA 1J4EA 2PLJA 1XFCA 1JAEA 2V68A 1DWHM 3ZWSA 1EO7A 4PA8A 4X9SA 4ATLA 3HGRA 1LWHA 3VD3A 3W74A 4XTDA 1EP2A 4IPLA 1A5KC 3M41A 4HPGA 2GJXA 1OIFA 4LXFA 3VIFA 2EJ1A 3MMTA 3BL3A 3W2UA 2WBKA 3UGVA 3FNDA 4H4IA 1X6UA 3M0VA 3NZRA 1XXXA 1RXOB 4M6UA 3W2JA 3WLKX 2EBNA 4AG0A 4BHYA 4AWSA 3PZUA 3UWWA 1GG0A 2DUXA 2J4GA 3RLGA 3RAOA 3VILA 3CQ0A 4UBPC 5C8BB 1JCYA 5FF2A 3RFAA 3ONCA 3IK2A 4F0RA 4NT0A 5I3IA 3L4UA 3S47A 3KVKA 1HUVA 1UJPA 4CNPA 3PUEA 4D6FA 4ZTXA 2VQUA 1GJWA 2X09A 4Q4MA 5C6MA 1I2PA 1WA3A 3IWPA 2FTWA 2VEGA 5EYWA 4CQ9A 1PBGA 4L9XA 1UQYA 4LYKA 3NURA 5LA2A 1SSGA 4LS1A 1A47A 3JZEA 4MJMA 4ACZB 1F3XA 4X61A 2X1UA 2DT0A 1MUCA 5A6AA 2QV5A 3S83A 1B9BA 5HMFA 3LLXA 3NDOA 4LJ3A 2WMGA 2DSKA 1DVJA 1RVKA 3RU8X 1JXJA 2EPOA 5DRIA 4K1WA 2IPJA 4UIOA 2OWWA 4HMDA 3WLOA 1FWCC 1Q85A 3O6YX 5CKSA 1IF2A 3LV5A 2CLHA 5D37A 3FHQA 3ARTA 5FJUA 4YTUA 1PSCA 1BAGA 2HXUA 1TPWA 2YBTA 3K1GA 3WNNA 2EG6A 3CO4A 3CQJA 3K4WA 3TDFA 3ICJA 3OIXA 3GDBA 4FR6A 1NU5A 1VFTA 2A3AA 1PWMA 3QFWA 3VKBA 4GYPA 4JD4A 3POHA 2V0TA 5FF3A 1IEVA 3WMLA 3MUIA 3AISA 4HPNA 4PMYA 4DF0A 1F4AA 4GE8A 2Z6IA 1PYMA 3UG3A 1O5XA 4O11A 1MUMA 4W9TA 1KBLA 1R3RA 5DMMA 2ZBTA 1J0HA 2CBVA 3GS6A 4ALDA 3CS2A 3N34A 3CZ8A 3LMYA 4UTWA 3SCNA 1NDWA 2E09A 3CBWA 1R2TA 4H04A 3R0KA 5MHBA 3H24A 1KFCA 3QPZA 1NQ6A 5KMYA 3TA6A 3BSHA 3EX3A 4P2VA 3GNDA 4MWAC 1EH9A 3ZR5A 1AW2A 5HR7A 3LZ5A 1FWHC 4W5UA 5CPNA 3NO1A 1H4PA 3I7RA 1KRMA 3GTNA 4P7NA 5AC7A 1J0KA 3R1ZA 1QRQA 1DWFM 1LCOA 1IIHA 2F6UA 4NJIA 4DWSB 1EDGA 1G4SA 4PTNA 1ZJIA 3SN1A 4GO9A 2PMQA 1IHIA 4GIYA 1MQRA 5HDRA 1XRSA 4R7OA 2KAUC 2WHLA 2WM0A 4KEUA 5T91A 1XYCA 3TUUA 1Q6CA 3N9KA 1O1HA 1NDVA 2QCCA 4XD3A 2VEFA 1BWVA 1V4YA 2E9BA 3GW0A 3F03K 3MI6A 1PVNA 4HNCA 4FB7A 1YPFA 1VF8A 3W7JA 4QCEA 1XLFA 3IGHX 3RMJA 1F6PA 2V69A 1QPNA 1DWGM 4J27A 2D3LA 3V5CA 4A05A 4IM4A 4AC7C 3BAXA 3FAWA 1Q45A 4I7UA 5HWNA 2YDQA 1BD0A 3MT1A 1JDDA 2I57A 4ADSA 3QZ6A 4IX2A 2Z1KA 4J3VA 5DCEA 1KTNA 3LPOA 3OEXA 2WZIA 1A3HA 5A2BA 5B80A 4KCVA 5A94A 5DY3A 9XIMA 2J9XA 5BMXA 3FJ4A 4GUFA 9XIAA 5BXPA 1Y8BA 4HNOA 2XGBA 5IHSA 2WW5A 1XKYA 3QC0A 4D6EA 1CZ1A 3TW9A 1LJYA 3FVMA 4U5IA 1GT8A 1Q7MA 2VL4A 4CQAA 1FWTA 1XJBA 2OJPA 2ACUA 1BXBA 4LCRA 4UOJA 5J04A 3PUGA 3W83A 3OU8A 3W72A 1M7PA 1J6OA 1GJPA 3XINA 1XIGA 2TRSA 2NXGA 3JRKA 4O4VA 1NWRA 1RUSA 5JU6A 3W38A 2VHLA 1X8FA 1UP3A 1HX0A 1BXCA 1XCWA 2OSWA 4W84A 2JEPA 5TF0A 1ZAJA 1S5VA 4UOQA 2OEJA 3ORWA 4DJEA 1XDLA 4DEFA 1SFLA 3H7RA 1N82A 3MW7A 5CH9A 2WKLA 4RV3A 4W8BA 4WY0A 3N04A 1XICA 4L1GA 4L6HA 1M53A 2CZEA 3PBYA 3W7PA 3L5MA 1PZ0A 1IWBA 1TPEA 1WP6A 3PG9A 4B2DD 4QBXA 1OFEA 1IEIA 4E38A 5BW6A 2FDMA 1QWGA 3PJUA 1F8IA 2DZXA 3N12A 4GIAA 4UWMA 4PE8A 1DJWA 4ADUA 4AWEA 3IUHA 2W91A 3AWOA 1UWUA 2GGEA 2QGHA 5CC3A 3CAQA 5HWMA 1J11A 3NWRA 1OX5A 3TZNA 3EWXA 1D7KA 1EXPA 4JCMA 4PRRA 3N29A 1XRTA 1OT1A 2B7OA 2IKIA 4EE9A 2C13A 2QCGA 4CGTA 2G96A 3T0CA 1ISVA 3UR7A 3VX0A 3E02A 3G1AA 1WZMA 3LHZA 3F4NA 3NSNA 2GQ3A 1SJAA 2Q6ZA 1ZQ5A 4UCGA 4KWWA 3U3HA 2V2DA 3NL6A 3ZVHA 1J79A 4MGGA 3LA4A 5HNNA 3DFNA 3C8NA 2OYMA 3FVDA 3WEMA 3T4CA 2B7QA 4HHPA 3ZMRA 3A9BA 2Q71A 2J7CA 4IL0A 3OOQA 3AMDA 1SSDA 4AX6A 1XFBA 5IXEA 2P3EA 2PTWA 3FCPA 1S5TA 2BB0A 3GIYA 4TMBA 4AHPA 5F7UA 1JCMP 1CXLA 3WL1A 3H4GA 1E6QM 3AYVA 1KD0A 2YXGA 3L7RA 2PWFA 2ZUSA 4FLSA 4W8LA 1KGXA 1KFEA 2UY2A 1XIIA 1VFLA 4U3AA 1JDFA 3CV2A 4DB7A 5ABEA 1ZJHA 1TPH1 1Q7QA 3BZJA 4JX6A 1NFGA 2YPIA 1US0A 1TFVA 1PCKA 3GC4A 3LN3A 3H4WA 2OCZA 4GZJA 1EJVC 3W29A 4LUJA 2AKMA 1E6XM 4W87A 2OEMA 4Q7NA 1P0KA 5GPRA 4D6CA 1J8VA 3VNIA 3RR1A 2A1YA 4LYPA 4UTTA 3W1QA 1UCWA 3WQWA 1JFHA 1Y5WA 4CQDA 3W6MA 3GE7A 5C2GA 1H5YA 1UWAA 1GEQA 3CUJA 5DXYA 1ITCA 5C9UA 4FALA 4ZQMA 1K6AA 2HBVA 3K8LA 4FLRA 5IRPA 2OWCA 5BMWA 3VD9A 1F5ZA 3UYCA 3WJZA 4IUGA 1AJ2A 2FQIA 2WVVA 3WLMA 3P74A 1HT6A 1DIKA 4P8WA 1A5UA 1DV7A 3AS3A 1OC6A 4PTMA 1RQHA 3V4BA 3CV6A 4MY9A 1Q5MA 2XIOA 4UQBA 3GVWA 4L9ZA 2ZTKA 3MUCA 1XGEA 3OZYA 1J5TA 3M6YA 3QKEA 4PTDA 3VGEA 3II1A 4RW3A 1KBIA 2ZRXA 1OGSA 3PAOA 3AMGA 4J28A 1LBLA 3L23A 3VI2A 3W00A 4HMNA 3GKAA 1B3ZA 3VD5A 1EPXA 2GQAA 3R2GA 3FXGA 5G4HC 2I5IA 5BOEA 2Q8ZA 4KWOA 2OG9A 3LPFA 2QDDA 1PB0A 1R3TA 1RD6A 2WJEA 3BLFA 5C7HA 1OB0A 2OR2A 2E9LA 5TNVA 5E93A 1O95A 5GNYA 1FWFC 3NQEA 5AVHA 5FI8A 4DJFC 1OCBA 4CU6A 5BOOA 1IYXA 1ZAIA 2WZMA 3UXKA 4RW5A 3GU2A 1XL9A 2FB2A 4JTGA 3TR9A 2W4XA 1GOOA 5C5YA 3IJIA 3G0XA 2XGZA 1RAKA 1UZHA 3SQSA 3T0BA 3ZLFA 1OYAA 1QHPA 3QVQA 3BAIA 3VIHA 1JZ8A 2Z1XA 5FESA 3TN4A 3MHUA 3G1HA 4PMXA 4LW7A 2DZUA 4PTWA 3I6RA 2E5BA 4GY1A 3SJNA 2P76A 2ISVA 1VBUA 4OT7A 1MDRA 3IVSA 4Z2IA 1S2UA 4ICNA 4Q8VA 3M0IA 4KBXA 1MSSA 1IZKA 4J3ZA 1BEUA 3NAVA 1E3ZA 4UFMA 1H1NA 2IW0A 2YA0A 3GH4A 2Z1VA 4R3UA 3N6JA 2QVHA 3AQUA 1HN1A 6ENLA 4JNMA 4WSJA 1GYMA 2ODOA 1G4EA 1W54A 4AY7A 4HJFA 4XD4A 1SO3A 1EP3A 5F4WA 3MI3A 1FX6A 3WUEA 1SJBA 4G7EA 3OHIA 3R5EA 2OXNA 3N11A 3MWAA 3CZLA 3PNZA 5BU9A 3WBYA 1YTEA 5EMLA 5HUPA 3U5YA 1U33A 2Y88A 3DI1A 1K7XA 2BWGA 3AIQA 3HGSA 1OZMA 4JTAA 3AZRA 5ABFB 3SB0A 1TCMA 2P8CA 3UD6A 3LXCA 3BOXA 5HWJA 2FFIA 1VBHA 4KF1A 1UASA 3SCTA 3UWVA 2A4AA 2A3HA 3C5QA 5CBBA 1AK5A 2ANUA 3FAXA 5BROA 2NV9A 4MKSA 3MMDA 4YIWA 4IGMA 1JFXA 1ODUA 3BSGA 1RV8A 4PBFA 5K9XA 5C0QA 3KVMA 5JMUA 3QZAA 2E1WA 4LAZA 3JU2A 3GDTA 4CVWA 2A6LA 2NQZA 3KVLA 4R33A 1J18A 4JIIX 1UR9A 3A64A 5EPDA 3WNMA 1W31A 2WMIA 3GG0A 4IXXA 3UPWA 2VTFA 4IZGA 3WQGA 4ML9A 2G95A 5AZ1A 4DAIA 3HA1A 3PZNA 4O1AA 5C2XA 3CGTA 4JTEA 3VZXA 3IJ9A 1B3YA 4IH3A 2I16A 4XSMA 1HO1A 4NXSA 2DIJA 2G4FA 2PODA 4HK6A 5D9MA 1OHLA 5DXXA 3U5UA 3BTNA 4NAFA 1E1CA 4NI3A 2INEA 1SFTA 4JIRA 1E73M 3PUDA 2R8WA 4V1YA 4DUWA 2ZUWA 1XD0A 5CPQA 4H9TA 4BWLA 3UERA 1DIEA 2QF8A 3WF1A 1R3SA 3H22A 4IIBA 2CESA 4HNLA 4Q4QA 4AZCB 4PULA 3KL0A 4WZHA 3WNKA 3PHAA 4QLKA 2UV8G 4GMEA 1REQA 1OX6A 4AIEA 3NPWA 4AC1X 1UD6A 2A3CA 2Y61A 3KHDA 1OF8A 4IF2A 3MZNA 2ZWZA 4UB9A 1WXZA 4EXBA 4GABA 3BK0A 3S9ZA 1LT8A 3L0NA 4TO8A 1WKYA 4PMZA 4GX8A 3ABOA 3CXOA 3MCMA 1TV4A 1I2RA 4AD4A 1V03A 1OADA 3HQPA 3EYPA 4DVOA 4PUNA 2ZE0A 3W7RA 3WJXA 2WXDM 2X2GA 4KGJA 1IT0A 4D8LA 3QOMA 1QVBA 4K1GA 1R3WA 4NZJA 3PTDA 2ISWA 3CPRA 2NLYA 2WZTA 1BGGA 5A8OA 2G4JA 3E74A 2R1NA 4HA3A 4ZQRA 2GUBA 2NQ5A 1YBQB 4Q8TA 1CTNA 3VKDA 5C71A 3LENA 1NF7A 4L1XA 4M81A 2NQJA 4UFHA 2B7PA 3M0LA 4EF9A 2XH7A 3T8LA 3C56A 2X1IA 1RLDA 4O53A 4WDXA 4IIFA 5AFDA 1WO2A 1NWTA 3M64A 4NIRA 2OOFA 1VB9A 3W53A 4RR4A 2ZX5A 3UETA 2J7DA 5H6HA 1D7FA 1BRLA 1DP0A 1X38A 3LOTA 3GC2A 3BOFA 2Y4SA 3N6QA 4C1LA 1L6WA 3WDIA 2QYGA 3UU0A 1DJNA 3QGKC 2XISA 1NWSA 4GRSA 1XC6A 2NQHA 3H2CA 4U31A 2NZLA 4GY0A 3ZR6A 4CD7A 4O1BA 5FF0A 1YLVA 2QCFA 3A13A 3EBVA 2D2GA 4QS5A 3GX9A 1WXJA 3AIBA 4W93A 1LQ0A 5KITA 1TYGA 4JYDA 1RPXA 1X1OA 2E6YA 3NZ1A 4S3FA 2XZ9A 1QCWA 3PBGA 3CUZA 3ZS4A 2QDHA 1O7AA 3CUHA 4K37A 1M03A 3NPXA 3S2CA 3F4CA 3CL7A 1WZLA 3AIRA 1F61A 1UC5A 3VNZA 1TRDA 4NF7A 4L5ZA 1FWJC 3V1PA 4N6FA 4MUPA 5I3HA 3O9NA 4Y8EA 1HKMA 4OE7A 1LG2A 1PHQA 2SFPA 3NPUA 3F2CA 8RUCA 1E43A 3ZJ7A 1FKWA 2XIQA 3UW6A 2VFIA 3QW4B 8CGTA 3R0DA 1JZ5A 1V3KA 1LYXA 1HVXA 3LTSA 3P82A 1FWEC 1IE7C 3VIMA 1XH0A 4LVFA 4GQGA 2RDTA 2CPUA 3FKRA 2VZOA 3BG9A 2FJKA 4Y9PA 3LTYA 4K7YA 2FMOA 3CO8A 1RP8A 2HSAA 5FOOA 5I24A 3P5YA 2I9UA 3QY6A 1W3LA 3XISA 1JYWA 2GUYA 3W71A 4BQ5A 1H51A 4MDPA 1Z8AA 4JYFA 2NUWA 3I6TA 4CQ8A 2HS6A 4DJDD 3S1GA 4O16A 3N2BA 3CAKA 1W1YA 2YA1A 4QM1A 3NOYA 1ISWA 5FEZA 3EOLA 1FHUA 3MV01 3U0HA 4EOUA 1KFWA 4A3HA 3S6TA 4ACZA 1OFAA 2BASA 1NSJA 3QY7A 3B97A 3W76A 4JICA 3CLWA 1BVWA 1RJPA 2ESCA 1NTHA 7PTDA 4H9VA 4HU0A 4TR9A 4NI8A 3M1ZA 4UTUA 3WDHA 2ADAA 1AQ0A 5KZEA 3LK6A 2PDPA 4KIRA 3S46A 1JDEA 2Y70A 3SIMA 2GGIA 3H54A 1H1ZA 3VGBA 1A3WA 5I23A 4LYQA 3T0TA 2CZVA 4HSNA 3WLQA 3A4AA 3PVFA 4WOQA 5GJNA 4J3WA 5F2GA 4H6RA 1SO4A 1FP8A 4G56A 3R11A 4HN8A 2Y5EA 1FH7A 4GKTA 3SCRA 4UXDA 3WMBA 2WSRA 2CKRA 1NH6A 1EGVA 1U22A 2NX9A 2QV4A 2FMNA 2VCCA 3W7MA 1XHGA 2X41A 4RZ5A 1UJQA 4FF5A 2A21A 1JRCA 2CLFA 4UTMA 3W1RA 1HKVA 1V7YA 4UTJA 3U48A 3G3MA 3G18A 4Z42C 3UF9A 4C6JA 1KCKA 4NZ1A 1DTNA 3MYOA 1JF5A 1DIOA 2HE5A 4FMVA 3C4UA 2G3MA 3S5SA 2QJMA 2EAWA 2C0AA 2A3EA 5U7SA 8XIAA 1JD9A 1POJA 1TCDA 4UNKA 2PU0A 1M6JA 2IMRA 3CHCA 1LL6A 1U1HA 2DZSA 3QKZA 2JBMA 4YS1A 5LIUX 1RD5A 2J6VA 4BK9A 4QAWA 4KFPA 2OYKA 2YFNA 1OG6A 1A4MA 4AFYA 4PN2A 3L5LA 2JALA 4PEKA 3AYRA 2XH2A 4PR4A 1K7EA 3DG7A 5JIPA 3BLDA 3NL2A 5D8WA 1PKLA 3OZOA 3P6LA 3GXFA 2AGKA 1R6WA 1H60A 4DWSA 1XIJA 4N9BA 3L4XA 5HMSA 4AISA 1JCXA 5FEXA 1MZHA 4I90A 3W6LA 1TUXA 3SIZA 4CNTA 4ERAA 2Z29A 3B9NA 3EAUA 1UMLA 3H2NA 1ZTVA 5M5DA 2BNJA 1ZHAA 1E72M 4AXNA 3N2MA 4HJWA 4MFDA 4O54A 1QUMA 3TE9A 3P61A 3WQ8A 3L2LA 3XIMA 1J5SA 1XISA 3LNPA 3ITGA 2FZBA 3YPIA 1EJ7L 3IGXA 3W1TA 1EWEA 4HKPA 3U2EA 1N8WA 1DJQA 3UXDA 2G3JA 3NCOA 4O1EA 4XX6A 1ISYA 1WDWA 4B15A 4LB4A 4L6OA 5A8NA 1E0XA 1LLOA 1VCGA 3F5JA 1QNPA 3N13A 3TAKA 3KBSA 3VO0A 2QAFA 3IIOA 2QPSA 4US5D 9CGTA 4G1NA 1V51A 4FNPA 3EPOA 2WQPA 2IS7A 4Q4KA 2BVDA 4MB5A 3H12A 5A2CA 5GJPA 3K8KA 3WLLA 3J7HA 4AD1A 3WQOA 1E6RA 4GYKA 3VXGA 1S2TA 1YNQA 1L0PA 3TTYA 3TSDA 3W9ZA 3BJSA 2ZZ6A 4CCDA 2EEXA 1RSCA 1XP3A 4LU0A 1TMHA 1VEMA 4B3LA 2YLAA 4K39A 3QN3A 4KRTA 2J66A 1O12A 4WX2A 3IUDA 1YTKA 1EFZA 3AMLA 3UVIA 4LNCA 2FYMA 1K9EA 2D20A 5J5DA 2J8FA 2PTDA 4H9ZA 3CUGA 3U4AA 2V82A 3SFWA 1U2YA 3S8HA 4LWWA 3SUWA 1HF6A 2X0HA 1OD0A 4ZXLA 3WBXA 3SGUA 4OBTA 3TN3A 2I56A 1E56A 1J0ZA 3PZMA 1S39A 3WMSA 1S2VA 3TV8A 2ONEA 5AN7A 5G1YA 3FJ6A 2CC0A 4L56A 2W67A 2GOUA 4OUEA 2VR5A 1FCVA 3APYA 3EOSA 1QI2A 1CXHA 3V0TA 4WJ8A 1EOMA 2X0SA 3P3BA 3EZ4A 1W8SA 1PKMA 4JTKA 4Q8WA 3DYOA 1KBKA 1V02A 4GI4A 1SJDA 4EF8A 1RCQA 2PGRA 1UR0A 1VYRA 1MXGA 3LTPA 5FD0A 3GQYA 4FP1A 1UPPA 3U4FA 3PZVA 1DXFA 4QDMA 3BDKA 4ORIA 4A3RA 1WZKA 2VDGA 4GY7A 1M9HA 2XJ7A 3GFYA 2OU4A 3WJSA 1W9PA 2VR4A 1W3TA 4NZ5A 2AGTA 1DHKA 3W7IA 1H7XA 3CJPA 3Q2DA 5LIXX 1ITQA 4MLRA 4MY8A 1RPKA 1P43A 4GVIA 1NEYA 2OT0A 1TO3A 4YWIA 2GWNA 2HRWA 4KEMA 5D38A 2AQWA 3ZYZA 1GVRA 1UG6A 4Q8QA 2PDQA 4JN6A 2EHHA 4Z2HA 4GLEA 1JCJA 1ZP4A 2DPEA 4ZEPA 4AEOA 2DT3A 3VGHA 1A50A 4CQBA 4LEQA 1ZZMA 4ASTA 5A6JA 5CPLA 1W91A 5CC7A 4OWGA 4XB3A 1NOWA 2PGFA 2PTXA 1FXQA 4Q7BA 1AVAA 5E5CA 1SZEA 2PA6A 5LA1A 2XSAA 3DHUA 1LL7A 5G2WA 2W63A 3RYSA 1JZ7A 2EKGA 4WXYA 2YXXA 4NJHA 4NJJA 2AKZA 3PG8A 4CU8A 1SZNA 3WD4A 1C92A 2O7QA 2VRJA 3IEBA 2JK2A 4TX8A 1GQIA 1P0BA 4R34A 3WEOA 3ONBA 1LT7A 4JTSA 3CPUA 1KR1A 3EGJA 1FH8A 3ZWTA 1CXIA 1J9YA 3T42A 2PE4A 2VX4A 3APTA 1OM0A 3MANA 2P1FA 4Z1DA 5H2ZA 4GD0A 3A3WA 3WK0A 2QCLA 3AYSA 4D2JA 4HNTA 2PWUA 1LBMA 1T6MA 4XZBA 2W3ZA 5T8GA 2WZHA 4I3GA 1BVNP 1Z32X 5T9BG 4LX4A 3C3NA 3SZ8A 4U2ZA 1GZGA 5I02A 3G8RA 3K2GA 5CZKA 3L65A 3D47A 1DXIA 1O6IA 3WH5A 3QQWA 3BV4A 4RLIA 4J1OA 5F1UA 4GJIA 1TIMA 3RO8A 3LX9A 2W66A 1W9UA 1KC7A 3RCYA 1RBOB 3G1RA 5DELA 4ERGA 1EP1A 1C9WA 4U3CA 5AYZA 4BF7A 4GZ7A 1U30A 1LWIA 1S2WA 2C7FA 3O0KA 4JTFA 3SGZA 4A6GA 4YVXA 1QBAA 4D6DA 4HNUA 3AMKA 1K03A 1P1MA 1E9YB 5EU9A 3VMOA 3PTKA 4TV5A 3L4YA 4Y9OA 4M51A 5HULA 3KL5A 4DO4A 3BURA 3LCXA 2PI6A 5LGXA 3AJXA 3D46A 1E51A 2B81A 4L61A 1YPIA 3WK3A 1Y0EA 2UBPC 1Q13A 4O0QA 1LUCB 1C90A 4ZB5A 3WNPA 4OGZA 3GUGA 3IRSA 4HN4A 2FPTA 2VFFA 1B5TA 1OFOA 4L4OA 4JEQA 2G3NA 2WJZA 2YCKX 4D1IA 3C3UA 3W37A 3A5VA 2XVPA 5DQPA 2FGLA 3I68A 2CHNA 3SW6A 1A5CA 1VFOA 4DF2A 3OBEA 2ZKMX 4IPNB 3HJEA 4BCEA 5I3GA 2PPGA 5HXMA 3WFLA 4XZNX 1AQHA 4DUVA 2Y7GA 2OZ8A 3KBNA 2D2OA 3UR2A 4ML4A 2ZUUA 4I7VA 1Q6GA 4B5NA 4WF7A 3M5VA 1QWKA 3IJ8A 5MF5A 1OK6A 3GTHA 4G1KA 1E0UA 4Q8PA 1V6WA 1XRFA 3AALA 2Y24A 3BANA 3L4ZA 1QASA 3BGJA 5LNRA 1FQ0A 4REQB 3CZEA 1E15A 2FTPA 1Z7AA 2OELA 3UY8A 1B90A 4MZ1A 2YL9A 1SR0A 2ZRVA 3B8VA 3THQA 1CLVA 1HL8A 1W1B1 3HJZA 2NX1A 4CVUA 1QOQA 1PKNA 3SRHA 4HCLA 3UP8A 1C9DA 3I3EA 3UJRA 1GKRA 2ZC1A 3NL5A 1A0DA 3LHWA 3OODA 5D2WA 3N15A 2ZIDA 5EL1A 4XZIA 4NJGA 5FF4A 1LBFA 3WUBA 1OT2A 2J75A 1TSIA 1SQ7A 3LCGA 1UYQA 5CLWA 1ODZA 4H1ZA 2Z27A 2FJUB 4AY1A 1VPQA 1K77A 3O15A 4A35A 3ZJKA 4KWUA 3PK7A 4Y90A 2BGSA 2WV8A 3P7YA 4B91A 4MPKA 3GTIA 3ATZA 4HP5A 2CBJA 4JTHA 4Y6GA 1CGUA 3KVJA 3M0KA 2PDKA 2DW6A 2C71A 3GTFA 1V8EA 1WAWA 4B5SA 3MI2A 3P0XA 4PSRA 4EWJA 4HGXA 4I7WA 4RCXA 5ABFA 3TMLA 1FXPA 4GK8A 2CYGA 4QTGA 3S3GA 3W70A 4DBDA 4BF5A 3KW3A 1JYVA 3GIQA 1OX4B 5G5IA 3S6DA 4O57A 2G50A 3NQCA 2VOMA 3T78A 4DO7A 3PM6A 3SRFA 4AZIA 4PRWA 4GQBA 1AL8A 2PP1A 3KFTA 3UZJA 1GOIA 3T2PA 3ARUA 5C9ZA 3S2JA 2DZAA 3L4VA 1KM0A 3U6WA 3LLFA 2TSYA 3R79A 1VENA 3ARPA 5A1AA 1IQ8A 1T8XA 3C86A 4F0KA 5E0FA 4C6KA 1RY0A 4UFKA 4XKMA 4DPQA 1CXEA 2C79A 3W7KA 3GNRA 4DLFA 5LA0A 3LI1A 3NIYA 2PDFA 4LOCA 2YSWA 4E6MA 1V02E 1LOQA 3N3TA 4C6OA 4LCQA 3C2YA 1G0CA 1RJRA 3TN6A 1NP2A 4HVXA 4N0RA 5CSYA 3F7JA 1V6UA 1GQKA 4LUTB 3EOOA 3MDUA 1MXSA 5AC5A 3GY1A 3KOXA 2YW4A 1AA1B 4AZCA 1A5LC 4BKNA 3VABA 3E0IA 2PRLA 1VBGA 1KFJA 1AQMA 3AJ7A 2VNCA 5DO8A 3BC9A 2O9OA 4W4QA 3VM5A 3C52A 2IPWA 2E6DA 4CNUA 4R9OA 2O55A 3VE7A 1TWDA 1LOSA 4LC8A 3KRUA 3G77A 2H3BA 4GVHA 2D0FA 2QZRA 5EMMA 1EOKA 4QIUA 5K4ZA 4S3JA 1W3HA 3ABQA 3TQ0A 3S1XA 1IGSA 3N19B 4BS0A 3QPYA 1TR1A 3UA3A 2A7RA 1TWSA 5BRBA 4IIDA 3SQMA 1MYRA 1VBRA 5HA7A 5M03A 1YIXA 3THDA 3BPWA 3S5NA 3WBAA 5DT5A 2IKHA 1DWAM 3TX9A 3NGJA 3VTRA 1S2CA 3CUIA 3UT0A 4AB4A 1ZALA 2O7SA 1KM2A 4QNEA 3HM7A 1YBQA 1K4GA 3GU9A 4QQUA 3R94A 1N7KA 1I0BA 3VC6A 3FDGA 4JAWA 4LANA 1G7VA 1KM5A 1XYAA 4DUXA 3P14A 3H26A 2PRHA 2DW7A 1H3GA 2BSLA 4AW7A 4F8XA 3MUXA 1XKJA 4I6VA 4DF1A 3M0ZA 3VNJA 1UPMB 5RUBA 3IVUA 3A3XA 3CIXA 4EAMA 1P0DA 3B8TA 1FWGC 4PCFA 4KFNA 2EXOA 4MSSA 1TB3A 4BJHA 1KWKA 4ZO9A 3BLOA 3TFCA 1IR2A 3B8SA 2WANA 1G4PA 2X8RA 2XVLA 3ZXWA 1SM9A 1YQ2A 5CSSA 4DY1A 4O0KA 5LNVA 2WMKA 1RCOB 4I8DA 3HB9A 3VE9A 1DE6A 4DYKA 1QK0A 3OZMA 4HU3A 2BVTA 1M1BA 2BZNA 3OQEA 3AU2A 3BMXA 2HK1A 1A0CA 3EX4A 1WUFA 1KW1A 3QYQA 4X3ZA 1JGMA 4CD6A 5D02A 3NZGA 2YXOA 3CPGA 4GIRA 1HP4A 3DC0A 1FWBC 5G1MA 1OC5A 3JZUA 2QUNA 1Z48A 2V5DA 1KGWA 5C70A 4WUIA 3GNXA 1ISZA 2W79A 2YL8A 3HG2A 1N8FA 2HVNA 1EYWA 4GXPA 4QSHA 3KWXA 3DFYA 5EFFA 4GYPC 5K2ZA 1XLBA 1PKYA 1H50A 1ONWA 1K70A 2YFOA 4KW2A 4R85A 3HPAA 4Y96A 4RDZA 3BARA 1ZRQA 3NSMA 3WQ4A 2C14A 4OOZA 1YYAA 3NDZA 3T8QA 1Q6EA 2OWXA 2J7EA 2IXVA 3PFMA 3WENA 3FS2A 4RNJA 2YZ5A 4XZWA 4EPEC 3LBCA 3LXBA 5HPCA 2ZZ1A 5CSRA 3AC0A 3MP5A 5I3JA 4UTWC 3QOKA 3EB2A 1R47A 3UR5A 1LROA 1NVMA 5AHEA 2Z0IA 1X98A 3USBA 1ZBWA 1E6NA 1DJHA 3GSMA 2PCEA 3EWDA 3IGSA 3IAPA 4M5PA 3Q4DA 4HCDA 4QX4A 4GGBA 1OY0A 1BYAA 3HZ3A 5LIKX 1W1A1 2ATSA 1EX1A 3HV9A 3UYIA 4NYYA 1EJWC 4UFIA 5AYXA 3RRXA 3BZGA 1YDYA 2CITA 4OBRA 5AZ0A 1O1ZA 1W3IA 1JCNA 3W82A 2PDYA 1DORA 3HOJA 1MXDA 2WVTA 3B3DA 1CI1A 1US2A 1ME9A 4B3ZA 4TTGA 3TYUA 2FFCA 3E12A 1UWSA 3KCJA 3TONA 4IPPA 5K3VA 1FDZA 4JYEA 1LWJA 3E0LA 3TLQA 4JHOA 2Z1SA 4WK9A 4AHQA 1E4LA 2FVLA 4LS0A 1KXHA 4JFUA 1B9ZA 1QO5A 2PWGA 3W28A 1T7LA 1GQJA 2YGYA 1R86A 1QK2A 4JHMA 5JH1A 3MY9A 3N9RA 1C7SA 3QR0A 1W3JA 3G22A 2O0TA 4XIAA 3QXBA 4YTRA 1ICSA 3EEZA 1JZ4A 4O1CA 4UMBA 3FJNA 4UTFA 1MFVA 5DX7A 4W8AA 4U5KA 3VCNA 4NRRA 4LBUA 1VHCA 4X0NA 2GK1B 3U9IA 2ZADA 3FN9A 3OLDA 3SQLA 3UCDA 3AS2A 3KLKA 3CQKA 5FJOA 4AH7A 2ZZ7A 1PL9A 4MJ4A 4UNLA 4GINA 4HPHA 1D9EA 4TQTA 5BRQA 5K9DA 2B7NA 3ANUA 3EOUA 4S3CA 4XBJA 4LUIA 2DIKA 2PDLA 4DIAA 1M7XA 2PBGA 3MB9A 2VI0A 1QATA 5CJMA 3CWOX 1B3XA 4OECA 2XG9A 3SY1A 4GGHA 2BS9A 3WDPP 1GOQA 1NQKA 1XYBA 2CLLA 1V7AA 3W25A 5BCAA 3SI9A 2ZXAA 1E6PA 3WEZA 3D6NA 2OYLA 1G7UA 4GACA 3IPWA 4RE2A 3MDWA 4TX6A 2BY1A 3IIXA 2CXGA 1R7OA 1VYPX 5CG0A 3L68A 1HL9A 1GVQA 3ECQA 3W2NA 3SECA 4HOZA 3BMVA 4RE0A 2VGBA 3OGRA 3BAJA 1AD4A 4DJEC 4C6LA 3AXXA 1P6WA 3WMCA 2VDIA 4J2PA 1HIZA 1VJZA 1TPFA 2OFJA 3UESA 1KO0A 3RX4A 1XLDA 4XBKA 4QXIA 4A2SA 4DHGA 3CLMA 2VC9A 4KFOA 3ZM8A 4H7ZA 2RH9A 2FZDA 3WD1A 1B3OA 3UJFA 1A80A 3UWYA 4LT9A 3TEVA 4PMRA 1J2BA 2WYSA 3T0AA 3HQOA 2W9MA 3NO5A 2X40A 5I77A 4MMWA 5FL1A 4QRNA 4UFJA 1GVOA 1WOAA 4GC4A 4PMOA 2X1SA 4L4PA 2NUYA 1S3HA 2GWGA 2WJDA 5CZ0A 2PWEA 1VLIA 4LALA 1TIWA 1I8JA 3WSUA 2VFGA 4FHAA 4N6EA 4WVXA 3DG6A 4XAGA 3RK8A 1LL4A 3FSTA 3GHRA 4TMCA 4LSBA 1SZFA 4FK9A 4XUGA 1KKRA 3RXZA 2Y0FA 2ZZ3A 3VNDA 1L6GA 3QV9A 5FAJA 4HT3A 3STFA 2CBIA 1U5VA 3I6EA 1M5WA 1QPKA 2C91A 1A0EA 4TU1A 3KP0A 4D9PA 2O92A 3TYDA 3ZJ8A 1UKQA 1ONXA 1G6CA 2V30A 2CU0A 2WBGA 1G4TA 3B04A 3M7WA 8TIMA 1UH4A 1GHSA 3ARWA 4PB3A 3TH6A 3DFHA 2VEKA 4V1XA 1H7WA 1J0JA 4UQDA 2BXVA 1GVFA 3ITOA 3UWZA 1W5QA 1VGAA 4IJBA 2OPJA 1KCZA 4ZSTA 1EIBA 1Z69A 3VIOA 2RDXA 3ZLGA 5IBXA 5FEPA 2Y85A 1GVEA 4D71A 3NL3A 3NQ7A 1QMLA 1IWPA 2F6KA 3HO8A 1R38A 3CNYA 4HZ6A 2DVXA 4S3EA 1P48A 3A5FA 4N9EA 3GUWA 4BF9A 3C6CA 3GD6A 2UWFA 4O50A 3TAOA 2VWTA 1XUZA 3KCLA 4EXQA 2IKGA 1HJXA 3MP3A 3S1VA 3L2IA 4GIEA 4UTTC 1E0TA 4MM1A 4HPXA 1Q8JA 1XYLA 3QFEA 1H41A 4M1RA 2P0IA 5JBFA 3LSCA 3DAQA 1EZWA 1XRVA 3KBWA 3O7UA 4MOZA 5CAHA 4ORMA 4MYAA 3AHXA 3IJ7A 5B7YA 2G8ZA 2ZFAA 1XCXA 4MWAD 1GHRA 1CLXA 1SR9A 2L5HA 1LLZA 2CFFA 1W17A 1V77A 3Q45A 5HJLA 1F6YA 1E0VA 2LLEA 4JN7A 4EPDC 3CAWA 1AW5A 4R27A 1HQTA 5AOUA 5A6MA 1HJSA 3EWUA 4GC3A 4DYJA 4JFVA 1C8VA 3WG6A 2CHOA 4AU0A 5HUOA 1JPIA 3B8UA 2QMJA 4PFMA 1XIDA 3B4UA 1FHDA 4NG3A 4QCFA 2R1MA 3PS7A 2VC6A 3LQGA 4W7WA 4M24A 1MO0A 3GYEA 2OODA 3RJXA 2WNQA 4S1FA 3LERA 2ZC8A 3CYVA 2HQAA 1GOWA 2V3EA 1YMYA 1JGIA 1X7IA 3C0LA 3DHPA 1T99A 2PWHA 1BXNA 3T7VA 3AI0A 3QC3A 3ALFA 2XN2A 2NVCA 2A5HA 3WLJA 3NQ6A 1GK8A 1EB3A 4ZOBA 2E8YA 4CD8A 4O17A 1XLAA 2XSBA 3NQ8A 5AHMA 4F3HA 5KTLA 4IJRA 1IZCA 4C7FA 1Q3NA 3S2LA 4HIBA 4JCLA 5E6ZA 2IPGA 2REQB 1YE4A 3E0FA 2HVOA 7TAAA 4K7VA 1DYSA 3RGTA 5KZ6A 2ZX9A 3B0UX 4X0VA 1P7TB 1IEWA 4L1WA 4QDPA 4AD0A 2PURA 1F74A 5F1VA 4KEZA 3V0SA 5E09A 2HDJA 2GYIA 3L12A 5EMUA 1SPQA 4JNYA 1UKTA 3E5PA 3VGFA 4DYEA 6TAAA 4YCOA 3MUAA 2ZRZA 1ZPTA 1A4LA 1A5BA 4KPLA 3T55A 1V0MA 3FV9A 4JEJA 3W24A 3E0VA 1HO4A 4C60A 2HXTA 1UH2A 3B8IA 4J3SA 3SDOA 4V2XA 3BMWA 1UKPA 1QU4A 2WVSA 4XAYA 5IFPA 1EJRC 2Z7GA 1E9ZB 1LUCA 2BGNE 2MUCA 1E9IA 3R7MA 4JX4A 3N14A 3BCDA 3SRDA 1Q63A 3UY7A 4IFRA 3CHFA 3LYEA 4IMGA 2I1OA 1OBAA 1VZWA 1UR8A 2XDFA 4JBRA 3CU2A 3WQCA 1EUAA 1JPDX 4Y9NA 3GDMA 4RKAA 1XBXA 4IP7A 3MP4A 4OV9A 3NQFA 3URNA 1PUDA 2DY3A 4E8GA 2Z26A 3PFRA 1TX2A 3AXMA 1L6SA 1KNWA 3KBVA 4H9UA 4PUWA 4GUHA 4MVAA 4TV6A 3M7SA 2DIEA 5FJTA 4REQA 2XH0A 4TUFA 3GR8A 1WUEA 2J7BA 3BJTA 5ECUA 4OFCA 2PEVA 3PAJA 4D6GA 2ZQ0A 1VC4A 3FX4A 2G3FA 4FX8A 5GVJA 4D8AA 3HFTA 5AHNA 2VT0A 3LCFA 4HZ7A 3GDLA 2QNEA 3WH7A 6TIMA 4B5WA 2ZX6A 2ZE3A 4JQAA 7REQB 4AZBA 1U5HA 3H4XA 2JQXA 3QH2A 4NZ4A 4F66A 3F4DA 3KDOA 1AH3A 1ME8A 2QCMA 3QLDA 4E4FA 1B30A 1BTCA 1E5JA 3AO0A 3ENLA 1E5NA 4B4HA 2WNWA 4KS0A 5DEZA 2ZICA 2P5NA 3UG5A 3OBAA 4PRTA 4B2DA 3T44A 3WN6A 3AAMA 4HHHA 2TYSA 5GNZA 3W07A 2TAAA 2R14A 2VFDA 4BWLC 3QR1A 4KETA 3RO6A 4CCEA 2VELA 3MZ2A 4LRTA 1ZFJA 1UZ4A 1C8QA 3TC6A 1UOKA 3DX5A 4GCAA 4H8NA 1RLCL 2JKAA 3EDKA 5DY2A 5D2YA 1IXNA 3ZQ9A 3T1GA 2QS8A 4GI8A 1AMKA 1OX4A 2NSOA 2ASHA 3AFBA 1FCUA 3MKKA 3S2MA 1R85A 1HGWA 3T07A 2P53A 2RDWA 3VUSA 1IV8A 5F4SA 3L66A 5CBJA 3LRMA 4DBWA 4OIFA 3VKAA 3VNLA 3IJLA 3KXQA 4KMQA 4C6EA 4AIOA 2Y7FA 4KGLA 4NX5A 1XW8A 3H7UA 3DGBA 2TODA 5CG7A 4UMCA 4ECLA 1G9HA 3VNMA 3EXTA 2VJXA 4GNKB 5E9XA 4Z1YA 1RJQA 2ON3A 4DELA 3CHEA 4LVAA 3H53A 3W1NA 5HPOA 3KDNA 3W0KA 4M7SA 4HOXA 2UY3A 3DYMA 2VUYA 2DZVA 3IK4A 1Q2RA 2NT1A 2WHKA 1AODA 2NVAA 4JFWA 4LBRA 3ES7A 1F2JA 3W1PA 5AHIA 4WHBA 3EXSA 5HANA 1F07A 3K13A 2OQYA 3NG3A 2GVGA 3P80A 4HMEA 3MWCA 1GKPA 4JOMA 1SJCA 4WKFA 4DI9A 2AL2A 3GG1A 4YN5A 2CWNA 2ZYFA 3G6MA 3S5ZA 4LUTA 3M16A 2YZRA 3VDCA 8A3HA 5HK4A 1QI4A 4JX5A 3IARA 5CAKA 1TREA 2V5LA 1AH4A 4Q6XA 4IICA 2FHCA 3IIZA 5FIPA 3B0PA 3MJYA 4Z17A 4IQEA 3WIJA 3L21A 3KM8A 4KERA 3ZO9A 4YWSA 3G1XA 3VPLA 3BLKA 1V3JA 4I5RA 3STEA 1I1XA 1B54A 2X0YA 4R7WA 3WLHA 4E3TA 2WCSA 1KB3A 4ONVA 3LUTA 3C2FA 3B0YA 3GAKA 4I9MA 4W85A 2ZOXA 3ZSTA 3SM0A 4D6HA 4ZO6A 4IFOA 1CECA 1U5JA 2P88A 3FGCB 1OG0A 4H9MA 1CW2A 4UQAA 5I03A 4DJFD 5H1WA 1TTIA 1EHNA 3EMCA 5JQ9A 3QZEA 1UBSA 1SZRA 1GVSA 3GH7A 1BGAA 1QO2A 2J7HA 4JY9A 2BODX 4A22A 2J9ZA 1CCWB 3TJIA 3MSRA 1HTIA 3OLEA 1TWZA 4L64A 3I3DA 3NXFA 1MW1A 4PCTA 2HNHA 2C1HA 2GVYA 1GPWA 2E40A 3PSVA 4QJ5B 2QUMA 1W5OA 5AVNA 5G2IA 5CGMA 1XLKA 4O1FA 2W61A 3ITVA 4GWEA 3CTLA 5G1TA 2WZEA 4UFLA 2RJGA 3NDYA 1DWJM 2FPVA 3IUIA 3ARYA 3TTOA 5D9OA 3DH7A 2MANA 4F0HA 3R8RA 5D9PA 3W84A 3VK5A 3WF2A 3W2LA 4A3QA 1E4MM 4DM2A 2ZRYA 3HFYA 3D3AA 3W22A 4XAFA 4H6EA 4LV9A 4G5DA 1CWYA 1RVGA 3B8WA 1XCFA 4P5UA 2QPXA 1QNOA 1EPVA 5AKQA 3AUJA 4XAZA 3VDBA 2H8ZA 3PUOA 2O9TA 2J47A 3WNLA 2IXUA 4Y7EA 2XYLA 2OX4A 4IJCA 1KR0A 3VIIA 3P67A 3W2KA 2PLMA 2ZXBA 4LH8A 5GJMA 2J9YA 4BI7A 3K4AA 3BOLA 3SCVA 2Y7DA 4FS9A 4RE3A 4JIEA 2WKJA 2NQ9A 3LGGA 4HK5A 1KFKA 5JVLA 3PJXA 1WDSA 3H55A 1KCLA 3UZ5A 4E0CA 2AOSA 3TKFA 2E67A 3ANVA 4WKAA 4S3GA 1J10A 2RDUA 1ECEA 2Y8VA 1XPGA 4EX4A 3S9IA 3O1NA 2QCNA 3ITTA 4M6QA 3SCPA 4EIVA 1GVIA 3PPGA 3QSTA 3B06A 4HU8A 4F0MA 1KGUA 1XINA 2ZVRA 2NLIA 3BAWA 4XD5A 1QT1A 4PB4A 4QQ3A 1ZAHA 3Q58A 3TQKA 1JVNA 2OVLA 3MHFA 3KLLA 3ZFHA 1VKFA 4HYWA 3HG3A 4ZL1A 5M1TA 4P7RA 1L9WA 5AHFA 1KXQA 2EGZA 5KSWA 1G5AA 1W3KA 3I4KA 1MUWA 4V15A 4Z1AA 1GPFA 4WGXA 4P7LA 3GR4A 3KOFA 4M7TA 3V16A 4D6JA 1QDSA 1GZ1A 1WKDA 4V33A 1JYXA 5AC8A 2E9MA 1TR9A 3SUTA 4DWSC 4IP4A 4JQ3A 4CEXC 3S0CA 1ZBCA 3M46A 5M3WA 1OEPA 2J24A 4H41A 3PZGA 3WDQA 1WCGA 4XVDA 3AROA 6XIAA 3QGVA 3O2LA 1QW7A 2Q01A 2FKPA 1H62A 1K8YA 4J3TA 2WHJA 1WPCA 1FP9A 3B40A 4D8ZA 2GDQA 4B5TA 5XIMA 4HTYA 3DYPA 2ZTJA 1Q6RA 4LF2A 2B4GA 1PDZA 1QI0A 2CCRA 1ZGDA 2ZWYA 4KRUA 4QITA 4B9ZA 4NX0A 4WD0A 6PTDA 1NF0A 1PTDA 2GK1A 3B0VC 1Y5VA 3EA1A 4GOAA 4DZIA 3NR0A 4NXKA 3ZOAA 4W7UA 3LBMA 4XZMX 1S3TC 1RALA 4PUDA 5C9XA 1VHNA 4C6DA 1YHTA 3IV8A 3TYBA 1WQ5A 5FCZA 1FHVA 3SN4A 3GZAA 3LCWA 1SVDA 3LXAA 1YDNA 3HMCA 1UD5A 3IAQA 2J27A 4W7VA 4PL1A 1SO5A 2D3NA 3HN3A 3NYDA 3UA4A 3SGGA 2E0PA 5EKYA 1ELSA 1V0LA 3KUMA 3A6OA 2PP3A 2RGMA 1CX9A 2Y7EA 3DFTA 1FA2A 4YMZA 3LV6A 4IIHA 2FHFA 3OVPA 4FXJA 1V5XA 1VIZA 3PPCA 2BOGX 4R5EA 3A21A 3N2XA 4M3PA 5LHFA 4Z2KA 2C16A 3EDFA 2A7NA 1WB0A 3LS9A 1EJTC 1K6WA 3ELFA 1KM3A 2VMFA 3WQ6A 5LZLA 4GPNA 3T6CA 4XUYA 4C6NA 5CCZA 4GBUA 2HISA 4MLJA 1LZOA 3FEMA 1MEHA 4E5TA 1L8PA 3ARZA 3QW3A 1YX1A 4MJ2A 1XH1A 4R7JA 3P81A 3GWQA 4DZAA 2PD5A 1UWIA 5I3DA 3C0SA 5LXXA 3GIPA 2ATMA 1NDYA 4YYFA 1R7AA 4OUIA 2PF0A 3NO3A 3TW6A 4C65A 1GUVA 2C6QA 3O07A 4QLJA 1L6FA 1W1TA 5CPSA 4IMFA 2Y89A 1HG3A 3EPMA 2XVKA 5AHLA 3S9YA 4R9XA 3TNOA 1JL8A 5IDIA 1FDYA 4QJ4B 2BY3A 1TVPA 4WXZA 5JH2A 1QTWA 2OKOA 4LAMA 4D1JA 3SO7A 2XGIA 3UFYA 3DFPA 4FNSA 1OVDA 4KCTA 4A8LA 5LSMA 5ABHA 3KEHA 3CK5A 2V8ZA 5HMDA 5A6BD 2PDGA 2VD9A 4GHRA 4Z0JA 4HA4A 1UD2A 4S39A 4QS6A 3GXPA 2A6NA 1JJKA 3KHJA 4E2BA 1WDDA 1KM6A 2WLZA 4J2MA 3AXHA 4WR3A 3URAA 2O9RA 4JDYA 4O52A 5IDZA 4J4KA 3W81A 1GOXA 1ZP3A 3I7SA 1QXLA 1D8WA 5KETA 2ZCGA 1V6YA 2XSXA 5G2HA 2H6RA 2ZXDA 1XYZA 3LCHA 3CZJA 1GG1A 2W0UA 4GQ0A 3FLUA 2OKTA 3IV3A 1ZJBA 4C6BA 1FWNA 1ESWA 3QHOA 2G0WA 4HBKA 2DQXA 2FVKA 3VAVA 4UTLA 4PUJA 4UUIA 3TVAA 4NRSA 2QEZA 4MPQA 2E68A 3NM3A 3HPFA 2OZ0A 2HROA 3OQ8A 1H0IA 4GYJA 3AIWA 2XWEA 2OQLA 3H2OA 5I79A 1PPIA 3TN5A 1B4KA 1X6NA 1JQVA 3PBMA 2DORA 3LG3A 1UD4A 4C6PA 3SCWA 2HS8A 3VDHA 1YXCA 3E6EA 3QRHA 3CWHA 2GFTA 3QMTA 1MRQA 3GO2A 4EACA 5EB8A 3A47A 1BQGA 3AIEA 1BWKA 4L9YA 1PHWA 3LHVA 3ARQA 5I5RA 4PYSA 3BUVA 4NKCA 4DBSA 3DHDA 4ZB2A 3SCSA 1O68A 3CV1A 1OFRA 2IQTA 4DJDA 7ENLA 4JFSA 4RZ6A 2V5BA 4Z0SA 2WSKA 4WOZA 4LPCA 4YNGA 3FHAA 4L7ZA 2HK0A 1WDRA 3V7PA 5E9AA 4IQDA 3BJFA 3RX2A 3SUSA 2PS2A 3A4XA 1IZJA 3TK7A 4NJKA 4H3DA 3S4TA 1GTEA 1VFSA 3W01A 3GK0A 3GTXA 1KRCC 3M5XA 5I00A 1SO6A 3ZSSA 3G0UA 2ZA1A 1FWSA 1ZBVA 3EWBX 4F0LA 4AWUA 3QLLA 3RPDA 1KFBA 4NAEB 4YPJA 2QJIA 3WQEA 3WFZA 3LPGA 2PDUA 3WDRA 3RUBL 1HL2A 4DZ5A 4XZHA 1W3NA 5D04C 3R25A 3W23A 3CL8A 2GQ9A 1DPMA 5JIWA 2PDNA 3ID7A 3DESA 1BG4A 4GUJA 5A8MA 1I60A 3PTQA 2NWRA 3BVJA 4O4WA 4C7DA 3T81A 4DUOA 5I78A 1WDPA 2VWSA 2OO0A 5ABTA 5BYWA 4M29A 1ZENA 1QBBA 3NZPA 4UZUA 2WSPA 2OTDA 4GQRA 1GONA 4AVOA 2E8ZA 4C90A 1Q6OA 4S23A 1H7PA 1KA9F 3VKJA 4TVCA 1NM9A 1RA5A 2VRQA 3U57A 4IP5A 1E9LA 1OJXA 1HKJA 2YW3A 4N42A 1EBHA 2CZ5A 4Z08A 1CBGA 3LPPA 5MKGB 4DXXA 2R1LA 2Z1WA 4PODA 1YNPA 2D2JA 2REQA 2YR1A 3QQ1A 3LCLA 4OHQA 3URBA 2BDQA 4LAOA 2PF8A 4NQ1A 4TTUA 1RH9A 4JGDA 3GVRA 1VPXA 1P7TA 3BQ5A 2CIPA 1NWUA 3UCCA 2C19A 3QQ0A 3MKVA 1K4HA 2WMIB 1BQCA 2J62A 1D2KA 1K9DA 3QTGA 1Z6KA 3GXDA 2JIEA 1OF6A 2ZX7A 4J35A 3M4HA 2DZWA 4XAPA 2FPYA 1C91A 3CAVA 1MEWA 2WQDA 1ZCCA 2YCLB 4JTJA 2POTA 2GGGA 3PANA 3TSMA 4LY4A 2CHRA 2YL6A 1F3WA 1QJWA 1EQCA 1UZDA 3NSXA 4IL2A 1NIUA 3NEVA 5I6SA 3O3RA 1W0MA 3E5BA 3DCPA 1T41A 4HYRA 1F9CA 3EA2A 3NNTA 2GVLA 3CL6A 4H8UA 3P0WA 3P8JA 3N73A 2C15A 4R88A 3QBUA 1XLCA 1GEHA 4PCNA 5AB3A 3U2CA 1C93A 4M8UA 1FBAA 3Q67A 3SBFA 4US5A 3AHYA 4BI6A 2GQ8A 3MYPA 1GVYA 5DMNA 4QEHA 2D0GA 2CWXA 4ZB0A 3ALGA 3ITYA 4FIQA 3KTXA 2QJJA 2YBUA 1Q2SA 1I9CB 3W87A 4JL2A 4LVBA 1TRIA 4PB5A 5CZTA 2QGYA 3U8GA 2ZUVA 3KE0A 2GGHA 3CUXA 3RG6A 2PDHA 3TOYA 1DE5A 1FWRA 4U10A 3FY1A 5A95A 2GSHA 3R89A 5A6SA 3BW4A 3W7CA 1N8