4RYFH

Clpp1/2 heterocomplex from listeria monocytogenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
183
Chain Sequence
b'LIPTVIAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title ClpP12 heterocomplex from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 66
structure length 183
sequence length 191
chains with identical sequence I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4ryfH00
2VSSF 1WZ8A 3QYRA 5DU8A 1FC9A 3H0UA 2J5IA 4HNKA 5DZKH 4FN8A 5E0SA 5DL1A 4IZDA 3HP0A 2EJ5A 1FC6A 4L8KA 3HINA 3GMAA 4KNPA 1XO6A 1YG8A 5DTWA 1TG6A 3QREA 3ZW8A 2CBYA 3GKBA 5KDRB 3OMEA 5JBWA 3DJAA 3QWDA 5C9GA 3PZKA 2NP9A 3HRXA 4EMMA 2F9YA 2BZRA 3N6RB 3MYBA 5G1QA 1UYRA 3IB9A 4JSBA 5INIA 3WG5A 4ASIA 4QFEA 3L3SA 4WCZA 1WDMA 4F47A 2Q35A 3H0QA 3RSTA 2ZQRA 2ZL0A 4JOTA 3T3WA 4JYJA 3MOYA 3BEZA 3R0OA 4K29A 4NEKA 1HNUA 4JFCA 3V5EA 1FC7A 3T8AA 3FDUA 4NNQA 3IAVA 4QIIA 2IEXA 4KWBA 1HNOA 4HC8A 4IZBA 1SG4A 1NZYA 1VRGA 4ZDBA 4RYFH 3HLN1 4ELWA 3FF6A 3R9SA 2X58A 3Q7HA 3TT6A 3KTKA 3LKEA 5CTBA 1DUBA 2J5IB 1TYFA 3HE2A 3OC7A 3QXZA 3ZWBA 2J5GA 3H0JA 3TV5A 1OD4A 3U9RB 3IBBA 3R6HA 1N6DA 3TLFA 2VSUA 2X24A 2A7KA 3P2LA 2Q2XA 3P5MA 3NJDA 2PG8A 4U18A 4G2RA 1UYTA 3U9SB 2F9IA 2F9YB 3QMJA 4ZDFA 3Q0JA 4JJTA 3RRVA 3K8XA 2FBMA 1SZOA 2A7SA 5FIFA 3GF3A 4OMRA 1XNWA 4B3HA 1Y7OA 1W2XA 2VSUE 3I47A 1RJNA 1X0UA 4I42A 3Q1TA 3SLLA 3TDCA 3BPPA 3NJBA 4DI1A 2C8TA 2DEOA 5E0SH 3ZW9A 2Q34A 4JCRA 4I4ZA 4RCNA 4FN7A 4WZ8B 1WDKA 2HW5A 4FNBA 1NZYB 1ON9A 4LK5A 4Q1IA 4U0GA 3JU1A 4EMLA 4I52A 2VSUC 2VSUF 5G1RA 5DU4A 1Q52A 5DUCA 5G1SA 2VREA 4MOUA 4ELSA 3QKAA 1EY3A 2ZL4A 1MJ3A 3PEAA 4FZWC 3M6NA 5DTPA 2J5II 2ZL3A 1K39A 4QIJA 4KPKA 2F9IB 3DORA 1EF9A 4ZDDA 4JCTA 1N6EA 3KTIA 3TZ3A 2QQ3A 1UYSA 4JCQA 1XX4A 4U19A 5DZKA 2J5GD 5DUFA 2DUBA 1WDLA 4ZU2A 1DCIA 1UYVA 2A81A 3R9TA 3Q0GA 3H0SA 3QXIA 2J5SA 5KJPA 3KTHA 4FNDA 3SWXA 2F6IA 1O8UA 4ZDCA 2D3TA 3G64A 3VIVA 4FZWA 5DU6A 3U9TB 4U0HA 4FJWD 3TVUA 4EMPA 3STAA 1YG6A 2CE3A 3KTGA 5JBXA 1J7XA 1Q51A 3T89A 1XNYA 1XNVA 3PGQA 3MFMA 3TRRA 5FUSA 3MT6A 4OLQA 3R9QA 2PBPA 3ZWAA 4WYOB 1N6FA 5INGA 1OD2A 3KQFA 4KD6A 1UIYA 4Q0GA 3TVWA 3M6MA 2VSSA 4ZDEA 4GM2A 5MGBA 3GF7A 4U1AA 5E0NX 5KDRA 3V5IA 4RYFA 2PPYA 1RJMA 4B3JA 3P85A 2ZQQA 4B3IA 4IZCA 2GTRA 4ELXA 1FCFA 3PE8A 2FZSA 3BF0A 4K3WA 1EF8A 4U0GH 4JWVA 3H81A 4Z0MA 4MXIA 5INFA 3H02A 3T8BA 3OT6A 3ZWCA 4FB8A 1K32A 5DKPA 2VSSE 3TT7A 4JYLA 1PJHA 3K50A 3RSIA 3LAOA 4K2NA 2F6QA 2FW2A 3GLMA 3ISAA 5IKLB 4YLHA 3QK8A 4GHNA 4JVTA 1HZDA 4L6WA 1PIXA 2VX2A 3T88A 1JXZA 4OG1A 2WTBA 2W3PA 1ON3A 3KTJA 4MI2A 5CTCA 2ZL2A 2UZFA 3ST9A 5C90A 4JCSA
chains in the Genus database with same CATH superfamily
2VSSF 1WZ8A 3QYRA 5DU8A 1FC9A 3H0UA 2J5IA 4HNKA 5DZKH 4FN8A 5E0SA 5DL1A 4IZDA 3HP0A 2EJ5A 1FC6A 4L8KA 3HINA 3GMAA 4KNPA 1XO6A 1YG8A 5DTWA 1TG6A 3QREA 3ZW8A 2CBYA 3GKBA 5KDRB 3OMEA 5JBWA 3DJAA 3QWDA 5C9GA 3PZKA 2NP9A 3HRXA 4EMMA 2F9YA 2BZRA 3N6RB 3MYBA 5G1QA 1UYRA 3IB9A 4JSBA 5INIA 3WG5A 4ASIA 4QFEA 3L3SA 4WCZA 1WDMA 4F47A 2Q35A 3H0QA 3RSTA 2ZQRA 2ZL0A 4JOTA 3T3WA 4JYJA 3MOYA 3BEZA 3R0OA 4K29A 4NEKA 1HNUA 4JFCA 3V5EA 1FC7A 3T8AA 3FDUA 4NNQA 3IAVA 4QIIA 2IEXA 4KWBA 1HNOA 4HC8A 4IZBA 1SG4A 1NZYA 1VRGA 4ZDBA 4RYFH 3HLN1 4ELWA 3FF6A 3R9SA 2X58A 3Q7HA 3TT6A 3KTKA 3LKEA 5CTBA 1DUBA 2J5IB 1TYFA 3HE2A 3OC7A 3QXZA 3ZWBA 2J5GA 3H0JA 3TV5A 1OD4A 3U9RB 3IBBA 3R6HA 1N6DA 3TLFA 2VSUA 2X24A 2A7KA 3P2LA 2Q2XA 3P5MA 3NJDA 2PG8A 4U18A 4G2RA 1UYTA 3U9SB 2F9IA 4HDTA 2F9YB 3QMJA 4ZDFA 3Q0JA 4JJTA 3RRVA 3K8XA 2FBMA 1SZOA 2A7SA 5FIFA 3GF3A 4OMRA 1XNWA 4B3HA 1Y7OA 1W2XA 2VSUE 3I47A 1RJNA 1X0UA 4I42A 3Q1TA 3SLLA 3TDCA 3BPPA 3NJBA 4DI1A 2C8TA 2DEOA 5E0SH 3ZW9A 2Q34A 4J2UA 4JCRA 4I4ZA 4RCNA 4FN7A 4WZ8B 1WDKA 2HW5A 4FNBA 1NZYB 1ON9A 4LK5A 4Q1IA 4U0GA 3JU1A 4EMLA 4I52A 2VSUC 2VSUF 5G1RA 5DU4A 1Q52A 5DUCA 5G1SA 2VREA 4MOUA 4ELSA 3QKAA 1EY3A 2ZL4A 1MJ3A 5HUQA 3PEAA 4FZWC 3M6NA 5DTPA 2J5II 2ZL3A 1K39A 4QIJA 4KPKA 2F9IB 3DORA 1EF9A 4ZDDA 4JCTA 1N6EA 3KTIA 3TZ3A 2QQ3A 1UYSA 4JCQA 1XX4A 4U19A 5DZKA 2J5GD 5DUFA 2DUBA 1WDLA 4ZU2A 1DCIA 1UYVA 2A81A 3R9TA 3Q0GA 3H0SA 3QXIA 2J5SA 5KJPA 3KTHA 2YJGA 4FNDA 3SWXA 2F6IA 1O8UA 4ZDCA 2D3TA 3G64A 3VIVA 4FZWA 5DU6A 3U9TB 4U0HA 4FJWD 4NARA 3TVUA 4EMPA 3STAA 1YG6A 2CE3A 3BPTA 3KTGA 5JBXA 1J7XA 1Q51A 3T89A 1XNYA 1XNVA 3PGQA 3MFMA 3TRRA 5FUSA 3MT6A 4OLQA 3R9QA 2PBPA 3ZWAA 4WYOB 1N6FA 5INGA 1OD2A 3KQFA 4KD6A 1UIYA 4Q0GA 3TVWA 3M6MA 2VSSA 4ZDEA 4GM2A 5MGBA 3GF7A 4U1AA 5E0NX 5KDRA 3V5IA 4RYFA 2PPYA 1RJMA 4B3JA 3P85A 2ZQQA 4B3IA 4IZCA 2GTRA 4ELXA 1FCFA 3PE8A 2FZSA 3BF0A 4K3WA 1EF8A 4U0GH 4JWVA 3H81A 4Z0MA 4MXIA 5INFA 3H02A 3T8BA 3OT6A 3ZWCA 4FB8A 1K32A 5DKPA 2VSSE 3TT7A 4JYLA 1PJHA 3K50A 3RSIA 3LAOA 4K2NA 2F6QA 2FW2A 3GLMA 3ISAA 5IKLB 4YLHA 3QK8A 4GHNA 4JVTA 1HZDA 4L6WA 1PIXA 2VX2A 3T88A 1JXZA 4OG1A 2WTBA 2W3PA 1ON3A 3KTJA 4MI2A 5CTCA 2ZL2A 2UZFA 3ST9A 5C90A 4JCSA
chains in the Genus database with same CATH topology
2VSSF 1WZ8A 3QYRA 5DU8A 1FC9A 3H0UA 2J5IA 4HNKA 5DZKH 4FN8A 5E0SA 5DL1A 4IZDA 3HP0A 2EJ5A 1FC6A 4L8KA 3HINA 3GMAA 4KNPA 1XO6A 1YG8A 5DTWA 1TG6A 3QREA 3ZW8A 2CBYA 3GKBA 5KDRB 3OMEA 5JBWA 3DJAA 3QWDA 5C9GA 3PZKA 2NP9A 3HRXA 4EMMA 2F9YA 2BZRA 3N6RB 3MYBA 5G1QA 1UYRA 3IB9A 4JSBA 5INIA 3WG5A 4ASIA 4QFEA 3L3SA 4WCZA 1WDMA 4F47A 2Q35A 3H0QA 3RSTA 2ZQRA 2ZL0A 4JOTA 3T3WA 4JYJA 3MOYA 3BEZA 3R0OA 4K29A 4NEKA 1HNUA 4JFCA 3V5EA 1FC7A 3T8AA 3FDUA 4NNQA 3IAVA 4QIIA 2IEXA 4KWBA 1HNOA 4HC8A 4IZBA 1SG4A 1NZYA 1VRGA 4ZDBA 4RYFH 3HLN1 4ELWA 3FF6A 3R9SA 2X58A 3Q7HA 3TT6A 3KTKA 3LKEA 5CTBA 1DUBA 2J5IB 1TYFA 3HE2A 3OC7A 3QXZA 3ZWBA 2J5GA 3H0JA 3TV5A 1OD4A 3U9RB 3IBBA 3R6HA 1N6DA 3TLFA 2VSUA 2X24A 2A7KA 3P2LA 2Q2XA 3P5MA 3NJDA 2PG8A 4U18A 4G2RA 1UYTA 3U9SB 2F9IA 4HDTA 2F9YB 3QMJA 4ZDFA 3Q0JA 4JJTA 3RRVA 3K8XA 2FBMA 1SZOA 2A7SA 5FIFA 3GF3A 4OMRA 1XNWA 4B3HA 1Y7OA 1W2XA 2VSUE 3I47A 1RJNA 1X0UA 4I42A 3Q1TA 3SLLA 3TDCA 3BPPA 3NJBA 4DI1A 2C8TA 2DEOA 5E0SH 3ZW9A 2Q34A 4J2UA 4JCRA 4I4ZA 4RCNA 4FN7A 4WZ8B 1WDKA 2HW5A 4FNBA 1NZYB 1ON9A 4LK5A 4Q1IA 4U0GA 3JU1A 4EMLA 4I52A 2VSUC 2VSUF 5G1RA 5DU4A 1Q52A 5DUCA 5G1SA 2VREA 4MOUA 4ELSA 3QKAA 1EY3A 2ZL4A 1MJ3A 5HUQA 3PEAA 4FZWC 3M6NA 5DTPA 2J5II 2ZL3A 1K39A 4QIJA 4KPKA 2F9IB 3DORA 1EF9A 4ZDDA 4JCTA 1N6EA 3KTIA 3TZ3A 2QQ3A 1UYSA 4JCQA 1XX4A 4U19A 5DZKA 2J5GD 5DUFA 2DUBA 1WDLA 4ZU2A 1DCIA 1UYVA 2A81A 3R9TA 3Q0GA 3H0SA 3QXIA 2J5SA 5KJPA 3KTHA 2YJGA 4FNDA 3SWXA 2F6IA 1O8UA 4ZDCA 2D3TA 3G64A 3VIVA 4FZWA 5DU6A 3U9TB 4U0HA 4FJWD 4NARA 3TVUA 4EMPA 3STAA 1YG6A 2CE3A 3BPTA 3KTGA 5JBXA 1J7XA 1Q51A 3T89A 1XNYA 1XNVA 3PGQA 3MFMA 3TRRA 5FUSA 3MT6A 4OLQA 3R9QA 2PBPA 3ZWAA 4WYOB 1N6FA 5INGA 1OD2A 3KQFA 4KD6A 1UIYA 4Q0GA 3TVWA 3M6MA 2VSSA 4ZDEA 4GM2A 5MGBA 3GF7A 4U1AA 5E0NX 5KDRA 3V5IA 4RYFA 2PPYA 1RJMA 4B3JA 3P85A 2ZQQA 4B3IA 4IZCA 2GTRA 4ELXA 1FCFA 3PE8A 2FZSA 3BF0A 4K3WA 1EF8A 4U0GH 4JWVA 3H81A 4Z0MA 4MXIA 5INFA 3H02A 3T8BA 3OT6A 3ZWCA 4FB8A 1K32A 5DKPA 2VSSE 3TT7A 4JYLA 1PJHA 3K50A 3RSIA 3LAOA 4K2NA 2F6QA 2FW2A 3GLMA 3ISAA 5IKLB 4YLHA 3QK8A 4GHNA 4JVTA 1HZDA 4L6WA 1PIXA 2VX2A 3T88A 1JXZA 4OG1A 2WTBA 2W3PA 1ON3A 3KTJA 4MI2A 5CTCA 2ZL2A 2UZFA 3ST9A 5C90A 4JCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSS F;  1WZ8 A;  3QYR A;  5DU8 A;  1FC9 A;  3H0U A;  2J5I A;  4HNK A;  5DZK H;  4FN8 A;  5E0S A;  5DL1 A;  4IZD A;  3HP0 A;  2EJ5 A;  1FC6 A;  4L8K A;  3HIN A;  3GMA A;  4KNP A;  1XO6 A;  1YG8 A;  5DTW A;  1TG6 A;  3QRE A;  3ZW8 A;  2CBY A;  3GKB A;  5KDR B;  3OME A;  5JBW A;  3DJA A;  3QWD A;  5C9G A;  3PZK A;  2NP9 A;  3HRX A;  4EMM A;  2F9Y A;  2BZR A;  3N6R B;  3MYB A;  5G1Q A;  1UYR A;  3IB9 A;  4JSB A;  5INI A;  3WG5 A;  4ASI A;  4QFE A;  3L3S A;  4WCZ A;  1WDM A;  4F47 A;  2Q35 A;  3H0Q A;  3RST A;  2ZQR A;  2ZL0 A;  4JOT A;  3T3W A;  4JYJ A;  3MOY A;  3BEZ A;  3R0O A;  4K29 A;  4NEK A;  1HNU A;  4JFC A;  3V5E A;  1FC7 A;  3T8A A;  3FDU A;  4NNQ A;  3IAV A;  4QII A;  2IEX A;  4KWB A;  1HNO A;  4HC8 A;  4IZB A;  1SG4 A;  1NZY A;  1VRG A;  4ZDB A;  4RYF H;  3HLN 1;  4ELW A;  3FF6 A;  3R9S A;  2X58 A;  3Q7H A;  3TT6 A;  3KTK A;  3LKE A;  5CTB A;  1DUB A;  2J5I B;  1TYF A;  3HE2 A;  3OC7 A;  3QXZ A;  3ZWB A;  2J5G A;  3H0J A;  3TV5 A;  1OD4 A;  3U9R B;  3IBB A;  3R6H A;  1N6D A;  3TLF A;  2VSU A;  2X24 A;  2A7K A;  3P2L A;  2Q2X A;  3P5M A;  3NJD A;  2PG8 A;  4U18 A;  4G2R A;  1UYT A;  3U9S B;  2F9I A;  2F9Y B;  3QMJ A;  4ZDF A;  3Q0J A;  4JJT A;  3RRV A;  3K8X A;  2FBM A;  1SZO A;  2A7S A;  5FIF A;  3GF3 A;  4OMR A;  1XNW A;  4B3H A;  1Y7O A;  1W2X A;  2VSU E;  3I47 A;  1RJN A;  1X0U A;  4I42 A;  3Q1T A;  3SLL A;  3TDC A;  3BPP A;  3NJB A;  4DI1 A;  2C8T A;  2DEO A;  5E0S H;  3ZW9 A;  2Q34 A;  4JCR A;  4I4Z A;  4RCN A;  4FN7 A;  4WZ8 B;  1WDK A;  2HW5 A;  4FNB A;  1NZY B;  1ON9 A;  4LK5 A;  4Q1I A;  4U0G A;  3JU1 A;  4EML A;  4I52 A;  2VSU C;  2VSU F;  5G1R A;  5DU4 A;  1Q52 A;  5DUC A;  5G1S A;  2VRE A;  4MOU A;  4ELS A;  3QKA A;  1EY3 A;  2ZL4 A;  1MJ3 A;  3PEA A;  4FZW C;  3M6N A;  5DTP A;  2J5I I;  2ZL3 A;  1K39 A;  4QIJ A;  4KPK A;  2F9I B;  3DOR A;  1EF9 A;  4ZDD A;  4JCT A;  1N6E A;  3KTI A;  3TZ3 A;  2QQ3 A;  1UYS A;  4JCQ A;  1XX4 A;  4U19 A;  5DZK A;  2J5G D;  5DUF A;  2DUB A;  1WDL A;  4ZU2 A;  1DCI A;  1UYV A;  2A81 A;  3R9T A;  3Q0G A;  3H0S A;  3QXI A;  2J5S A;  5KJP A;  3KTH A;  4FND A;  3SWX A;  2F6I A;  1O8U A;  4ZDC A;  2D3T A;  3G64 A;  3VIV A;  4FZW A;  5DU6 A;  3U9T B;  4U0H A;  4FJW D;  3TVU A;  4EMP A;  3STA A;  1YG6 A;  2CE3 A;  3KTG A;  5JBX A;  1J7X A;  1Q51 A;  3T89 A;  1XNY A;  1XNV A;  3PGQ A;  3MFM A;  3TRR A;  5FUS A;  3MT6 A;  4OLQ A;  3R9Q A;  2PBP A;  3ZWA A;  4WYO B;  1N6F A;  5ING A;  1OD2 A;  3KQF A;  4KD6 A;  1UIY A;  4Q0G A;  3TVW A;  3M6M A;  2VSS A;  4ZDE A;  4GM2 A;  5MGB A;  3GF7 A;  4U1A A;  5E0N X;  5KDR A;  3V5I A;  4RYF A;  2PPY A;  1RJM A;  4B3J A;  3P85 A;  2ZQQ A;  4B3I A;  4IZC A;  2GTR A;  4ELX A;  1FCF A;  3PE8 A;  2FZS A;  3BF0 A;  4K3W A;  1EF8 A;  4U0G H;  4JWV A;  3H81 A;  4Z0M A;  4MXI A;  5INF A;  3H02 A;  3T8B A;  3OT6 A;  3ZWC A;  4FB8 A;  1K32 A;  5DKP A;  2VSS E;  3TT7 A;  4JYL A;  1PJH A;  3K50 A;  3RSI A;  3LAO A;  4K2N A;  2F6Q A;  2FW2 A;  3GLM A;  3ISA A;  5IKL B;  4YLH A;  3QK8 A;  4GHN A;  4JVT A;  1HZD A;  4L6W A;  1PIX A;  2VX2 A;  3T88 A;  1JXZ A;  4OG1 A;  2WTB A;  2W3P A;  1ON3 A;  3KTJ A;  4MI2 A;  5CTC A;  2ZL2 A;  2UZF A;  3ST9 A;  5C90 A;  4JCS A; 
#chains in the Genus database with same CATH topology
 2VSS F;  1WZ8 A;  3QYR A;  5DU8 A;  1FC9 A;  3H0U A;  2J5I A;  4HNK A;  5DZK H;  4FN8 A;  5E0S A;  5DL1 A;  4IZD A;  3HP0 A;  2EJ5 A;  1FC6 A;  4L8K A;  3HIN A;  3GMA A;  4KNP A;  1XO6 A;  1YG8 A;  5DTW A;  1TG6 A;  3QRE A;  3ZW8 A;  2CBY A;  3GKB A;  5KDR B;  3OME A;  5JBW A;  3DJA A;  3QWD A;  5C9G A;  3PZK A;  2NP9 A;  3HRX A;  4EMM A;  2F9Y A;  2BZR A;  3N6R B;  3MYB A;  5G1Q A;  1UYR A;  3IB9 A;  4JSB A;  5INI A;  3WG5 A;  4ASI A;  4QFE A;  3L3S A;  4WCZ A;  1WDM A;  4F47 A;  2Q35 A;  3H0Q A;  3RST A;  2ZQR A;  2ZL0 A;  4JOT A;  3T3W A;  4JYJ A;  3MOY A;  3BEZ A;  3R0O A;  4K29 A;  4NEK A;  1HNU A;  4JFC A;  3V5E A;  1FC7 A;  3T8A A;  3FDU A;  4NNQ A;  3IAV A;  4QII A;  2IEX A;  4KWB A;  1HNO A;  4HC8 A;  4IZB A;  1SG4 A;  1NZY A;  1VRG A;  4ZDB A;  4RYF H;  3HLN 1;  4ELW A;  3FF6 A;  3R9S A;  2X58 A;  3Q7H A;  3TT6 A;  3KTK A;  3LKE A;  5CTB A;  1DUB A;  2J5I B;  1TYF A;  3HE2 A;  3OC7 A;  3QXZ A;  3ZWB A;  2J5G A;  3H0J A;  3TV5 A;  1OD4 A;  3U9R B;  3IBB A;  3R6H A;  1N6D A;  3TLF A;  2VSU A;  2X24 A;  2A7K A;  3P2L A;  2Q2X A;  3P5M A;  3NJD A;  2PG8 A;  4U18 A;  4G2R A;  1UYT A;  3U9S B;  2F9I A;  4HDT A;  2F9Y B;  3QMJ A;  4ZDF A;  3Q0J A;  4JJT A;  3RRV A;  3K8X A;  2FBM A;  1SZO A;  2A7S A;  5FIF A;  3GF3 A;  4OMR A;  1XNW A;  4B3H A;  1Y7O A;  1W2X A;  2VSU E;  3I47 A;  1RJN A;  1X0U A;  4I42 A;  3Q1T A;  3SLL A;  3TDC A;  3BPP A;  3NJB A;  4DI1 A;  2C8T A;  2DEO A;  5E0S H;  3ZW9 A;  2Q34 A;  4J2U A;  4JCR A;  4I4Z A;  4RCN A;  4FN7 A;  4WZ8 B;  1WDK A;  2HW5 A;  4FNB A;  1NZY B;  1ON9 A;  4LK5 A;  4Q1I A;  4U0G A;  3JU1 A;  4EML A;  4I52 A;  2VSU C;  2VSU F;  5G1R A;  5DU4 A;  1Q52 A;  5DUC A;  5G1S A;  2VRE A;  4MOU A;  4ELS A;  3QKA A;  1EY3 A;  2ZL4 A;  1MJ3 A;  5HUQ A;  3PEA A;  4FZW C;  3M6N A;  5DTP A;  2J5I I;  2ZL3 A;  1K39 A;  4QIJ A;  4KPK A;  2F9I B;  3DOR A;  1EF9 A;  4ZDD A;  4JCT A;  1N6E A;  3KTI A;  3TZ3 A;  2QQ3 A;  1UYS A;  4JCQ A;  1XX4 A;  4U19 A;  5DZK A;  2J5G D;  5DUF A;  2DUB A;  1WDL A;  4ZU2 A;  1DCI A;  1UYV A;  2A81 A;  3R9T A;  3Q0G A;  3H0S A;  3QXI A;  2J5S A;  5KJP A;  3KTH A;  2YJG A;  4FND A;  3SWX A;  2F6I A;  1O8U A;  4ZDC A;  2D3T A;  3G64 A;  3VIV A;  4FZW A;  5DU6 A;  3U9T B;  4U0H A;  4FJW D;  4NAR A;  3TVU A;  4EMP A;  3STA A;  1YG6 A;  2CE3 A;  3BPT A;  3KTG A;  5JBX A;  1J7X A;  1Q51 A;  3T89 A;  1XNY A;  1XNV A;  3PGQ A;  3MFM A;  3TRR A;  5FUS A;  3MT6 A;  4OLQ A;  3R9Q A;  2PBP A;  3ZWA A;  4WYO B;  1N6F A;  5ING A;  1OD2 A;  3KQF A;  4KD6 A;  1UIY A;  4Q0G A;  3TVW A;  3M6M A;  2VSS A;  4ZDE A;  4GM2 A;  5MGB A;  3GF7 A;  4U1A A;  5E0N X;  5KDR A;  3V5I A;  4RYF A;  2PPY A;  1RJM A;  4B3J A;  3P85 A;  2ZQQ A;  4B3I A;  4IZC A;  2GTR A;  4ELX A;  1FCF A;  3PE8 A;  2FZS A;  3BF0 A;  4K3W A;  1EF8 A;  4U0G H;  4JWV A;  3H81 A;  4Z0M A;  4MXI A;  5INF A;  3H02 A;  3T8B A;  3OT6 A;  3ZWC A;  4FB8 A;  1K32 A;  5DKP A;  2VSS E;  3TT7 A;  4JYL A;  1PJH A;  3K50 A;  3RSI A;  3LAO A;  4K2N A;  2F6Q A;  2FW2 A;  3GLM A;  3ISA A;  5IKL B;  4YLH A;  3QK8 A;  4GHN A;  4JVT A;  1HZD A;  4L6W A;  1PIX A;  2VX2 A;  3T88 A;  1JXZ A;  4OG1 A;  2WTB A;  2W3P A;  1ON3 A;  3KTJ A;  4MI2 A;  5CTC A;  2ZL2 A;  2UZF A;  3ST9 A;  5C90 A;  4JCS A; 
#chains in the Genus database with same CATH homology
 2VSS F;  1WZ8 A;  3QYR A;  5DU8 A;  1FC9 A;  3H0U A;  2J5I A;  4HNK A;  5DZK H;  4FN8 A;  5E0S A;  5DL1 A;  4IZD A;  3HP0 A;  2EJ5 A;  1FC6 A;  4L8K A;  3HIN A;  3GMA A;  4KNP A;  1XO6 A;  1YG8 A;  5DTW A;  1TG6 A;  3QRE A;  3ZW8 A;  2CBY A;  3GKB A;  5KDR B;  3OME A;  5JBW A;  3DJA A;  3QWD A;  5C9G A;  3PZK A;  2NP9 A;  3HRX A;  4EMM A;  2F9Y A;  2BZR A;  3N6R B;  3MYB A;  5G1Q A;  1UYR A;  3IB9 A;  4JSB A;  5INI A;  3WG5 A;  4ASI A;  4QFE A;  3L3S A;  4WCZ A;  1WDM A;  4F47 A;  2Q35 A;  3H0Q A;  3RST A;  2ZQR A;  2ZL0 A;  4JOT A;  3T3W A;  4JYJ A;  3MOY A;  3BEZ A;  3R0O A;  4K29 A;  4NEK A;  1HNU A;  4JFC A;  3V5E A;  1FC7 A;  3T8A A;  3FDU A;  4NNQ A;  3IAV A;  4QII A;  2IEX A;  4KWB A;  1HNO A;  4HC8 A;  4IZB A;  1SG4 A;  1NZY A;  1VRG A;  4ZDB A;  4RYF H;  3HLN 1;  4ELW A;  3FF6 A;  3R9S A;  2X58 A;  3Q7H A;  3TT6 A;  3KTK A;  3LKE A;  5CTB A;  1DUB A;  2J5I B;  1TYF A;  3HE2 A;  3OC7 A;  3QXZ A;  3ZWB A;  2J5G A;  3H0J A;  3TV5 A;  1OD4 A;  3U9R B;  3IBB A;  3R6H A;  1N6D A;  3TLF A;  2VSU A;  2X24 A;  2A7K A;  3P2L A;  2Q2X A;  3P5M A;  3NJD A;  2PG8 A;  4U18 A;  4G2R A;  1UYT A;  3U9S B;  2F9I A;  4HDT A;  2F9Y B;  3QMJ A;  4ZDF A;  3Q0J A;  4JJT A;  3RRV A;  3K8X A;  2FBM A;  1SZO A;  2A7S A;  5FIF A;  3GF3 A;  4OMR A;  1XNW A;  4B3H A;  1Y7O A;  1W2X A;  2VSU E;  3I47 A;  1RJN A;  1X0U A;  4I42 A;  3Q1T A;  3SLL A;  3TDC A;  3BPP A;  3NJB A;  4DI1 A;  2C8T A;  2DEO A;  5E0S H;  3ZW9 A;  2Q34 A;  4J2U A;  4JCR A;  4I4Z A;  4RCN A;  4FN7 A;  4WZ8 B;  1WDK A;  2HW5 A;  4FNB A;  1NZY B;  1ON9 A;  4LK5 A;  4Q1I A;  4U0G A;  3JU1 A;  4EML A;  4I52 A;  2VSU C;  2VSU F;  5G1R A;  5DU4 A;  1Q52 A;  5DUC A;  5G1S A;  2VRE A;  4MOU A;  4ELS A;  3QKA A;  1EY3 A;  2ZL4 A;  1MJ3 A;  5HUQ A;  3PEA A;  4FZW C;  3M6N A;  5DTP A;  2J5I I;  2ZL3 A;  1K39 A;  4QIJ A;  4KPK A;  2F9I B;  3DOR A;  1EF9 A;  4ZDD A;  4JCT A;  1N6E A;  3KTI A;  3TZ3 A;  2QQ3 A;  1UYS A;  4JCQ A;  1XX4 A;  4U19 A;  5DZK A;  2J5G D;  5DUF A;  2DUB A;  1WDL A;  4ZU2 A;  1DCI A;  1UYV A;  2A81 A;  3R9T A;  3Q0G A;  3H0S A;  3QXI A;  2J5S A;  5KJP A;  3KTH A;  2YJG A;  4FND A;  3SWX A;  2F6I A;  1O8U A;  4ZDC A;  2D3T A;  3G64 A;  3VIV A;  4FZW A;  5DU6 A;  3U9T B;  4U0H A;  4FJW D;  4NAR A;  3TVU A;  4EMP A;  3STA A;  1YG6 A;  2CE3 A;  3BPT A;  3KTG A;  5JBX A;  1J7X A;  1Q51 A;  3T89 A;  1XNY A;  1XNV A;  3PGQ A;  3MFM A;  3TRR A;  5FUS A;  3MT6 A;  4OLQ A;  3R9Q A;  2PBP A;  3ZWA A;  4WYO B;  1N6F A;  5ING A;  1OD2 A;  3KQF A;  4KD6 A;  1UIY A;  4Q0G A;  3TVW A;  3M6M A;  2VSS A;  4ZDE A;  4GM2 A;  5MGB A;  3GF7 A;  4U1A A;  5E0N X;  5KDR A;  3V5I A;  4RYF A;  2PPY A;  1RJM A;  4B3J A;  3P85 A;  2ZQQ A;  4B3I A;  4IZC A;  2GTR A;  4ELX A;  1FCF A;  3PE8 A;  2FZS A;  3BF0 A;  4K3W A;  1EF8 A;  4U0G H;  4JWV A;  3H81 A;  4Z0M A;  4MXI A;  5INF A;  3H02 A;  3T8B A;  3OT6 A;  3ZWC A;  4FB8 A;  1K32 A;  5DKP A;  2VSS E;  3TT7 A;  4JYL A;  1PJH A;  3K50 A;  3RSI A;  3LAO A;  4K2N A;  2F6Q A;  2FW2 A;  3GLM A;  3ISA A;  5IKL B;  4YLH A;  3QK8 A;  4GHN A;  4JVT A;  1HZD A;  4L6W A;  1PIX A;  2VX2 A;  3T88 A;  1JXZ A;  4OG1 A;  2WTB A;  2W3P A;  1ON3 A;  3KTJ A;  4MI2 A;  5CTC A;  2ZL2 A;  2UZF A;  3ST9 A;  5C90 A;  4JCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...