4RYFH

Clpp1/2 heterocomplex from listeria monocytogenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
183
Chain Sequence
LIPTVIAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ClpP12 heterocomplex from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 66
structure length 183
sequence length 191
chains with identical sequence I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4ryfH00
2VSUC 4JCSA 2VSSF 5KJPA 4U0HA 2CE3A 1EF8A 4JCQA 5FIFA 3H0JA 4ZDBA 2VSUE 4IZDA 3GMAA 4WZ8B 3P2LA 3R6HA 3R0OA 4JVTA 5JBWA 4RYFH 5DTPA 2NP9A 1ON3A 2A81A 2GTRA 3JU1A 3TVUA 1XNYA 1XO6A 3R9TA 3TVWA 4ZDEA 3ZWBA 5DUCA 4L6WA 3DORA 3I47A 1Q52A 1OD4A 1UIYA 1W2XA 5E0SA 2QQ3A 4QFEA 3Q0JA 4JOTA 1FC6A 2DEOA 1DCIA 3IAVA 4ZDCA 3KTKA 4JCTA 4B3JA 1Y7OA 5DUFA 5DU4A 4QIIA 3TT7A 5KDRA 1K39A 3QYRA 2ZL4A 2F6IA 4DI1A 3U9SB 3U9RB 2F9IB 2J5GA 3T3WA 1UYRA 3QXZA 3M6MA 4FNDA 4MI2A 1PIXA 4ZU2A 3RSTA 3GF7A 3OMEA 1XNWA 2DUBA 2J5IB 4IZBA 4JCRA 3TZ3A 3DJAA 3KTJA 5IKLB 3MYBA 1WDLA 4B3IA 3PGQA 1TYFA 4F47A 4FZWA 1WDMA 3GLMA 5C90A 5E0NX 2J5SA 2ZQQA 3H0QA 3HLN1 1FC7A 3OT6A 1HNUA 2Q2XA 2J5IA 3Q7HA 1N6EA 2ZQRA 2FBMA 2ZL0A 1WDKA 1SZOA 3QMJA 1UYTA 3K50A 4Q0GA 1FC9A 4Q1IA 2PBPA 3T88A 2A7SA 1NZYA 4FZWC 3MFMA 4U18A 5G1RA 4U0GH 2VX2A 3G64A 5DZKH 2F6QA 5KDRB 3TRRA 4ELXA 3TDCA 1K32A 4NNQA 4OLQA 4EMMA 2Q34A 4RCNA 3RSIA 1VRGA 4FJWD 4OG1A 3BPPA 4OMRA 3HP0A 1EF9A 3L3SA 1PJHA 3HE2A 3FF6A 4JYJA 3LKEA 4K29A 5G1SA 3SWXA 1TG6A 4ZDDA 4MXIA 2PG8A 3QREA 1HZDA 3KTHA 2Q35A 4EMPA 4GM2A 4U0GA 4U19A 2F9IA 1UYVA 3GKBA 4JFCA 4KNPA 4JYLA 3GF3A 2EJ5A 3Q1TA 3TLFA 3H0SA 4IZCA 1DUBA 3NJDA 2PPYA 4JWVA 1YG6A 3V5IA 4KWBA 3P5MA 2F9YA 2A7KA 4ELSA 3SLLA 3U9TB 1ON9A 4RYFA 4G2RA 3BF0A 1XNVA 5CTBA 1NZYB 3M6NA 3ZW8A 2X58A 5DZKA 4ZDFA 2F9YB 4I52A 4QIJA 4B3HA 2J5GD 4WYOB 5JBXA 5DL1A 2ZL2A 3PZKA 3WG5A 2FZSA 1UYSA 1FCFA 4ASIA 3R9QA 3PE8A 1EY3A 5DKPA 1MJ3A 2VSUA 3T8AA 4WCZA 3P85A 3LAOA 3HRXA 1N6FA 3STAA 2VSUF 3MOYA 3TT6A 1HNOA 3K8XA 3H0UA 3NJBA 4FNBA 4HC8A 4YLHA 3QK8A 4KD6A 2WTBA 3TV5A 2BZRA 3MT6A 4I42A 4FN7A 4LK5A 4L8KA 1JXZA 2VSSA 5MGBA 4EMLA 2D3TA 5CTCA 3N6RB 2VREA 1X0UA 2X24A 1J7XA 4GHNA 5E0SH 5INGA 2IEXA 3FDUA 2HW5A 3KTGA 3IB9A 2W3PA 4MOUA 3BEZA 3ISAA 3HINA 4FB8A 4K3WA 3ST9A 1RJNA 1SG4A 5DTWA 4Z0MA 2CBYA 3Q0GA 4FN8A 2C8TA 3ZW9A 5INIA 1RJMA 1YG8A 4JSBA 5INFA 3KTIA 3QXIA 3V5EA 4K2NA 1OD2A 2J5II 5G1QA 3IBBA 1Q51A 3KQFA 5FUSA 4NEKA 5C9GA 2UZFA 3QKAA 3H02A 3ZWCA 3T89A 3QWDA 2ZL3A 3R9SA 3ZWAA 1WZ8A 4JJTA 3RRVA 5DU6A 1O8UA 4KPKA 3OC7A 4ELWA 3H81A 3T8BA 2FW2A 1XX4A 5DU8A 2VSSE 3PEAA 1N6DA 4HNKA 4I4ZA 3VIVA 4U1AA
chains in the Genus database with same CATH superfamily
2VSUC 4JCSA 2VSSF 5KJPA 4U0HA 2CE3A 1EF8A 4JCQA 5FIFA 3H0JA 4ZDBA 2VSUE 4IZDA 3BPTA 3GMAA 4WZ8B 3P2LA 3R6HA 3R0OA 4JVTA 5JBWA 4RYFH 5DTPA 2NP9A 1ON3A 2A81A 2GTRA 3JU1A 3TVUA 1XNYA 1XO6A 3R9TA 3TVWA 4ZDEA 3ZWBA 5DUCA 4L6WA 3DORA 3I47A 1Q52A 1OD4A 1UIYA 1W2XA 5E0SA 2QQ3A 4QFEA 3Q0JA 4JOTA 1FC6A 2DEOA 1DCIA 3IAVA 4ZDCA 3KTKA 4JCTA 4B3JA 1Y7OA 5DUFA 5DU4A 4QIIA 3TT7A 5KDRA 1K39A 3QYRA 2ZL4A 2F6IA 4DI1A 3U9SB 3U9RB 2F9IB 2J5GA 4NARA 3T3WA 1UYRA 3QXZA 3M6MA 4FNDA 4MI2A 1PIXA 4ZU2A 3RSTA 3GF7A 3OMEA 1XNWA 2DUBA 2J5IB 4IZBA 4JCRA 3TZ3A 3DJAA 3KTJA 5IKLB 3MYBA 1WDLA 4B3IA 3PGQA 1TYFA 4F47A 4FZWA 1WDMA 3GLMA 5C90A 5E0NX 2J5SA 2ZQQA 3H0QA 3HLN1 1FC7A 3OT6A 1HNUA 2Q2XA 2J5IA 3Q7HA 1N6EA 2ZQRA 2FBMA 2ZL0A 1WDKA 1SZOA 3QMJA 1UYTA 3K50A 4Q0GA 1FC9A 4Q1IA 2PBPA 3T88A 2A7SA 1NZYA 4FZWC 3MFMA 4U18A 5G1RA 4U0GH 2VX2A 3G64A 5DZKH 2F6QA 5KDRB 3TRRA 4ELXA 3TDCA 1K32A 4NNQA 4OLQA 4EMMA 2Q34A 4RCNA 3RSIA 1VRGA 4FJWD 4OG1A 3BPPA 4OMRA 3HP0A 1EF9A 2YJGA 3L3SA 1PJHA 3HE2A 3FF6A 4JYJA 3LKEA 4K29A 5G1SA 3SWXA 1TG6A 4ZDDA 4MXIA 2PG8A 3QREA 1HZDA 3KTHA 2Q35A 4EMPA 4GM2A 4U0GA 4U19A 2F9IA 1UYVA 3GKBA 4JFCA 4KNPA 4JYLA 3GF3A 2EJ5A 3Q1TA 3TLFA 3H0SA 4IZCA 1DUBA 3NJDA 2PPYA 4JWVA 1YG6A 3V5IA 4KWBA 3P5MA 2F9YA 2A7KA 4ELSA 3SLLA 3U9TB 1ON9A 4RYFA 4G2RA 3BF0A 1XNVA 5CTBA 1NZYB 3M6NA 3ZW8A 2X58A 5DZKA 4ZDFA 2F9YB 4I52A 4QIJA 4B3HA 2J5GD 4WYOB 5JBXA 5DL1A 2ZL2A 3PZKA 3WG5A 2FZSA 1UYSA 1FCFA 4ASIA 3R9QA 3PE8A 1EY3A 5DKPA 1MJ3A 2VSUA 3T8AA 4WCZA 3P85A 3LAOA 3HRXA 1N6FA 3STAA 2VSUF 3MOYA 3TT6A 1HNOA 3K8XA 3H0UA 3NJBA 4FNBA 4HC8A 4YLHA 3QK8A 4KD6A 2WTBA 3TV5A 2BZRA 3MT6A 4I42A 4FN7A 4LK5A 4L8KA 1JXZA 2VSSA 5MGBA 4EMLA 2D3TA 5CTCA 3N6RB 2VREA 1X0UA 2X24A 1J7XA 4GHNA 5E0SH 5INGA 2IEXA 3FDUA 2HW5A 3KTGA 3IB9A 4HDTA 2W3PA 4MOUA 3BEZA 3ISAA 3HINA 4FB8A 4K3WA 3ST9A 1RJNA 1SG4A 5DTWA 4Z0MA 2CBYA 3Q0GA 4FN8A 2C8TA 3ZW9A 5INIA 1RJMA 1YG8A 4JSBA 5INFA 3KTIA 3QXIA 3V5EA 4K2NA 1OD2A 2J5II 5G1QA 3IBBA 1Q51A 3KQFA 5FUSA 4NEKA 5C9GA 2UZFA 3QKAA 3H02A 3ZWCA 3T89A 3QWDA 2ZL3A 3R9SA 3ZWAA 1WZ8A 5HUQA 4JJTA 3RRVA 5DU6A 1O8UA 4KPKA 3OC7A 4ELWA 3H81A 3T8BA 2FW2A 1XX4A 5DU8A 2VSSE 3PEAA 1N6DA 4HNKA 4I4ZA 4J2UA 3VIVA 4U1AA
chains in the Genus database with same CATH topology
2VSUC 4JCSA 2VSSF 5KJPA 4U0HA 2CE3A 1EF8A 4JCQA 5FIFA 3H0JA 4ZDBA 2VSUE 4IZDA 3BPTA 3GMAA 4WZ8B 3P2LA 3R6HA 3R0OA 4JVTA 5JBWA 4RYFH 5DTPA 2NP9A 1ON3A 2A81A 2GTRA 3JU1A 3TVUA 1XNYA 1XO6A 3R9TA 3TVWA 4ZDEA 3ZWBA 5DUCA 4L6WA 3DORA 3I47A 1Q52A 1OD4A 1UIYA 1W2XA 5E0SA 2QQ3A 4QFEA 3Q0JA 4JOTA 1FC6A 2DEOA 1DCIA 3IAVA 4ZDCA 3KTKA 4JCTA 4B3JA 1Y7OA 5DUFA 5DU4A 4QIIA 3TT7A 5KDRA 1K39A 3QYRA 2ZL4A 2F6IA 4DI1A 3U9SB 3U9RB 2F9IB 2J5GA 4NARA 3T3WA 1UYRA 3QXZA 3M6MA 4FNDA 4MI2A 1PIXA 4ZU2A 3RSTA 3GF7A 3OMEA 1XNWA 2DUBA 2J5IB 4IZBA 4JCRA 3TZ3A 3DJAA 3KTJA 5IKLB 3MYBA 1WDLA 4B3IA 3PGQA 1TYFA 4F47A 4FZWA 1WDMA 3GLMA 5C90A 5E0NX 2J5SA 2ZQQA 3H0QA 3HLN1 1FC7A 3OT6A 1HNUA 2Q2XA 2J5IA 3Q7HA 1N6EA 2ZQRA 2FBMA 2ZL0A 1WDKA 1SZOA 3QMJA 1UYTA 3K50A 4Q0GA 1FC9A 4Q1IA 2PBPA 3T88A 2A7SA 1NZYA 4FZWC 3MFMA 4U18A 5G1RA 4U0GH 2VX2A 3G64A 5DZKH 2F6QA 5KDRB 3TRRA 4ELXA 3TDCA 1K32A 4NNQA 4OLQA 4EMMA 2Q34A 4RCNA 3RSIA 1VRGA 4FJWD 4OG1A 3BPPA 4OMRA 3HP0A 1EF9A 2YJGA 3L3SA 1PJHA 3HE2A 3FF6A 4JYJA 3LKEA 4K29A 5G1SA 3SWXA 1TG6A 4ZDDA 4MXIA 2PG8A 3QREA 1HZDA 3KTHA 2Q35A 4EMPA 4GM2A 4U0GA 4U19A 2F9IA 1UYVA 3GKBA 4JFCA 4KNPA 4JYLA 3GF3A 2EJ5A 3Q1TA 3TLFA 3H0SA 4IZCA 1DUBA 3NJDA 2PPYA 4JWVA 1YG6A 3V5IA 4KWBA 3P5MA 2F9YA 2A7KA 4ELSA 3SLLA 3U9TB 1ON9A 4RYFA 4G2RA 3BF0A 1XNVA 5CTBA 1NZYB 3M6NA 3ZW8A 2X58A 5DZKA 4ZDFA 2F9YB 4I52A 4QIJA 4B3HA 2J5GD 4WYOB 5JBXA 5DL1A 2ZL2A 3PZKA 3WG5A 2FZSA 1UYSA 1FCFA 4ASIA 3R9QA 3PE8A 1EY3A 5DKPA 1MJ3A 2VSUA 3T8AA 4WCZA 3P85A 3LAOA 3HRXA 1N6FA 3STAA 2VSUF 3MOYA 3TT6A 1HNOA 3K8XA 3H0UA 3NJBA 4FNBA 4HC8A 4YLHA 3QK8A 4KD6A 2WTBA 3TV5A 2BZRA 3MT6A 4I42A 4FN7A 4LK5A 4L8KA 1JXZA 2VSSA 5MGBA 4EMLA 2D3TA 5CTCA 3N6RB 2VREA 1X0UA 2X24A 1J7XA 4GHNA 5E0SH 5INGA 2IEXA 3FDUA 2HW5A 3KTGA 3IB9A 4HDTA 2W3PA 4MOUA 3BEZA 3ISAA 3HINA 4FB8A 4K3WA 3ST9A 1RJNA 1SG4A 5DTWA 4Z0MA 2CBYA 3Q0GA 4FN8A 2C8TA 3ZW9A 5INIA 1RJMA 1YG8A 4JSBA 5INFA 3KTIA 3QXIA 3V5EA 4K2NA 1OD2A 2J5II 5G1QA 3IBBA 1Q51A 3KQFA 5FUSA 4NEKA 5C9GA 2UZFA 3QKAA 3H02A 3ZWCA 3T89A 3QWDA 2ZL3A 3R9SA 3ZWAA 1WZ8A 5HUQA 4JJTA 3RRVA 5DU6A 1O8UA 4KPKA 3OC7A 4ELWA 3H81A 3T8BA 2FW2A 1XX4A 5DU8A 2VSSE 3PEAA 1N6DA 4HNKA 4I4ZA 4J2UA 3VIVA 4U1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSU C;  4JCS A;  2VSS F;  5KJP A;  4U0H A;  2CE3 A;  1EF8 A;  4JCQ A;  5FIF A;  3H0J A;  4ZDB A;  2VSU E;  4IZD A;  3GMA A;  4WZ8 B;  3P2L A;  3R6H A;  3R0O A;  4JVT A;  5JBW A;  4RYF H;  5DTP A;  2NP9 A;  1ON3 A;  2A81 A;  2GTR A;  3JU1 A;  3TVU A;  1XNY A;  1XO6 A;  3R9T A;  3TVW A;  4ZDE A;  3ZWB A;  5DUC A;  4L6W A;  3DOR A;  3I47 A;  1Q52 A;  1OD4 A;  1UIY A;  1W2X A;  5E0S A;  2QQ3 A;  4QFE A;  3Q0J A;  4JOT A;  1FC6 A;  2DEO A;  1DCI A;  3IAV A;  4ZDC A;  3KTK A;  4JCT A;  4B3J A;  1Y7O A;  5DUF A;  5DU4 A;  4QII A;  3TT7 A;  5KDR A;  1K39 A;  3QYR A;  2ZL4 A;  2F6I A;  4DI1 A;  3U9S B;  3U9R B;  2F9I B;  2J5G A;  3T3W A;  1UYR A;  3QXZ A;  3M6M A;  4FND A;  4MI2 A;  1PIX A;  4ZU2 A;  3RST A;  3GF7 A;  3OME A;  1XNW A;  2DUB A;  2J5I B;  4IZB A;  4JCR A;  3TZ3 A;  3DJA A;  3KTJ A;  5IKL B;  3MYB A;  1WDL A;  4B3I A;  3PGQ A;  1TYF A;  4F47 A;  4FZW A;  1WDM A;  3GLM A;  5C90 A;  5E0N X;  2J5S A;  2ZQQ A;  3H0Q A;  3HLN 1;  1FC7 A;  3OT6 A;  1HNU A;  2Q2X A;  2J5I A;  3Q7H A;  1N6E A;  2ZQR A;  2FBM A;  2ZL0 A;  1WDK A;  1SZO A;  3QMJ A;  1UYT A;  3K50 A;  4Q0G A;  1FC9 A;  4Q1I A;  2PBP A;  3T88 A;  2A7S A;  1NZY A;  4FZW C;  3MFM A;  4U18 A;  5G1R A;  4U0G H;  2VX2 A;  3G64 A;  5DZK H;  2F6Q A;  5KDR B;  3TRR A;  4ELX A;  3TDC A;  1K32 A;  4NNQ A;  4OLQ A;  4EMM A;  2Q34 A;  4RCN A;  3RSI A;  1VRG A;  4FJW D;  4OG1 A;  3BPP A;  4OMR A;  3HP0 A;  1EF9 A;  3L3S A;  1PJH A;  3HE2 A;  3FF6 A;  4JYJ A;  3LKE A;  4K29 A;  5G1S A;  3SWX A;  1TG6 A;  4ZDD A;  4MXI A;  2PG8 A;  3QRE A;  1HZD A;  3KTH A;  2Q35 A;  4EMP A;  4GM2 A;  4U0G A;  4U19 A;  2F9I A;  1UYV A;  3GKB A;  4JFC A;  4KNP A;  4JYL A;  3GF3 A;  2EJ5 A;  3Q1T A;  3TLF A;  3H0S A;  4IZC A;  1DUB A;  3NJD A;  2PPY A;  4JWV A;  1YG6 A;  3V5I A;  4KWB A;  3P5M A;  2F9Y A;  2A7K A;  4ELS A;  3SLL A;  3U9T B;  1ON9 A;  4RYF A;  4G2R A;  3BF0 A;  1XNV A;  5CTB A;  1NZY B;  3M6N A;  3ZW8 A;  2X58 A;  5DZK A;  4ZDF A;  2F9Y B;  4I52 A;  4QIJ A;  4B3H A;  2J5G D;  4WYO B;  5JBX A;  5DL1 A;  2ZL2 A;  3PZK A;  3WG5 A;  2FZS A;  1UYS A;  1FCF A;  4ASI A;  3R9Q A;  3PE8 A;  1EY3 A;  5DKP A;  1MJ3 A;  2VSU A;  3T8A A;  4WCZ A;  3P85 A;  3LAO A;  3HRX A;  1N6F A;  3STA A;  2VSU F;  3MOY A;  3TT6 A;  1HNO A;  3K8X A;  3H0U A;  3NJB A;  4FNB A;  4HC8 A;  4YLH A;  3QK8 A;  4KD6 A;  2WTB A;  3TV5 A;  2BZR A;  3MT6 A;  4I42 A;  4FN7 A;  4LK5 A;  4L8K A;  1JXZ A;  2VSS A;  5MGB A;  4EML A;  2D3T A;  5CTC A;  3N6R B;  2VRE A;  1X0U A;  2X24 A;  1J7X A;  4GHN A;  5E0S H;  5ING A;  2IEX A;  3FDU A;  2HW5 A;  3KTG A;  3IB9 A;  2W3P A;  4MOU A;  3BEZ A;  3ISA A;  3HIN A;  4FB8 A;  4K3W A;  3ST9 A;  1RJN A;  1SG4 A;  5DTW A;  4Z0M A;  2CBY A;  3Q0G A;  4FN8 A;  2C8T A;  3ZW9 A;  5INI A;  1RJM A;  1YG8 A;  4JSB A;  5INF A;  3KTI A;  3QXI A;  3V5E A;  4K2N A;  1OD2 A;  2J5I I;  5G1Q A;  3IBB A;  1Q51 A;  3KQF A;  5FUS A;  4NEK A;  5C9G A;  2UZF A;  3QKA A;  3H02 A;  3ZWC A;  3T89 A;  3QWD A;  2ZL3 A;  3R9S A;  3ZWA A;  1WZ8 A;  4JJT A;  3RRV A;  5DU6 A;  1O8U A;  4KPK A;  3OC7 A;  4ELW A;  3H81 A;  3T8B A;  2FW2 A;  1XX4 A;  5DU8 A;  2VSS E;  3PEA A;  1N6D A;  4HNK A;  4I4Z A;  3VIV A;  4U1A A; 
#chains in the Genus database with same CATH topology
 2VSU C;  4JCS A;  2VSS F;  5KJP A;  4U0H A;  2CE3 A;  1EF8 A;  4JCQ A;  5FIF A;  3H0J A;  4ZDB A;  2VSU E;  4IZD A;  3BPT A;  3GMA A;  4WZ8 B;  3P2L A;  3R6H A;  3R0O A;  4JVT A;  5JBW A;  4RYF H;  5DTP A;  2NP9 A;  1ON3 A;  2A81 A;  2GTR A;  3JU1 A;  3TVU A;  1XNY A;  1XO6 A;  3R9T A;  3TVW A;  4ZDE A;  3ZWB A;  5DUC A;  4L6W A;  3DOR A;  3I47 A;  1Q52 A;  1OD4 A;  1UIY A;  1W2X A;  5E0S A;  2QQ3 A;  4QFE A;  3Q0J A;  4JOT A;  1FC6 A;  2DEO A;  1DCI A;  3IAV A;  4ZDC A;  3KTK A;  4JCT A;  4B3J A;  1Y7O A;  5DUF A;  5DU4 A;  4QII A;  3TT7 A;  5KDR A;  1K39 A;  3QYR A;  2ZL4 A;  2F6I A;  4DI1 A;  3U9S B;  3U9R B;  2F9I B;  2J5G A;  4NAR A;  3T3W A;  1UYR A;  3QXZ A;  3M6M A;  4FND A;  4MI2 A;  1PIX A;  4ZU2 A;  3RST A;  3GF7 A;  3OME A;  1XNW A;  2DUB A;  2J5I B;  4IZB A;  4JCR A;  3TZ3 A;  3DJA A;  3KTJ A;  5IKL B;  3MYB A;  1WDL A;  4B3I A;  3PGQ A;  1TYF A;  4F47 A;  4FZW A;  1WDM A;  3GLM A;  5C90 A;  5E0N X;  2J5S A;  2ZQQ A;  3H0Q A;  3HLN 1;  1FC7 A;  3OT6 A;  1HNU A;  2Q2X A;  2J5I A;  3Q7H A;  1N6E A;  2ZQR A;  2FBM A;  2ZL0 A;  1WDK A;  1SZO A;  3QMJ A;  1UYT A;  3K50 A;  4Q0G A;  1FC9 A;  4Q1I A;  2PBP A;  3T88 A;  2A7S A;  1NZY A;  4FZW C;  3MFM A;  4U18 A;  5G1R A;  4U0G H;  2VX2 A;  3G64 A;  5DZK H;  2F6Q A;  5KDR B;  3TRR A;  4ELX A;  3TDC A;  1K32 A;  4NNQ A;  4OLQ A;  4EMM A;  2Q34 A;  4RCN A;  3RSI A;  1VRG A;  4FJW D;  4OG1 A;  3BPP A;  4OMR A;  3HP0 A;  1EF9 A;  2YJG A;  3L3S A;  1PJH A;  3HE2 A;  3FF6 A;  4JYJ A;  3LKE A;  4K29 A;  5G1S A;  3SWX A;  1TG6 A;  4ZDD A;  4MXI A;  2PG8 A;  3QRE A;  1HZD A;  3KTH A;  2Q35 A;  4EMP A;  4GM2 A;  4U0G A;  4U19 A;  2F9I A;  1UYV A;  3GKB A;  4JFC A;  4KNP A;  4JYL A;  3GF3 A;  2EJ5 A;  3Q1T A;  3TLF A;  3H0S A;  4IZC A;  1DUB A;  3NJD A;  2PPY A;  4JWV A;  1YG6 A;  3V5I A;  4KWB A;  3P5M A;  2F9Y A;  2A7K A;  4ELS A;  3SLL A;  3U9T B;  1ON9 A;  4RYF A;  4G2R A;  3BF0 A;  1XNV A;  5CTB A;  1NZY B;  3M6N A;  3ZW8 A;  2X58 A;  5DZK A;  4ZDF A;  2F9Y B;  4I52 A;  4QIJ A;  4B3H A;  2J5G D;  4WYO B;  5JBX A;  5DL1 A;  2ZL2 A;  3PZK A;  3WG5 A;  2FZS A;  1UYS A;  1FCF A;  4ASI A;  3R9Q A;  3PE8 A;  1EY3 A;  5DKP A;  1MJ3 A;  2VSU A;  3T8A A;  4WCZ A;  3P85 A;  3LAO A;  3HRX A;  1N6F A;  3STA A;  2VSU F;  3MOY A;  3TT6 A;  1HNO A;  3K8X A;  3H0U A;  3NJB A;  4FNB A;  4HC8 A;  4YLH A;  3QK8 A;  4KD6 A;  2WTB A;  3TV5 A;  2BZR A;  3MT6 A;  4I42 A;  4FN7 A;  4LK5 A;  4L8K A;  1JXZ A;  2VSS A;  5MGB A;  4EML A;  2D3T A;  5CTC A;  3N6R B;  2VRE A;  1X0U A;  2X24 A;  1J7X A;  4GHN A;  5E0S H;  5ING A;  2IEX A;  3FDU A;  2HW5 A;  3KTG A;  3IB9 A;  4HDT A;  2W3P A;  4MOU A;  3BEZ A;  3ISA A;  3HIN A;  4FB8 A;  4K3W A;  3ST9 A;  1RJN A;  1SG4 A;  5DTW A;  4Z0M A;  2CBY A;  3Q0G A;  4FN8 A;  2C8T A;  3ZW9 A;  5INI A;  1RJM A;  1YG8 A;  4JSB A;  5INF A;  3KTI A;  3QXI A;  3V5E A;  4K2N A;  1OD2 A;  2J5I I;  5G1Q A;  3IBB A;  1Q51 A;  3KQF A;  5FUS A;  4NEK A;  5C9G A;  2UZF A;  3QKA A;  3H02 A;  3ZWC A;  3T89 A;  3QWD A;  2ZL3 A;  3R9S A;  3ZWA A;  1WZ8 A;  5HUQ A;  4JJT A;  3RRV A;  5DU6 A;  1O8U A;  4KPK A;  3OC7 A;  4ELW A;  3H81 A;  3T8B A;  2FW2 A;  1XX4 A;  5DU8 A;  2VSS E;  3PEA A;  1N6D A;  4HNK A;  4I4Z A;  4J2U A;  3VIV A;  4U1A A; 
#chains in the Genus database with same CATH homology
 2VSU C;  4JCS A;  2VSS F;  5KJP A;  4U0H A;  2CE3 A;  1EF8 A;  4JCQ A;  5FIF A;  3H0J A;  4ZDB A;  2VSU E;  4IZD A;  3BPT A;  3GMA A;  4WZ8 B;  3P2L A;  3R6H A;  3R0O A;  4JVT A;  5JBW A;  4RYF H;  5DTP A;  2NP9 A;  1ON3 A;  2A81 A;  2GTR A;  3JU1 A;  3TVU A;  1XNY A;  1XO6 A;  3R9T A;  3TVW A;  4ZDE A;  3ZWB A;  5DUC A;  4L6W A;  3DOR A;  3I47 A;  1Q52 A;  1OD4 A;  1UIY A;  1W2X A;  5E0S A;  2QQ3 A;  4QFE A;  3Q0J A;  4JOT A;  1FC6 A;  2DEO A;  1DCI A;  3IAV A;  4ZDC A;  3KTK A;  4JCT A;  4B3J A;  1Y7O A;  5DUF A;  5DU4 A;  4QII A;  3TT7 A;  5KDR A;  1K39 A;  3QYR A;  2ZL4 A;  2F6I A;  4DI1 A;  3U9S B;  3U9R B;  2F9I B;  2J5G A;  4NAR A;  3T3W A;  1UYR A;  3QXZ A;  3M6M A;  4FND A;  4MI2 A;  1PIX A;  4ZU2 A;  3RST A;  3GF7 A;  3OME A;  1XNW A;  2DUB A;  2J5I B;  4IZB A;  4JCR A;  3TZ3 A;  3DJA A;  3KTJ A;  5IKL B;  3MYB A;  1WDL A;  4B3I A;  3PGQ A;  1TYF A;  4F47 A;  4FZW A;  1WDM A;  3GLM A;  5C90 A;  5E0N X;  2J5S A;  2ZQQ A;  3H0Q A;  3HLN 1;  1FC7 A;  3OT6 A;  1HNU A;  2Q2X A;  2J5I A;  3Q7H A;  1N6E A;  2ZQR A;  2FBM A;  2ZL0 A;  1WDK A;  1SZO A;  3QMJ A;  1UYT A;  3K50 A;  4Q0G A;  1FC9 A;  4Q1I A;  2PBP A;  3T88 A;  2A7S A;  1NZY A;  4FZW C;  3MFM A;  4U18 A;  5G1R A;  4U0G H;  2VX2 A;  3G64 A;  5DZK H;  2F6Q A;  5KDR B;  3TRR A;  4ELX A;  3TDC A;  1K32 A;  4NNQ A;  4OLQ A;  4EMM A;  2Q34 A;  4RCN A;  3RSI A;  1VRG A;  4FJW D;  4OG1 A;  3BPP A;  4OMR A;  3HP0 A;  1EF9 A;  2YJG A;  3L3S A;  1PJH A;  3HE2 A;  3FF6 A;  4JYJ A;  3LKE A;  4K29 A;  5G1S A;  3SWX A;  1TG6 A;  4ZDD A;  4MXI A;  2PG8 A;  3QRE A;  1HZD A;  3KTH A;  2Q35 A;  4EMP A;  4GM2 A;  4U0G A;  4U19 A;  2F9I A;  1UYV A;  3GKB A;  4JFC A;  4KNP A;  4JYL A;  3GF3 A;  2EJ5 A;  3Q1T A;  3TLF A;  3H0S A;  4IZC A;  1DUB A;  3NJD A;  2PPY A;  4JWV A;  1YG6 A;  3V5I A;  4KWB A;  3P5M A;  2F9Y A;  2A7K A;  4ELS A;  3SLL A;  3U9T B;  1ON9 A;  4RYF A;  4G2R A;  3BF0 A;  1XNV A;  5CTB A;  1NZY B;  3M6N A;  3ZW8 A;  2X58 A;  5DZK A;  4ZDF A;  2F9Y B;  4I52 A;  4QIJ A;  4B3H A;  2J5G D;  4WYO B;  5JBX A;  5DL1 A;  2ZL2 A;  3PZK A;  3WG5 A;  2FZS A;  1UYS A;  1FCF A;  4ASI A;  3R9Q A;  3PE8 A;  1EY3 A;  5DKP A;  1MJ3 A;  2VSU A;  3T8A A;  4WCZ A;  3P85 A;  3LAO A;  3HRX A;  1N6F A;  3STA A;  2VSU F;  3MOY A;  3TT6 A;  1HNO A;  3K8X A;  3H0U A;  3NJB A;  4FNB A;  4HC8 A;  4YLH A;  3QK8 A;  4KD6 A;  2WTB A;  3TV5 A;  2BZR A;  3MT6 A;  4I42 A;  4FN7 A;  4LK5 A;  4L8K A;  1JXZ A;  2VSS A;  5MGB A;  4EML A;  2D3T A;  5CTC A;  3N6R B;  2VRE A;  1X0U A;  2X24 A;  1J7X A;  4GHN A;  5E0S H;  5ING A;  2IEX A;  3FDU A;  2HW5 A;  3KTG A;  3IB9 A;  4HDT A;  2W3P A;  4MOU A;  3BEZ A;  3ISA A;  3HIN A;  4FB8 A;  4K3W A;  3ST9 A;  1RJN A;  1SG4 A;  5DTW A;  4Z0M A;  2CBY A;  3Q0G A;  4FN8 A;  2C8T A;  3ZW9 A;  5INI A;  1RJM A;  1YG8 A;  4JSB A;  5INF A;  3KTI A;  3QXI A;  3V5E A;  4K2N A;  1OD2 A;  2J5I I;  5G1Q A;  3IBB A;  1Q51 A;  3KQF A;  5FUS A;  4NEK A;  5C9G A;  2UZF A;  3QKA A;  3H02 A;  3ZWC A;  3T89 A;  3QWD A;  2ZL3 A;  3R9S A;  3ZWA A;  1WZ8 A;  5HUQ A;  4JJT A;  3RRV A;  5DU6 A;  1O8U A;  4KPK A;  3OC7 A;  4ELW A;  3H81 A;  3T8B A;  2FW2 A;  1XX4 A;  5DU8 A;  2VSS E;  3PEA A;  1N6D A;  4HNK A;  4I4Z A;  4J2U A;  3VIV A;  4U1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...