4RYFA

Clpp1/2 heterocomplex from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
b'ITNILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVQGQSTEIEIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title ClpP12 heterocomplex from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4ryfA00
3KTIA 2EJ5A 2ZQQA 5INGA 1YG8A 5DZKA 5DZKH 3T3WA 3ISAA 3I47A 4JCQA 5C9GA 1XO6A 1EY3A 4EMMA 3FDUA 1W2XA 4U0GA 2W3PA 2VX2A 2DUBA 4IZDA 3Q0GA 4FZWC 3PE8A 3QXZA 1FC9A 4IZBA 2PBPA 1N6DA 4FNBA 1Q52A 3SLLA 4MI2A 1SG4A 3RSTA 3QXIA 3GMAA 4B3JA 4NEKA 3OC7A 5DKPA 3JU1A 4I4ZA 4OG1A 4WYOB 1EF9A 4FN8A 3P2LA 4JCTA 1JXZA 2X58A 2IEXA 3NJDA 4EMLA 1XNYA 4YLHA 4ZU2A 5KDRB 3K8XA 3IAVA 2ZL2A 3HINA 2QQ3A 3N6RB 3PZKA 4JCRA 3PEAA 3KQFA 3T8AA 3ZWBA 4GM2A 4RYFH 3TDCA 1NZYB 3KTJA 5IKLB 5G1QA 1TG6A 3WG5A 5DTWA 4I52A 4IZCA 4KPKA 3DJAA 1FC6A 5DUFA 2J5IB 2VREA 3ZWAA 4DI1A 2J5GD 4FNDA 1O8UA 3MFMA 3U9RB 3IB9A 4L6WA 5DL1A 3P85A 1N6EA 3TT6A 4FJWD 2PG8A 2Q2XA 1EF8A 1UYTA 4OMRA 4ELXA 2PPYA 4KWBA 3MYBA 2F6QA 2F9YA 3T88A 3QKAA 5DTPA 3ZW9A 5INFA 1K39A 2F9IB 4ELSA 2BZRA 4EMPA 1OD2A 4U19A 3TRRA 4U0GH 2J5II 5CTBA 4GHNA 3NJBA 5INIA 3KTHA 3BF0A 1YG6A 5DU8A 4HNKA 1DUBA 3RRVA 3R9SA 5MGBA 2J5GA 5FIFA 4K3WA 2VSUC 3PGQA 4LK5A 3QK8A 4Z0MA 3TVUA 3R0OA 3TT7A 2FBMA 2FW2A 2ZQRA 2VSSA 4WCZA 1XX4A 4MXIA 1TYFA 1OD4A 3H0JA 1FC7A 3TZ3A 4QIIA 1X0UA 3GF3A 4RCNA 1RJNA 2J5IA 5DU4A 2CE3A 3TVWA 3BEZA 1UYSA 3QWDA 3TLFA 3RSIA 4NNQA 5DUCA 3Q7HA 4FZWA 4JWVA 3R9TA 3M6MA 1HNUA 4ZDDA 4U0HA 5G1SA 1XNWA 3ZWCA 4JFCA 2NP9A 3IBBA 3T89A 4U18A 4ELWA 2VSUA 5G1RA 1PIXA 3TV5A 3Q0JA 5E0NX 1DCIA 4JCSA 3H0QA 1N6FA 4I42A 3V5EA 2GTRA 4B3IA 4ZDFA 4G2RA 1UYRA 5CTCA 4FB8A 4MOUA 3HE2A 2X24A 3OMEA 4QIJA 4K2NA 4K29A 2A81A 4ZDCA 1J7XA 3U9SB 2J5SA 3H0SA 1HZDA 3KTKA 2VSSE 4QFEA 1Y7OA 4Q0GA 3ST9A 1ON9A 1PJHA 3GLMA 2ZL0A 3Q1TA 3T8BA 2Q34A 2FZSA 1RJMA 2F9YB 5DU6A 2A7KA 3HLN1 3QYRA 4WZ8B 3G64A 4B3HA 1UIYA 4U1AA 5KDRA 3KTGA 1SZOA 3GF7A 3L3SA 5KJPA 3K50A 1XNVA 4Q1IA 3M6NA 1NZYA 4L8KA 1HNOA 3R9QA 4ZDBA 2DEOA 4JYLA 3H02A 3QREA 1VRGA 4ASIA 3MT6A 3P5MA 4OLQA 2Q35A 4JYJA 3FF6A 1UYVA 3LAOA 2VSUE 2D3TA 4HC8A 3H81A 4JJTA 3V5IA 1ON3A 1FCFA 3DORA 1MJ3A 2HW5A 2VSSF 3HP0A 3U9TB 4RYFA 4FN7A 5C90A 1WDKA 2WTBA 3OT6A 3H0UA 1WZ8A 1K32A 1WDLA 3GKBA 2C8TA 5E0SA 5E0SH 5JBXA 5FUSA 4F47A 2F9IA 3BPPA 2F6IA 4JVTA 4JSBA 4KNPA 4JOTA 3R6HA 1Q51A 3STAA 2CBYA 3LKEA 2ZL4A 3MOYA 3SWXA 2ZL3A 3HRXA 3QMJA 4ZDEA 3ZW8A 2A7SA 5JBWA 4KD6A 1WDMA 2UZFA 2VSUF 3VIVA
chains in the Genus database with same CATH superfamily
3KTIA 2EJ5A 2ZQQA 5INGA 1YG8A 5DZKA 5DZKH 3T3WA 3ISAA 3I47A 4JCQA 5C9GA 1XO6A 1EY3A 4EMMA 3FDUA 1W2XA 4U0GA 2W3PA 2VX2A 2DUBA 4IZDA 3Q0GA 4FZWC 3PE8A 3QXZA 1FC9A 4IZBA 2PBPA 1N6DA 4FNBA 1Q52A 3SLLA 4MI2A 1SG4A 3RSTA 3QXIA 3GMAA 4B3JA 4NEKA 3OC7A 5DKPA 3JU1A 4I4ZA 4OG1A 4WYOB 1EF9A 4FN8A 3P2LA 4JCTA 1JXZA 2X58A 2IEXA 3NJDA 4EMLA 1XNYA 4YLHA 4ZU2A 5KDRB 3K8XA 3IAVA 2ZL2A 3HINA 2QQ3A 3N6RB 3PZKA 4JCRA 3PEAA 3KQFA 3T8AA 3ZWBA 4GM2A 4RYFH 3TDCA 1NZYB 3KTJA 5IKLB 5G1QA 5HUQA 1TG6A 3WG5A 5DTWA 4I52A 4IZCA 4KPKA 3DJAA 1FC6A 5DUFA 2J5IB 2VREA 3ZWAA 4DI1A 2J5GD 4FNDA 1O8UA 3MFMA 3U9RB 3IB9A 4L6WA 5DL1A 3P85A 1N6EA 3TT6A 4FJWD 2PG8A 2Q2XA 1EF8A 1UYTA 4OMRA 4ELXA 2PPYA 4KWBA 3MYBA 2F6QA 2F9YA 3T88A 3QKAA 5DTPA 3ZW9A 5INFA 1K39A 2F9IB 4ELSA 2BZRA 4EMPA 1OD2A 4U19A 3TRRA 4U0GH 2J5II 5CTBA 4GHNA 3NJBA 5INIA 3KTHA 3BF0A 1YG6A 5DU8A 4HNKA 1DUBA 3RRVA 3R9SA 5MGBA 2J5GA 5FIFA 4K3WA 2VSUC 3PGQA 4LK5A 3QK8A 4Z0MA 3TVUA 3R0OA 3TT7A 2FBMA 2FW2A 2ZQRA 2VSSA 4WCZA 1XX4A 4MXIA 1TYFA 4NARA 1OD4A 3H0JA 4HDTA 1FC7A 3TZ3A 4QIIA 1X0UA 3GF3A 4RCNA 1RJNA 2J5IA 5DU4A 2CE3A 3TVWA 3BEZA 1UYSA 3QWDA 3TLFA 4J2UA 3RSIA 4NNQA 5DUCA 3Q7HA 4FZWA 4JWVA 3R9TA 3M6MA 1HNUA 4ZDDA 4U0HA 5G1SA 1XNWA 3ZWCA 4JFCA 2NP9A 3IBBA 3T89A 4U18A 4ELWA 2VSUA 5G1RA 1PIXA 3TV5A 3Q0JA 5E0NX 1DCIA 4JCSA 3H0QA 1N6FA 4I42A 3V5EA 2GTRA 4B3IA 4ZDFA 4G2RA 1UYRA 5CTCA 4FB8A 4MOUA 3HE2A 2X24A 3OMEA 4QIJA 4K2NA 4K29A 2A81A 4ZDCA 1J7XA 3U9SB 2J5SA 3H0SA 1HZDA 3KTKA 2VSSE 4QFEA 1Y7OA 4Q0GA 3ST9A 1ON9A 1PJHA 3GLMA 2ZL0A 3Q1TA 3T8BA 2Q34A 2FZSA 1RJMA 2F9YB 5DU6A 2A7KA 3HLN1 3QYRA 4WZ8B 3G64A 4B3HA 1UIYA 4U1AA 5KDRA 3KTGA 1SZOA 3GF7A 3L3SA 5KJPA 3K50A 1XNVA 4Q1IA 3M6NA 1NZYA 4L8KA 1HNOA 3R9QA 4ZDBA 2DEOA 4JYLA 3H02A 3QREA 1VRGA 4ASIA 3MT6A 3P5MA 4OLQA 2Q35A 4JYJA 3FF6A 1UYVA 3LAOA 2VSUE 2D3TA 4HC8A 3H81A 4JJTA 3V5IA 1ON3A 1FCFA 3DORA 1MJ3A 2HW5A 2VSSF 3HP0A 3U9TB 4RYFA 4FN7A 5C90A 1WDKA 2WTBA 3OT6A 3H0UA 1WZ8A 1K32A 1WDLA 3BPTA 3GKBA 2C8TA 5E0SA 5E0SH 5JBXA 5FUSA 2YJGA 4F47A 2F9IA 3BPPA 2F6IA 4JVTA 4JSBA 4KNPA 4JOTA 3R6HA 1Q51A 3STAA 2CBYA 3LKEA 2ZL4A 3MOYA 3SWXA 2ZL3A 3HRXA 3QMJA 4ZDEA 3ZW8A 2A7SA 5JBWA 4KD6A 1WDMA 2UZFA 2VSUF 3VIVA
chains in the Genus database with same CATH topology
3KTIA 2EJ5A 2ZQQA 5INGA 1YG8A 5DZKA 5DZKH 3T3WA 3ISAA 3I47A 4JCQA 5C9GA 1XO6A 1EY3A 4EMMA 3FDUA 1W2XA 4U0GA 2W3PA 2VX2A 2DUBA 4IZDA 3Q0GA 4FZWC 3PE8A 3QXZA 1FC9A 4IZBA 2PBPA 1N6DA 4FNBA 1Q52A 3SLLA 4MI2A 1SG4A 3RSTA 3QXIA 3GMAA 4B3JA 4NEKA 3OC7A 5DKPA 3JU1A 4I4ZA 4OG1A 4WYOB 1EF9A 4FN8A 3P2LA 4JCTA 1JXZA 2X58A 2IEXA 3NJDA 4EMLA 1XNYA 4YLHA 4ZU2A 5KDRB 3K8XA 3IAVA 2ZL2A 3HINA 2QQ3A 3N6RB 3PZKA 4JCRA 3PEAA 3KQFA 3T8AA 3ZWBA 4GM2A 4RYFH 3TDCA 1NZYB 3KTJA 5IKLB 5G1QA 5HUQA 1TG6A 3WG5A 5DTWA 4I52A 4IZCA 4KPKA 3DJAA 1FC6A 5DUFA 2J5IB 2VREA 3ZWAA 4DI1A 2J5GD 4FNDA 1O8UA 3MFMA 3U9RB 3IB9A 4L6WA 5DL1A 3P85A 1N6EA 3TT6A 4FJWD 2PG8A 2Q2XA 1EF8A 1UYTA 4OMRA 4ELXA 2PPYA 4KWBA 3MYBA 2F6QA 2F9YA 3T88A 3QKAA 5DTPA 3ZW9A 5INFA 1K39A 2F9IB 4ELSA 2BZRA 4EMPA 1OD2A 4U19A 3TRRA 4U0GH 2J5II 5CTBA 4GHNA 3NJBA 5INIA 3KTHA 3BF0A 1YG6A 5DU8A 4HNKA 1DUBA 3RRVA 3R9SA 5MGBA 2J5GA 5FIFA 4K3WA 2VSUC 3PGQA 4LK5A 3QK8A 4Z0MA 3TVUA 3R0OA 3TT7A 2FBMA 2FW2A 2ZQRA 2VSSA 4WCZA 1XX4A 4MXIA 1TYFA 4NARA 1OD4A 3H0JA 4HDTA 1FC7A 3TZ3A 4QIIA 1X0UA 3GF3A 4RCNA 1RJNA 2J5IA 5DU4A 2CE3A 3TVWA 3BEZA 1UYSA 3QWDA 3TLFA 4J2UA 3RSIA 4NNQA 5DUCA 3Q7HA 4FZWA 4JWVA 3R9TA 3M6MA 1HNUA 4ZDDA 4U0HA 5G1SA 1XNWA 3ZWCA 4JFCA 2NP9A 3IBBA 3T89A 4U18A 4ELWA 2VSUA 5G1RA 1PIXA 3TV5A 3Q0JA 5E0NX 1DCIA 4JCSA 3H0QA 1N6FA 4I42A 3V5EA 2GTRA 4B3IA 4ZDFA 4G2RA 1UYRA 5CTCA 4FB8A 4MOUA 3HE2A 2X24A 3OMEA 4QIJA 4K2NA 4K29A 2A81A 4ZDCA 1J7XA 3U9SB 2J5SA 3H0SA 1HZDA 3KTKA 2VSSE 4QFEA 1Y7OA 4Q0GA 3ST9A 1ON9A 1PJHA 3GLMA 2ZL0A 3Q1TA 3T8BA 2Q34A 2FZSA 1RJMA 2F9YB 5DU6A 2A7KA 3HLN1 3QYRA 4WZ8B 3G64A 4B3HA 1UIYA 4U1AA 5KDRA 3KTGA 1SZOA 3GF7A 3L3SA 5KJPA 3K50A 1XNVA 4Q1IA 3M6NA 1NZYA 4L8KA 1HNOA 3R9QA 4ZDBA 2DEOA 4JYLA 3H02A 3QREA 1VRGA 4ASIA 3MT6A 3P5MA 4OLQA 2Q35A 4JYJA 3FF6A 1UYVA 3LAOA 2VSUE 2D3TA 4HC8A 3H81A 4JJTA 3V5IA 1ON3A 1FCFA 3DORA 1MJ3A 2HW5A 2VSSF 3HP0A 3U9TB 4RYFA 4FN7A 5C90A 1WDKA 2WTBA 3OT6A 3H0UA 1WZ8A 1K32A 1WDLA 3BPTA 3GKBA 2C8TA 5E0SA 5E0SH 5JBXA 5FUSA 2YJGA 4F47A 2F9IA 3BPPA 2F6IA 4JVTA 4JSBA 4KNPA 4JOTA 3R6HA 1Q51A 3STAA 2CBYA 3LKEA 2ZL4A 3MOYA 3SWXA 2ZL3A 3HRXA 3QMJA 4ZDEA 3ZW8A 2A7SA 5JBWA 4KD6A 1WDMA 2UZFA 2VSUF 3VIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTI A;  2EJ5 A;  2ZQQ A;  5ING A;  1YG8 A;  5DZK A;  5DZK H;  3T3W A;  3ISA A;  3I47 A;  4JCQ A;  5C9G A;  1XO6 A;  1EY3 A;  4EMM A;  3FDU A;  1W2X A;  4U0G A;  2W3P A;  2VX2 A;  2DUB A;  4IZD A;  3Q0G A;  4FZW C;  3PE8 A;  3QXZ A;  1FC9 A;  4IZB A;  2PBP A;  1N6D A;  4FNB A;  1Q52 A;  3SLL A;  4MI2 A;  1SG4 A;  3RST A;  3QXI A;  3GMA A;  4B3J A;  4NEK A;  3OC7 A;  5DKP A;  3JU1 A;  4I4Z A;  4OG1 A;  4WYO B;  1EF9 A;  4FN8 A;  3P2L A;  4JCT A;  1JXZ A;  2X58 A;  2IEX A;  3NJD A;  4EML A;  1XNY A;  4YLH A;  4ZU2 A;  5KDR B;  3K8X A;  3IAV A;  2ZL2 A;  3HIN A;  2QQ3 A;  3N6R B;  3PZK A;  4JCR A;  3PEA A;  3KQF A;  3T8A A;  3ZWB A;  4GM2 A;  4RYF H;  3TDC A;  1NZY B;  3KTJ A;  5IKL B;  5G1Q A;  1TG6 A;  3WG5 A;  5DTW A;  4I52 A;  4IZC A;  4KPK A;  3DJA A;  1FC6 A;  5DUF A;  2J5I B;  2VRE A;  3ZWA A;  4DI1 A;  2J5G D;  4FND A;  1O8U A;  3MFM A;  3U9R B;  3IB9 A;  4L6W A;  5DL1 A;  3P85 A;  1N6E A;  3TT6 A;  4FJW D;  2PG8 A;  2Q2X A;  1EF8 A;  1UYT A;  4OMR A;  4ELX A;  2PPY A;  4KWB A;  3MYB A;  2F6Q A;  2F9Y A;  3T88 A;  3QKA A;  5DTP A;  3ZW9 A;  5INF A;  1K39 A;  2F9I B;  4ELS A;  2BZR A;  4EMP A;  1OD2 A;  4U19 A;  3TRR A;  4U0G H;  2J5I I;  5CTB A;  4GHN A;  3NJB A;  5INI A;  3KTH A;  3BF0 A;  1YG6 A;  5DU8 A;  4HNK A;  1DUB A;  3RRV A;  3R9S A;  5MGB A;  2J5G A;  5FIF A;  4K3W A;  2VSU C;  3PGQ A;  4LK5 A;  3QK8 A;  4Z0M A;  3TVU A;  3R0O A;  3TT7 A;  2FBM A;  2FW2 A;  2ZQR A;  2VSS A;  4WCZ A;  1XX4 A;  4MXI A;  1TYF A;  1OD4 A;  3H0J A;  1FC7 A;  3TZ3 A;  4QII A;  1X0U A;  3GF3 A;  4RCN A;  1RJN A;  2J5I A;  5DU4 A;  2CE3 A;  3TVW A;  3BEZ A;  1UYS A;  3QWD A;  3TLF A;  3RSI A;  4NNQ A;  5DUC A;  3Q7H A;  4FZW A;  4JWV A;  3R9T A;  3M6M A;  1HNU A;  4ZDD A;  4U0H A;  5G1S A;  1XNW A;  3ZWC A;  4JFC A;  2NP9 A;  3IBB A;  3T89 A;  4U18 A;  4ELW A;  2VSU A;  5G1R A;  1PIX A;  3TV5 A;  3Q0J A;  5E0N X;  1DCI A;  4JCS A;  3H0Q A;  1N6F A;  4I42 A;  3V5E A;  2GTR A;  4B3I A;  4ZDF A;  4G2R A;  1UYR A;  5CTC A;  4FB8 A;  4MOU A;  3HE2 A;  2X24 A;  3OME A;  4QIJ A;  4K2N A;  4K29 A;  2A81 A;  4ZDC A;  1J7X A;  3U9S B;  2J5S A;  3H0S A;  1HZD A;  3KTK A;  2VSS E;  4QFE A;  1Y7O A;  4Q0G A;  3ST9 A;  1ON9 A;  1PJH A;  3GLM A;  2ZL0 A;  3Q1T A;  3T8B A;  2Q34 A;  2FZS A;  1RJM A;  2F9Y B;  5DU6 A;  2A7K A;  3HLN 1;  3QYR A;  4WZ8 B;  3G64 A;  4B3H A;  1UIY A;  4U1A A;  5KDR A;  3KTG A;  1SZO A;  3GF7 A;  3L3S A;  5KJP A;  3K50 A;  1XNV A;  4Q1I A;  3M6N A;  1NZY A;  4L8K A;  1HNO A;  3R9Q A;  4ZDB A;  2DEO A;  4JYL A;  3H02 A;  3QRE A;  1VRG A;  4ASI A;  3MT6 A;  3P5M A;  4OLQ A;  2Q35 A;  4JYJ A;  3FF6 A;  1UYV A;  3LAO A;  2VSU E;  2D3T A;  4HC8 A;  3H81 A;  4JJT A;  3V5I A;  1ON3 A;  1FCF A;  3DOR A;  1MJ3 A;  2HW5 A;  2VSS F;  3HP0 A;  3U9T B;  4RYF A;  4FN7 A;  5C90 A;  1WDK A;  2WTB A;  3OT6 A;  3H0U A;  1WZ8 A;  1K32 A;  1WDL A;  3GKB A;  2C8T A;  5E0S A;  5E0S H;  5JBX A;  5FUS A;  4F47 A;  2F9I A;  3BPP A;  2F6I A;  4JVT A;  4JSB A;  4KNP A;  4JOT A;  3R6H A;  1Q51 A;  3STA A;  2CBY A;  3LKE A;  2ZL4 A;  3MOY A;  3SWX A;  2ZL3 A;  3HRX A;  3QMJ A;  4ZDE A;  3ZW8 A;  2A7S A;  5JBW A;  4KD6 A;  1WDM A;  2UZF A;  2VSU F;  3VIV A; 
#chains in the Genus database with same CATH topology
 3KTI A;  2EJ5 A;  2ZQQ A;  5ING A;  1YG8 A;  5DZK A;  5DZK H;  3T3W A;  3ISA A;  3I47 A;  4JCQ A;  5C9G A;  1XO6 A;  1EY3 A;  4EMM A;  3FDU A;  1W2X A;  4U0G A;  2W3P A;  2VX2 A;  2DUB A;  4IZD A;  3Q0G A;  4FZW C;  3PE8 A;  3QXZ A;  1FC9 A;  4IZB A;  2PBP A;  1N6D A;  4FNB A;  1Q52 A;  3SLL A;  4MI2 A;  1SG4 A;  3RST A;  3QXI A;  3GMA A;  4B3J A;  4NEK A;  3OC7 A;  5DKP A;  3JU1 A;  4I4Z A;  4OG1 A;  4WYO B;  1EF9 A;  4FN8 A;  3P2L A;  4JCT A;  1JXZ A;  2X58 A;  2IEX A;  3NJD A;  4EML A;  1XNY A;  4YLH A;  4ZU2 A;  5KDR B;  3K8X A;  3IAV A;  2ZL2 A;  3HIN A;  2QQ3 A;  3N6R B;  3PZK A;  4JCR A;  3PEA A;  3KQF A;  3T8A A;  3ZWB A;  4GM2 A;  4RYF H;  3TDC A;  1NZY B;  3KTJ A;  5IKL B;  5G1Q A;  5HUQ A;  1TG6 A;  3WG5 A;  5DTW A;  4I52 A;  4IZC A;  4KPK A;  3DJA A;  1FC6 A;  5DUF A;  2J5I B;  2VRE A;  3ZWA A;  4DI1 A;  2J5G D;  4FND A;  1O8U A;  3MFM A;  3U9R B;  3IB9 A;  4L6W A;  5DL1 A;  3P85 A;  1N6E A;  3TT6 A;  4FJW D;  2PG8 A;  2Q2X A;  1EF8 A;  1UYT A;  4OMR A;  4ELX A;  2PPY A;  4KWB A;  3MYB A;  2F6Q A;  2F9Y A;  3T88 A;  3QKA A;  5DTP A;  3ZW9 A;  5INF A;  1K39 A;  2F9I B;  4ELS A;  2BZR A;  4EMP A;  1OD2 A;  4U19 A;  3TRR A;  4U0G H;  2J5I I;  5CTB A;  4GHN A;  3NJB A;  5INI A;  3KTH A;  3BF0 A;  1YG6 A;  5DU8 A;  4HNK A;  1DUB A;  3RRV A;  3R9S A;  5MGB A;  2J5G A;  5FIF A;  4K3W A;  2VSU C;  3PGQ A;  4LK5 A;  3QK8 A;  4Z0M A;  3TVU A;  3R0O A;  3TT7 A;  2FBM A;  2FW2 A;  2ZQR A;  2VSS A;  4WCZ A;  1XX4 A;  4MXI A;  1TYF A;  4NAR A;  1OD4 A;  3H0J A;  4HDT A;  1FC7 A;  3TZ3 A;  4QII A;  1X0U A;  3GF3 A;  4RCN A;  1RJN A;  2J5I A;  5DU4 A;  2CE3 A;  3TVW A;  3BEZ A;  1UYS A;  3QWD A;  3TLF A;  4J2U A;  3RSI A;  4NNQ A;  5DUC A;  3Q7H A;  4FZW A;  4JWV A;  3R9T A;  3M6M A;  1HNU A;  4ZDD A;  4U0H A;  5G1S A;  1XNW A;  3ZWC A;  4JFC A;  2NP9 A;  3IBB A;  3T89 A;  4U18 A;  4ELW A;  2VSU A;  5G1R A;  1PIX A;  3TV5 A;  3Q0J A;  5E0N X;  1DCI A;  4JCS A;  3H0Q A;  1N6F A;  4I42 A;  3V5E A;  2GTR A;  4B3I A;  4ZDF A;  4G2R A;  1UYR A;  5CTC A;  4FB8 A;  4MOU A;  3HE2 A;  2X24 A;  3OME A;  4QIJ A;  4K2N A;  4K29 A;  2A81 A;  4ZDC A;  1J7X A;  3U9S B;  2J5S A;  3H0S A;  1HZD A;  3KTK A;  2VSS E;  4QFE A;  1Y7O A;  4Q0G A;  3ST9 A;  1ON9 A;  1PJH A;  3GLM A;  2ZL0 A;  3Q1T A;  3T8B A;  2Q34 A;  2FZS A;  1RJM A;  2F9Y B;  5DU6 A;  2A7K A;  3HLN 1;  3QYR A;  4WZ8 B;  3G64 A;  4B3H A;  1UIY A;  4U1A A;  5KDR A;  3KTG A;  1SZO A;  3GF7 A;  3L3S A;  5KJP A;  3K50 A;  1XNV A;  4Q1I A;  3M6N A;  1NZY A;  4L8K A;  1HNO A;  3R9Q A;  4ZDB A;  2DEO A;  4JYL A;  3H02 A;  3QRE A;  1VRG A;  4ASI A;  3MT6 A;  3P5M A;  4OLQ A;  2Q35 A;  4JYJ A;  3FF6 A;  1UYV A;  3LAO A;  2VSU E;  2D3T A;  4HC8 A;  3H81 A;  4JJT A;  3V5I A;  1ON3 A;  1FCF A;  3DOR A;  1MJ3 A;  2HW5 A;  2VSS F;  3HP0 A;  3U9T B;  4RYF A;  4FN7 A;  5C90 A;  1WDK A;  2WTB A;  3OT6 A;  3H0U A;  1WZ8 A;  1K32 A;  1WDL A;  3BPT A;  3GKB A;  2C8T A;  5E0S A;  5E0S H;  5JBX A;  5FUS A;  2YJG A;  4F47 A;  2F9I A;  3BPP A;  2F6I A;  4JVT A;  4JSB A;  4KNP A;  4JOT A;  3R6H A;  1Q51 A;  3STA A;  2CBY A;  3LKE A;  2ZL4 A;  3MOY A;  3SWX A;  2ZL3 A;  3HRX A;  3QMJ A;  4ZDE A;  3ZW8 A;  2A7S A;  5JBW A;  4KD6 A;  1WDM A;  2UZF A;  2VSU F;  3VIV A; 
#chains in the Genus database with same CATH homology
 3KTI A;  2EJ5 A;  2ZQQ A;  5ING A;  1YG8 A;  5DZK A;  5DZK H;  3T3W A;  3ISA A;  3I47 A;  4JCQ A;  5C9G A;  1XO6 A;  1EY3 A;  4EMM A;  3FDU A;  1W2X A;  4U0G A;  2W3P A;  2VX2 A;  2DUB A;  4IZD A;  3Q0G A;  4FZW C;  3PE8 A;  3QXZ A;  1FC9 A;  4IZB A;  2PBP A;  1N6D A;  4FNB A;  1Q52 A;  3SLL A;  4MI2 A;  1SG4 A;  3RST A;  3QXI A;  3GMA A;  4B3J A;  4NEK A;  3OC7 A;  5DKP A;  3JU1 A;  4I4Z A;  4OG1 A;  4WYO B;  1EF9 A;  4FN8 A;  3P2L A;  4JCT A;  1JXZ A;  2X58 A;  2IEX A;  3NJD A;  4EML A;  1XNY A;  4YLH A;  4ZU2 A;  5KDR B;  3K8X A;  3IAV A;  2ZL2 A;  3HIN A;  2QQ3 A;  3N6R B;  3PZK A;  4JCR A;  3PEA A;  3KQF A;  3T8A A;  3ZWB A;  4GM2 A;  4RYF H;  3TDC A;  1NZY B;  3KTJ A;  5IKL B;  5G1Q A;  5HUQ A;  1TG6 A;  3WG5 A;  5DTW A;  4I52 A;  4IZC A;  4KPK A;  3DJA A;  1FC6 A;  5DUF A;  2J5I B;  2VRE A;  3ZWA A;  4DI1 A;  2J5G D;  4FND A;  1O8U A;  3MFM A;  3U9R B;  3IB9 A;  4L6W A;  5DL1 A;  3P85 A;  1N6E A;  3TT6 A;  4FJW D;  2PG8 A;  2Q2X A;  1EF8 A;  1UYT A;  4OMR A;  4ELX A;  2PPY A;  4KWB A;  3MYB A;  2F6Q A;  2F9Y A;  3T88 A;  3QKA A;  5DTP A;  3ZW9 A;  5INF A;  1K39 A;  2F9I B;  4ELS A;  2BZR A;  4EMP A;  1OD2 A;  4U19 A;  3TRR A;  4U0G H;  2J5I I;  5CTB A;  4GHN A;  3NJB A;  5INI A;  3KTH A;  3BF0 A;  1YG6 A;  5DU8 A;  4HNK A;  1DUB A;  3RRV A;  3R9S A;  5MGB A;  2J5G A;  5FIF A;  4K3W A;  2VSU C;  3PGQ A;  4LK5 A;  3QK8 A;  4Z0M A;  3TVU A;  3R0O A;  3TT7 A;  2FBM A;  2FW2 A;  2ZQR A;  2VSS A;  4WCZ A;  1XX4 A;  4MXI A;  1TYF A;  4NAR A;  1OD4 A;  3H0J A;  4HDT A;  1FC7 A;  3TZ3 A;  4QII A;  1X0U A;  3GF3 A;  4RCN A;  1RJN A;  2J5I A;  5DU4 A;  2CE3 A;  3TVW A;  3BEZ A;  1UYS A;  3QWD A;  3TLF A;  4J2U A;  3RSI A;  4NNQ A;  5DUC A;  3Q7H A;  4FZW A;  4JWV A;  3R9T A;  3M6M A;  1HNU A;  4ZDD A;  4U0H A;  5G1S A;  1XNW A;  3ZWC A;  4JFC A;  2NP9 A;  3IBB A;  3T89 A;  4U18 A;  4ELW A;  2VSU A;  5G1R A;  1PIX A;  3TV5 A;  3Q0J A;  5E0N X;  1DCI A;  4JCS A;  3H0Q A;  1N6F A;  4I42 A;  3V5E A;  2GTR A;  4B3I A;  4ZDF A;  4G2R A;  1UYR A;  5CTC A;  4FB8 A;  4MOU A;  3HE2 A;  2X24 A;  3OME A;  4QIJ A;  4K2N A;  4K29 A;  2A81 A;  4ZDC A;  1J7X A;  3U9S B;  2J5S A;  3H0S A;  1HZD A;  3KTK A;  2VSS E;  4QFE A;  1Y7O A;  4Q0G A;  3ST9 A;  1ON9 A;  1PJH A;  3GLM A;  2ZL0 A;  3Q1T A;  3T8B A;  2Q34 A;  2FZS A;  1RJM A;  2F9Y B;  5DU6 A;  2A7K A;  3HLN 1;  3QYR A;  4WZ8 B;  3G64 A;  4B3H A;  1UIY A;  4U1A A;  5KDR A;  3KTG A;  1SZO A;  3GF7 A;  3L3S A;  5KJP A;  3K50 A;  1XNV A;  4Q1I A;  3M6N A;  1NZY A;  4L8K A;  1HNO A;  3R9Q A;  4ZDB A;  2DEO A;  4JYL A;  3H02 A;  3QRE A;  1VRG A;  4ASI A;  3MT6 A;  3P5M A;  4OLQ A;  2Q35 A;  4JYJ A;  3FF6 A;  1UYV A;  3LAO A;  2VSU E;  2D3T A;  4HC8 A;  3H81 A;  4JJT A;  3V5I A;  1ON3 A;  1FCF A;  3DOR A;  1MJ3 A;  2HW5 A;  2VSS F;  3HP0 A;  3U9T B;  4RYF A;  4FN7 A;  5C90 A;  1WDK A;  2WTB A;  3OT6 A;  3H0U A;  1WZ8 A;  1K32 A;  1WDL A;  3BPT A;  3GKB A;  2C8T A;  5E0S A;  5E0S H;  5JBX A;  5FUS A;  2YJG A;  4F47 A;  2F9I A;  3BPP A;  2F6I A;  4JVT A;  4JSB A;  4KNP A;  4JOT A;  3R6H A;  1Q51 A;  3STA A;  2CBY A;  3LKE A;  2ZL4 A;  3MOY A;  3SWX A;  2ZL3 A;  3HRX A;  3QMJ A;  4ZDE A;  3ZW8 A;  2A7S A;  5JBW A;  4KD6 A;  1WDM A;  2UZF A;  2VSU F;  3VIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...