4RYFA

Clpp1/2 heterocomplex from listeria monocytogenes
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
ITNILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVQGQSTEIEIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ClpP12 heterocomplex from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4ryfA00
3GMAA 5C90A 4JCRA 3ZWCA 2BZRA 3IAVA 4KWBA 4MXIA 4OMRA 5C9GA 5MGBA 4GM2A 2VX2A 3R9TA 3KTIA 3MFMA 2ZL3A 3M6NA 3ZW9A 1PJHA 2ZL4A 3OMEA 1NZYB 1SG4A 5E0NX 4RYFH 4B3HA 1N6DA 3HP0A 4KD6A 1WDMA 5DZKA 4FZWC 3KTHA 4Z0MA 1N6FA 4EMLA 2QQ3A 5E0SH 2F9YA 2J5II 5JBXA 2VSSA 4KPKA 3R9QA 1YG6A 4I42A 5INIA 5DTWA 4LK5A 3R6HA 1XNVA 1JXZA 3SWXA 4MOUA 1UIYA 3H02A 4G2RA 1ON3A 1XO6A 3TRRA 3R0OA 4EMMA 3RSTA 1FCFA 2EJ5A 2F9IB 3U9SB 1HNUA 3WG5A 1K39A 5KJPA 4WCZA 1TG6A 2J5IA 4U0GA 3T8AA 1WDKA 2VSUC 5FIFA 2GTRA 2J5GD 4MI2A 1UYSA 1FC7A 3ZWBA 3TT6A 3FDUA 4IZCA 4JCSA 3DORA 1DCIA 4RCNA 2F9YB 3Q0JA 2X58A 4NEKA 2A7SA 2ZQRA 4L8KA 3SLLA 5CTCA 2PPYA 5DU6A 1TYFA 3H0UA 3QYRA 5DUFA 2VSUA 5DL1A 1Q51A 1OD4A 4JYJA 5DUCA 4ZDBA 1O8UA 3QKAA 5DU8A 4JJTA 1RJNA 3V5IA 3QWDA 3TVWA 3ZW8A 4L6WA 4K2NA 4B3JA 2W3PA 5E0SA 3MOYA 2ZL0A 3TVUA 3KTGA 2J5GA 1UYVA 2A81A 3QREA 3R9SA 2HW5A 1VRGA 2DEOA 3QXZA 5KDRB 4KNPA 2VSUE 4OG1A 4U0HA 3ST9A 2VSUF 3VIVA 2ZQQA 3G64A 3HRXA 4FNBA 2DUBA 5CTBA 4JFCA 3I47A 4U0GH 2FBMA 3OT6A 3TLFA 1MJ3A 3GLMA 3P85A 5FUSA 2X24A 2IEXA 4RYFA 4FN8A 2Q35A 4U19A 1SZOA 1XNYA 3HLN1 3BEZA 4K29A 5INFA 2J5SA 3T89A 3NJDA 3DJAA 1EY3A 3K50A 4ZDFA 3U9TB 4JOTA 4U18A 2C8TA 4ASIA 3H0JA 4QIJA 4JVTA 4DI1A 3TT7A 4FZWA 2CBYA 4F47A 4IZDA 4B3IA 1EF8A 1FC6A 3STAA 3H0QA 3K8XA 3T8BA 3PZKA 3LKEA 2UZFA 2D3TA 4IZBA 4EMPA 1NZYA 3FF6A 3HINA 4JCTA 3M6MA 1EF9A 2A7KA 3V5EA 1N6EA 3P2LA 5DTPA 2VREA 4YLHA 3L3SA 3GF7A 3OC7A 5JBWA 2J5IB 4I4ZA 2F6QA 4FN7A 2VSSF 4Q0GA 5G1RA 3GF3A 5DZKH 3QXIA 3TDCA 3GKBA 1DUBA 3T3WA 1UYRA 3LAOA 4FNDA 2F9IA 1K32A 1Y7OA 3IBBA 5DU4A 4I52A 4WYOB 2Q2XA 4JSBA 3H0SA 1ON9A 4U1AA 3Q7HA 2FW2A 3BPPA 3IB9A 4K3WA 3T88A 3KQFA 5INGA 4JYLA 3KTKA 1UYTA 4HNKA 1W2XA 1Q52A 2VSSE 5KDRA 4QFEA 4ELWA 4Q1IA 5DKPA 3Q1TA 3MYBA 3RSIA 2PG8A 3ZWAA 5G1QA 4JWVA 3H81A 4ELXA 1RJMA 3PEAA 3KTJA 5IKLB 1J7XA 3QMJA 4GHNA 2F6IA 2CE3A 3Q0GA 3TZ3A 1HNOA 1FC9A 4ZDDA 1X0UA 4ZDCA 3NJBA 3P5MA 2WTBA 3PE8A 4HC8A 2ZL2A 4FJWD 1XNWA 1OD2A 4FB8A 3PGQA 3BF0A 1YG8A 1HZDA 2FZSA 3HE2A 5G1SA 1WDLA 1WZ8A 2NP9A 4OLQA 4NNQA 2PBPA 3RRVA 4ELSA 3TV5A 3JU1A 4ZU2A 4JCQA 1PIXA 3QK8A 3ISAA 2Q34A 3U9RB 3N6RB 4ZDEA 4WZ8B 3MT6A 4QIIA 1XX4A
chains in the Genus database with same CATH superfamily
3GMAA 5C90A 4JCRA 3ZWCA 2BZRA 3IAVA 4KWBA 4MXIA 4OMRA 5C9GA 5MGBA 4GM2A 2VX2A 3R9TA 3KTIA 3MFMA 2ZL3A 3M6NA 3ZW9A 1PJHA 2ZL4A 3OMEA 1NZYB 1SG4A 5E0NX 4RYFH 4B3HA 1N6DA 3HP0A 4KD6A 1WDMA 5DZKA 4FZWC 3KTHA 4Z0MA 1N6FA 4EMLA 2QQ3A 5E0SH 2F9YA 2J5II 5JBXA 2VSSA 4KPKA 3R9QA 1YG6A 4I42A 5INIA 5DTWA 4LK5A 3R6HA 1XNVA 1JXZA 3SWXA 4MOUA 1UIYA 3H02A 4G2RA 1ON3A 1XO6A 3TRRA 3R0OA 4EMMA 3RSTA 1FCFA 2EJ5A 2F9IB 3U9SB 1HNUA 3WG5A 1K39A 5KJPA 4WCZA 1TG6A 2J5IA 4U0GA 3T8AA 1WDKA 2VSUC 5FIFA 2GTRA 2J5GD 4MI2A 1UYSA 1FC7A 3ZWBA 3TT6A 3FDUA 4IZCA 4JCSA 3DORA 1DCIA 4RCNA 2F9YB 3Q0JA 2X58A 4NEKA 2A7SA 2ZQRA 4L8KA 3SLLA 5CTCA 2PPYA 5DU6A 1TYFA 3H0UA 3QYRA 5DUFA 2VSUA 5DL1A 1Q51A 1OD4A 4JYJA 5DUCA 4ZDBA 1O8UA 3QKAA 5DU8A 4JJTA 1RJNA 3V5IA 3QWDA 3TVWA 3ZW8A 4L6WA 4K2NA 4B3JA 2W3PA 5E0SA 3MOYA 2ZL0A 3TVUA 3KTGA 2J5GA 1UYVA 2A81A 3QREA 3R9SA 2HW5A 1VRGA 2DEOA 3QXZA 5KDRB 4KNPA 2VSUE 4OG1A 4U0HA 3ST9A 2VSUF 3VIVA 2ZQQA 3G64A 3HRXA 4FNBA 2DUBA 5CTBA 4JFCA 3I47A 4U0GH 2FBMA 3OT6A 3TLFA 1MJ3A 3GLMA 3P85A 5FUSA 2X24A 2IEXA 4RYFA 4FN8A 2Q35A 4U19A 1SZOA 1XNYA 3HLN1 3BEZA 4K29A 5INFA 2J5SA 3T89A 3NJDA 3DJAA 1EY3A 3K50A 4ZDFA 3U9TB 4JOTA 4U18A 2C8TA 4ASIA 3H0JA 4QIJA 4JVTA 2YJGA 4DI1A 3TT7A 4FZWA 2CBYA 4F47A 4IZDA 4B3IA 1EF8A 1FC6A 3STAA 3H0QA 3K8XA 3T8BA 3PZKA 3LKEA 2UZFA 2D3TA 4IZBA 4EMPA 1NZYA 3FF6A 3HINA 4JCTA 3M6MA 1EF9A 2A7KA 3V5EA 1N6EA 4J2UA 3P2LA 5DTPA 2VREA 4YLHA 3L3SA 3GF7A 3OC7A 5JBWA 2J5IB 4I4ZA 2F6QA 4FN7A 2VSSF 4Q0GA 5G1RA 3GF3A 5DZKH 3QXIA 3TDCA 3GKBA 1DUBA 3T3WA 1UYRA 3LAOA 4FNDA 2F9IA 1K32A 1Y7OA 3IBBA 5DU4A 4I52A 4WYOB 3BPTA 2Q2XA 4JSBA 3H0SA 1ON9A 4U1AA 3Q7HA 2FW2A 3BPPA 3IB9A 4K3WA 3T88A 3KQFA 5INGA 4JYLA 3KTKA 1UYTA 4HNKA 1W2XA 1Q52A 2VSSE 5KDRA 4QFEA 4ELWA 4NARA 4Q1IA 5DKPA 3Q1TA 3MYBA 3RSIA 2PG8A 3ZWAA 5G1QA 4JWVA 3H81A 4ELXA 1RJMA 3PEAA 3KTJA 5IKLB 1J7XA 3QMJA 4GHNA 2F6IA 2CE3A 3Q0GA 3TZ3A 1HNOA 1FC9A 4ZDDA 1X0UA 4ZDCA 3NJBA 3P5MA 2WTBA 3PE8A 4HC8A 2ZL2A 4FJWD 1XNWA 1OD2A 4FB8A 3PGQA 3BF0A 1YG8A 1HZDA 2FZSA 3HE2A 5G1SA 1WDLA 1WZ8A 2NP9A 4OLQA 4NNQA 2PBPA 3RRVA 4ELSA 3TV5A 3JU1A 4ZU2A 4HDTA 4JCQA 1PIXA 3QK8A 3ISAA 2Q34A 3U9RB 3N6RB 4ZDEA 4WZ8B 3MT6A 4QIIA 5HUQA 1XX4A
chains in the Genus database with same CATH topology
3GMAA 5C90A 4JCRA 3ZWCA 2BZRA 3IAVA 4KWBA 4MXIA 4OMRA 5C9GA 5MGBA 4GM2A 2VX2A 3R9TA 3KTIA 3MFMA 2ZL3A 3M6NA 3ZW9A 1PJHA 2ZL4A 3OMEA 1NZYB 1SG4A 5E0NX 4RYFH 4B3HA 1N6DA 3HP0A 4KD6A 1WDMA 5DZKA 4FZWC 3KTHA 4Z0MA 1N6FA 4EMLA 2QQ3A 5E0SH 2F9YA 2J5II 5JBXA 2VSSA 4KPKA 3R9QA 1YG6A 4I42A 5INIA 5DTWA 4LK5A 3R6HA 1XNVA 1JXZA 3SWXA 4MOUA 1UIYA 3H02A 4G2RA 1ON3A 1XO6A 3TRRA 3R0OA 4EMMA 3RSTA 1FCFA 2EJ5A 2F9IB 3U9SB 1HNUA 3WG5A 1K39A 5KJPA 4WCZA 1TG6A 2J5IA 4U0GA 3T8AA 1WDKA 2VSUC 5FIFA 2GTRA 2J5GD 4MI2A 1UYSA 1FC7A 3ZWBA 3TT6A 3FDUA 4IZCA 4JCSA 3DORA 1DCIA 4RCNA 2F9YB 3Q0JA 2X58A 4NEKA 2A7SA 2ZQRA 4L8KA 3SLLA 5CTCA 2PPYA 5DU6A 1TYFA 3H0UA 3QYRA 5DUFA 2VSUA 5DL1A 1Q51A 1OD4A 4JYJA 5DUCA 4ZDBA 1O8UA 3QKAA 5DU8A 4JJTA 1RJNA 3V5IA 3QWDA 3TVWA 3ZW8A 4L6WA 4K2NA 4B3JA 2W3PA 5E0SA 3MOYA 2ZL0A 3TVUA 3KTGA 2J5GA 1UYVA 2A81A 3QREA 3R9SA 2HW5A 1VRGA 2DEOA 3QXZA 5KDRB 4KNPA 2VSUE 4OG1A 4U0HA 3ST9A 2VSUF 3VIVA 2ZQQA 3G64A 3HRXA 4FNBA 2DUBA 5CTBA 4JFCA 3I47A 4U0GH 2FBMA 3OT6A 3TLFA 1MJ3A 3GLMA 3P85A 5FUSA 2X24A 2IEXA 4RYFA 4FN8A 2Q35A 4U19A 1SZOA 1XNYA 3HLN1 3BEZA 4K29A 5INFA 2J5SA 3T89A 3NJDA 3DJAA 1EY3A 3K50A 4ZDFA 3U9TB 4JOTA 4U18A 2C8TA 4ASIA 3H0JA 4QIJA 4JVTA 2YJGA 4DI1A 3TT7A 4FZWA 2CBYA 4F47A 4IZDA 4B3IA 1EF8A 1FC6A 3STAA 3H0QA 3K8XA 3T8BA 3PZKA 3LKEA 2UZFA 2D3TA 4IZBA 4EMPA 1NZYA 3FF6A 3HINA 4JCTA 3M6MA 1EF9A 2A7KA 3V5EA 1N6EA 4J2UA 3P2LA 5DTPA 2VREA 4YLHA 3L3SA 3GF7A 3OC7A 5JBWA 2J5IB 4I4ZA 2F6QA 4FN7A 2VSSF 4Q0GA 5G1RA 3GF3A 5DZKH 3QXIA 3TDCA 3GKBA 1DUBA 3T3WA 1UYRA 3LAOA 4FNDA 2F9IA 1K32A 1Y7OA 3IBBA 5DU4A 4I52A 4WYOB 3BPTA 2Q2XA 4JSBA 3H0SA 1ON9A 4U1AA 3Q7HA 2FW2A 3BPPA 3IB9A 4K3WA 3T88A 3KQFA 5INGA 4JYLA 3KTKA 1UYTA 4HNKA 1W2XA 1Q52A 2VSSE 5KDRA 4QFEA 4ELWA 4NARA 4Q1IA 5DKPA 3Q1TA 3MYBA 3RSIA 2PG8A 3ZWAA 5G1QA 4JWVA 3H81A 4ELXA 1RJMA 3PEAA 3KTJA 5IKLB 1J7XA 3QMJA 4GHNA 2F6IA 2CE3A 3Q0GA 3TZ3A 1HNOA 1FC9A 4ZDDA 1X0UA 4ZDCA 3NJBA 3P5MA 2WTBA 3PE8A 4HC8A 2ZL2A 4FJWD 1XNWA 1OD2A 4FB8A 3PGQA 3BF0A 1YG8A 1HZDA 2FZSA 3HE2A 5G1SA 1WDLA 1WZ8A 2NP9A 4OLQA 4NNQA 2PBPA 3RRVA 4ELSA 3TV5A 3JU1A 4ZU2A 4HDTA 4JCQA 1PIXA 3QK8A 3ISAA 2Q34A 3U9RB 3N6RB 4ZDEA 4WZ8B 3MT6A 4QIIA 5HUQA 1XX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMA A;  5C90 A;  4JCR A;  3ZWC A;  2BZR A;  3IAV A;  4KWB A;  4MXI A;  4OMR A;  5C9G A;  5MGB A;  4GM2 A;  2VX2 A;  3R9T A;  3KTI A;  3MFM A;  2ZL3 A;  3M6N A;  3ZW9 A;  1PJH A;  2ZL4 A;  3OME A;  1NZY B;  1SG4 A;  5E0N X;  4RYF H;  4B3H A;  1N6D A;  3HP0 A;  4KD6 A;  1WDM A;  5DZK A;  4FZW C;  3KTH A;  4Z0M A;  1N6F A;  4EML A;  2QQ3 A;  5E0S H;  2F9Y A;  2J5I I;  5JBX A;  2VSS A;  4KPK A;  3R9Q A;  1YG6 A;  4I42 A;  5INI A;  5DTW A;  4LK5 A;  3R6H A;  1XNV A;  1JXZ A;  3SWX A;  4MOU A;  1UIY A;  3H02 A;  4G2R A;  1ON3 A;  1XO6 A;  3TRR A;  3R0O A;  4EMM A;  3RST A;  1FCF A;  2EJ5 A;  2F9I B;  3U9S B;  1HNU A;  3WG5 A;  1K39 A;  5KJP A;  4WCZ A;  1TG6 A;  2J5I A;  4U0G A;  3T8A A;  1WDK A;  2VSU C;  5FIF A;  2GTR A;  2J5G D;  4MI2 A;  1UYS A;  1FC7 A;  3ZWB A;  3TT6 A;  3FDU A;  4IZC A;  4JCS A;  3DOR A;  1DCI A;  4RCN A;  2F9Y B;  3Q0J A;  2X58 A;  4NEK A;  2A7S A;  2ZQR A;  4L8K A;  3SLL A;  5CTC A;  2PPY A;  5DU6 A;  1TYF A;  3H0U A;  3QYR A;  5DUF A;  2VSU A;  5DL1 A;  1Q51 A;  1OD4 A;  4JYJ A;  5DUC A;  4ZDB A;  1O8U A;  3QKA A;  5DU8 A;  4JJT A;  1RJN A;  3V5I A;  3QWD A;  3TVW A;  3ZW8 A;  4L6W A;  4K2N A;  4B3J A;  2W3P A;  5E0S A;  3MOY A;  2ZL0 A;  3TVU A;  3KTG A;  2J5G A;  1UYV A;  2A81 A;  3QRE A;  3R9S A;  2HW5 A;  1VRG A;  2DEO A;  3QXZ A;  5KDR B;  4KNP A;  2VSU E;  4OG1 A;  4U0H A;  3ST9 A;  2VSU F;  3VIV A;  2ZQQ A;  3G64 A;  3HRX A;  4FNB A;  2DUB A;  5CTB A;  4JFC A;  3I47 A;  4U0G H;  2FBM A;  3OT6 A;  3TLF A;  1MJ3 A;  3GLM A;  3P85 A;  5FUS A;  2X24 A;  2IEX A;  4RYF A;  4FN8 A;  2Q35 A;  4U19 A;  1SZO A;  1XNY A;  3HLN 1;  3BEZ A;  4K29 A;  5INF A;  2J5S A;  3T89 A;  3NJD A;  3DJA A;  1EY3 A;  3K50 A;  4ZDF A;  3U9T B;  4JOT A;  4U18 A;  2C8T A;  4ASI A;  3H0J A;  4QIJ A;  4JVT A;  4DI1 A;  3TT7 A;  4FZW A;  2CBY A;  4F47 A;  4IZD A;  4B3I A;  1EF8 A;  1FC6 A;  3STA A;  3H0Q A;  3K8X A;  3T8B A;  3PZK A;  3LKE A;  2UZF A;  2D3T A;  4IZB A;  4EMP A;  1NZY A;  3FF6 A;  3HIN A;  4JCT A;  3M6M A;  1EF9 A;  2A7K A;  3V5E A;  1N6E A;  3P2L A;  5DTP A;  2VRE A;  4YLH A;  3L3S A;  3GF7 A;  3OC7 A;  5JBW A;  2J5I B;  4I4Z A;  2F6Q A;  4FN7 A;  2VSS F;  4Q0G A;  5G1R A;  3GF3 A;  5DZK H;  3QXI A;  3TDC A;  3GKB A;  1DUB A;  3T3W A;  1UYR A;  3LAO A;  4FND A;  2F9I A;  1K32 A;  1Y7O A;  3IBB A;  5DU4 A;  4I52 A;  4WYO B;  2Q2X A;  4JSB A;  3H0S A;  1ON9 A;  4U1A A;  3Q7H A;  2FW2 A;  3BPP A;  3IB9 A;  4K3W A;  3T88 A;  3KQF A;  5ING A;  4JYL A;  3KTK A;  1UYT A;  4HNK A;  1W2X A;  1Q52 A;  2VSS E;  5KDR A;  4QFE A;  4ELW A;  4Q1I A;  5DKP A;  3Q1T A;  3MYB A;  3RSI A;  2PG8 A;  3ZWA A;  5G1Q A;  4JWV A;  3H81 A;  4ELX A;  1RJM A;  3PEA A;  3KTJ A;  5IKL B;  1J7X A;  3QMJ A;  4GHN A;  2F6I A;  2CE3 A;  3Q0G A;  3TZ3 A;  1HNO A;  1FC9 A;  4ZDD A;  1X0U A;  4ZDC A;  3NJB A;  3P5M A;  2WTB A;  3PE8 A;  4HC8 A;  2ZL2 A;  4FJW D;  1XNW A;  1OD2 A;  4FB8 A;  3PGQ A;  3BF0 A;  1YG8 A;  1HZD A;  2FZS A;  3HE2 A;  5G1S A;  1WDL A;  1WZ8 A;  2NP9 A;  4OLQ A;  4NNQ A;  2PBP A;  3RRV A;  4ELS A;  3TV5 A;  3JU1 A;  4ZU2 A;  4JCQ A;  1PIX A;  3QK8 A;  3ISA A;  2Q34 A;  3U9R B;  3N6R B;  4ZDE A;  4WZ8 B;  3MT6 A;  4QII A;  1XX4 A; 
#chains in the Genus database with same CATH topology
 3GMA A;  5C90 A;  4JCR A;  3ZWC A;  2BZR A;  3IAV A;  4KWB A;  4MXI A;  4OMR A;  5C9G A;  5MGB A;  4GM2 A;  2VX2 A;  3R9T A;  3KTI A;  3MFM A;  2ZL3 A;  3M6N A;  3ZW9 A;  1PJH A;  2ZL4 A;  3OME A;  1NZY B;  1SG4 A;  5E0N X;  4RYF H;  4B3H A;  1N6D A;  3HP0 A;  4KD6 A;  1WDM A;  5DZK A;  4FZW C;  3KTH A;  4Z0M A;  1N6F A;  4EML A;  2QQ3 A;  5E0S H;  2F9Y A;  2J5I I;  5JBX A;  2VSS A;  4KPK A;  3R9Q A;  1YG6 A;  4I42 A;  5INI A;  5DTW A;  4LK5 A;  3R6H A;  1XNV A;  1JXZ A;  3SWX A;  4MOU A;  1UIY A;  3H02 A;  4G2R A;  1ON3 A;  1XO6 A;  3TRR A;  3R0O A;  4EMM A;  3RST A;  1FCF A;  2EJ5 A;  2F9I B;  3U9S B;  1HNU A;  3WG5 A;  1K39 A;  5KJP A;  4WCZ A;  1TG6 A;  2J5I A;  4U0G A;  3T8A A;  1WDK A;  2VSU C;  5FIF A;  2GTR A;  2J5G D;  4MI2 A;  1UYS A;  1FC7 A;  3ZWB A;  3TT6 A;  3FDU A;  4IZC A;  4JCS A;  3DOR A;  1DCI A;  4RCN A;  2F9Y B;  3Q0J A;  2X58 A;  4NEK A;  2A7S A;  2ZQR A;  4L8K A;  3SLL A;  5CTC A;  2PPY A;  5DU6 A;  1TYF A;  3H0U A;  3QYR A;  5DUF A;  2VSU A;  5DL1 A;  1Q51 A;  1OD4 A;  4JYJ A;  5DUC A;  4ZDB A;  1O8U A;  3QKA A;  5DU8 A;  4JJT A;  1RJN A;  3V5I A;  3QWD A;  3TVW A;  3ZW8 A;  4L6W A;  4K2N A;  4B3J A;  2W3P A;  5E0S A;  3MOY A;  2ZL0 A;  3TVU A;  3KTG A;  2J5G A;  1UYV A;  2A81 A;  3QRE A;  3R9S A;  2HW5 A;  1VRG A;  2DEO A;  3QXZ A;  5KDR B;  4KNP A;  2VSU E;  4OG1 A;  4U0H A;  3ST9 A;  2VSU F;  3VIV A;  2ZQQ A;  3G64 A;  3HRX A;  4FNB A;  2DUB A;  5CTB A;  4JFC A;  3I47 A;  4U0G H;  2FBM A;  3OT6 A;  3TLF A;  1MJ3 A;  3GLM A;  3P85 A;  5FUS A;  2X24 A;  2IEX A;  4RYF A;  4FN8 A;  2Q35 A;  4U19 A;  1SZO A;  1XNY A;  3HLN 1;  3BEZ A;  4K29 A;  5INF A;  2J5S A;  3T89 A;  3NJD A;  3DJA A;  1EY3 A;  3K50 A;  4ZDF A;  3U9T B;  4JOT A;  4U18 A;  2C8T A;  4ASI A;  3H0J A;  4QIJ A;  4JVT A;  2YJG A;  4DI1 A;  3TT7 A;  4FZW A;  2CBY A;  4F47 A;  4IZD A;  4B3I A;  1EF8 A;  1FC6 A;  3STA A;  3H0Q A;  3K8X A;  3T8B A;  3PZK A;  3LKE A;  2UZF A;  2D3T A;  4IZB A;  4EMP A;  1NZY A;  3FF6 A;  3HIN A;  4JCT A;  3M6M A;  1EF9 A;  2A7K A;  3V5E A;  1N6E A;  4J2U A;  3P2L A;  5DTP A;  2VRE A;  4YLH A;  3L3S A;  3GF7 A;  3OC7 A;  5JBW A;  2J5I B;  4I4Z A;  2F6Q A;  4FN7 A;  2VSS F;  4Q0G A;  5G1R A;  3GF3 A;  5DZK H;  3QXI A;  3TDC A;  3GKB A;  1DUB A;  3T3W A;  1UYR A;  3LAO A;  4FND A;  2F9I A;  1K32 A;  1Y7O A;  3IBB A;  5DU4 A;  4I52 A;  4WYO B;  3BPT A;  2Q2X A;  4JSB A;  3H0S A;  1ON9 A;  4U1A A;  3Q7H A;  2FW2 A;  3BPP A;  3IB9 A;  4K3W A;  3T88 A;  3KQF A;  5ING A;  4JYL A;  3KTK A;  1UYT A;  4HNK A;  1W2X A;  1Q52 A;  2VSS E;  5KDR A;  4QFE A;  4ELW A;  4NAR A;  4Q1I A;  5DKP A;  3Q1T A;  3MYB A;  3RSI A;  2PG8 A;  3ZWA A;  5G1Q A;  4JWV A;  3H81 A;  4ELX A;  1RJM A;  3PEA A;  3KTJ A;  5IKL B;  1J7X A;  3QMJ A;  4GHN A;  2F6I A;  2CE3 A;  3Q0G A;  3TZ3 A;  1HNO A;  1FC9 A;  4ZDD A;  1X0U A;  4ZDC A;  3NJB A;  3P5M A;  2WTB A;  3PE8 A;  4HC8 A;  2ZL2 A;  4FJW D;  1XNW A;  1OD2 A;  4FB8 A;  3PGQ A;  3BF0 A;  1YG8 A;  1HZD A;  2FZS A;  3HE2 A;  5G1S A;  1WDL A;  1WZ8 A;  2NP9 A;  4OLQ A;  4NNQ A;  2PBP A;  3RRV A;  4ELS A;  3TV5 A;  3JU1 A;  4ZU2 A;  4HDT A;  4JCQ A;  1PIX A;  3QK8 A;  3ISA A;  2Q34 A;  3U9R B;  3N6R B;  4ZDE A;  4WZ8 B;  3MT6 A;  4QII A;  5HUQ A;  1XX4 A; 
#chains in the Genus database with same CATH homology
 3GMA A;  5C90 A;  4JCR A;  3ZWC A;  2BZR A;  3IAV A;  4KWB A;  4MXI A;  4OMR A;  5C9G A;  5MGB A;  4GM2 A;  2VX2 A;  3R9T A;  3KTI A;  3MFM A;  2ZL3 A;  3M6N A;  3ZW9 A;  1PJH A;  2ZL4 A;  3OME A;  1NZY B;  1SG4 A;  5E0N X;  4RYF H;  4B3H A;  1N6D A;  3HP0 A;  4KD6 A;  1WDM A;  5DZK A;  4FZW C;  3KTH A;  4Z0M A;  1N6F A;  4EML A;  2QQ3 A;  5E0S H;  2F9Y A;  2J5I I;  5JBX A;  2VSS A;  4KPK A;  3R9Q A;  1YG6 A;  4I42 A;  5INI A;  5DTW A;  4LK5 A;  3R6H A;  1XNV A;  1JXZ A;  3SWX A;  4MOU A;  1UIY A;  3H02 A;  4G2R A;  1ON3 A;  1XO6 A;  3TRR A;  3R0O A;  4EMM A;  3RST A;  1FCF A;  2EJ5 A;  2F9I B;  3U9S B;  1HNU A;  3WG5 A;  1K39 A;  5KJP A;  4WCZ A;  1TG6 A;  2J5I A;  4U0G A;  3T8A A;  1WDK A;  2VSU C;  5FIF A;  2GTR A;  2J5G D;  4MI2 A;  1UYS A;  1FC7 A;  3ZWB A;  3TT6 A;  3FDU A;  4IZC A;  4JCS A;  3DOR A;  1DCI A;  4RCN A;  2F9Y B;  3Q0J A;  2X58 A;  4NEK A;  2A7S A;  2ZQR A;  4L8K A;  3SLL A;  5CTC A;  2PPY A;  5DU6 A;  1TYF A;  3H0U A;  3QYR A;  5DUF A;  2VSU A;  5DL1 A;  1Q51 A;  1OD4 A;  4JYJ A;  5DUC A;  4ZDB A;  1O8U A;  3QKA A;  5DU8 A;  4JJT A;  1RJN A;  3V5I A;  3QWD A;  3TVW A;  3ZW8 A;  4L6W A;  4K2N A;  4B3J A;  2W3P A;  5E0S A;  3MOY A;  2ZL0 A;  3TVU A;  3KTG A;  2J5G A;  1UYV A;  2A81 A;  3QRE A;  3R9S A;  2HW5 A;  1VRG A;  2DEO A;  3QXZ A;  5KDR B;  4KNP A;  2VSU E;  4OG1 A;  4U0H A;  3ST9 A;  2VSU F;  3VIV A;  2ZQQ A;  3G64 A;  3HRX A;  4FNB A;  2DUB A;  5CTB A;  4JFC A;  3I47 A;  4U0G H;  2FBM A;  3OT6 A;  3TLF A;  1MJ3 A;  3GLM A;  3P85 A;  5FUS A;  2X24 A;  2IEX A;  4RYF A;  4FN8 A;  2Q35 A;  4U19 A;  1SZO A;  1XNY A;  3HLN 1;  3BEZ A;  4K29 A;  5INF A;  2J5S A;  3T89 A;  3NJD A;  3DJA A;  1EY3 A;  3K50 A;  4ZDF A;  3U9T B;  4JOT A;  4U18 A;  2C8T A;  4ASI A;  3H0J A;  4QIJ A;  4JVT A;  2YJG A;  4DI1 A;  3TT7 A;  4FZW A;  2CBY A;  4F47 A;  4IZD A;  4B3I A;  1EF8 A;  1FC6 A;  3STA A;  3H0Q A;  3K8X A;  3T8B A;  3PZK A;  3LKE A;  2UZF A;  2D3T A;  4IZB A;  4EMP A;  1NZY A;  3FF6 A;  3HIN A;  4JCT A;  3M6M A;  1EF9 A;  2A7K A;  3V5E A;  1N6E A;  4J2U A;  3P2L A;  5DTP A;  2VRE A;  4YLH A;  3L3S A;  3GF7 A;  3OC7 A;  5JBW A;  2J5I B;  4I4Z A;  2F6Q A;  4FN7 A;  2VSS F;  4Q0G A;  5G1R A;  3GF3 A;  5DZK H;  3QXI A;  3TDC A;  3GKB A;  1DUB A;  3T3W A;  1UYR A;  3LAO A;  4FND A;  2F9I A;  1K32 A;  1Y7O A;  3IBB A;  5DU4 A;  4I52 A;  4WYO B;  3BPT A;  2Q2X A;  4JSB A;  3H0S A;  1ON9 A;  4U1A A;  3Q7H A;  2FW2 A;  3BPP A;  3IB9 A;  4K3W A;  3T88 A;  3KQF A;  5ING A;  4JYL A;  3KTK A;  1UYT A;  4HNK A;  1W2X A;  1Q52 A;  2VSS E;  5KDR A;  4QFE A;  4ELW A;  4NAR A;  4Q1I A;  5DKP A;  3Q1T A;  3MYB A;  3RSI A;  2PG8 A;  3ZWA A;  5G1Q A;  4JWV A;  3H81 A;  4ELX A;  1RJM A;  3PEA A;  3KTJ A;  5IKL B;  1J7X A;  3QMJ A;  4GHN A;  2F6I A;  2CE3 A;  3Q0G A;  3TZ3 A;  1HNO A;  1FC9 A;  4ZDD A;  1X0U A;  4ZDC A;  3NJB A;  3P5M A;  2WTB A;  3PE8 A;  4HC8 A;  2ZL2 A;  4FJW D;  1XNW A;  1OD2 A;  4FB8 A;  3PGQ A;  3BF0 A;  1YG8 A;  1HZD A;  2FZS A;  3HE2 A;  5G1S A;  1WDL A;  1WZ8 A;  2NP9 A;  4OLQ A;  4NNQ A;  2PBP A;  3RRV A;  4ELS A;  3TV5 A;  3JU1 A;  4ZU2 A;  4HDT A;  4JCQ A;  1PIX A;  3QK8 A;  3ISA A;  2Q34 A;  3U9R B;  3N6R B;  4ZDE A;  4WZ8 B;  3MT6 A;  4QII A;  5HUQ A;  1XX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...