4RXTA

Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
295
structure length
295
Chain Sequence
SMAEVTIPIIVKDTTSFYWQIVLAGARKAGKDLGVKVPELGAQAETDVNGQISILENAVAGKPAAIVISPTEFKALGKPVDEAAKSVPIIGIDSGADSKAFKSFLTTDNTQGGRIAADGLAAAIKAMTGKEEGDVVIITNTPGAGSLEQRRTGFLDQVKTKYPGLKVVADKYADGQATTGLNIMTDLITANPKIVGVFASNLIMAQGVGQAIAENKLSDKVKVIGFDSDDKTLGFLKSGAIAGLVVQDPYRMGYDGIKTALAVSKGEKVEANVDTGANLVTKANMSDPKIEALIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sugar Binding Transporter Arad_9553 from Agrobacterium Radiobacter, Target Efi-511541
rcsb
source organism Agrobacterium radiobacter
molecule tags Transport protein
molecule keywords Sugar ABC transporter
total genus 105
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rxtA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rxtA01
3KLOA 2J48A 2A9OA 4XARA 2A9PA 4RK5A 3TO5A 1FSPA 3LUFA 2B1JA 2E4ZA 4DADA 4RWEA 2JRLA 3MMNA 3CLKA 3RVMA 5JS2A 5BRAA 4LE2A 4MQEA 3O1IC 1ISSA 1M2EA 4MYRA 3OMXA 4MR8B 1OXKB 2GBPA 4KQCA 4UHKA 5IUJC 1RXIA 3CTPA 1PUXA 5ED4A 1DBQA 1TLFA 3HCWA 3RVOA 2FQYA 2LBPA 1M2FA 4EY3A 5BQ3A 5JNTA 1GUDA 2QW1A 2IPNA 2NT4A 5GQSA 1ZH4A 5DKFA 2FEWB 4MS4A 3GRCA 3RVQA 1VPWA 3HUUA 3F73A 3LKBA 3NNDA 2WRZA 4WXEA 5KQMA 3KTOA 3A0UA 3SG0A 3L49A 4Z4CA 1EWVA 1FQWA 3JTEA 1C0EA 1JL3A 1KGSA 5KQGA 3CRNA 3HXMA 3NHZA 1YTUA 4IGAA 4N03A 2FLWA 1USIA 5C5EA 5IULC 3S99A 3EODA 1BDHA 5HM6A 1AB5A 3H1GA 1EWTA 1W9HA 2JB9A 2PL9A 4G0QA 3H5VA 4Z0NA 5IEBA 4E7PA 3H75A 4MR9B 3OQNA 3OLZA 1SXGA 2WB4A 3GL9A 4MAAA 3O2SB 4JB2A 1SD5A 4XFKA 4CBVA 5CHYA 1APBA 1YS7A 2F8TA 2VK2A 4D6XA 2OQRA 1GCGA 3MA0A 1Z18A 2MSLA 1DCMA 3JPWA 4G0XA 3IP5A 4YP9A 4NICA 5TPWB 1C4WA 4WWHA 3H1FA 3F6PA 3LUAA 2FEPA 2CHEA 9ABPA 2PUGA 1ZDMA 3O2QB 2VYCA 3M9XA 1DG9A 5JNWA 2YHBA 4ZYLA 4PE5B 1R8JA 1Z13A 5PNTA 5IEJA 1Z12A 4O5AA 1YVUA 1FFSA 2PJUA 4O1HA 4MS3B 4EYOA 3KYJB 3EULA 3Q7RA 5KC8A 3K9CA 2WY2D 4H3KB 5FBKA 2Q5CA 3W9SA 1CYEA 1URPA 3BILA 4ETIA 4RK4A 3LMKA 2MSKA 4N0PA 1U8TA 4KK3A 1Z17A 5I4CA 1RXEA 1ZHHA 3KKEA 1LJUA 1JWLA 1EHCA 1XWWA 1OXBB 3H5IA 5DCLA 4Z4IA 1DJMA 4PEVA 4RV5A 4F06A 2FMFA 4RSMA 2LIVA 2GWRA 2O20A 2R4QA 4MS1B 1KRWA 3CG4A 3LUGA 4MRMB 2FTKE 4L85A 2IYNA 3UUGA 2PAFA 1P6UA 5KI6A 3QLVA 2TMYA 3C97A 1JF8A 4Z99A 2B4AA 2NZUG 4QICA 1FFWA 3KHTA 3ROTA 5DLEA 1FFGA 4LZLA 2PUEA 2IPLA 3M6MD 5EWLA 5FWYA 3NHMA 4G86A 4OG2A 3F7NA 1GUBA 4QYMA 3T38A 2FLKA 3CS3A 4MS1A 4KQ9A 1DZ3A 5DTEA 1UDRA 2MSWA 3HDVA 4RK7A 4D74A 4F11A 2PE5A 1ZAYA 2PUBA 3DBIA 5IX8A 4QYWA 1NXSA 5CNKA 3BRQA 3RQIA 4FB4A 4TMYA 4MR7B 5B3JA 1PEYA 3C3WA 3NBMA 4KZKA 2YHAA 1BA2A 6ABPA 3GBPA 1L5ZA 4YCSA 2QR3A 5HSGA 4MLCA 3QLVC 3LUKA 2R47A 3UK0A 5ABPA 1CEYA 1MB3A 2L18A 4G0MA 1DRJA 3QX8A 1USKA 4UHJA 5JNUA 1JX6A 2HJ9A 2FN9A 1DRKA 1Z15A 2HQBA 4O1IA 1SRRA 5HQJA 4DQDA 3B2NA 4IMJB 3SQNA 4DN6A 2JBAB 3OLYA 1B00A 2H0AA 1DCKA 1JBEA 4LDAA 4YV7A 5JS1A 1H9CA 5TQ2B 5TPWA 1JFVA 1NXOA 1JHZA 4Z4GA 4XAQA 3RVKA 1KMIY 2HPHA 2WJWA 4KPYA 2L17A 2NT3A 3MQ4A 4W5TA 4KVFA 5T3YA 3EJWA 4ZJPA 3LUJA 3I42A 4LE1A 2OENG 3N6VA 2IKSA 4QPJC 2QZJA 3TB6A 4JOQA 3T6KA 4OLAA 1U2PA 3T95A 3BREA 4OBBA 1RPJA 1USGA 3I5AA 4RU1A 1D1QA 3CNBA 3I45A 1EWKA 3KS9A 4RY9A 8ABPA 5CNMA 2WMYA 4LDZA 3IPCA 3HVRA 3OLVA 2PKXA 3A0RB 4W5QA 1QP7A 3GV0A 1DP4A 3N8IA 1ZGGA 2E4UA 3KYIB 4W5NA 2P9HA 1P2FA 4OTZA 3TD9A 1A0OA 4RZSA 3SY8A 2RJNA 2QXYA 4KK4A 4MS4B 2JCGA 1D1PA 2QV0A 1F4VA 1TVMA 1U0SY 3EGCA 3N75A 3QEKA 3DZDA 7ABPA 2E4XA 3VNAA 3VNBA 3HDGA 3QLUA 3OMWA 4JP1A 3BRSA 1NTRA 2ZWMA 1LJLA 3CU5A 4KV7A 4FE4A 4N76A 1XHFA 4MR8A 5BRJA 1NY5A 3CHYA 4MQEB 3O1JC 2E4YA 3C6QA 4JAVC 4L4UA 4YO7A 4EGSA 4RXTA 3RH0A 2AYXA 3RVSA 3TX6A 3JY6A 3OLXA 4Q6BA 1JFTA 3GBVA 1YK1A 4MGEA 5TPZD 1NATA 4ETMA 3OO0A 4W5RA 5IBQA 1VRVA 3QK7A 1QP0A 3TMYA 1YS6A 2CD7A 2KYRA 3HM9A 1PEAA 1PHRA 2FEKA 2RDMA 1P8AA 3Q15C 3A3KA 2P4UA 4FE7A 4TLMB 3SAJA 3Q9SA 4TN5A 1TM2A 4N47A 1VKRA 2E4VA 2PLNA 2PUFA 3EDCA 2MYUA 1HEYA 5TPZA 2R25B 5F64A 1JDPA 2MYPA 1Z25A 5TQ2A 3GYBA 4XXHA 3HS3A 2NZVG 2DRIA 3IPAA 1DC7A 3SNKA 2JBAA 3EQZA 5JNVA 4PZ0A 5T7BA 1K66A 2PUDA 3E61A 4PICA 3RVLA 3CG0A 4MQFA 5JNRA 3HZHA 5GOTA 5TE9A 5C5CA 3Q7TA 1D2AA 4E7OA 3HJFA 1NXXA 4EUKA 1BDIA 2JVIA 2IPMA 4N0QA 3QX9A 1IIBA 2MYTA 1NXVA 4RDCA 4ZMRA 4ZPJA 1ZESA 1JFSA 3G1WA 2ID7A 2LUOA 3D02A 4MR7A 4G97A 1RZRA 2A9QA 4GPAA 3H1EA 2V0NA 3H5LA 3N0XA 3URMA 5BR1A 1NXPA 3GT7A 1U04A 2AYZA 1Z2DA 4G0ZA 2VUIB 3CFYA 2XDYA 4HNQA 2QVCA 1CHNA 1T34A 2JVJA 3A10A 5FWYB 5EWLB 3E3MA 5KWSA 1E2BA 3NNSA 5CNJA 2FXIA 3OLWA 1TJYA 4HNSA 3JVDA 3LUDA 1LBHA 4OATA 3LTEA 4WXMA 1JH9A 3FFWA 3HEBA 4IRXA 3KJXA 2QU7A 2FN8A 2FMHA 3H5WA 3R0JA 2CHFA 4HNRA 3QEMB 4MRMA 1QKKA 4KREA 1JYEA 4EVSA 4KNYA 2VUHB 1BDJA 3H6HA 3DGEC 2PMCA 4F12A 1PNRA 1LBIA 3F6CA 1GLGA 2L2QA 4GNRA 1QO0A 1ZN2A 1XHEA 4XLTA 1QQBA 1I3CA 1F51E 3C3KA 3IP6A 1MIHA 5EWMA 5KQPA 3CZ5A 3QLTA 3OO1A 3GA5A 5FWXB 4NQRA 5TQ0A 3LKVA 2FVYA 1BVHA 1JYFA 2FQXA 4MS3A 2X7XA 4RK0A 2FSPA 4OLBA 4RKQA 3LUHA 2GKGA 4Q7EA 4WUTA 3ILYA 4G0OA 2M1ZA 5EWJA 3P9YA 3HSYA 3M9WA 3K4HA 3FMVA 1SXIA 3O21A 4YRZA 4G0PA 1WETA 4RS3A 5KQLA 3L6UA 1QMPA 1DBPA 1D5WA 3NNNA 2W42A 3LOPA 3H5OA 3MM4A 1EAYA 4LE0A 4LX8A 4YS6A 2HSGA 3QELA 3RVJA 4B09A 4ZMSA 2A9RA 2FMIA 3IP7A 4NCAA 2F8SA 2MYNA 5JNSA 1DC8A 3QELB 2PL1A 4Z9AA 3FFXA 4RY8A 1AB6A 1LK0A 3C3MA 3QLUC 4RXUA 2WWVD 2E4WA 4MR9A 4Z4HA 5HKOA 3OQOA 1KRXA 1W25A 3FGZA 4NCBA 4W5OA 4EYQA 2ID9A 1PNTA 3EQ2A 5EWJB 3UKJA 4D6YA 4HYEA 4RY0A 3BBLA 1D4ZA 3OM0A 3JPYA 2PUAA 4XASA 4EVRA 1Z2EA 3MYYA 2HQRA 1QPZA 1A2OA 2RGYA 3H6GA 1K68A 1U2QA 5TQ0B 1VLZA 5FWXA 3DLHA 5IC5A 5EWMB 4IMIB 2GX6A 3Q41A 1JDNA 3D8UA 3O2JA 4S04A 4F3TA 1ZVVA 1YMUA 4JB0A 1YK0A 3KLNA 5D2CA 4YLEA 1E6MA 1MB0A 2N9UA 4IF4A 4KRFA 4Q6WA 1A04A 3QEMA 5CNIA 4JASB 2QVGA 3LUCA 2BGGA 3CKMA 4MLDA 1DBWA 5IUNC 3FDFA 4H3HB 6CHYA 4YR7A 3O1HB 3H5TA 4F8JA 1ZITA 1RZRD 1QP4A 5TQJA 1MVOA 2IPAB 3HK2A 4PYRA 3O74A 1M5UA 4RK1A 4RXMA 1E6KA 4Z4FA 3HO1A 4KFCA 4MPTA 4P1ZA 4NV3A 3T8YA 2FQWA 1ABEA 1S8NA 3G85A 4ML3A 1NXWA 3DLBA 2L19A 3FFTA 4YGXB 5DGCA 1Z26A 2PUCA 1TMYA 1P6QA 2ZAYA 3HV2A 4S05A 1M5TA 3N53A 4IILA 3KSMA 2FMKA 4RKRA 2NUBA 3RVPA 1J56A 4Z4EA 1Y1LA 3IDOA 4H60A 4TLLB 3RVNA 5KC9A 1DCFA 1SXHA 2H3HA 4Z9BA 1QNLA 3SM9A 3N0WA 1ISRA 4MQFB 3GWGA 1ZY2A 5FBHA 3O75A 1QO0D 1YIOA 1GCAA 1BAPA 3EAFA 2M98A 3MIZA 5E3JA 2FW0A 4ETNA 3KCNA 4EVQA 4LRQA 3KG2A 2GI4A 2LPMA 4EYKA 3IP9A 4M88A 4EYGA 2FKAA 2I6FA 3ILHA 3LFTA 4Y9TA 4RK6A 5B3JC 1EFAA 3JVIA 4N41A 1QQAA 4YWHA 3N0RA 2LP4Y 1RNLA 1L5YA 3Q7SA 2JVKA 3I09A 2WJAA 2JK1A 3OM1A 5IUKC 4WT7A 2RJOA 3CZCA 3HUTA 4G0YA 4P98A 2IDMA 2QSJA 1ABFA 1JLKA 1YMVA 1MAVA 1E6LA 1ZH2A 2IOYA 3DGFC 2R48A 1ZGZA 3JS5A 2HQOA 4KMRA 3RVRA 2CWDA 3OQMA 4WZZA 1Z16A 1NXTA 3MF4A 4JA2A 3ROFA
chains in the Genus database with same CATH superfamily
3AF1A 3CW9A 5ALTA 2J48A 4UARA 1X1AA 4IO0A 1R4NB 1T9CA 5H02A 4C0AC 3ONNA 4FJ0A 3OFVA 5E2AA 1TNDA 2WU1A 4I4LA 4YR9A 1MT0A 2FPKA 2ZE6A 2ZR8A 1BNCA 2CGEA 2AMLA 2FX3A 2JGMA 2QRJA 4MQEA 2WC1A 1XWFA 1V6SA 3U6KA 3EWIA 3TD6A 3ZY6A 1Z3IX 4O4JF 4UHDA 4WHMA 5DP2A 4DWWA 3KEOA 2GB4A 3JQCA 5L7WA 2YOGA 2Z8ZA 2GVDC 4YPFA 5ESDA 4EY3A 1JILA 2BC9A 3OOWA 5GM1A 1K63A 2FSVC 3H84A 3N05A 3WGZA 4F6RA 2XRZA 1KQFA 2GETA 5CAEB 1ICEA 4S1VA 1YAJA 5CDFA 5EJ6A 2OV6A 1XRRA 3AF6A 2YRFA 3K20A 9MHTA 4PC1A 5LFAA 4XLLA 2UUCB 2P1ZA 3WIUA 3EB9A 3T3NA 4GZ6A 1VMAA 1NYTA 3JYLA 3SHQA 3WYBA 4E08A 3GP8A 1JL3A 3ZBTA 1IVSA 2ZJ3A 4N5HX 3V00A 2HJGA 2V55B 3M6LA 3SZGA 2IU6A 1TYZA 3IAM1 5EVJA 2EWWA 4D92A 1CB7A 2WYWA 1XDSA 2GM5A 2ZIGA 5D86A 1YJ8A 4QJBA 1QGUB 1H2FA 4HDKA 5EIWA 1UXJA 2HA6A 2Z6AA 3SQWA 4LOLA 4TTJA 3QE4A 2QE7A 1V39A 3HEMA 2FOIA 2FVXA 3IUPA 1X3SA 1YZQA 2NZJA 1N4DA 2BR4A 2J0UB 5K3OA 1P1RA 4B71A 3FDXA 1GCGA 4DCSA 3FOWA 1E3DA 2OVBA 1IQUA 4KQ2A 4BRUA 1KH1A 4NICA 5HPYB 4MUIA 1C7FA 1CF9A 1E2HA 1PHPA 2MJLA 2IDJA 1BD3A 3DWGA 3H1FA 3LUAA 1XA4A 3N2GB 3QBJA 3WIVA 1E79D 2C2MA 3IVMA 1VL8A 3KTFA 1CB0A 4V0QA 3N9IA 4BFCA 2PTHA 2X8LA 2WM9B 2BKEA 1J2TA 1UOOA 2FSFA 1RJWA 2ZBRA 1U3VA 4NS1A 4PPQA 5FPHA 4EPXA 2JJYA 4BMPB 5JYEA 3L8MA 1DOHA 3HCAA 3HVKA 3QGMA 3DEAA 4L5YA 2GPNA 1X80A 3FY4A 3PNBA 4UFOA 1DFIA 1G5IA 4X6XA 1LQUA 4RQUA 2P40A 4HLDA 4JUFA 4LW8A 2OHIA 3K9CA 1XVUA 3IR6A 4PWYA 4BO5A 3ICEA 1CZKA 1L3BA 4ZAVA 3S1SA 5E7MA 2OVFA 3ENKA 1HZZA 4L9SA 4PG6A 1MJHA 2EEPA 2WWTA 3P9KA 2BEWA 2BFDA 1Y5NA 2HHAA 4U7FA 5DHQA 4K3VA 3C8ZA 3VTKA 3O73A 2X9QA 3G2LA 3JSAA 1WSWA 5F2KA 1RKVA 4YXFA 1YDFA 2GAOA 3WLOA 4QTZA 4WXHA 4E4TA 3MJVA 1P6XA 4POOA 2GWRA 1U5AA 4EKDA 1VP3A 1B7GO 2WLSA 3MTBA 3UAGA 4MRMB 3CNQS 2Q4RA 4X95A 1XZNA 2BCGY 3MW8A 1X42A 2G5PA 2PAFA 4WXRA 5SICE 1Q0PA 2F1IA 3D5TA 3U7JA 4ARSA 4FFRA 1Q11A 2BGMA 3A4IA 3KVOA 1I13A 3UPDA 2A7QA 3ENNA 2Z6QA 3ZDXB 1KSGA 2VQFB 2PQ0A 3ABQB 5DSZA 3L3BA 3OICA 4KP7A 5B4TA 4CLRB 3VVLA 3ZDYB 3E9RA 1TAGA 2FYTA 3FZQA 5SZHB 2VP9A 2VS1A 4ZVVA 3AZPA 5ADWA 1HEUA 4M89A 4JH0A 4O2BF 3HDVA 4GKJB 5A5EA 3QPBA 5KSWB 2PE5A 1H9AA 4JI8B 5DN6A 5CNKA 1KSHA 1YVDA 3ADPA 1NN5A 1G41A 2AFVA 1X9IA 2GPJA 2PUTA 2VHEA 3PENA 3PJFA 3GDFA 4HLQB 5LIRA 4I4TB 4FGKA 5T64A 3W0LB 3MGAA 4MHTA 3IBTA 1Z9BA 1BX3A 3HB4X 4QXRA 3ZK7A 4ISCA 2JKZA 1T36B 1V1RB 3O8DA 1OX6A 3WQQA 3IV7A 4R6WA 3WRVA 3UC5A 3RODA 3WZ2A 3K94A 2X0FA 3L8GA 3ONWA 3FUVA 2OP1A 4H17A 1CNMA 3LDFA 4AI6A 4NNOA 1SCDA 1JLSA 1ZUIA 2GS9A 2ZRPA 2ZVJA 1GPJA 3H87A 4HN2A 3N2GA 2LV8A 2QLLA 5ENVA 4YV7A 1VIMA 3FWHA 4AQDA 1SCUB 4YX9A 1NXOA 1TT7A 1DKOA 1U2SA 1YUMA 5KYVA 4MRPA 2WPDD 1G5PA 1NJFA 4PYMA 1J90A 2VBIA 2I6UA 3PFGA 3R5FA 4UNSA 5F7ZA 2W2NA 4RHTA 3TZEA 4N3BA 4B33A 2L17A 2MINB 4IIUA 5FWAA 3K9BA 3OCZA 2DQKA 4GMHA 5BNFA 1TXGA 3SXUB 3UQZA 5JBQA 1X86B 2Z2IA 2QVZX 1C1HA 1L8QA 4UNIA 3MMZA 4JOQA 2QRZA 3C3CA 3THRA 4J0JA 4OJMX 1UPUA 4TTRA 2HADA 1ZCJA 2O2ZA 4X8HA 4K26A 4YV2A 4OFXA 1O58A 3CNBA 2GD2A 1NMZA 1VPEA 1NUHA 2GCGA 1NNEA 1GV1A 1QLHA 4KI7A 4II2A 5KYXA 1YIAA 3PE4A 5FNVB 4CM8B 2XA2A 3VR0A 3CVWA 2O1EA 4I5EA 4N18A 1ZM9A 1E2EA 1L5QA 2WWWA 3FTNA 3GV0A 3N8IA 4QUEA 3TOZA 1PWZA 4O2LA 2ORYA 4DT1A 3HXOA 4E6EA 1P2FA 4L4ZA 2WFMA 2FRVA 3W8NA 3D3QA 3OJOA 1KYWA 1N6KA 3C45A 2ZI6A 2X3YA 3LC2O 4AYTA 5AJZA 1IRXA 4M7OA 4TTPA 1SC1A 5REQA 4ES6A 2CV1A 2IXTA 2G40A 3VJLA 1RWOA 2E4XA 3PD1A 3WIBA 2MOKA 4C1NA 5FTJA 3PFFA 1DKQA 3L5OA 3O4GA 4M8IA 4ZVPA 4Q3LA 2AF3C 1M83A 2OGZA 4MUBA 2OV3A 3PGXA 4BGIA 4CZ2A 4BO0A 5DNVA 4DCMA 3KKOA 1XDDA 4W5JA 5FPQA 4RA6A 1U2DC 3DDNA 3CEHA 1HDCA 2AOUA 2ZSJA 1GARA 3JAWB 2AYXA 4TXJA 2UZIR 3JY6A 3O8OB 2IDZA 4IEIA 2BP7B 3B36A 3TBKA 3BE6A 2YRWA 4F7WA 2P3OA 4P34A 2NIPA 3CJRA 3CJQA 3C7AA 2NTNA 2XTZA 1MNQA 2GA9A 3G17A 3DVLA 4F4DA 5EUMA 3CRQA 4H6XA 3TMYA 2OGWA 2AMJA 2CXNA 4LOHA 5DX1A 4BX8A 1V45E 4IJ6A 5H4GA 4KQMA 3MSXA 2RI1A 2F90A 3FAKA 4J4HA 1B42A 5EUCA 5CXQA 3OJ0A 3G9UA 4QQRA 5DU2A 2NSLA 1M2GA 3A1WA 3VYVA 2DUJA 2EHJA 1U8EA 2E4VA 1FQKA 4KXXA 1B76A 2VP2A 1KJYA 2BZSA 2Z2XA 2X1LA 4QOGA 4BNYA 4QT0A 4DHWA 1SXJA 1FX0A 4CIDA 3M4NA 4RTRA 1WMAA 4Q7LA 4X54A 3CN7A 1G3RA 2TMDA 3MG9A 4JITA 3S2EA 1KXJA 3SZUA 4AP6A 1LQ2A 1HYBA 4BVAA 2GJ4A 3QUAA 4UCFA 1XTQA 3COVA 3GH3A 2K7FA 2PFSA 3C3PA 3QVLA 1F4PA 3IFSA 4TYWA 2DQSA 1D2AA 1NF9A 4JXXA 4HQRA 4HYTA 2GRAA 3IVRA 4U7JA 1TL7C 2Q29A 2VH2A 3O8NA 5IT9A 1BDIA 1CX9B 1R88A 2EFGA 4MTCA 1GQOA 1QDUA 1NN1A 5A5VA 2QIOA 4E70A 4YGYA 1PZXA 2YS6A 4XYEA 4UUMA 4ZK2A 1JFSA 1HTWA 1QB8A 1WZCA 3ZE8A 5ES4B 3F4KA 4NEGA 4ER5A 3VZBA 2C9BA 5D51S 1PEDA 3PUXA 2PXHA 4MIKA 4CUKA 1MO3A 2AYZA 1WPXA 2ZWAA 3BRWD 5CIQA 1Z2DA 3CJTA 2WSYB 3OEEA 1U4SA 5HKKA 5I8PA 2G0TA 2XCUA 1E94E 2MR5A 2ZYDA 3GEDA 1AKYA 3QYFA 3P9CA 1AVTA 3S8MA 5EWLB 4CEIA 2VTBB 4DQKA 4HUQA 1P9OA 2ZUVA 3G8CA 3IEVA 2R96A 2A0XA 3G89A 1NR5A 3FFWA 3VC7A 4GH5A 5COBA 1K89A 3O03A 1GWNA 1V7PC 5KNLA 3MMPA 4GPIB 4HNRA 5AJHA 3TPZA 1I6KA 1UZMA 1X8LA 3NGLA 3UHFA 1IH8A 2I22A 2VUHB 1U7PA 2QX7A 5JEDA 5JSUA 4FFBB 3SF8B 3OFJA 2VZEA 2QJRA 4NEHB 4A9AA 1D7OA 3OSUA 5K6TA 1ZZEA 5T4EA 1SZDA 1LCIA 3Q1LA 3SBXA 1JQEA 2GNOA 1M2OB 2YVQA 2Z4RA 5LMUB 2C5AA 2ONYA 3NHFA 1WCIB 3I72A 5EWMA 5KQPA 2XMRA 4X61A 3HH8A 1O94A 1V5FA 2A92A 2HNAA 2H1CA 3GA5A 4IJUA 4U2CA 1P2UA 2IUTA 3MAAC 4U7HA 1COWA 4UTOA 1NVAA 1JYFA 4F9EA 3G9ZA 5I9SA 1MX5A 2NTYC 2B8NA 2X42A 3R9KA 3I0MA 4RD3A 3OTQA 5AJWA 1AG9A 4I14A 1LRLA 2RAVA 3P97A 2FW1A 4TZTA 4JMPA 3GG2A 4AS3A 1C1XB 2AC2A 2X5NA 4G0PA 5FL3A 5HFJA 3TTSA 4ARZA 4PQFA 2R00C 3QE2A 4KE6A 1LX6A 5KYXB 2PSEA 5JSHA 3M5CA 5DHUA 1Y7LA 1G42A 3D6HA 4XTRA 4CKBA 3RVJA 3ECSA 3WBFA 2ZPTX 1POXA 4M7WA 3PC2A 2WTAA 4LX0A 3M7IA 3BZUA 3KEMA 1M2JA 3I01A 4OHPA 1HEIA 2FE4A 1IMOA 1X1RA 2WI8A 3HWRA 4B0PA 4E14A 3C85A 4RY8A 3KQNA 1UJMA 2Y1CA 3TE7A 3R5HA 4RDXA 4Z4HA 4ONEA 4Q82A 1H8HD 1GLNA 2SKEA 3A1DA 1P1CA 4LQ4A 2BFEA 4OQLA 1RI3A 4YCBA 4EYQA 2JJMA 5BT9A 4UW9A 4C29A 5HIKA 3EQ2A 1CEQA 1YS4A 1Z5GA 2KSQA 5ARBA 2Q21A 1EK1A 4A82A 4DUGD 5C8XA 1F20A 2GDZA 5FTNA 4YRBA 4AO8A 1IBKB 2EP7A 4JXJA 2OUKA 3AQ4A 5BSFA 3L1HA 3FHOA 3DLHA 2AH5A 4J0IA 1HH4A 3W6OA 5CT6A 1OOEA 2WDZA 2ZOSA 2OKCA 4PG8A 5KU1A 2P5TB 1ZVVA 3MJSA 2ZRNA 4JC8A 4KLCA 4OXQA 1W0CA 5K3DA 3ZPXA 2BFFB 4CKZA 2IXFA 1EE2A 2COEA 2OK8A 3R3HA 5DM4A 1J9ZA 2HC9A 5JAZA 2BFWA 2JFHA 3AZOA 4ZO9A 1DBIA 2NZWA 3SOPA 1CTQA 3B8EA 4BCCA 1XA3A 1NNUA 1JEJA 5CNIA 1BYUA 3G49A 5TXGA 3RVDA 1GRCA 4HWSA 3DEHA 1N6OA 5HX7A 1IYZA 3CKMA 3ZJYA 2G06A 3IAFA 1XEWX 1B4DA 4F4HA 3A1VA 4H3HB 2QMQA 2VPWA 5K0JA 1RFGE 3O1HB 4L78A 1AUVA 2HR1A 3IBSA 4RAOA 1W0JA 3WWOA 1YHNA 3UT6A 1W76A 4K9QA 3DO5A 3KT3A 4CR8A 3M82A 2V59A 1NVVR 1ZA1A 3WV5A 3MHTA 1OWPA 2HV9A 1EKXA 2NU8B 2FQWA 3K9HA 3RPEA 3U4AA 5KNCA 2BRUA 4BO2A 5MDHA 1SWVA 5DASA 4L28A 5KHOC 1ADFA 4LY0A 2R5WA 1XEAA 4DC9A 4KQHA 2ZAYA 3TEJA 3GZTB 1QHNA 2J45A 3OSZA 4HWGA 1FQOA 4U00A 5DBFA 5I6DA 3T7SA 2XXAB 3TI7A 3LDHA 3NI2A 1M0WA 1E18A 4DC0A 5A71A 4P22A 4KIJA 3KSRA 2B78A 3RASA 1A9PA 4B75A 2YW9A 4H1TA 1G4AE 2G08A 4PZPA 2B2NA 2TS1A 4BGDA 2AZ4A 1WL8A 3IMGA 3MZ0A 3BXOA 3L05A 1DLIA 3E18A 5KAPA 5CDFE 2BR5A 4J6FA 3T7JA 2Q7OE 3ECCA 1R10A 3KT0A 4YRZA 5E3JA 2HQ1A 3ET4A 1A5AB 3H99A 5LM3A 1CWUA 2UZAA 4DAEA 5DIFA 2WSBA 4TV8B 4JI2B 3G2KA 1U1FA 2EXXA 3DFUA 4IW3B 2EKQA 3VVMA 3L41A 2GF2A 3OD5A 4BLRA 2I6FA 3DDWA 3MUOA 4B1FA 2P9ZA 1EFUA 1LQTA 3U3MA 4Q4CA 1YDWA 2HJRA 3PKIA 5DM70 4QECA 3O8LA 5A2GA 3R76A 3FCCA 3DXZA 1YBMA 3I9KA 4NJEA 1YMVA 3QU5A 1E1CA 1QFSA 5DGHA 3AHIA 1DT5A 1OXTA 1GTG1 1NXTA 1FP2A 2D5CA 3MYRA 5B36A 3D0RA 3U6BA 2CXUA 4OHMA 3P7MA 2HWWA 3VZRA 5KTNA 1L5MA 2J3LA 2LDXA 4AJ4A 4XUEA 2B4QA 2JI6A 4XIFA 2AI1A 3DJYA 3QW2A 4A0GA 4MRSA 3BFVA 4GVPA 1JTVA 3DVRX 3Q7QA 4KO8A 1Z5NA 3U7QB 5BWBA 1U7UA 3KJNA 1R6UA 3O1IC 4Y2VA 5EIEA 2RG7A 1XMOB 5HRUA 2Y1WA 5SZIA 1NN3A 3O4FA 2DHEA 4FYPA 4TROA 2LBPA 3FPLA 4BLVA 3GA0A 1MR3F 1AO0A 5BY2A 2A3RA 2QW1A 1PDOA 3EUAA 3H2BA 4TLDA 5DHFA 5GQSA 3ZCXA 4F4UA 4RTNA 1C0KA 4MS4A 5A5FA 1VPWA 5EZYA 4CCSA 5JT1A 2Y1GA 2WRZA 4XR4A 5MGNA 4Q9AA 4AJLA 4ZV7A 1L1EA 1U90A 2WWGA 2PZFA 2FJUA 3NAZA 4LRSB 4TSRA 1IZZA 4YAOA 5KX5F 4MVJI 4R2JA 3MC1A 3TAHA 4YRRA 2P2SA 3ZWWA 4NF2A 2ADMA 4IMRA 1OU4A 4MIYA 4X8OA 3II6X 1XVVA 3BMNB 2GD0A 2VR1A 3WK4A 5HZMA 3IURA 3S99A 2I3DA 2H54A 4OFWA 3EXG2 1KGDA 2ZUCA 4TKLA 2H0QA 1I30A 4ZVKA 4CIWA 1ANKA 4CQMD 3T3IA 4H3VA 2YZNA 1YB1A 2WB4A 2Z83A 2MU1A 3O2SB 3B82A 3CEMA 3OZGA 4DRXA 1S9DA 3A1CA 3WYCA 3ZDCA 2B69A 3JWEA 4RS4A 1HZZC 5EKSA 3REQB 1YS7A 2O8FA 4BZXA 1M1XB 3JSXA 2XKKA 1QBGA 1C3OA 1QHHB 1JJAA 3D8TA 1BJRE 1Z18A 2QT1A 4H7HA 4HATA 4V38A 1E9SA 3BFPA 3IP5A 2Z8XA 1ZW6A 1XQYA 4INAA 1DC4A 2HK8A 1UT6A 4UUNA 4V02A 1Y7PA 4JJGA 13PKA 3M9XA 3R9IA 1NLMA 3NHAA 3BK1A 4KACA 3B53X 3WMRA 4JX9A 2RHTA 4LI3X 4ND1A 4I5IA 4Y0VA 4JU8A 1POWA 5TGDA 3U0VA 3ZDRA 4DQLA 4LFAB 1FFCA 3NAGA 4O5AA 4U02A 3ZZ0A 2IUSA 2OE2A 4O1HA 3ZXIA 1R66A 4EYOA 4G5HA 2RBKA 3GCWA 1KJ9A 3AJRA 4JJ4A 4UU0A 1LPOA 4CKCB 3NBXX 4FEYA 1GL3A 1YE3A 3N5KA 1A4UA 4LY6A 3NP7A 3QEOA 4ENRA 2J9RA 3OFND 1PYGA 1PFVA 1ZM7A 4IKPA 3MUFA 4XFDA 4HH0A 3KKEA 4BO7A 5JU6A 3DPIA 4W1RA 4EI7A 1M0EA 2A67A 5DCLA 4Q47A 4PLGA 1VE7A 5BSWA 1Q95A 4Y7CA 4UNRA 4QHYA 2P2LA 4RSMA 4GZ3A 4Q9JA 2IEZA 2ISCA 1H2YA 1QLWA 1N5MA 4WUVA 3V34A 3AL0C 5DZSA 3F6YA 4LPKA 1T3ZA 2F00A 1GAXA 4EHFA 5K3EA 3HB5X 2DFPA 1P5ZB 2QMHA 4L95C 3UNXA 4GF5A 2IH4A 2P9EA 2Q4OA 1X1EA 3ETEA 4ZREA 2C7PA 1Q0QA 2NSDA 1YSCA 3JWIA 1WU8A 1FFWA 2IVFA 1T6XA 2OO7A 4LZLA 3A4NA 5DYTA 1PO7A 1E2IA 1I7NA 1UJ5A 1J8YF 1ZI9A 2XYPA 1RLUA 1X39A 2WF8A 4L8FA 1JJBA 2OLJA 3UJNA 2YNMC 2GBFA 3D3JA 5DTEA 1EXNA 1Y5LA 1Y8ZA 4J03A 3FB4A 3GJSA 4U6NA 4F11A 4XFJA 1FSPA 5AUPB 1ESCA 4EF6A 1PFKA 5IK2D 2W98A 3DDHA 1G5FA 3RS5A 1JEYA 4Q39A 4CQLB 1L1FA 2IXAA 1QLJA 1JTFA 1B3BA 1KS9A 3OETA 4RPIA 3VZDA 1BA3A 1BEZA 2EJTA 2OCPA 2PWPA 4IINA 3FYDA 4IVRA 3A9CA 3U9TA 1SBYA 5ALPA 4G1EB 2X77A 1X7YA 1U8ZA 1LA2A 3O5AA 3PHIA 1NQUA 3MMSA 1VE9A 4BE9A 4ESEA 2EJVA 4RZ2A 1IQ0A 3I4CA 3IBFA 1G98A 3ZCSA 5M04A 1TC2A 5SY6A 2HJ9A 3I5UA 2UYQA 3W5UA 1Y8AA 3U3XA 1P3JA 2ZS8A 1OLOA 2I5PO 4Q4LA 4WZAA 1BGVA 1RLJA 5HA5A 3V2GA 1PGQA 5FEMA 4A15A 1II8A 3H5NA 2DHDA 1H9CA 2WJYA 3IP8A 2VEOA 4DVJA 3I61A 2GFIA 2HMWA 1LY1A 2Y0EA 3N7AA 3LZ6A 5EY5B 1LUAA 4BNWA 2D2XA 1HY3A 1RDFA 3H0KA 5LZ9A 4Z4GA 2L69A 2HPHA 4HWOA 3EQ8A 1IPEA 1PVOA 4KVFA 2ZTSA 1CK4A 2GAIA 1RQ7A 1XCJA 4PCVA 3GFFA 3FCAA 1NVMB 3H9CA 4QQFA 4TVOA 5DLYA 5BSTA 4O2AF 1OWNA 1IOWA 1WKBA 2PKWA 3C6XA 4HMPA 3FGPA 2HCJB 1QGUA 1WOYA 2Q9UA 1H2HA 3OUUA 4K6OA 4QOIA 4J49A 1T9ZA 3VPXA 4YB8A 2A0KA 5KTYA 1TPZA 3OJFA 1SEVA 2H59A 1QYDA 4JHXA 3GLRA 4KQGA 4X3CA 4B34A 2ZKLA 8ABPA 2HT1A 2R97A 5EPOA 1EUQA 2AOWA 4L5BA 5AM4A 3ZQ4A 1TUIA 2C82A 1U63A 2BGUA 3VDMA 4HTFA 2GCOB 1QYCA 2CVHA 1T6BY 3FA2A 3SICE 1UMBB 2XYRA 1PDVA 4LYAA 2GBIA 5D5QA 4AS2A 2CXHA 1D1PA 1RJ9B 4RGVA 2A57A 1NFQA 2W93A 2COKA 3A25A 1ATZA 1UEIA 2F1RA 2J3DA 4G26A 4KC0A 4B7ZA 4Z4QA 1N2IA 4FI3F 4Q12A 1DIBA 1XYYA 4MRVA 1ND6A 4JP1A 1N6IA 3WGKA 4AO6A 3M3DA 1ORHA 1ZN8A 4Q24A 3EXHC 4FE4A 2X6TA 2ZB4A 4I55A 4QPPA 3QFCA 5IU6A 1OFUX 3ZE0B 4TQUS 1DBRA 4BNIA 1SCJA 2F7SA 1SXJC 2HCFA 1F2UA 5TR9A 3VOBA 2I6TA 2ZJOA 1Y6GA 2TECE 3CLUD 2X58A 3G88A 3KYCA 4K6HA 1CCWA 2FFQA 1LNQA 3O3CA 2HW8A 5FA8A 2P1DA 1A8IA 1E9EA 4MKFA 2MMCA 1L5FA 3JQQA 2BR3A 3ZWDA 2WABA 1ZWLA 5JSZB 4O02B 2O5VA 2ABWA 1PHRA 4TLMB 4TYYA 3HY3A 2WKSA 5FYDA 4LYEA 3PDIA 5BW4A 1KI6B 3TQOA 4P7BA 3K05A 1U98A 3T4XA 4MUJA 3UXHA 3ECAA 5ERYA 4FONA 4AKGA 1VKRA 4L74A 2CLKB 4HRYA 4LRUA 1ZUNA 2B21A 3IQEA 3Q0EA 2HRQA 1P45A 4X6LA 1CF4A 4EL0A 1SNYA 1Z82A 4LYHA 2IYOA 4MVJM 2WHRA 2WWFA 2CBXA 4JJKA 5FL7A 3RFTA 3QM1A 1LK7A 1Z0UA 1ZGHA 1HOXA 3IPAA 3C2QA 3O9ZA 4WLUA 4MWOA 3SKYA 4ZTUB 2CXSA 1RZ3A 3LBIA 2QL5A 2R8XA 3LVQE 2DTXA 3WOVA 1ZCAA 3W3AA 2JLQA 1P9NA 4LPSA 4UNPA 4JBWA 4XB2A 2B8EA 1GGVA 3RSOA 5JZ9A 4RGYA 3D6FA 1DQZA 2F9MA 1GGFA 3PR1A 1HDEA 1PQWA 1Z45A 4FFWA 5GPBA 1IZ7A 1ZW1A 4JN6B 3DAHA 1VE1A 1N1EA 4TXLA 3K0FB 1UJNA 3PQ4A 1ODIA 4PX2A 3PFHA 3HDHA 3KALA 3K4QA 1BHJA 2SBTA 1BVUA 4NCKA 5P8WA 5K6AC 4LWQA 1MB4A 3O93A 2JFVA 3B1ZA 3NWJA 1NPTO 3EXFA 4N48A 4MICA 1N78A 3L43A 3W34A 4B3XA 3UJCA 2YVKA 4OBXA 4F1KA 1L7OA 5KMGB 1S7GA 1IZ0A 1A5SB 1EG2A 1N5DA 2OR3A 4HNQA 1H1LB 4P4GA 4WZBB 1AA6A 1MQ9A 2E4AA 2C4NA 2QD2A 3A10A 2QD5A 3IS3A 5KWSA 3IGFA 1G8MA 1CZNA 4KQIA 5E1OA 3MAGA 1SUBA 1XR3A 1XRPA 3O47A 2VJDA 5DT2A 1AQYA 4HVAA 5AVTA 3A3PA 4LSZA 4M99A 3UJ6A 4JB3A 3DVQX 4ENPA 1H3FA 4QARA 3PD0A 1RAEA 2PBLA 1R3UA 2BE9A 4CDGA 5IT4A 1RXUA 3O0TA 2E7ZA 2RHCA 2WOOA 3ENWA 3KTAB 4L7VA 4LMRA 4NOKA 2RGCA 1QG6A 4KNYA 3EVZA 1BDJA 3U4GA 3ESZA 4EZEA 5DW3A 4RTKA 4MWCA 4AO7A 4EVSA 4F12A 1LBIA 4YFYA 4EGJA 4Z54A 2V7BA 2RB4A 3NZEA 5CJ2A 4O29A 1QO0A 5GM2A 3E5NA 4WV3A 3ETGA 4IV8A 4CMHA 2JGDB 5C3UA 4E1VA 1O95C 5HZHA 4FGZA 5E8JA 3NUZA 4K1LA 5HQ3B 2GD6A 3BC1A 1BVHA 2FQXA 2EERA 2X7XA 1ZPDA 5FNZA 4TWIA 4Q7EA 2H1OA 1QUEA 3W5DA 4MDYA 4OQZA 5AJUA 5AOBA 4E09A 3T5BA 4A4DA 2SKDA 4KFTA 4QLBA 2VQEB 5D5PA 3QMPA 4YRAA 3UK6A 3SBDA 1O4VA 3SZLA 3FYHA 4UHBA 4CT5A 4PRYA 4Y2HA 2HGSA 3S7ZA 4N8SA 4D99A 2A4MA 3SYRA 3QHPA 4ZO6A 2P2CA 3PNOA 4INPA 5FBWB 1BN7A 1JKFA 4H77A 2CK3D 1G6OA 1KO5A 2YWEA 4X1OA 2HDWA 2YASA 1RJEA 2CFIA 3OIGA 3LSYA 4OAOA 3ST7A 4EO9A 2ZB2A 3RJ9A 1OYWA 4FOSA 4ZMSA 3AX6A 1K7EB 1W1UA 2GZDA 2W83A 3BWDD 3Q1KA 1Y3CE 2C4WA 3JZFA 4GFDA 5LPNA 1LZKA 4BQQA 2JH8A 3D3NA 4G37A 4WA8A 1N6PA 4BYGA 1KRXA 3TQQA 1F7VA 2B20A 2HMTA 2RKOA 3JQ8A 2IP4A 4WA7A 1RQXA 1AKUA 1ZD4A 5EJ4A 4V3BA 5JW6A 5KEIA 1XDUA 2C8JA 3OZIA 4GICA 3M49A 5C7IO 1UC5B 5LQDA 2HQRA 3ADOA 4BNUA 2ZJ2A 4HDNA 3VZQA 1MD9A 3O91A 2VQDA 3FR7A 3K15A 3N2NA 3OZAA 1H8HA 3D7NA 2Z8YA 4GWGA 3LBAA 2O8CB 2XOKA 2ZRIA 3ZV7A 4GMDA 1Z34A 4QDOA 4IUCS 4G5SA 5AP9A 1EFTA 2DWUA 3NBFA 1GNLA 3RS4A 5HXAA 1JHQA 2O6HA 2QG6A 4BFWA 4EEKA 4DBZA 4EKIA 1Z63A 1W4BA 2XDWA 2ZE7A 3FTFA 2ID8A 3UO8B 2FPOA 5EP1A 1HI9A 1VSQA 2E37A 3VKFA 4GLFA 2YN2A 1V3UA 4D80A 3PXGA 4AN1A 3X2FA 4ILEA 2Y1LA 3DKPA 5EJFA 4ZYTA 5E6SB 3TXXA 4JQCA 3HCBA 5FDFA 2QORA 3SVLA 2W2LD 1NW7A 3AETB 2CLOB 1EUZA 3AI1A 4XTCS 5F21A 4F5ZA 1C1DB 4Z9YA 3PX7A 1ZITA 1QP4A 3DZHA 1H2AS 2VF8A 3EPRA 4I1VA 4PY2A 3SMVA 4F84A 4ALMA 4QGHA 3RS8A 4BLPA 2EIHA 2YS7A 3NAMA 2WYOA 4NG4A 5G0WA 1VMKA 4KFCA 1W4CA 4MPTA 3KP1A 1XRNA 2OV4A 4R8KA 3T8YA 2HMAA 4O4HA 4DREA 3STVA 1N2CA 3QJYA 3H1PA 2YN0A 1XP8A 2QX9A 3ER6A 4FLMA 1V5WA 4MIEA 1V96A 2GM9A 2YXEA 3K6RA 1P1HA 3PDCA 4IS2A 3E58A 5D7BA 1GDHA 5KYTA 5LP6F 3C4QA 5LOVB 5KNCD 2CMKA 3GELA 4KCGA 2ZSHA 1D04A 4RFSB 4ZOBA 1JEOA 4CKEB 1DCFA 3JZDA 1DTEA 2BEUA 1QNLA 2YHIA 3W79A 2OD7A 3IOBA 2G9VA 1EB9A 1PGJA 5KYGA 2HEIA 4XVCA 10MHA 1WCYA 3D4OA 4A91A 1TRHA 5KTRA 5BN5B 3HYCA 5CXUA 1JXQA 4WNYA 4BKQA 4H6VA 2YJ6A 1BWSA 3B9QA 4K2AA 3D1VA 3N28A 3NTLA 2WFZA 3BZBA 2ZYUX 4O8ZA 2FW0A 5AXCA 3NVKI 1WRBA 3KCNA 1M8GA 1M76A 1MTZA 3ZTYA 1FP7A 1EFVA 4CKEA 3H9EO 1O94D 3AOEC 3FBTA 2IDKA 5SZKB 1PNQA 3DDOA 4B46A 2V03A 1VGRA 1WXHA 2ZU0C 2CJPA 3QPCA 1EFAA 5B3JC 1QH0A 1XTTA 2PEZA 2QPOA 3N1UA 4KVZA 5FJIA 4HNUA 1AMOA 5EZYF 3KJZA 4DDKA 6Q21A 1VL5A 3QUQA 4BP9A 3ZH2A 4ZQHA 2PGLA 1ZCFA 4MUGA 3BB4A 2ESRA 4NYIR 5B12A 4ZV9A 1H2XA 1SMKA 1RTKA 1YZFA 1ABFA 1OAKA 4UCQA 1JLKA 1AN9A 4GE3A 2FJ0A 1V8BA 1NJ1A 3DT8A 1K8RA 3H65A 3PPXA 4Q3BA 4YV1A 2X0DA 1G59A 4WRRA 3ICQB 2PX2A 3MIIA 4WNCA 4OMCA 2JCVA 4MH0R 4S0XA 1BJKA 4GOMD 5IS2A 2A7XA 2QR2A 3NIDB 3T5DA 4JBNA 1MP0A 2E4ZA 4IXWA 1J0BA 5JJBA 3L6CA 4TM7A 3IBCA 3AJDA 1XCBA 3RWOA 2NP6A 5BRAA 1YHZA 5JD4A 5B57C 4AZTA 1JI3A 3CRMA 2VZLA 3BJMA 3E70C 3JD2A 4FQ8A 4FFNA 5DBHX 2C95A 2WJ3A 3CWZA 4Q1CA 5TMBA 3UIEA 1R0LA 5TVKA 3UH0A 3WLIA 3ZD9A 5AKLA 1GUFA 5ED4A 3NO4A 4BFXA 2RCNA 4XGQA 3AFMA 3QV2A 1PIWA 4IGKA 1ZH4A 2FZEA 2AI3A 4DV1B 2WT8A 3K6SA 4PAGA 4P4NA 4D4MA 5LJLA 2HSDA 3SE0A 4K40A 1EWVA 1YJBA 2C96A 4NMLA 3A58B 3NCHA 2J9GA 2ZTMA 3U56A 3G0IA 4NE9A 3EGEA 1WE2A 5TIIA 1RI1A 2ZJZA 5AW9A 1ZFNA 3QMVA 3AO0B 4N03A 1AIPA 5BYBA 4BRSA 4EPYA 2G71A 2H6EA 4BMXA 4I5DA 5EMHA 4AQ7A 1V8OA 3QVOA 4L73A 3HN6A 4GNKA 1VMIA 1W9HA 2WE7A 3MWFA 4H6WA 4XPIA 1QVAA 5TX7A 2C2YA 4BTLA 3HJAA 3VHXA 2BH9A 5IJZA 2ZSEA 2EP8A 2PBRA 2WWIA 3LH5A 5TS2A 1H66A 4B3IA 1HYEA 4M9RA 5J4LA 1NVEA 5AI5A 4I3HA 5K2OA 3I2HA 3L4KA 3FUWA 2CLHB 3W5AA 4CCWA 2F8TA 2VK2A 3O90A 2DULA 2QRHA 3DE5X 4L16A 5TMEA 3TZHA 4D79A 5CU7A 1KK2A 4REQB 4PQEA 3KJQA 4R0MA 1E7WA 2PUGA 2EFEB 3I1FA 2N42A 2RK6A 2Z1MA 3I6BA 5FPTA 3KVRA 4U8GA 4IG4A 3FKQA 5K20A 3HO6A 1HFWA 1QZXA 3JXEA 4ZOLB 5KYUB 5BQPA 1B2LA 4PE5B 2B0JA 1DX4A 3ESDA 3KKQA 1VKZA 2OMKA 4H2DA 1TMKA 1G8HA 2M6SA 3ROMA 3LE8A 2IWRA 5G53C 4KITB 3OZUA 5K8TA 5J2TB 1BU8A 4LXIA 2XNJA 1CSEE 1H93A 3EDQA 1GA1A 5AKEA 2JFUA 4B0OA 1WCV1 1XRSB 2VOJA 3M81A 4GGOA 4HZUA 1UFOA 1JWLA 5ALXA 1T9BA 3AY7A 4DJDC 3O92A 2AG0A 2ZYGA 1NRIA 1R8SA 4YRQA 5JALA 4WKGA 1B15A 4OHVA 4KPFC 5BNTA 2R65A 2YFYA 3AC0A 4KZPA 4YLYA 4R3WA 1DAIA 1JSXA 4QOEA 2O3JA 1ZLYA 3LWBA 3ILSA 2VSQA 3NJRA 4EHHA 3WG9A 3LUGA 1TADA 4QPDA 3FSGA 4PXAA 4EW1A 4EO7A 1JAIA 1J2JA 5DB4A 1X0XA 1ZJ6A 4EFLA 4XYBA 3BZWA 1KHHA 4KPUA 4QICA 4ED9A 3ZDZB 5H8WA 2Z09A 2FPIB 4BNGA 1FBTA 3NKLA 2WYUA 4R5HA 4F96A 5IDVA 2PS1A 1LVUA 1SOAA 1GUBA 2CUZA 3GJ8A 4GW3A 4TLCA 4TXHA 4S1NA 4WADA 3PDHA 4ZU6X 3TRIA 1W36D 1B8PA 4DYDA 3R77A 1ST3A 1ZKDA 5FI3A 4ARUA 4DA7A 3HKCA 1W0KA 4UQOA 3FCXA 2ADFA 3RQIA 1C3JA 3NEAA 4JC0A 3VJKA 2O7VA 1E4EA 1FYFA 1N9GB 4X1YB 1I9CA 2OWDA 2VH1A 1SB8A 4N5MA 3BAFA 1WZ2A 4KZKA 4Q9LA 1O4WA 3MXTA 5F2OA 4RAQA 3ZHZA 4OLHA 4GMKA 1P4AA 2AKYA 4PIPA 4U0JA 1JDBB 1X9GA 1IQPA 4I1UA 4R2WA 4HH1A 2F67A 2OBNA 4U2FA 1NBME 2XZDA 1RLMA 2O7NA 4QATA 1H1DA 3GUHA 1K5DA 2X4LA 4U39A 4L9RA 4ZXPA 1L6RA 5FTLA 4QU8A 1Z15A 2BN4A 4OY3A 2IV2X 3B2NA 1H9BA 2HA4A 2WWXA 2ACVA 2JBAB 1XV5A 2IUUA 1F9EA 3AXTA 3BXPA 4U2GA 4WEQA 5JWRA 3EEBA 3G5TA 5EYPA 2W4IA 1W4ZA 2ZFUA 1ID1A 3CZ9A 4JGIA 1PBTA 3OIVA 3NT2A 1DIGA 1DQPA 2WUEA 2H5IA 1KAOA 4RV9A 2ZTHA 4EBFA 3EOBI 4O4IA 2ZT5A 3OT1B 1Z4NA 2O0MA 3OQNA 1TKRA 1YJQA 2GNAA 2RC5A 3Q5GA 1PE0A 2JFQA 3OPMA 4RKEA 1Z7GA 4DV0B 3CVUA 2J7PD 1C8VB 2AW5A 1Z6QA 3LZCA 2Q4TA 1XU7A 1RT9A 1DEOA 4PSCA 2GO1A 4LXTA 5KTMA 3JQ7A 2BZGA 2IHZA 3SC4A 2RONA 4EUFA 2OO5A 3CMMA 1P31A 1RHQA 4AY2A 1IL0A 3TJZA 3FOZA 3H4TA 2GTPA 2W9XA 1QIKA 4PHTA 2G36A 2HPAA 1TO1E 1J6UA 2OSBA 3D3KA 3NHPA 1RPNA 3B1YA 4G5OA 1FNCA 2NU9B 5LXTF 2O2EA 2WYVA 4R2HA 3ABOB 2DU8A 3MJDA 2BJWA 4MQBA 3WBBA 3AKZA 1W93A 1O57A 1ZH6A 1A0OA 3OCWA 5CEJA 2ZBFA 4Q3OA 1UBEA 1V6CA 3K6SB 2H63A 4B40A 2QE6A 5J59A 1DTSA 2CXOA 4D9HA 3AFGA 1NF8A 1DJOA 2WJIA 3TBFA 2WFLB 4DV4B 3GLKA 2OZLB 2ZXFA 3ZE9A 1KAHA 1K3TA 1F1JA 1RJ9A 3BRSA 5ESWA 1I9GA 3SPXA 2XQJA 2GZ1A 1NI5A 2VFAA 4PSKA 4XB1A 1NQWA 3KQMA 3PXDA 1R0BA 5SYAA 3UANA 4L4UA 3QENA 1F0PA 1MFPA 4X24A 3V4ZA 1ZMOA 2WPDA 5H9VA 2NGRA 4NBRA 1AS2A 1N0WA 2O3TA 4JUAA 4OPMA 4CEHA 3K0CA 5IJ9B 1LEHA 5EFZA 4X94A 1N6NA 4IM7A 4JROA 2VPXA 3BN3A 3WAKA 3PR2B 2AMVA 3RT1A 2GUGA 3LT4A 4BBPA 2AF4C 1EESA 1VHWA 4M4SA 2CCKA 2P3LA 5DCUA 4FNOA 3U3OA 3CISA 4PO9A 5KKNB 4LJ5A 3ZTTA 2ZAMA 1TTTA 1IHUA 2JGFA 2ZJFA 1E79A 2VKQA 3IV9A 4LHYA 4WX2B 1J97A 2PXAA 1QPGA 2VBGA 1YBHA 3G0CA 4N47A 5JJKA 4O1MA 4LNUB 2YZMA 1NC1A 1IBMB 2IZ6A 3E5RA 1KYTA 5TPZA 1ZM2A 1YRYE 3KVYA 2GESA 2OCKA 2J3HA 2WAXA 3LD9A 1NBAA 5PGMA 1GIAA 4MJXA 4BX9A 4YUYA 1XZKA 1II8B 3HLKA 3L4EA 4JI1B 1FE8A 4QL3A 2V4UA 1DC7A 1PL6A 3ZWOA 2NVWA 4F8YA 3ZIAA 2VO1A 4M7PA 1KEEA 1VE3A 1UZUA 1Z5UA 2QMOA 3H9JA 4HS4A 1Q1AA 3DC2A 4MPRA 4OQEA 2WLTA 3AF5A 4WCFA 3FLBA 4X92A 3CVXA 2GGSA 4RLSA 3NJ4A 3PKJA 5HK8A 2IGTA 3UV3A 2OA0A 3WGOA 5DSTA 5IVIA 5AHOA 3QPUA 4KRYA 1ARZA 1EP3B 1FLVA 2F3PA 4V03A 3NTQA 1IQRA 4JEMA 1B8OA 3CB2A 4N0QA 4O8CA 1JA0A 2ZS9A 3E1KA 3DZCA 2V6JA 3HFGA 1XZAA 2C83A 1FRNA 2N1BA 4TL9A 4YRFA 1PJBA 1J00A 1U7OA 1P7ZA 3AKCA 2J3JA 2NAPA 4AY5A 2O5EA 3T06B 4D25A 4G0ZA 1YB2A 3VAZA 4QYSA 5CDTA 1EK2A 1GNTA 3S2IA 1SU7A 4AWXA 1B73A 2FE1A 3UMVA 4NZ9A 3HMKA 1SIWA 1WUYA 3WMXA 3EARA 2VWGA 5AI8A 4ZDJA 3ZHUA 2B9VA 4CDRA 1Y0BA 1GPH1 5JXJA 1LV8A 2PKEA 1JSLA 2ZAOA 1PL7A 2DPHA 3H97A 3A6HA 5AM1A 1LWOA 3I2KA 2GYUA 5DW0A 1H6CA 4EJ6A 8OHMA 1S89A 4IRXA 4OD0A 2EQAA 4P81A 1NC3A 4XQ0A 4CW7A 5J40A 4C06A 5IT0A 2ZPAA 2PQMA 1JE0A 2IYZA 3DZBA 3KYDB 4GD3Q 3GN2A 2EJBA 4RELA 3BDAA 2ZIVB 2RKBA 1HNXB 3K32A 1E3WB 2ZROA 2OBFA 3FPHA 2F1HA 3FGOA 4J7XA 5KX5B 4J0HA 1PQUA 1R6XA 1J22A 3AEUA 5CCDA 1KU0A 2P9FA 9LDTA 1F51E 4RF2A 1N5LA 4ZOEA 3IALA 3COJA 4TKUB 1O5TA 4K05A 1BKYA 4S2EA 3M0EA 1T2FA 2M6RA 3Q3EA 4PZZA 1HYGA 3O0DA 1ZOSA 2CYAA 2RH4A 5DXJA 4L0DA 4YRNA 2XI4A 5FD8A 4X7PA 2IIVA 3N8GA 1K7CA 1X3LA 4B3BA 5A6SA 1HZJA 4HKTA 5LQUA 2WG2A 2PZMA 5K0NA 2HXGA 2ZYAA 4BNDB 1WHTB 3O21A 4QVKA 3EXEA 1E1RD 4M7RA 2FSSA 2QTRA 2XEXA 4Q37A 1WETA 1Z28A 1USUA 1DBPA 1KO7A 3HFSA 4FLEA 1XX6A 3LOPA 3H5OA 4UAUA 3MM4A 5GIPE 4PC6A 5E1MA 1P75A 4NCAA 3UGJA 5JROA 3WGTA 2PWBA 4LRWA 3QELB 1KEPA 2QP3A 4TV8F 2C07A 1MX9A 5CW2A 3L7KA 2DTDA 1UBCA 2W6NA 3AGQA 3QLUC 4FFMA 4E30A 1WXFA 3DCYA 3H2SA 1WHTA 3WIOA 4BTVA 2Q1TA 1QORA 3O95A 2NLOA 1VZ3A 2Q7XA 3CCFA 4KRGA 1T0JB 1UMCB 2VP3A 1LC0A 1NR7A 4LECA 3G2MA 5IARA 1WG8A 3IEPA 5BSRA 1UDAA 2H29A 4NX2A 2UVPA 3BMNA 3OM0A 1EGQA 2IHKA 3HGQA 3WWZA 1GZVA 2JATA 3TOCA 4G25A 3N3AC 1JA1A 3QUSA 4UAJA 5TT0A 3UAZA 1SM4A 2E5LB 4L4SA 1PK9A 5EPUA 2WK1A 1COWD 2CNBA 4UCXA 5LUBA 3D6VA 4A2WA 4IVQA 4E51A 5A9SA 4P3YA 4CLOA 1V2HE 4J91A 2D1TA 2CXQA 1V5IA 2OCDA 1YMUA 3CPHA 2QN8A 3DA8A 3I9V6 1JKJB 4BWYA 3FOFC 2ECFA 2FH5B 3IIKA 1IY1A 1QMGA 4MQ4A 1WMDA 1MB0A 3M33A 3SHVA 3GJXC 1O6GA 2E82A 5IAAA 3THWB 1XZPA 1AH2A 3ZDDA 4BNNA 5BR8B 4P33A 4I5GA 1L2TA 1ZLXA 3KK0A 3NORA 4WACA 4WY5A 1X74A 4XQCA 4O2RA 4MLDA 5FUBA 3TNJA 2H92A 2IHJA 5IUNC 1K5HA 2CE7A 4OM8A 5JNLA 4Y1FA 2FCAA 1FOEB 3PZRA 4X63A 1EFLA 1ZO8A 5JJIA 1XN4A 3ZC3A 1RZRD 3FCUB 1TLTA 4PXSA 4YI3A 4DIOA 1L7BA 2FUKA 3DEZA 3WLNA 4GLBA 3RC3A 1U0OC 4ZOQI 4X1IA 3NP9A 1NMQA 2PMDA 4M83A 2Q5EA 4CMKA 4PYOA 2O54A 2NNLD 5EIFA 5EXSA 4B3SB 1JS1X 4WAUA 4UTXA 3USCS 2PH1A 1NXWA 3AOEA 4EJSB 3UUEA 2A14A 3OQPA 3KSDO 1PFUA 3Q0IA 4YGXB 5TEVA 3DLCA 3TZBA 5HKBA 1GFIA 1NNI1 1PJ4A 2CL0X 1USVA 5JYBA 4RKRA 4EFNA 1G38A 4R8SA 1IJKA 2RAFA 1NBHA 4LVUA 3H7IA 4LXUA 4LGVA 3DOFA 3OI7A 3U31A 4DMGA 2B1RA 2B2XA 4M3NA 2AYYA 4KOEC 1XN1A 4ALKA 2C4VA 1VG0B 2P27A 1XQ6A 5K4AA 1FVOA 4OP1A 1XZQA 2XADA 1PJLA 4MO9A 1F2TA 1YFZA 5HNKA 1BMDA 1DBVO 3ADCA 1QO0D 1UPTA 4AMUA 4GC9A 4G1CA 2QX6A 1ZK3A 4XGKA 1ZG3A 4YJ3F 3HJTA 2OYRA 3FTEA 4DABA 2FNAA 4FT2A 3BE8A 4ETNA 4LS3A 4WFQA 1DIHA 3K9NA 5G0SA 1FTWA 3MWGA 4X3PA 4EARA 5HKKD 1TVEA 4O3MA 3GZ4A 4FBLA 4MCHA 3OZBA 4US2R 4QAQA 2RGNC 5HRCA 4N41A 5FUWA 3KXKA 5A4MS 3GPIA 3ZVNA 4DR6B 2AFIE 3K8YA 2JVKA 5AVOA 1TAQA 2IOHA 1YS2X 3AEKA 3N2YA 5CM8B 1UBSB 5BV8A 2R66A 4ICIA 3ISTA 1B8UA 3QVGB 2A0WA 4RDIA 2O2CA 4FGUA 5DWDA 1CRWG 4ESHA 3HJUA 2C77A 2FPWA 2IEDA 4LDNA 4TM8A 5ALYA 3KLOA 1XNJA 3A14A 4HY3A 3FCSB 3VZPA 4R68A 3MOSA 3L8YA 3C1OA 4JYBA 2QM3A 3UXEA 2HMUA 1VECA 4EWLA 5BPFA 3CRZA 3MGGA 4QIHA 2HO5A 1CJBA 1KQ3A 2QZ9A 3KNZA 3J7AC 2PXCA 3P96A 4LE2A 3O4RA 4X6YA 2ODPA 3U7HB 3HBFA 4MR8B 2GBPA 4ZVNA 3EPLA 4G4SO 2ODEA 2VJYA 2HLHA 1ZSYA 1E1QA 1XTSA 3Q8LA 2BE7A 2XOXA 4BFZA 2WFLA 3ND7A 3GLIE 2JIDA 2AVDA 1ZNZA 3K16A 5AM2A 3EPHA 4UM8B 3LI2A 3P2KA 3CNNA 3EQ6A 1F4LA 1QAMA 2C29D 5CA1F 3G2NA 3L49A 4EY7A 1WLSA 4WLVA 4XVHA 1GL6A 2GJKA 2BV3A 2ZYRA 5ADHA 3BJRA 3GXOA 2XCOA 1KGSA 3FI0A 1Q0LA 3KQOA 2VNHA 3PZBA 3CWQA 3KWLA 5LYJB 2OAGA 2BDEA 3COPA 3OLQA 1NJ2A 1OC4A 4HFRA 1G21E 1WA5A 5H16A 2I2CA 2AFIB 3RSQA 1K4YA 5D3KA 5F7OA 2BFEB 4QDXA 1KFJB 1EWTA 3JQ7B 4MVJF 4PQRA 3D8RA 4PYJA 5BUQA 3ILVA 4PGHA 1ZCBA 4JT4A 4TKVA 2DFKB 3EC7A 1E9AA 4BMNA 3EZ2A 5FH9A 3U3KA 4GQBA 4LF4B 4QXMA 3ZE6A 1YQ9A 2Z5FA 4F56A 1JFRA 5C18A 3MTGA 4ZCSA 5HE9A 4CR6A 3T1QA 5G4LA 1H5QA 5FR2A 4PZDA 4RIEA 3OC0A 5TPWB 4C22A 2QAIA 4DGQA 1E5DA 1DADA 2CHEA 2X40A 3D1JA 4G0UA 2VYVD 1BWRA 3KXLA 3O2QB 1MC4A 1YRAA 3FMPB 4ANFA 1HQCA 1MU0A 1SUCA 3CIFA 1RWBA 2K4MA 5E6RA 4E1BA 1PBNA 4HWKA 3ZDAA 3QXGA 3W5SA 3PEYA 3PTZA 4CODB 4KOAA 3T7KA 4UCWA 4KTVE 1KVUA 1C30B 2NZXA 4NP6A 5TSDA 3MTDA 2NO9A 2PGXA 2PJUA 2HA2A 1Z38A 1VRWA 3UGKA 4XYGA 3TFQA 4BMOB 5IKEA 5C8YB 1XCMA 4ECAA 2FZ4A 1L5VA 3GLIA 1LPMA 2E1PA 2I3AA 4KK3A 4EVIA 3X3HA 1E59A 2PZEA 2Q9CA 3QWHA 4PEVA 1FLAA 3OEHA 2FMFA 2AEJA 3FWNA 3G2HA 2GEVA 4KXQA 4IIXA 4ZZIA 2EGGA 2DUMA 4FB5A 1KRWA 1MC5A 1QPBA 3Q3HA 4PHCA 5J23A 3MS4A 3QFFA 1MABB 2OILA 4C7OB 3SMQA 1SKBA 2PS3A 5G2OA 4NMWA 4OKIA 2WMDA 2B1IA 1RHJA 3D7RA 3R5KA 5EEGA 5EMKA 4B87A 3CSUA 1IDN1 3IQXA 3LO5A 3A6DA 3OHMA 1J23A 5FHRA 2IPLA 4AKEA 1NVBA 1JG3A 2GFHA 4XJSA 1NMSA 2C3YA 4INOA 4C05A 3NHMA 4IR7A 4Y6QA 1Z2NX 1BG6A 2HO4A 2QDKA 3QHQA 5IF9A 3ZJVA 3ADKA 1LBQA 4B6EA 2ON6A 1RE1A 1SWWA 3AHCA 3SC3A 4HLUC 1GXSA 1R0SA 4RLHA 4C0SA 4AC9A 2XCIA 1FDUA 5I7WA 1XPUA 1L4FA 3IUMA 1FP6A 1JQKA 3RK4A 1FRZA 4JBGA 2WE8A 4MPJA 2YZ7A 1UR5A 2I7DA 1SUEA 3UJAA 3W3ZB 4C9BA 2ZI4A 5A9RA 2OV2A 4IDNA 3GJ3A 3UW1A 4Z0PA 3TLAA 3K0FA 3MOIA 3BKWA 3C7CB 4NBNA 5ALFA 5DNUA 1AXRA 2VHXA 3OTWA 1SA0B 2Q1SA 2VJMA 4BC1A 3VPBA 4EJMA 1G7RA 2QD3A 4G0NA 4RZ3A 3MCAA 3HA5A 4Y1EA 4YREA 3GIDA 4UUBA 3UK0A 5DNCA 1MB3A 2AVNA 2FGJA 1TVKA 3ELDA 4JVMA 1NW3A 1Z6XA 2AOTB 2HZBA 2FN9A 4WLNA 3MOGA 4W63A 4B8WA 5JH7B 5KDDA 3AL3A 5EC8A 2VA9A 5JMTA 5LUAA 3NYWA 4HFJA 3IAEA 3DEIA 3KWFA 4YAWA 4ZVLA 5K8LA 3L8EA 5F1PA 4JLMA 2XVZA 2DLCX 2A86A 4FYXA 1WUTA 3P0RA 4C43A 2G1KA 4PLVA 5CBPB 2R44A 4FYVA 2PS9A 3NM5A 5JVDF 2B5WA 3T7TA 3I32A 4DM4A 4DR5B 1YU6A 5BP7A 1KMIY 4FHGA 4PSAA 4PTLA 3SIWA 3FYCA 1GITA 4AQYB 1P5HA 3REQA 2J0EA 1Q1EA 3CR3C 2R8BA 1RBZA 3KD3A 1K3FA 3M2TA 4CG0A 4H15A 1JDZA 5LA6B 2XVMA 3LBHA 4AJNA 2GKSA 1JHRA 4NATA 1OBFO 1V25A 4LVOA 3N2LA 3NHRA 3NC1C 4J7UA 5JISA 3A4TA 5KO2A 4A6PA 2IH5A 3MRTA 3CPJB 5EKTA 1H6BA 2EJCA 5A1TA 1PAUA 4PANA 3GOQA 3UF0A 1IOZA 1Q0SA 2PEYA 3F5DA 2PKXA 1VG8A 4JVNA 4U9IS 4GSLA 4BATA 4E12A 4F86A 5HUJA 2OZPA 2H2GA 4DDUA 1TUEA 2BBWA 3W2GA 4D4JA 1AUPA 4M9ZA 4AIIA 3LYHA 3H7AA 4R81A 3TFWA 1MEJA 1K06A 3D7KA 1RWPA 1QGDA 4WI1A 4RCYA 3DFZA 3IILA 3RRMA 2XUIA 1IEWA 1N1GA 4A0RA 3RAFC 1DDOA 2V3CC 1XE3A 3NM6B 4WJZA 4JLPA 4OLFA 2QSUA 3B2EA 3EH1A 1QP8A 4Y2PA 4IHAA 4UTRA 4L1KA 3WMEA 1YCHA 2AUMA 3KV3O 3A9RA 3S27A 2DZDA 2Q6TA 1NTRA 5EERA 2ZZMA 1CUFA 1TMGE 4KGDA 4EJ0A 3TJMA 1CDOA 1XHFA 3JAKB 1H3NA 3RUHA 1NOIA 4YACA 4Q93A 1UMBA 2QTBA 2VSYA 3G7NA 4KW7A 5G4KB 5J4YA 3K2QA 4ECEA 4V2IA 2ZWPA 2IE8A 1K3UB 2YNMD 3CM0A 4E32A 1TD9A 1S96A 4PLCA 1KTVA 3T9FA 3N2ZB 4LOJA 3RIEA 4FFVA 1M7GA 3UKOA 3JVVA 3WE7A 3I3OA 5C31A 4WFKA 1WTAA 1IIRA 1H8ED 3M5DA 3OY2A 3W1EA 5AM5A 3IELA 4W5RA 5B30A 1E2QA 4IHJA 1FIUA 1MKYA 5CD1A 1AF4A 1PWEA 2QLTA 4C88A 4DEYA 2QAGC 4NJMB 4P5DA 3B6IA 4G4SP 2BKUA 3OUZA 4TRMA 1WXIA 2PT9A 3E7WA 4V0SA 2RGXA 2H1SA 4L8LA 4YDSA 4YRCA 2CE2X 5DO9A 4JYPA 2UV8A 1NFRA 5AIBA 4NV0A 1I0LA 1UKCA 2GHRA 5HCNA 4JLNA 2A30A 4FMBB 1H0RA 3TLJA 4DXDA 2MYPA 2CJWB 3AR3A 2EZTA 1XHLA 4OHUA 4XA8A 1YC5A 3DOOA 2UUBB 4GOJA 4LXGA 4MW0A 1PTJC 1C0IA 2HV8A 2FPGB 3V2IA 4KSYA 3PGJA 4JZYA 3FMIA 2XCSB 1NE7A 2NYUA 3OC6A 5A3QA 1E63A 1W48A 3KLBA 2UDPA 2PZ8A 1YR2A 1D03A 3QH4A 2WNSA 4NU5A 4WOCA 3FXAA 3OVMA 1KQGA 3ZVKA 2O2XA 2VJKA 2J9FA 4CT4B 3ADBA 1NMXA 3AF0A 3T3OA 1YOBA 1BX0A 2ETXA 3R7AA 4I81A 4B7UA 5BMVF 1UEJA 3KOUA 1U0FA 3I92A 2QLJA 4X5OA 5CA0A 2XKBA 2OLEA 5J3JA 2QNIA 3A06A 3Q40A 4BAGA 4TV9B 4ZPJA 3TLBA 5IH7A 2YVLA 1GT6A 4MZXA 5LWHA 4GKKB 1PJ2A 4BFLA 3I4FA 4E2ZA 2HA0A 3KEGA 1B6SA 5LA6F 4UBJA 5AHKA 3IC5A 4JOSA 1T24A 1M10A 3P2OA 4AYWA 4UEOA 1M1YE 2PR7A 5FQOA 1J9EA 1YQTA 1GR1A 2QVCA 3WO1A 2CDCA 5EL0A 1HG0A 1XZFA 2VDVE 4XM2A 3E35A 5K99A 1SN7A 2FXIA 1DJNA 3G7SA 3PNPA 3Q3VA 3ZYCA 3KZKA 2ZUEA 1GR0A 4OQMA 5CFRA 2XLBA 1YJXA 3BQMB 4GUDA 4TOIA 2HLDD 3BIJA 4P84A 1V37A 1SK9A 3BG5A 1O87A 3JWJA 4K9PA 1W5EA 4P92A 4LF8B 1H4TA 3VVCA 2QM7A 4MRAA 2GRJA 3TEMA 5BUZA 4RE5A 3FX2A 1H3EA 2Z56A 4HBZA 3ROKA 4LQLA 2GT1A 3CF4G 3FSRA 3EMDA 1I80A 4TX1A 4CL3A 2PAAA 3QA3E 5LXTA 1DAEA 1X94A 1OAAA 2NU6A 1U1IA 3PCXA 2CD9A 1O8CA 2XA9A 4MKRA 2VAPA 1QANA 3ZBPA 5KINB 5CK5A 1XU4A 2CHUA 4BL5A 1BEEA 3LA8A 1CRZA 3C1TA 2Q28A 1C5KA 4HHEA 3CVJA 4PRKA 4X90A 1I1NA 2VJOA 1FU4A 1YL5A 2QE7D 4X66B 1CR2A 1H2WA 3PU6A 3W2EA 3K1YA 1AQIA 3U19A 1JPUA 4AJ1A 3CH6A 2PLRA 1K7SN 1KAMA 4V0ME 3RAEC 4CIXA 3DM5A 2XTAA 5ALMA 1A88A 4BLSA 5K8VA 1FMTA 3Q87B 2DKFA 3O3MB 2TMGA 4DQXA 4MLZA 2Z6UA 4A16A 1ECGA 3QKIA 1NQVA 1SU6A 2R8RA 2XNKA 1JR3D 2YMQA 3EEFA 3FTCA 3HR7A 3NIGB 1GFSA 3PFIA 3QU2A 4KO1S 2DC1A 5KHAA 3DL4A 1M1UA 5LLTA 3W5CA 2Q50A 3FSEA 2R11A 1LC3A 4R0NA 4ZHQF 1T5OA 2XUHA 2YCLA 1KK1A 1NULA 1X8JA 2HUPA 3DL0A 4UBKA 4YUVA 5INTA 4BU0A 1ORWA 5D1NA 1JU4A 3F6EX 4QYTA 4MR9A 3HCCA 1JW9B 5BURA 4TT3D 3AM3A 4QEDA 1WUKS 1JALA 1O7JA 4Y30A 4JWKA 5LYYA 3ESYA 3Q72A 4TVBA 1W47A 2JIMA 3MD0A 1R18A 4WK2B 1ZGBA 3RSGA 3BJEA 3C6BA 4H1HA 4HTAA 1JIJA 2FWBA 1J06A 1WS6A 2QQGA 2P6NA 3KAQA 4J94A 4D6YA 4EZIA 2NO0A 1G7TA 3HP7A 3I23A 2DHCA 1M6HA 1YGYA 2XCLA 1R27A 2QX4A 1MJFA 2RGYA 4D0RA 1JPNA 1VHTA 4JOCA 1PLJA 2AR7A 3HU2A 2PYIA 5FA5A 1FBNA 1E1DA 2OFOA 3STWA 1BZYA 5EJEA 1GAJA 3E7DA 1GDTA 2XB9A 5KREA 1IEXA 1O89A 1DC6A 3DF7A 1OQAA 2VWHA 4MA5A 3DMHA 3MWLA 1IBSA 1E64A 4J2OA 2V65A 4D0LB 3NOQA 4DIEA 5LDHA 2I65A 1P80A 1JHXA 1I7QB 2JLZA 3IO5A 3ETLA 4AJIA 2I1VB 4GRAA 2Y1OA 5K45A 1N0IA 3BDIA 2CF5A 5E0OA 4F38A 3FJYA 3NG1A 3U1BA 1XMPA 3ZNOA 3IR7A 3U7QA 1I2DA 1SVIA 3LUCA 1D09A 2HKIA 4L6IA 2PLFA 4TKMA 1MLDA 2HCTA 4NNPA 4W1SA 4FC6A 3LLMA 4JENA 4KN5A 3UGQA 5AOAA 1AURA 1R4NA 2CLFB 5J63A 1PK8A 3H9BA 1YGPA 1ZD2P 2NUTA 3EQ7A 5FOUA 3K8OE 4I66A 4LG1A 4DPKA 2BPOA 4KXNA 3V8PA 4OHBA 3B52X 4MB6A 3ANMA 3EXFB 2OLKA 4NL4H 1RKBA 2AMFA 4MQ6A 1WF6A 3FOBA 3RTEA 4EGAA 1NFFA 3GD7A 3TR6A 5CCXA 1M1NB 2Q1UA 5JSFA 2RGNA 2I2DA 1GPLA 6ADHA 3HZOA 3VMFA 4OHKA 3UICA 3C14C 5E0KB 1DG3A 1ATIA 5KNBD 1J56A 3VR3A 1WDWB 1LVGA 5CTAA 1JWAB 2WJJA 2VJLA 3F97A 2WYHA 4X3OA 3SM9A 2IYXA 3A32A 4YAUA 5J47A 1ISRA 3LPAA 4MW9A 1N3LA 3IVXA 3VKGA 1W6UA 2Q6IA 2Z2JA 3PT9A 5KWJA 4DWOA 4QDTA 2YFHA 2PX0A 3DL2A 3JQ6A 3FROA 5EHGA 2G4VA 2JD0A 3N8NA 2VIIA 1FS6A 1XMVA 4RPGA 4ZARA 1CJTC 2A9VA 5FLXA 5JG7A 3RU3A 4C6SA 2QUAA 3B3JA 3OCVA 1VL1A 3P26A 4OQDA 1J9GA 1KDOA 1NX6A 4ZAWA 2P65A 3CGGA 3N39C 2VNKA 3LFTA 3ZWPA 2XXAA 2CVQA 1X1BA 1WUIS 1ORDA 1CP3A 3E48A 4NABA 4D9GA 3IPLA 2RH8A 1E69A 2UUPA 4HD8A 4NAHA 5IANA 1S6YA 5L6MB 4Y9UA 4V3CA 3ND8A 4JI3B 3R8FA 3RVQA 1CRLA 4EMTA 1LV7A 2HSZA 2ZTVA 2UKDA 4B5LA 2H8KA 3IOYA 2QR5A 1E8MA 1EXWA 3RS2A 4YXWD 1S0UA 4YAJA 4YROA 3KYCB 3C7TA 4K9KA 4ZCIA 4FFOA 4X6UA 3LUFA 1V35A 4FNAA 3BIFA 2C7GA 1MVLA 4Q4JB 5HKLA 1G3IA 2QPAA 1E61A 3CLKA 3C3AA 4NMHA 4KKXB 2ES4A 3OMXA 4CM5A 1ZISA 1L4GA 4XOIA 1EMDA 1PUXA 5FF9A 2GARA 1TLFA 3CEPB 3P9SA 1F38A 1Z7WA 4ZGGA 1M2WA 4DV3B 2Q5OA 3R0IA 1SOVA 1G4HA 2QROA 3O4IA 1DPFA 1L4YA 5CEEA 5JTTA 1DO2A 4S1OA 3L7JA 5EEHA 4MV1A 2Y92A 3IUNA 4EFMA 4G5XA 2XE7A 2W2TA 1L5HA 5ENDA 2GCOA 5D8DA 3HL0A 5HDQA 2XXJA 3T5MA 3WWPA 2N0SA 3TUJC 3JALA 4MWTA 2MSCB 3ROFA 4JODA 2XYGA 2BTEA 2B94A 4CMAA 5LQAA 5K8CA 2QA5A 1CVIA 4F45A 4MTLA 4OQ4A 1RZUA 1TZCA 3FPSA 3DDZX 4XVRA 1PF7E 2LGJA 3L77A 4Y0NA 4ERXA 5JJCA 3UWOA 1ZP6A 1A9SA 4YALA 2FGKA 2PH3A 4Z86A 1PLKA 3HHPA 1EX9A 3DV2A 4YP5A 4S2UA 3LO8A 2XMCA 4QO8A 5IH3A 2LIPA 2QSZA 4C0KA 2IJGX 4TQ9A 3RYHA 2NMVA 2H8GA 4RESA 3VSEA 3B5JA 2I99A 4URUR 2V7TA 3Q9NA 3GDGA 3BL5A 3DQQA 5P21A 3M6XA 2EDAA 2BAGA 3EY4A 2MSLA 3L7MA 3R1IA 4Q3KA 4R7ZA 1U1CA 4EP1A 3U3JA 3R3ZA 4GECA 2BHSA 1SURA 3HBAA 1W87A 3LRTA 3L6DA 1XCPA 5IVPA 2YMLA 4DEVA 1MW8X 3B3AA 1WY5A 1WQ4A 3I8XA 4WZAB 1I2BA 1XXLA 4U5XA 2Q2VA 2XB4A 1QR2A 4BEWA 2QDXA 4IZHA 4HI0E 2O2YA 4YVFA 1NI4B 2OGSA 4FX2A 4B4UA 3AEZA 2XRMA 5GONA 3UJ3X 3BMCA 3AY6A 4DCPA 4IH1A 2WY2D 3PICA 5FBKA 1F3LA 3ROXA 1E9FA 3EVBA 1GKYA 2PGIA 3T7EA 4ODIA 3T3GA 2HJSA 4Y2SA 3ZWNA 4FEGA 3R8CA 3B1KA 2QOEA 2YOHA 4TYMA 2NU6B 1ZHHA 2IYQA 2OCIA 3G13A 4B6JA 2QVYX 1WD7A 1YHYA 2ODWA 2Q8PA 4F06A 1DWOA 2LDBA 3TQFA 1CUAA 4CTKA 2Q4DA 2F43B 2VWPA 4TT8A 3UV6A 5JFOA 2Q8QA 3WSTA 5JI3E 1J5PA 3HL4A 1QGED 3AEYA 1SELA 2PBZA 3DE3X 3DMRA 3SN6A 2WSLA 3UUGA 1T9HA 3W4IA 1MJGA 1XTKA 1JHYA 2FZVA 1B14A 1WPRA 3HCOA 2HHLA 4KAJA 4BZQA 4J0EA 1YVEI 4B2PA 4C03A 3KHTA 4D3FA 4YMLA 3RKSA 4YCDA 1FFGA 2WAYA 2OBLA 3DP9A 3IT1A 5EWLA 1OLUA 2EWVA 2G67A 2JDIA 4QPZA 1B93A 3LA6A 4G1MB 1ZM4A 4C6TA 4KQ9A 4BNJA 3ZWQA 4E46A 4CCYB 3OZVA 1L7NA 1ZEJA 3OPQA 5IX8A 1NXSA 4P82A 4K8OA 4JELA 3KL2A 1SOUA 2PGOA 1FNDA 2BFNA 3MUEA 1SBCA 3R8XA 1YRHA 2FPMA 3HTXA 1YB5A 3C3WA 3G59A 2H3EA 4TV9A 3W9BA 5AW8A 1K0UA 1UBGA 4LA4A 1YFKA 2BLLA 4O0MA 5F78A 3P9QA 3KQLA 1N25A 1QHGA 1ECFA 1OILA 3GX1A 1AJEA 3HP4A 2RGAA 1QTNA 1E7MA 3E3NA 5K8IA 2J46A 4M49A 2CT8A 2EG5A 4GI2A 1YDHA 5E6UB 1A5TA 1V47A 2L18A 3G1UA 3KKMA 3OZEA 4YBRA 3VSDA 5CLJA 5KSYA 4YHHB 2PUEA 4P4SA 2YWDA 2GNPA 5DISB 3VPDA 4RTMA 3AI2A 1NBEA 4PLFA 4DV6B 1LDEA 3GU3A 2O7RA 3NBYC 3PPWA 3FPAA 3FDZA 1X7GA 1YJCA 4G07A 5KNBH 3QJGA 5A4JA 4AY3A 1K92A 5MHTA 5JD5A 1TQ8A 3AJ8A 5TQ2B 2K87A 3FVVA 4MAFA 3T34A 1JFVA 4EA7A 2IYSA 2ZZNA 3TVTA 3IJRA 5CGQB 4RIFA 3W77A 3TBHA 3GLSA 1X92A 5FBVB 4KPYA 1TJ4A 4Y2JA 1WXEA 3ROEA 5FFNA 1T6YA 1X7WB 3V1KA 3S81A 3LUJA 5JSQA 3I42A 2W22A 2XZOA 3VC1A 2BHRA 5A3RA 3ASVA 2XTNA 1I32A 4U6SA 2QZJA 4NJMA 4C4OA 5IAKA 1XTZA 2YHSA 1L9XA 2Z9DA 4HK4A 1T3LA 4JKOA 3T6KA 5E3IA 4KXUA 4AZVA 3T35A 3WK6A 4IHJB 2QGZA 2VDKB 3P2IA 2ZCJA 5E9QA 4PYNA 4RKWA 5JS7A 1FFXA 3LBYA 3AUTA 5DNDA 4DSUA 1MOPA 4ROSA 1T3TA 5HIMA 2BP7A 3I9MA 2WA1A 1NZDA 2RH5A 4G24A 4RF3A 3AQIA 5AVVA 1QP7A 2ZJAA 2FQ1A 4ZI7A 2AOUB 2IKQA 1R6TA 4KBFA 4XI9A 3KYIB 3BD9A 4I6JA 3BCHA 3Q98A 4KQJA 2GO7A 2SECE 4DSZA 4MJ7A 2R6R1 3NHUA 1UKBA 1Y9EA 2W2OA 3HWSA 3CE9A 3E23A 3O83A 2IYLD 1ZC3A 2GXUA 1FC0A 1WCXA 1YZNA 2DY0A 2MTBA 3GEBA 2CFOA 5A05A 5L3ZA 2XA1A 4OGWA 1NKTA 4F6RB 3A27A 4Y7DA 4INJA 3RRXA 3ONFA 2DPGA 5REQB 1N92A 1MV5A 2C3MA 1H23A 2IGBA 5IKOA 4QKQA 3K92A 2G17A 3OF2A 2Z43A 4FJ2A 4HXEB 4BJ6A 4ZZ0A 4KGZA 2NTJA 1BW9B 4KHZA 4F9FA 1E9BA 1C8LA 3O7WA 1GUYA 4YO7A 2VHVA 4NH4A 3LECA 3N7UA 4UZEA 5KWIA 3DJFA 3P2MA 4OQNA 4Q6BA 1L5GB 4EO4A 1JB9A 1N0UA 1ZL0A 1YK1A 2GPSA 3U80A 3WLRA 5FAXA 3ZWAA 4DRYA 1Q6YA 3CUUA 3TL3A 1SKAA 3FSGD 4RQAA 5IAJA 3TLZA 4WY2A 1SUPA 4KWEA 2QMUA 2PZGA 1PEAA 2ONKA 3E3OA 1NM5C 3LBFA 1UK7A 4NJEB 3Q8MA 3RTDA 5HTKA 1E0JA 1QQ6A 4IJVA 4R7TA 5DYWA 3BH7A 2O48X 3TRFA 1L7QA 2VK8A 4HN9A 4JP8A 3D0QA 2PLNA 4N0EA 4M98A 1MQ8B 2X3FA 3PHLA 1JT2A 1J99A 2ID4A 2J4FA 5L53A 3JAMA 2CJXA 5F64A 2G6TA 3WMWA 5BOVA 1XNGA 1RC1A 4BCBA 4TV8A 4F97A 4Q4HB 3S28A 3GRPA 2JGNA 1U2EA 4NYJR 2A9JA 3WYAA 1OIVA 2JD2A 2B92A 1XIVA 4L76A 2XSZA 4RMJA 3BQ9A 1Y8CA 1ODLA 2Q49A 5F4ZA 4DJEC 2HHJA 3KUKA 1T36A 8LDHA 1QH8B 2FDRA 5GGYA 521PA 4LXHA 4B85A 1CBUA 5E6UA 4HDSA 4BVBA 1CETA 1EK0A 5JHGB 4E7OA 5CM2Z 3VSAA 3W6ZA 4JMLA <