4RYFH

Clpp1/2 heterocomplex from listeria monocytogenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
183
Chain Sequence
LIPTVIAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ClpP12 heterocomplex from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 66
structure length 183
sequence length 191
chains with identical sequence I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4ryfH00
2VSUF 3PE8A 3Q7HA 1RJNA 4JCSA 1XNYA 2GTRA 3RSTA 1EF8A 1OD2A 4U1AA 5CTCA 5DTWA 4U0GH 2ZL2A 1PIXA 3TZ3A 5KDRB 1ON3A 4RYFA 5E0SH 4IZCA 3TVWA 3Q1TA 2F6QA 3OC7A 3TV5A 1WDLA 1TG6A 1WZ8A 1UYRA 4EMMA 3QKAA 4ASIA 4FNBA 4ZDBA 4ELWA 5IKLB 3MT6A 3R9QA 3G64A 3TT6A 1UYVA 3JU1A 3FF6A 1RJMA 3PEAA 1HNUA 4G2RA 5DU4A 4JYJA 2D3TA 4RCNA 4F47A 3QREA 4FN7A 3ZW9A 1Q52A 1YG6A 3LKEA 4FZWA 5CTBA 3H81A 4HC8A 3KTIA 4JFCA 1HZDA 4OLQA 3K8XA 2J5GA 1EF9A 4I42A 1SG4A 2HW5A 3HE2A 1UYSA 2FZSA 5DU6A 3IBBA 4IZDA 1DCIA 3TLFA 1NZYA 4IZBA 3KTJA 3U9RB 3GF3A 3TDCA 3NJBA 2BZRA 1Q51A 5G1SA 4ZDDA 1PJHA 4GHNA 4JOTA 4YLHA 3P2LA 3ST9A 4Q1IA 3ISAA 1EY3A 4MI2A 4NEKA 4ELXA 2VREA 2WTBA 3Q0GA 3TT7A 3QWDA 4JJTA 5FUSA 3TRRA 3OMEA 4QIIA 3H02A 4DI1A 3V5IA 1HNOA 4I52A 4JWVA 1MJ3A 4JCQA 3M6MA 3U9TB 4FB8A 4MXIA 3ZWBA 4QFEA 4EMPA 1VRGA 4U19A 2IEXA 5DKPA 5E0NX 4OMRA 3OT6A 5DUFA 1YG8A 2VSUE 3GMAA 3ZWAA 2J5SA 2W3PA 2NP9A 2Q2XA 4FNDA 3N6RB 4WCZA 5DTPA 1FC9A 4I4ZA 3HP0A 1X0UA 3QK8A 1K39A 2Q35A 5JBXA 4GM2A 4WYOB 4RYFH 2DEOA 3PGQA 4Q0GA 3KTKA 2FBMA 1N6DA 3PZKA 3IB9A 3QXIA 4K2NA 3RRVA 1ON9A 3U9SB 2VX2A 2VSSA 1N6EA 1UIYA 4NNQA 2QQ3A 2X58A 4KD6A 2VSSE 3HINA 2PPYA 5E0SA 1OD4A 2F9IB 4ZDEA 4U0HA 3T89A 1K32A 4OG1A 2X24A 4B3IA 4U18A 2A81A 2PG8A 3R9SA 3H0UA 3KTGA 1UYTA 3QYRA 5KDRA 5DUCA 4KWBA 5FIFA 3NJDA 4B3JA 1FC6A 3R0OA 3V5EA 4MOUA 2ZL0A 4ELSA 2A7SA 3TVUA 3QMJA 3K50A 2F9YB 2VSSF 2ZQQA 1FC7A 4K29A 4FJWD 3STAA 3M6NA 1TYFA 4JYLA 5KJPA 1WDMA 5C90A 4JVTA 2UZFA 5G1QA 3FDUA 3BF0A 4JSBA 3DORA 3Q0JA 3MOYA 3T3WA 3P85A 5DL1A 3R6HA 1JXZA 3SLLA 2VSUA 5MGBA 2CBYA 4FZWC 1J7XA 4L6WA 5DU8A 4KPKA 2CE3A 5G1RA 2Q34A 3T8BA 1O8UA 3H0JA 4FN8A 3LAOA 3QXZA 3GKBA 5INFA 5DZKH 4JCTA 3R9TA 2A7KA 3ZWCA 2ZQRA 2C8TA 4KNPA 3RSIA 1NZYB 2EJ5A 4HNKA 4LK5A 5JBWA 2J5IB 1XNVA 3DJAA 5DZKA 2F9YA 2F9IA 4ZDFA 3GLMA 3L3SA 5C9GA 2VSUC 3SWXA 3KTHA 2J5II 1W2XA 1N6FA 1WDKA 3IAVA 4ZDCA 3VIVA 4B3HA 1Y7OA 2J5IA 3BPPA 1XX4A 3T88A 2J5GD 3WG5A 5INIA 4EMLA 1SZOA 1XNWA 2PBPA 4ZU2A 4Z0MA 2ZL3A 3HLN1 3MFMA 1FCFA 2F6IA 3MYBA 3H0QA 3GF7A 3I47A 2FW2A 3H0SA 5INGA 2ZL4A 1XO6A 3P5MA 2DUBA 3KQFA 4QIJA 4JCRA 4WZ8B 3T8AA 4L8KA 3BEZA 1DUBA 3HRXA 4U0GA 4K3WA 3ZW8A
chains in the Genus database with same CATH superfamily
2VSUF 3PE8A 3Q7HA 1RJNA 4JCSA 1XNYA 2GTRA 3RSTA 1EF8A 1OD2A 4U1AA 5CTCA 5DTWA 4U0GH 2ZL2A 1PIXA 3TZ3A 5KDRB 1ON3A 4RYFA 5E0SH 4IZCA 3TVWA 3Q1TA 2F6QA 3OC7A 3TV5A 1WDLA 1TG6A 1WZ8A 1UYRA 4EMMA 3QKAA 4ASIA 4FNBA 4ZDBA 4ELWA 5IKLB 3MT6A 3R9QA 3G64A 3TT6A 1UYVA 3JU1A 3FF6A 1RJMA 3PEAA 1HNUA 4G2RA 5DU4A 4JYJA 2D3TA 4RCNA 4F47A 3QREA 4FN7A 3ZW9A 1Q52A 1YG6A 3LKEA 4FZWA 3BPTA 5CTBA 3H81A 4HC8A 3KTIA 4JFCA 1HZDA 4OLQA 3K8XA 2J5GA 1EF9A 4I42A 1SG4A 2HW5A 3HE2A 1UYSA 2FZSA 5DU6A 3IBBA 4IZDA 1DCIA 3TLFA 1NZYA 4IZBA 3KTJA 3U9RB 3GF3A 3TDCA 3NJBA 2BZRA 1Q51A 5G1SA 4ZDDA 1PJHA 4GHNA 4JOTA 4YLHA 3P2LA 3ST9A 4Q1IA 3ISAA 1EY3A 4MI2A 4NEKA 4ELXA 2VREA 2WTBA 3Q0GA 3TT7A 3QWDA 4JJTA 5FUSA 3TRRA 3OMEA 4QIIA 3H02A 4DI1A 3V5IA 1HNOA 4I52A 4JWVA 1MJ3A 4JCQA 3M6MA 3U9TB 4FB8A 4MXIA 3ZWBA 4QFEA 4EMPA 1VRGA 4U19A 2IEXA 5DKPA 5E0NX 4OMRA 3OT6A 5DUFA 1YG8A 2VSUE 3GMAA 3ZWAA 2J5SA 2W3PA 2NP9A 2Q2XA 4FNDA 3N6RB 4WCZA 5DTPA 1FC9A 4I4ZA 3HP0A 1X0UA 3QK8A 1K39A 2Q35A 5JBXA 4GM2A 4WYOB 4RYFH 4NARA 2DEOA 3PGQA 4Q0GA 3KTKA 2FBMA 1N6DA 3PZKA 3IB9A 3QXIA 4K2NA 3RRVA 1ON9A 3U9SB 2VX2A 2VSSA 1N6EA 1UIYA 4NNQA 2QQ3A 2X58A 4KD6A 2VSSE 3HINA 2PPYA 5E0SA 1OD4A 2F9IB 4ZDEA 4U0HA 3T89A 1K32A 4OG1A 2X24A 4B3IA 4U18A 2A81A 2PG8A 3R9SA 3H0UA 3KTGA 1UYTA 3QYRA 5KDRA 5DUCA 4KWBA 5FIFA 3NJDA 4B3JA 1FC6A 4HDTA 3R0OA 3V5EA 4MOUA 2ZL0A 4ELSA 2A7SA 3TVUA 3QMJA 3K50A 2F9YB 2VSSF 2ZQQA 1FC7A 4K29A 4FJWD 3STAA 3M6NA 1TYFA 4JYLA 5KJPA 1WDMA 5C90A 4JVTA 2UZFA 5G1QA 3FDUA 3BF0A 4JSBA 3DORA 3Q0JA 3MOYA 3T3WA 3P85A 5DL1A 3R6HA 1JXZA 3SLLA 2VSUA 5MGBA 2CBYA 4FZWC 1J7XA 2YJGA 4L6WA 5DU8A 4KPKA 2CE3A 5G1RA 2Q34A 3T8BA 1O8UA 3H0JA 4FN8A 3LAOA 3QXZA 3GKBA 5INFA 5DZKH 4JCTA 3R9TA 2A7KA 3ZWCA 2ZQRA 2C8TA 4KNPA 3RSIA 1NZYB 2EJ5A 4HNKA 4LK5A 5JBWA 2J5IB 1XNVA 3DJAA 5DZKA 2F9YA 2F9IA 4ZDFA 3GLMA 3L3SA 5C9GA 2VSUC 3SWXA 3KTHA 2J5II 1W2XA 1N6FA 1WDKA 3IAVA 4ZDCA 4J2UA 3VIVA 4B3HA 1Y7OA 2J5IA 3BPPA 1XX4A 3T88A 2J5GD 3WG5A 5INIA 4EMLA 5HUQA 1SZOA 1XNWA 2PBPA 4ZU2A 4Z0MA 2ZL3A 3HLN1 3MFMA 1FCFA 2F6IA 3MYBA 3H0QA 3GF7A 3I47A 2FW2A 3H0SA 5INGA 2ZL4A 1XO6A 3P5MA 2DUBA 3KQFA 4QIJA 4JCRA 4WZ8B 3T8AA 4L8KA 3BEZA 1DUBA 3HRXA 4U0GA 4K3WA 3ZW8A
chains in the Genus database with same CATH topology
2VSUF 3PE8A 3Q7HA 1RJNA 4JCSA 1XNYA 2GTRA 3RSTA 1EF8A 1OD2A 4U1AA 5CTCA 5DTWA 4U0GH 2ZL2A 1PIXA 3TZ3A 5KDRB 1ON3A 4RYFA 5E0SH 4IZCA 3TVWA 3Q1TA 2F6QA 3OC7A 3TV5A 1WDLA 1TG6A 1WZ8A 1UYRA 4EMMA 3QKAA 4ASIA 4FNBA 4ZDBA 4ELWA 5IKLB 3MT6A 3R9QA 3G64A 3TT6A 1UYVA 3JU1A 3FF6A 1RJMA 3PEAA 1HNUA 4G2RA 5DU4A 4JYJA 2D3TA 4RCNA 4F47A 3QREA 4FN7A 3ZW9A 1Q52A 1YG6A 3LKEA 4FZWA 3BPTA 5CTBA 3H81A 4HC8A 3KTIA 4JFCA 1HZDA 4OLQA 3K8XA 2J5GA 1EF9A 4I42A 1SG4A 2HW5A 3HE2A 1UYSA 2FZSA 5DU6A 3IBBA 4IZDA 1DCIA 3TLFA 1NZYA 4IZBA 3KTJA 3U9RB 3GF3A 3TDCA 3NJBA 2BZRA 1Q51A 5G1SA 4ZDDA 1PJHA 4GHNA 4JOTA 4YLHA 3P2LA 3ST9A 4Q1IA 3ISAA 1EY3A 4MI2A 4NEKA 4ELXA 2VREA 2WTBA 3Q0GA 3TT7A 3QWDA 4JJTA 5FUSA 3TRRA 3OMEA 4QIIA 3H02A 4DI1A 3V5IA 1HNOA 4I52A 4JWVA 1MJ3A 4JCQA 3M6MA 3U9TB 4FB8A 4MXIA 3ZWBA 4QFEA 4EMPA 1VRGA 4U19A 2IEXA 5DKPA 5E0NX 4OMRA 3OT6A 5DUFA 1YG8A 2VSUE 3GMAA 3ZWAA 2J5SA 2W3PA 2NP9A 2Q2XA 4FNDA 3N6RB 4WCZA 5DTPA 1FC9A 4I4ZA 3HP0A 1X0UA 3QK8A 1K39A 2Q35A 5JBXA 4GM2A 4WYOB 4RYFH 4NARA 2DEOA 3PGQA 4Q0GA 3KTKA 2FBMA 1N6DA 3PZKA 3IB9A 3QXIA 4K2NA 3RRVA 1ON9A 3U9SB 2VX2A 2VSSA 1N6EA 1UIYA 4NNQA 2QQ3A 2X58A 4KD6A 2VSSE 3HINA 2PPYA 5E0SA 1OD4A 2F9IB 4ZDEA 4U0HA 3T89A 1K32A 4OG1A 2X24A 4B3IA 4U18A 2A81A 2PG8A 3R9SA 3H0UA 3KTGA 1UYTA 3QYRA 5KDRA 5DUCA 4KWBA 5FIFA 3NJDA 4B3JA 1FC6A 4HDTA 3R0OA 3V5EA 4MOUA 2ZL0A 4ELSA 2A7SA 3TVUA 3QMJA 3K50A 2F9YB 2VSSF 2ZQQA 1FC7A 4K29A 4FJWD 3STAA 3M6NA 1TYFA 4JYLA 5KJPA 1WDMA 5C90A 4JVTA 2UZFA 5G1QA 3FDUA 3BF0A 4JSBA 3DORA 3Q0JA 3MOYA 3T3WA 3P85A 5DL1A 3R6HA 1JXZA 3SLLA 2VSUA 5MGBA 2CBYA 4FZWC 1J7XA 2YJGA 4L6WA 5DU8A 4KPKA 2CE3A 5G1RA 2Q34A 3T8BA 1O8UA 3H0JA 4FN8A 3LAOA 3QXZA 3GKBA 5INFA 5DZKH 4JCTA 3R9TA 2A7KA 3ZWCA 2ZQRA 2C8TA 4KNPA 3RSIA 1NZYB 2EJ5A 4HNKA 4LK5A 5JBWA 2J5IB 1XNVA 3DJAA 5DZKA 2F9YA 2F9IA 4ZDFA 3GLMA 3L3SA 5C9GA 2VSUC 3SWXA 3KTHA 2J5II 1W2XA 1N6FA 1WDKA 3IAVA 4ZDCA 4J2UA 3VIVA 4B3HA 1Y7OA 2J5IA 3BPPA 1XX4A 3T88A 2J5GD 3WG5A 5INIA 4EMLA 5HUQA 1SZOA 1XNWA 2PBPA 4ZU2A 4Z0MA 2ZL3A 3HLN1 3MFMA 1FCFA 2F6IA 3MYBA 3H0QA 3GF7A 3I47A 2FW2A 3H0SA 5INGA 2ZL4A 1XO6A 3P5MA 2DUBA 3KQFA 4QIJA 4JCRA 4WZ8B 3T8AA 4L8KA 3BEZA 1DUBA 3HRXA 4U0GA 4K3WA 3ZW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSU F;  3PE8 A;  3Q7H A;  1RJN A;  4JCS A;  1XNY A;  2GTR A;  3RST A;  1EF8 A;  1OD2 A;  4U1A A;  5CTC A;  5DTW A;  4U0G H;  2ZL2 A;  1PIX A;  3TZ3 A;  5KDR B;  1ON3 A;  4RYF A;  5E0S H;  4IZC A;  3TVW A;  3Q1T A;  2F6Q A;  3OC7 A;  3TV5 A;  1WDL A;  1TG6 A;  1WZ8 A;  1UYR A;  4EMM A;  3QKA A;  4ASI A;  4FNB A;  4ZDB A;  4ELW A;  5IKL B;  3MT6 A;  3R9Q A;  3G64 A;  3TT6 A;  1UYV A;  3JU1 A;  3FF6 A;  1RJM A;  3PEA A;  1HNU A;  4G2R A;  5DU4 A;  4JYJ A;  2D3T A;  4RCN A;  4F47 A;  3QRE A;  4FN7 A;  3ZW9 A;  1Q52 A;  1YG6 A;  3LKE A;  4FZW A;  5CTB A;  3H81 A;  4HC8 A;  3KTI A;  4JFC A;  1HZD A;  4OLQ A;  3K8X A;  2J5G A;  1EF9 A;  4I42 A;  1SG4 A;  2HW5 A;  3HE2 A;  1UYS A;  2FZS A;  5DU6 A;  3IBB A;  4IZD A;  1DCI A;  3TLF A;  1NZY A;  4IZB A;  3KTJ A;  3U9R B;  3GF3 A;  3TDC A;  3NJB A;  2BZR A;  1Q51 A;  5G1S A;  4ZDD A;  1PJH A;  4GHN A;  4JOT A;  4YLH A;  3P2L A;  3ST9 A;  4Q1I A;  3ISA A;  1EY3 A;  4MI2 A;  4NEK A;  4ELX A;  2VRE A;  2WTB A;  3Q0G A;  3TT7 A;  3QWD A;  4JJT A;  5FUS A;  3TRR A;  3OME A;  4QII A;  3H02 A;  4DI1 A;  3V5I A;  1HNO A;  4I52 A;  4JWV A;  1MJ3 A;  4JCQ A;  3M6M A;  3U9T B;  4FB8 A;  4MXI A;  3ZWB A;  4QFE A;  4EMP A;  1VRG A;  4U19 A;  2IEX A;  5DKP A;  5E0N X;  4OMR A;  3OT6 A;  5DUF A;  1YG8 A;  2VSU E;  3GMA A;  3ZWA A;  2J5S A;  2W3P A;  2NP9 A;  2Q2X A;  4FND A;  3N6R B;  4WCZ A;  5DTP A;  1FC9 A;  4I4Z A;  3HP0 A;  1X0U A;  3QK8 A;  1K39 A;  2Q35 A;  5JBX A;  4GM2 A;  4WYO B;  4RYF H;  2DEO A;  3PGQ A;  4Q0G A;  3KTK A;  2FBM A;  1N6D A;  3PZK A;  3IB9 A;  3QXI A;  4K2N A;  3RRV A;  1ON9 A;  3U9S B;  2VX2 A;  2VSS A;  1N6E A;  1UIY A;  4NNQ A;  2QQ3 A;  2X58 A;  4KD6 A;  2VSS E;  3HIN A;  2PPY A;  5E0S A;  1OD4 A;  2F9I B;  4ZDE A;  4U0H A;  3T89 A;  1K32 A;  4OG1 A;  2X24 A;  4B3I A;  4U18 A;  2A81 A;  2PG8 A;  3R9S A;  3H0U A;  3KTG A;  1UYT A;  3QYR A;  5KDR A;  5DUC A;  4KWB A;  5FIF A;  3NJD A;  4B3J A;  1FC6 A;  3R0O A;  3V5E A;  4MOU A;  2ZL0 A;  4ELS A;  2A7S A;  3TVU A;  3QMJ A;  3K50 A;  2F9Y B;  2VSS F;  2ZQQ A;  1FC7 A;  4K29 A;  4FJW D;  3STA A;  3M6N A;  1TYF A;  4JYL A;  5KJP A;  1WDM A;  5C90 A;  4JVT A;  2UZF A;  5G1Q A;  3FDU A;  3BF0 A;  4JSB A;  3DOR A;  3Q0J A;  3MOY A;  3T3W A;  3P85 A;  5DL1 A;  3R6H A;  1JXZ A;  3SLL A;  2VSU A;  5MGB A;  2CBY A;  4FZW C;  1J7X A;  4L6W A;  5DU8 A;  4KPK A;  2CE3 A;  5G1R A;  2Q34 A;  3T8B A;  1O8U A;  3H0J A;  4FN8 A;  3LAO A;  3QXZ A;  3GKB A;  5INF A;  5DZK H;  4JCT A;  3R9T A;  2A7K A;  3ZWC A;  2ZQR A;  2C8T A;  4KNP A;  3RSI A;  1NZY B;  2EJ5 A;  4HNK A;  4LK5 A;  5JBW A;  2J5I B;  1XNV A;  3DJA A;  5DZK A;  2F9Y A;  2F9I A;  4ZDF A;  3GLM A;  3L3S A;  5C9G A;  2VSU C;  3SWX A;  3KTH A;  2J5I I;  1W2X A;  1N6F A;  1WDK A;  3IAV A;  4ZDC A;  3VIV A;  4B3H A;  1Y7O A;  2J5I A;  3BPP A;  1XX4 A;  3T88 A;  2J5G D;  3WG5 A;  5INI A;  4EML A;  1SZO A;  1XNW A;  2PBP A;  4ZU2 A;  4Z0M A;  2ZL3 A;  3HLN 1;  3MFM A;  1FCF A;  2F6I A;  3MYB A;  3H0Q A;  3GF7 A;  3I47 A;  2FW2 A;  3H0S A;  5ING A;  2ZL4 A;  1XO6 A;  3P5M A;  2DUB A;  3KQF A;  4QIJ A;  4JCR A;  4WZ8 B;  3T8A A;  4L8K A;  3BEZ A;  1DUB A;  3HRX A;  4U0G A;  4K3W A;  3ZW8 A; 
#chains in the Genus database with same CATH topology
 2VSU F;  3PE8 A;  3Q7H A;  1RJN A;  4JCS A;  1XNY A;  2GTR A;  3RST A;  1EF8 A;  1OD2 A;  4U1A A;  5CTC A;  5DTW A;  4U0G H;  2ZL2 A;  1PIX A;  3TZ3 A;  5KDR B;  1ON3 A;  4RYF A;  5E0S H;  4IZC A;  3TVW A;  3Q1T A;  2F6Q A;  3OC7 A;  3TV5 A;  1WDL A;  1TG6 A;  1WZ8 A;  1UYR A;  4EMM A;  3QKA A;  4ASI A;  4FNB A;  4ZDB A;  4ELW A;  5IKL B;  3MT6 A;  3R9Q A;  3G64 A;  3TT6 A;  1UYV A;  3JU1 A;  3FF6 A;  1RJM A;  3PEA A;  1HNU A;  4G2R A;  5DU4 A;  4JYJ A;  2D3T A;  4RCN A;  4F47 A;  3QRE A;  4FN7 A;  3ZW9 A;  1Q52 A;  1YG6 A;  3LKE A;  4FZW A;  3BPT A;  5CTB A;  3H81 A;  4HC8 A;  3KTI A;  4JFC A;  1HZD A;  4OLQ A;  3K8X A;  2J5G A;  1EF9 A;  4I42 A;  1SG4 A;  2HW5 A;  3HE2 A;  1UYS A;  2FZS A;  5DU6 A;  3IBB A;  4IZD A;  1DCI A;  3TLF A;  1NZY A;  4IZB A;  3KTJ A;  3U9R B;  3GF3 A;  3TDC A;  3NJB A;  2BZR A;  1Q51 A;  5G1S A;  4ZDD A;  1PJH A;  4GHN A;  4JOT A;  4YLH A;  3P2L A;  3ST9 A;  4Q1I A;  3ISA A;  1EY3 A;  4MI2 A;  4NEK A;  4ELX A;  2VRE A;  2WTB A;  3Q0G A;  3TT7 A;  3QWD A;  4JJT A;  5FUS A;  3TRR A;  3OME A;  4QII A;  3H02 A;  4DI1 A;  3V5I A;  1HNO A;  4I52 A;  4JWV A;  1MJ3 A;  4JCQ A;  3M6M A;  3U9T B;  4FB8 A;  4MXI A;  3ZWB A;  4QFE A;  4EMP A;  1VRG A;  4U19 A;  2IEX A;  5DKP A;  5E0N X;  4OMR A;  3OT6 A;  5DUF A;  1YG8 A;  2VSU E;  3GMA A;  3ZWA A;  2J5S A;  2W3P A;  2NP9 A;  2Q2X A;  4FND A;  3N6R B;  4WCZ A;  5DTP A;  1FC9 A;  4I4Z A;  3HP0 A;  1X0U A;  3QK8 A;  1K39 A;  2Q35 A;  5JBX A;  4GM2 A;  4WYO B;  4RYF H;  4NAR A;  2DEO A;  3PGQ A;  4Q0G A;  3KTK A;  2FBM A;  1N6D A;  3PZK A;  3IB9 A;  3QXI A;  4K2N A;  3RRV A;  1ON9 A;  3U9S B;  2VX2 A;  2VSS A;  1N6E A;  1UIY A;  4NNQ A;  2QQ3 A;  2X58 A;  4KD6 A;  2VSS E;  3HIN A;  2PPY A;  5E0S A;  1OD4 A;  2F9I B;  4ZDE A;  4U0H A;  3T89 A;  1K32 A;  4OG1 A;  2X24 A;  4B3I A;  4U18 A;  2A81 A;  2PG8 A;  3R9S A;  3H0U A;  3KTG A;  1UYT A;  3QYR A;  5KDR A;  5DUC A;  4KWB A;  5FIF A;  3NJD A;  4B3J A;  1FC6 A;  4HDT A;  3R0O A;  3V5E A;  4MOU A;  2ZL0 A;  4ELS A;  2A7S A;  3TVU A;  3QMJ A;  3K50 A;  2F9Y B;  2VSS F;  2ZQQ A;  1FC7 A;  4K29 A;  4FJW D;  3STA A;  3M6N A;  1TYF A;  4JYL A;  5KJP A;  1WDM A;  5C90 A;  4JVT A;  2UZF A;  5G1Q A;  3FDU A;  3BF0 A;  4JSB A;  3DOR A;  3Q0J A;  3MOY A;  3T3W A;  3P85 A;  5DL1 A;  3R6H A;  1JXZ A;  3SLL A;  2VSU A;  5MGB A;  2CBY A;  4FZW C;  1J7X A;  2YJG A;  4L6W A;  5DU8 A;  4KPK A;  2CE3 A;  5G1R A;  2Q34 A;  3T8B A;  1O8U A;  3H0J A;  4FN8 A;  3LAO A;  3QXZ A;  3GKB A;  5INF A;  5DZK H;  4JCT A;  3R9T A;  2A7K A;  3ZWC A;  2ZQR A;  2C8T A;  4KNP A;  3RSI A;  1NZY B;  2EJ5 A;  4HNK A;  4LK5 A;  5JBW A;  2J5I B;  1XNV A;  3DJA A;  5DZK A;  2F9Y A;  2F9I A;  4ZDF A;  3GLM A;  3L3S A;  5C9G A;  2VSU C;  3SWX A;  3KTH A;  2J5I I;  1W2X A;  1N6F A;  1WDK A;  3IAV A;  4ZDC A;  4J2U A;  3VIV A;  4B3H A;  1Y7O A;  2J5I A;  3BPP A;  1XX4 A;  3T88 A;  2J5G D;  3WG5 A;  5INI A;  4EML A;  5HUQ A;  1SZO A;  1XNW A;  2PBP A;  4ZU2 A;  4Z0M A;  2ZL3 A;  3HLN 1;  3MFM A;  1FCF A;  2F6I A;  3MYB A;  3H0Q A;  3GF7 A;  3I47 A;  2FW2 A;  3H0S A;  5ING A;  2ZL4 A;  1XO6 A;  3P5M A;  2DUB A;  3KQF A;  4QIJ A;  4JCR A;  4WZ8 B;  3T8A A;  4L8K A;  3BEZ A;  1DUB A;  3HRX A;  4U0G A;  4K3W A;  3ZW8 A; 
#chains in the Genus database with same CATH homology
 2VSU F;  3PE8 A;  3Q7H A;  1RJN A;  4JCS A;  1XNY A;  2GTR A;  3RST A;  1EF8 A;  1OD2 A;  4U1A A;  5CTC A;  5DTW A;  4U0G H;  2ZL2 A;  1PIX A;  3TZ3 A;  5KDR B;  1ON3 A;  4RYF A;  5E0S H;  4IZC A;  3TVW A;  3Q1T A;  2F6Q A;  3OC7 A;  3TV5 A;  1WDL A;  1TG6 A;  1WZ8 A;  1UYR A;  4EMM A;  3QKA A;  4ASI A;  4FNB A;  4ZDB A;  4ELW A;  5IKL B;  3MT6 A;  3R9Q A;  3G64 A;  3TT6 A;  1UYV A;  3JU1 A;  3FF6 A;  1RJM A;  3PEA A;  1HNU A;  4G2R A;  5DU4 A;  4JYJ A;  2D3T A;  4RCN A;  4F47 A;  3QRE A;  4FN7 A;  3ZW9 A;  1Q52 A;  1YG6 A;  3LKE A;  4FZW A;  3BPT A;  5CTB A;  3H81 A;  4HC8 A;  3KTI A;  4JFC A;  1HZD A;  4OLQ A;  3K8X A;  2J5G A;  1EF9 A;  4I42 A;  1SG4 A;  2HW5 A;  3HE2 A;  1UYS A;  2FZS A;  5DU6 A;  3IBB A;  4IZD A;  1DCI A;  3TLF A;  1NZY A;  4IZB A;  3KTJ A;  3U9R B;  3GF3 A;  3TDC A;  3NJB A;  2BZR A;  1Q51 A;  5G1S A;  4ZDD A;  1PJH A;  4GHN A;  4JOT A;  4YLH A;  3P2L A;  3ST9 A;  4Q1I A;  3ISA A;  1EY3 A;  4MI2 A;  4NEK A;  4ELX A;  2VRE A;  2WTB A;  3Q0G A;  3TT7 A;  3QWD A;  4JJT A;  5FUS A;  3TRR A;  3OME A;  4QII A;  3H02 A;  4DI1 A;  3V5I A;  1HNO A;  4I52 A;  4JWV A;  1MJ3 A;  4JCQ A;  3M6M A;  3U9T B;  4FB8 A;  4MXI A;  3ZWB A;  4QFE A;  4EMP A;  1VRG A;  4U19 A;  2IEX A;  5DKP A;  5E0N X;  4OMR A;  3OT6 A;  5DUF A;  1YG8 A;  2VSU E;  3GMA A;  3ZWA A;  2J5S A;  2W3P A;  2NP9 A;  2Q2X A;  4FND A;  3N6R B;  4WCZ A;  5DTP A;  1FC9 A;  4I4Z A;  3HP0 A;  1X0U A;  3QK8 A;  1K39 A;  2Q35 A;  5JBX A;  4GM2 A;  4WYO B;  4RYF H;  4NAR A;  2DEO A;  3PGQ A;  4Q0G A;  3KTK A;  2FBM A;  1N6D A;  3PZK A;  3IB9 A;  3QXI A;  4K2N A;  3RRV A;  1ON9 A;  3U9S B;  2VX2 A;  2VSS A;  1N6E A;  1UIY A;  4NNQ A;  2QQ3 A;  2X58 A;  4KD6 A;  2VSS E;  3HIN A;  2PPY A;  5E0S A;  1OD4 A;  2F9I B;  4ZDE A;  4U0H A;  3T89 A;  1K32 A;  4OG1 A;  2X24 A;  4B3I A;  4U18 A;  2A81 A;  2PG8 A;  3R9S A;  3H0U A;  3KTG A;  1UYT A;  3QYR A;  5KDR A;  5DUC A;  4KWB A;  5FIF A;  3NJD A;  4B3J A;  1FC6 A;  4HDT A;  3R0O A;  3V5E A;  4MOU A;  2ZL0 A;  4ELS A;  2A7S A;  3TVU A;  3QMJ A;  3K50 A;  2F9Y B;  2VSS F;  2ZQQ A;  1FC7 A;  4K29 A;  4FJW D;  3STA A;  3M6N A;  1TYF A;  4JYL A;  5KJP A;  1WDM A;  5C90 A;  4JVT A;  2UZF A;  5G1Q A;  3FDU A;  3BF0 A;  4JSB A;  3DOR A;  3Q0J A;  3MOY A;  3T3W A;  3P85 A;  5DL1 A;  3R6H A;  1JXZ A;  3SLL A;  2VSU A;  5MGB A;  2CBY A;  4FZW C;  1J7X A;  2YJG A;  4L6W A;  5DU8 A;  4KPK A;  2CE3 A;  5G1R A;  2Q34 A;  3T8B A;  1O8U A;  3H0J A;  4FN8 A;  3LAO A;  3QXZ A;  3GKB A;  5INF A;  5DZK H;  4JCT A;  3R9T A;  2A7K A;  3ZWC A;  2ZQR A;  2C8T A;  4KNP A;  3RSI A;  1NZY B;  2EJ5 A;  4HNK A;  4LK5 A;  5JBW A;  2J5I B;  1XNV A;  3DJA A;  5DZK A;  2F9Y A;  2F9I A;  4ZDF A;  3GLM A;  3L3S A;  5C9G A;  2VSU C;  3SWX A;  3KTH A;  2J5I I;  1W2X A;  1N6F A;  1WDK A;  3IAV A;  4ZDC A;  4J2U A;  3VIV A;  4B3H A;  1Y7O A;  2J5I A;  3BPP A;  1XX4 A;  3T88 A;  2J5G D;  3WG5 A;  5INI A;  4EML A;  5HUQ A;  1SZO A;  1XNW A;  2PBP A;  4ZU2 A;  4Z0M A;  2ZL3 A;  3HLN 1;  3MFM A;  1FCF A;  2F6I A;  3MYB A;  3H0Q A;  3GF7 A;  3I47 A;  2FW2 A;  3H0S A;  5ING A;  2ZL4 A;  1XO6 A;  3P5M A;  2DUB A;  3KQF A;  4QIJ A;  4JCR A;  4WZ8 B;  3T8A A;  4L8K A;  3BEZ A;  1DUB A;  3HRX A;  4U0G A;  4K3W A;  3ZW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...