4RYPA

Crystal structure of t. brucei farnesyl diphosphate synthase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
366
structure length
351
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Farnesyl diphosphate synthase inhibitors with unique ligand-binding geometries.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 139
structure length 351
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4rypA00
3NF2A 4PVXF 2VF6A 3WCGA 3WCFA 5B0LA 3S9VA 5B0JA 5IM1A 3M01A 2F89F 4LFGA 4PVYF 3QQVA 4RXEA 5ERNA 1RQIA 5ILIA 3WCDA 5A0JA 4LFVF 3WE9A 3WEHA 1VG7A 2Z52A 2OA6A 1HX9A 3PYBA 2PS8A 2Z4XA 2OPNA 4KQ5A 4RXCA 4H5CF 3RYWA 5IK9A 2E90A 2Z4YA 3P5RA 5B0MA 2E8XA 1N24A 3KB9A 1WL1A 2F7MF 3MAVA 2ZEVA 1WMWA 3WCBA 4NFJF 4KVYA 5AFXA 5H9DA 1N20A 4LOBA 2H8OA 2ONGA 2ZCRA 3M00A 1HM7A 3TFPA 3DYFA 4KKMA 2F9KF 4LZCA 3B7LA 3WEKA 5AELA 3RYEA 1DGPA 1V4IA 3KRCA 3PKOA 5EATA 3WCCA 3KRAB 5IL3A 3LVSA 1YYQA 3N46F 4KK2A 3ICZA 3Q2ZA 3WCJA 3EZ3A 5DGNF 2O1OA 3IBAA 3W7FA 5E8HA 1N1ZA 3OYRA 2Z78A 1KIZA 4NFIF 3CKEA 2E8UA 3UCAA 4DXJA 3EFQA 1JFAA 3Q1OA 5E8KA 5KSXF 1WL0A 3LOMA 1RQJA 3SAEA 5B0IA 2P1CA 2RAHA 2E8TA 1YJ4A 2ZCOA 4LA6A 3SDVA 3LSNA 3LMDA 1WKZA 3TFNA 5JV2F 3RBMA 3N49F 3LZ9A 4NKEA 3N3DA 5I1UA 5IKHA 4NG6A 4LZ0A 3EGTA 4E9ZA 4LTVA 4JZBA 1DI1A 4RNQA 5ER8A 4LPGF 2QISA 2EWGA 4P0VA 4H5EF 3LGZB 4DZWA 3WEFA 5DGSF 2Z50A 3N6KF 1ZW5A 1KIYA 5EAUA 4OGUA 3WCAA 4LIXA 5DHIA 3WCIA 3RMGA 1VG2A 2PS7A 3PYAA 4GP1A 4P0XA 1UBVA 3KBKA 4H5DF 4EA2A 3ACXA 3TC1A 3ZOUA 1HM4A 3WSBA 1UBWA 1YHMA 3AQBB 3G4DA 4OMGA 2Z4VA 4KFAA 2AEKA 5B02A 3P5PA 4KVIA 3KRCB 1HXGA 3OABB 5IMPA 3Q30A 5B0KA 5HN8A 3ACYA 3ZL6A 3WJKA 2Q9YA 3KROB 1YV5A 3WSAA 4LLTA 3WEJA 4XQTF 2Z4ZA 3VJAA 3NPKA 1N23A 4LXWA 5JUZF 4GP2A 4MC3A 4FJQA 3ICMA 4JVJF 5DZ2A 5IK6A 3WCMA 5B01A 3BNXA 5B00A 1N22A 4L2XF 4KPJA 4QPFA 2J5CA 4DWGA 3KRFB 3QKCA 3V1XA 3ID0A 4Q23A 1HXCA 3LG5A 3SDRA 1YHKA 3DYGA 5DGMF 3P8LA 3SDQA 1YYUA 3P8RA 4K10A 4DI5A 3N0GA 3OABA 4F6VA 4F62A 5IVGA 3KROA 1VG3A 4UMJA 3LK5A 4LPHF 5JV0F 3TS7A 5HN7A 3ZMCA 3VJCA 3LLWA 5JV1F 4KPDA 4JYXA 4XQRF 5B03A 1VG4A 3KRFA 2OGDA 1N21A 4RXDA 1WL2A 2J1OA 2ZCSA 3N45F 4N9UA 1UBYA 4EA0A 1PS1A 3N3LF 3VJ9A 2ZY1A 5IN8A 2E92A 2Q80A 2E8WA 3N1VF 3OACA 3P41A 3VJDA 4LA5A 3V1VA 5ILJA 5IK0A 4NUAA 4LFEA 3M02A 3AQCB 3KRPB 5DJPF 3N0FA 4N1ZF 3TFVA 5ILZA 4E1EA 3V66A 4LZ3A 3ICNA 4WK5A 3N5HF 5E8LA 3AQ0A 4KQSA 3ICKA 1YYTA 3CP6A 3M9UA 3NRIA 3VJ8A 5ERMA 5CG6A 4HD1A 5A0IA 2FTZA 2Q9ZA 4DHDA 4OKZA 1WL3A 3SDUA 3SDTA 3LDWA 3WEGA 4P0WA 2FORA 5IMNA 4E9UA 2PS4A 4F6XA 2F94F 2PS6A 4KQUA 4RYPA 3LGKA 4JXNA 4OKMA 5IL8A 4EA1A 5AHUB 4KVWA 3KRPA 5HN9A 4LLSA 2E94A 1YHLA 4NKFA 1YQ7A 4KWDA 3ACWA 1EZFA 5A0KA 5DJRF 2OPMA 2I19A 5EASA 3DYHA 3Q2QA 5IMIA 1V4EA 3VJEA 2F8CF 2E93A 1N1BA 2Z7IA 4LTZA 3WC9A 1V4JA 2E8VA 3M0GA 3AE0A 5CG5A 4KUXA 5HNAA 4MC0A 1UBXA 1HXAA 5DW7A 5ILYA 3OACB 3LEEA 3NPRA 3WCEA 1VG6A 3N5JF 5DJVF 5JA0F 3ADZA 3G4FA 1RTRA 3IPIA 4RXAA 2Z7HA 3BNYA 5AYPA 4ZQ8A 3ASXA 5EROA 1V4KA 4XQSF 3S4JA 5ILDA 2E4OA 2DH4A 4KVDA 5DHKA 1FPSA 4NFKF 1WY0A 1V4HA 2AELA 2ZEUA 3WJOA 3ZMBA 4JXYA 4DEMF 1JFGA 4JZXA 2E95A 3APZA 4FP4A 2AZKA 3WCHA 2AZJA 2ZCQA 4LUUA 4OMHA 5C05A 3PH7A 2J1PA 2ONHA 2E91A 2F92F 2Q58A 3VJBA 1YYRA 4DWBA 3MZVA 2AETA 2F8ZF 2AZLA 3KRAA 3CC9A 5IKAA 4GA3A 4MC8A 3ZCDA 5ILKA 3WJNA 5DIQF 4GAXA 2PS5A 5ILHA 2Z4WA 3N1WF 3WEIA 1YYSA 3PDEA 4QXSF 3WCLA 3LJIA
chains in the Genus database with same CATH superfamily
3NF2A 4PVXF 2VF6A 3WCGA 3WCFA 5B0LA 3S9VA 5B0JA 5IM1A 3M01A 2F89F 4LFGA 4PVYF 3QQVA 4RXEA 5ERNA 1RQIA 5ILIA 3WCDA 5A0JA 4LFVF 3WE9A 3WEHA 1VG7A 2Z52A 2OA6A 1HX9A 3PYBA 2PS8A 2Z4XA 2OPNA 4KQ5A 4RXCA 4H5CF 3RYWA 5IK9A 2E90A 2Z4YA 3P5RA 5B0MA 2E8XA 1N24A 3KB9A 1WL1A 2F7MF 3MAVA 2ZEVA 1WMWA 3WCBA 4NFJF 4KVYA 5AFXA 5H9DA 1N20A 4LOBA 2H8OA 2ONGA 2ZCRA 3M00A 1HM7A 3TFPA 3DYFA 4KKMA 2F9KF 4LZCA 3B7LA 3WEKA 5AELA 3RYEA 1DGPA 1V4IA 3KRCA 3PKOA 5EATA 3WCCA 3KRAB 5IL3A 3LVSA 1YYQA 3N46F 4KK2A 3ICZA 3Q2ZA 3WCJA 3EZ3A 5DGNF 2O1OA 3IBAA 3W7FA 5E8HA 1N1ZA 3OYRA 2Z78A 1KIZA 4NFIF 3CKEA 2E8UA 3UCAA 4DXJA 3EFQA 1JFAA 3Q1OA 5E8KA 5KSXF 1WL0A 3LOMA 1RQJA 3SAEA 5B0IA 2P1CA 2RAHA 2E8TA 1YJ4A 2ZCOA 4LA6A 3SDVA 3LSNA 3LMDA 1WKZA 3TFNA 5JV2F 3RBMA 3N49F 3LZ9A 4NKEA 3N3DA 5I1UA 5IKHA 4NG6A 4LZ0A 3EGTA 4E9ZA 4LTVA 4JZBA 1DI1A 4RNQA 5ER8A 4LPGF 2QISA 2EWGA 4P0VA 4H5EF 3LGZB 4DZWA 3WEFA 5DGSF 2Z50A 3N6KF 1ZW5A 1KIYA 5EAUA 4OGUA 3WCAA 4LIXA 5DHIA 3WCIA 3RMGA 1VG2A 2PS7A 3PYAA 4GP1A 4P0XA 1UBVA 3KBKA 4H5DF 4EA2A 3ACXA 3TC1A 3ZOUA 1HM4A 3WSBA 1UBWA 1YHMA 3AQBB 3G4DA 4OMGA 2Z4VA 4KFAA 2AEKA 5B02A 3P5PA 4KVIA 3KRCB 1HXGA 3OABB 5IMPA 3Q30A 5B0KA 5HN8A 3ACYA 3ZL6A 3WJKA 2Q9YA 3KROB 1YV5A 3WSAA 4LLTA 3WEJA 4XQTF 2Z4ZA 3VJAA 3NPKA 1N23A 4LXWA 5JUZF 4GP2A 4MC3A 4FJQA 3ICMA 4JVJF 5DZ2A 5IK6A 3WCMA 5B01A 3BNXA 5B00A 1N22A 4L2XF 4KPJA 4QPFA 2J5CA 4DWGA 3KRFB 3QKCA 3V1XA 3ID0A 4Q23A 1HXCA 3LG5A 3SDRA 1YHKA 3DYGA 5DGMF 3P8LA 3SDQA 1YYUA 3P8RA 4K10A 4DI5A 3N0GA 3OABA 4F6VA 4F62A 5IVGA 3KROA 1VG3A 4UMJA 3LK5A 4LPHF 5JV0F 3TS7A 5HN7A 3ZMCA 3VJCA 3LLWA 5JV1F 4KPDA 4JYXA 4XQRF 5B03A 1VG4A 3KRFA 2OGDA 1N21A 4RXDA 1WL2A 2J1OA 2ZCSA 3N45F 4N9UA 1UBYA 4EA0A 1PS1A 3N3LF 3VJ9A 2ZY1A 5IN8A 2E92A 2Q80A 2E8WA 3N1VF 3OACA 3P41A 3VJDA 4LA5A 3V1VA 5ILJA 5IK0A 4NUAA 4LFEA 3M02A 3AQCB 3KRPB 5DJPF 3N0FA 4N1ZF 3TFVA 5ILZA 4E1EA 3V66A 4LZ3A 3ICNA 4WK5A 3N5HF 5E8LA 3AQ0A 4KQSA 3ICKA 1YYTA 3CP6A 3M9UA 3NRIA 3VJ8A 5ERMA 5CG6A 4HD1A 5A0IA 2FTZA 2Q9ZA 4DHDA 4OKZA 1WL3A 3SDUA 3SDTA 3LDWA 3WEGA 4P0WA 2FORA 5IMNA 4E9UA 2PS4A 4F6XA 2F94F 2PS6A 4KQUA 4RYPA 3LGKA 4JXNA 4OKMA 5IL8A 4EA1A 5AHUB 4KVWA 3KRPA 5HN9A 4LLSA 2E94A 1YHLA 4NKFA 1YQ7A 4KWDA 3ACWA 1EZFA 5A0KA 5DJRF 2OPMA 2I19A 5EASA 3DYHA 3Q2QA 5IMIA 1V4EA 3VJEA 2F8CF 2E93A 1N1BA 2Z7IA 4LTZA 3WC9A 1V4JA 2E8VA 3M0GA 3AE0A 5CG5A 4KUXA 5HNAA 4MC0A 1UBXA 1HXAA 5DW7A 5ILYA 3OACB 3LEEA 3NPRA 3WCEA 1VG6A 3N5JF 5DJVF 5JA0F 3ADZA 3G4FA 1RTRA 3IPIA 4RXAA 2Z7HA 3BNYA 5AYPA 4ZQ8A 3ASXA 5EROA 1V4KA 4XQSF 3S4JA 5ILDA 2E4OA 2DH4A 4KVDA 5DHKA 1FPSA 4NFKF 1WY0A 1V4HA 2AELA 2ZEUA 3WJOA 3ZMBA 4JXYA 4DEMF 1JFGA 4JZXA 2E95A 3APZA 4FP4A 2AZKA 3WCHA 2AZJA 2ZCQA 4LUUA 4OMHA 5C05A 3PH7A 2J1PA 2ONHA 2E91A 2F92F 2Q58A 3VJBA 1YYRA 4DWBA 3MZVA 2AETA 2F8ZF 2AZLA 3KRAA 3CC9A 5IKAA 4GA3A 4MC8A 3ZCDA 5ILKA 3WJNA 5DIQF 4GAXA 2PS5A 5ILHA 2Z4WA 3N1WF 3WEIA 1YYSA 3PDEA 4QXSF 3WCLA 3LJIA
chains in the Genus database with same CATH topology
3NF2A 4PVXF 2VF6A 3WCGA 3WCFA 5B0LA 3S9VA 5B0JA 5IM1A 3M01A 2F89F 4LFGA 4PVYF 3QQVA 4RXEA 5ERNA 1RQIA 5ILIA 3WCDA 5A0JA 4LFVF 3WE9A 3WEHA 1VG7A 2Z52A 2OA6A 1HX9A 3PYBA 2PS8A 2Z4XA 2OPNA 4KQ5A 4RXCA 4H5CF 3RYWA 5IK9A 2E90A 2Z4YA 3P5RA 5B0MA 2E8XA 1N24A 3KB9A 1WL1A 2F7MF 3MAVA 2ZEVA 1WMWA 3WCBA 4NFJF 4KVYA 5AFXA 5H9DA 1N20A 4LOBA 2H8OA 2ONGA 2ZCRA 3M00A 1HM7A 3TFPA 3DYFA 4KKMA 2F9KF 4LZCA 3B7LA 3WEKA 5AELA 3RYEA 1DGPA 1V4IA 3KRCA 3PKOA 5EATA 3WCCA 3KRAB 5IL3A 3LVSA 1YYQA 3N46F 4KK2A 3ICZA 3Q2ZA 3WCJA 3EZ3A 5DGNF 2O1OA 3IBAA 3W7FA 5E8HA 1N1ZA 3OYRA 2Z78A 1KIZA 4NFIF 3CKEA 2E8UA 3UCAA 4DXJA 3EFQA 1JFAA 3Q1OA 5E8KA 5KSXF 1WL0A 3LOMA 1RQJA 3SAEA 5B0IA 2P1CA 2RAHA 2E8TA 1YJ4A 2ZCOA 4LA6A 3SDVA 3LSNA 3LMDA 1WKZA 3TFNA 5JV2F 3RBMA 3N49F 3LZ9A 4NKEA 3N3DA 5I1UA 5IKHA 4NG6A 4LZ0A 3EGTA 4E9ZA 4LTVA 4JZBA 1DI1A 4RNQA 5ER8A 4LPGF 2QISA 2EWGA 4P0VA 4H5EF 3LGZB 4DZWA 3WEFA 5DGSF 2Z50A 3N6KF 1ZW5A 1KIYA 5EAUA 4OGUA 3WCAA 4LIXA 5DHIA 3WCIA 3RMGA 1VG2A 2PS7A 3PYAA 4GP1A 4P0XA 1UBVA 3KBKA 4H5DF 4EA2A 3ACXA 3TC1A 3ZOUA 1HM4A 3WSBA 1UBWA 1YHMA 3AQBB 3G4DA 4OMGA 2Z4VA 4KFAA 2AEKA 5B02A 3P5PA 4KVIA 3KRCB 1HXGA 3OABB 5IMPA 3Q30A 5B0KA 5HN8A 3ACYA 3ZL6A 3WJKA 2Q9YA 3KROB 1YV5A 3WSAA 4LLTA 3WEJA 4XQTF 2Z4ZA 3VJAA 3NPKA 1N23A 4LXWA 5JUZF 4GP2A 4MC3A 4FJQA 3ICMA 4JVJF 5DZ2A 5IK6A 3WCMA 5B01A 3BNXA 5B00A 1N22A 4L2XF 4KPJA 4QPFA 2J5CA 4DWGA 3KRFB 3QKCA 3V1XA 3ID0A 4Q23A 1HXCA 3LG5A 3SDRA 1YHKA 3DYGA 5DGMF 3P8LA 3SDQA 1YYUA 3P8RA 4K10A 4DI5A 3N0GA 3OABA 4F6VA 4F62A 5IVGA 3KROA 1VG3A 4UMJA 3LK5A 4LPHF 5JV0F 3TS7A 5HN7A 3ZMCA 3VJCA 3LLWA 5JV1F 4KPDA 4JYXA 4XQRF 5B03A 1VG4A 3KRFA 2OGDA 1N21A 4RXDA 1WL2A 2J1OA 2ZCSA 3N45F 4N9UA 1UBYA 4EA0A 1PS1A 3N3LF 3VJ9A 2ZY1A 5IN8A 2E92A 2Q80A 2E8WA 3N1VF 3OACA 3P41A 3VJDA 4LA5A 3V1VA 5ILJA 5IK0A 4NUAA 4LFEA 3M02A 3AQCB 3KRPB 5DJPF 3N0FA 4N1ZF 3TFVA 5ILZA 4E1EA 3V66A 4LZ3A 3ICNA 4WK5A 3N5HF 5E8LA 3AQ0A 4KQSA 3ICKA 1YYTA 3CP6A 3M9UA 3NRIA 3VJ8A 5ERMA 5CG6A 4HD1A 5A0IA 2FTZA 2Q9ZA 4DHDA 4OKZA 1WL3A 3SDUA 3SDTA 3LDWA 3WEGA 4P0WA 2FORA 5IMNA 4E9UA 2PS4A 4F6XA 2F94F 2PS6A 4KQUA 4RYPA 3LGKA 4JXNA 4OKMA 5IL8A 4EA1A 5AHUB 4KVWA 3KRPA 5HN9A 4LLSA 2E94A 1YHLA 4NKFA 1YQ7A 4KWDA 3ACWA 1EZFA 5A0KA 5DJRF 2OPMA 2I19A 5EASA 3DYHA 3Q2QA 5IMIA 1V4EA 3VJEA 2F8CF 2E93A 1N1BA 2Z7IA 4LTZA 3WC9A 1V4JA 2E8VA 3M0GA 3AE0A 5CG5A 4KUXA 5HNAA 4MC0A 1UBXA 1HXAA 5DW7A 5ILYA 3OACB 3LEEA 3NPRA 3WCEA 1VG6A 3N5JF 5DJVF 5JA0F 3ADZA 3G4FA 1RTRA 3IPIA 4RXAA 2Z7HA 3BNYA 5AYPA 4ZQ8A 3ASXA 5EROA 1V4KA 4XQSF 3S4JA 5ILDA 2E4OA 2DH4A 4KVDA 5DHKA 1FPSA 4NFKF 1WY0A 1V4HA 2AELA 2ZEUA 3WJOA 3ZMBA 4JXYA 4DEMF 1JFGA 4JZXA 2E95A 3APZA 4FP4A 2AZKA 3WCHA 2AZJA 2ZCQA 4LUUA 4OMHA 5C05A 3PH7A 2J1PA 2ONHA 2E91A 2F92F 2Q58A 3VJBA 1YYRA 4DWBA 3MZVA 2AETA 2F8ZF 2AZLA 3KRAA 3CC9A 5IKAA 4GA3A 4MC8A 3ZCDA 5ILKA 3WJNA 5DIQF 4GAXA 2PS5A 5ILHA 2Z4WA 3N1WF 3WEIA 1YYSA 3PDEA 4QXSF 3WCLA 3LJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF2 A;  4PVX F;  2VF6 A;  3WCG A;  3WCF A;  5B0L A;  3S9V A;  5B0J A;  5IM1 A;  3M01 A;  2F89 F;  4LFG A;  4PVY F;  3QQV A;  4RXE A;  5ERN A;  1RQI A;  5ILI A;  3WCD A;  5A0J A;  4LFV F;  3WE9 A;  3WEH A;  1VG7 A;  2Z52 A;  2OA6 A;  1HX9 A;  3PYB A;  2PS8 A;  2Z4X A;  2OPN A;  4KQ5 A;  4RXC A;  4H5C F;  3RYW A;  5IK9 A;  2E90 A;  2Z4Y A;  3P5R A;  5B0M A;  2E8X A;  1N24 A;  3KB9 A;  1WL1 A;  2F7M F;  3MAV A;  2ZEV A;  1WMW A;  3WCB A;  4NFJ F;  4KVY A;  5AFX A;  5H9D A;  1N20 A;  4LOB A;  2H8O A;  2ONG A;  2ZCR A;  3M00 A;  1HM7 A;  3TFP A;  3DYF A;  4KKM A;  2F9K F;  4LZC A;  3B7L A;  3WEK A;  5AEL A;  3RYE A;  1DGP A;  1V4I A;  3KRC A;  3PKO A;  5EAT A;  3WCC A;  3KRA B;  5IL3 A;  3LVS A;  1YYQ A;  3N46 F;  4KK2 A;  3ICZ A;  3Q2Z A;  3WCJ A;  3EZ3 A;  5DGN F;  2O1O A;  3IBA A;  3W7F A;  5E8H A;  1N1Z A;  3OYR A;  2Z78 A;  1KIZ A;  4NFI F;  3CKE A;  2E8U A;  3UCA A;  4DXJ A;  3EFQ A;  1JFA A;  3Q1O A;  5E8K A;  5KSX F;  1WL0 A;  3LOM A;  1RQJ A;  3SAE A;  5B0I A;  2P1C A;  2RAH A;  2E8T A;  1YJ4 A;  2ZCO A;  4LA6 A;  3SDV A;  3LSN A;  3LMD A;  1WKZ A;  3TFN A;  5JV2 F;  3RBM A;  3N49 F;  3LZ9 A;  4NKE A;  3N3D A;  5I1U A;  5IKH A;  4NG6 A;  4LZ0 A;  3EGT A;  4E9Z A;  4LTV A;  4JZB A;  1DI1 A;  4RNQ A;  5ER8 A;  4LPG F;  2QIS A;  2EWG A;  4P0V A;  4H5E F;  3LGZ B;  4DZW A;  3WEF A;  5DGS F;  2Z50 A;  3N6K F;  1ZW5 A;  1KIY A;  5EAU A;  4OGU A;  3WCA A;  4LIX A;  5DHI A;  3WCI A;  3RMG A;  1VG2 A;  2PS7 A;  3PYA A;  4GP1 A;  4P0X A;  1UBV A;  3KBK A;  4H5D F;  4EA2 A;  3ACX A;  3TC1 A;  3ZOU A;  1HM4 A;  3WSB A;  1UBW A;  1YHM A;  3AQB B;  3G4D A;  4OMG A;  2Z4V A;  4KFA A;  2AEK A;  5B02 A;  3P5P A;  4KVI A;  3KRC B;  1HXG A;  3OAB B;  5IMP A;  3Q30 A;  5B0K A;  5HN8 A;  3ACY A;  3ZL6 A;  3WJK A;  2Q9Y A;  3KRO B;  1YV5 A;  3WSA A;  4LLT A;  3WEJ A;  4XQT F;  2Z4Z A;  3VJA A;  3NPK A;  1N23 A;  4LXW A;  5JUZ F;  4GP2 A;  4MC3 A;  4FJQ A;  3ICM A;  4JVJ F;  5DZ2 A;  5IK6 A;  3WCM A;  5B01 A;  3BNX A;  5B00 A;  1N22 A;  4L2X F;  4KPJ A;  4QPF A;  2J5C A;  4DWG A;  3KRF B;  3QKC A;  3V1X A;  3ID0 A;  4Q23 A;  1HXC A;  3LG5 A;  3SDR A;  1YHK A;  3DYG A;  5DGM F;  3P8L A;  3SDQ A;  1YYU A;  3P8R A;  4K10 A;  4DI5 A;  3N0G A;  3OAB A;  4F6V A;  4F62 A;  5IVG A;  3KRO A;  1VG3 A;  4UMJ A;  3LK5 A;  4LPH F;  5JV0 F;  3TS7 A;  5HN7 A;  3ZMC A;  3VJC A;  3LLW A;  5JV1 F;  4KPD A;  4JYX A;  4XQR F;  5B03 A;  1VG4 A;  3KRF A;  2OGD A;  1N21 A;  4RXD A;  1WL2 A;  2J1O A;  2ZCS A;  3N45 F;  4N9U A;  1UBY A;  4EA0 A;  1PS1 A;  3N3L F;  3VJ9 A;  2ZY1 A;  5IN8 A;  2E92 A;  2Q80 A;  2E8W A;  3N1V F;  3OAC A;  3P41 A;  3VJD A;  4LA5 A;  3V1V A;  5ILJ A;  5IK0 A;  4NUA A;  4LFE A;  3M02 A;  3AQC B;  3KRP B;  5DJP F;  3N0F A;  4N1Z F;  3TFV A;  5ILZ A;  4E1E A;  3V66 A;  4LZ3 A;  3ICN A;  4WK5 A;  3N5H F;  5E8L A;  3AQ0 A;  4KQS A;  3ICK A;  1YYT A;  3CP6 A;  3M9U A;  3NRI A;  3VJ8 A;  5ERM A;  5CG6 A;  4HD1 A;  5A0I A;  2FTZ A;  2Q9Z A;  4DHD A;  4OKZ A;  1WL3 A;  3SDU A;  3SDT A;  3LDW A;  3WEG A;  4P0W A;  2FOR A;  5IMN A;  4E9U A;  2PS4 A;  4F6X A;  2F94 F;  2PS6 A;  4KQU A;  4RYP A;  3LGK A;  4JXN A;  4OKM A;  5IL8 A;  4EA1 A;  5AHU B;  4KVW A;  3KRP A;  5HN9 A;  4LLS A;  2E94 A;  1YHL A;  4NKF A;  1YQ7 A;  4KWD A;  3ACW A;  1EZF A;  5A0K A;  5DJR F;  2OPM A;  2I19 A;  5EAS A;  3DYH A;  3Q2Q A;  5IMI A;  1V4E A;  3VJE A;  2F8C F;  2E93 A;  1N1B A;  2Z7I A;  4LTZ A;  3WC9 A;  1V4J A;  2E8V A;  3M0G A;  3AE0 A;  5CG5 A;  4KUX A;  5HNA A;  4MC0 A;  1UBX A;  1HXA A;  5DW7 A;  5ILY A;  3OAC B;  3LEE A;  3NPR A;  3WCE A;  1VG6 A;  3N5J F;  5DJV F;  5JA0 F;  3ADZ A;  3G4F A;  1RTR A;  3IPI A;  4RXA A;  2Z7H A;  3BNY A;  5AYP A;  4ZQ8 A;  3ASX A;  5ERO A;  1V4K A;  4XQS F;  3S4J A;  5ILD A;  2E4O A;  2DH4 A;  4KVD A;  5DHK A;  1FPS A;  4NFK F;  1WY0 A;  1V4H A;  2AEL A;  2ZEU A;  3WJO A;  3ZMB A;  4JXY A;  4DEM F;  1JFG A;  4JZX A;  2E95 A;  3APZ A;  4FP4 A;  2AZK A;  3WCH A;  2AZJ A;  2ZCQ A;  4LUU A;  4OMH A;  5C05 A;  3PH7 A;  2J1P A;  2ONH A;  2E91 A;  2F92 F;  2Q58 A;  3VJB A;  1YYR A;  4DWB A;  3MZV A;  2AET A;  2F8Z F;  2AZL A;  3KRA A;  3CC9 A;  5IKA A;  4GA3 A;  4MC8 A;  3ZCD A;  5ILK A;  3WJN A;  5DIQ F;  4GAX A;  2PS5 A;  5ILH A;  2Z4W A;  3N1W F;  3WEI A;  1YYS A;  3PDE A;  4QXS F;  3WCL A;  3LJI A; 
#chains in the Genus database with same CATH topology
 3NF2 A;  4PVX F;  2VF6 A;  3WCG A;  3WCF A;  5B0L A;  3S9V A;  5B0J A;  5IM1 A;  3M01 A;  2F89 F;  4LFG A;  4PVY F;  3QQV A;  4RXE A;  5ERN A;  1RQI A;  5ILI A;  3WCD A;  5A0J A;  4LFV F;  3WE9 A;  3WEH A;  1VG7 A;  2Z52 A;  2OA6 A;  1HX9 A;  3PYB A;  2PS8 A;  2Z4X A;  2OPN A;  4KQ5 A;  4RXC A;  4H5C F;  3RYW A;  5IK9 A;  2E90 A;  2Z4Y A;  3P5R A;  5B0M A;  2E8X A;  1N24 A;  3KB9 A;  1WL1 A;  2F7M F;  3MAV A;  2ZEV A;  1WMW A;  3WCB A;  4NFJ F;  4KVY A;  5AFX A;  5H9D A;  1N20 A;  4LOB A;  2H8O A;  2ONG A;  2ZCR A;  3M00 A;  1HM7 A;  3TFP A;  3DYF A;  4KKM A;  2F9K F;  4LZC A;  3B7L A;  3WEK A;  5AEL A;  3RYE A;  1DGP A;  1V4I A;  3KRC A;  3PKO A;  5EAT A;  3WCC A;  3KRA B;  5IL3 A;  3LVS A;  1YYQ A;  3N46 F;  4KK2 A;  3ICZ A;  3Q2Z A;  3WCJ A;  3EZ3 A;  5DGN F;  2O1O A;  3IBA A;  3W7F A;  5E8H A;  1N1Z A;  3OYR A;  2Z78 A;  1KIZ A;  4NFI F;  3CKE A;  2E8U A;  3UCA A;  4DXJ A;  3EFQ A;  1JFA A;  3Q1O A;  5E8K A;  5KSX F;  1WL0 A;  3LOM A;  1RQJ A;  3SAE A;  5B0I A;  2P1C A;  2RAH A;  2E8T A;  1YJ4 A;  2ZCO A;  4LA6 A;  3SDV A;  3LSN A;  3LMD A;  1WKZ A;  3TFN A;  5JV2 F;  3RBM A;  3N49 F;  3LZ9 A;  4NKE A;  3N3D A;  5I1U A;  5IKH A;  4NG6 A;  4LZ0 A;  3EGT A;  4E9Z A;  4LTV A;  4JZB A;  1DI1 A;  4RNQ A;  5ER8 A;  4LPG F;  2QIS A;  2EWG A;  4P0V A;  4H5E F;  3LGZ B;  4DZW A;  3WEF A;  5DGS F;  2Z50 A;  3N6K F;  1ZW5 A;  1KIY A;  5EAU A;  4OGU A;  3WCA A;  4LIX A;  5DHI A;  3WCI A;  3RMG A;  1VG2 A;  2PS7 A;  3PYA A;  4GP1 A;  4P0X A;  1UBV A;  3KBK A;  4H5D F;  4EA2 A;  3ACX A;  3TC1 A;  3ZOU A;  1HM4 A;  3WSB A;  1UBW A;  1YHM A;  3AQB B;  3G4D A;  4OMG A;  2Z4V A;  4KFA A;  2AEK A;  5B02 A;  3P5P A;  4KVI A;  3KRC B;  1HXG A;  3OAB B;  5IMP A;  3Q30 A;  5B0K A;  5HN8 A;  3ACY A;  3ZL6 A;  3WJK A;  2Q9Y A;  3KRO B;  1YV5 A;  3WSA A;  4LLT A;  3WEJ A;  4XQT F;  2Z4Z A;  3VJA A;  3NPK A;  1N23 A;  4LXW A;  5JUZ F;  4GP2 A;  4MC3 A;  4FJQ A;  3ICM A;  4JVJ F;  5DZ2 A;  5IK6 A;  3WCM A;  5B01 A;  3BNX A;  5B00 A;  1N22 A;  4L2X F;  4KPJ A;  4QPF A;  2J5C A;  4DWG A;  3KRF B;  3QKC A;  3V1X A;  3ID0 A;  4Q23 A;  1HXC A;  3LG5 A;  3SDR A;  1YHK A;  3DYG A;  5DGM F;  3P8L A;  3SDQ A;  1YYU A;  3P8R A;  4K10 A;  4DI5 A;  3N0G A;  3OAB A;  4F6V A;  4F62 A;  5IVG A;  3KRO A;  1VG3 A;  4UMJ A;  3LK5 A;  4LPH F;  5JV0 F;  3TS7 A;  5HN7 A;  3ZMC A;  3VJC A;  3LLW A;  5JV1 F;  4KPD A;  4JYX A;  4XQR F;  5B03 A;  1VG4 A;  3KRF A;  2OGD A;  1N21 A;  4RXD A;  1WL2 A;  2J1O A;  2ZCS A;  3N45 F;  4N9U A;  1UBY A;  4EA0 A;  1PS1 A;  3N3L F;  3VJ9 A;  2ZY1 A;  5IN8 A;  2E92 A;  2Q80 A;  2E8W A;  3N1V F;  3OAC A;  3P41 A;  3VJD A;  4LA5 A;  3V1V A;  5ILJ A;  5IK0 A;  4NUA A;  4LFE A;  3M02 A;  3AQC B;  3KRP B;  5DJP F;  3N0F A;  4N1Z F;  3TFV A;  5ILZ A;  4E1E A;  3V66 A;  4LZ3 A;  3ICN A;  4WK5 A;  3N5H F;  5E8L A;  3AQ0 A;  4KQS A;  3ICK A;  1YYT A;  3CP6 A;  3M9U A;  3NRI A;  3VJ8 A;  5ERM A;  5CG6 A;  4HD1 A;  5A0I A;  2FTZ A;  2Q9Z A;  4DHD A;  4OKZ A;  1WL3 A;  3SDU A;  3SDT A;  3LDW A;  3WEG A;  4P0W A;  2FOR A;  5IMN A;  4E9U A;  2PS4 A;  4F6X A;  2F94 F;  2PS6 A;  4KQU A;  4RYP A;  3LGK A;  4JXN A;  4OKM A;  5IL8 A;  4EA1 A;  5AHU B;  4KVW A;  3KRP A;  5HN9 A;  4LLS A;  2E94 A;  1YHL A;  4NKF A;  1YQ7 A;  4KWD A;  3ACW A;  1EZF A;  5A0K A;  5DJR F;  2OPM A;  2I19 A;  5EAS A;  3DYH A;  3Q2Q A;  5IMI A;  1V4E A;  3VJE A;  2F8C F;  2E93 A;  1N1B A;  2Z7I A;  4LTZ A;  3WC9 A;  1V4J A;  2E8V A;  3M0G A;  3AE0 A;  5CG5 A;  4KUX A;  5HNA A;  4MC0 A;  1UBX A;  1HXA A;  5DW7 A;  5ILY A;  3OAC B;  3LEE A;  3NPR A;  3WCE A;  1VG6 A;  3N5J F;  5DJV F;  5JA0 F;  3ADZ A;  3G4F A;  1RTR A;  3IPI A;  4RXA A;  2Z7H A;  3BNY A;  5AYP A;  4ZQ8 A;  3ASX A;  5ERO A;  1V4K A;  4XQS F;  3S4J A;  5ILD A;  2E4O A;  2DH4 A;  4KVD A;  5DHK A;  1FPS A;  4NFK F;  1WY0 A;  1V4H A;  2AEL A;  2ZEU A;  3WJO A;  3ZMB A;  4JXY A;  4DEM F;  1JFG A;  4JZX A;  2E95 A;  3APZ A;  4FP4 A;  2AZK A;  3WCH A;  2AZJ A;  2ZCQ A;  4LUU A;  4OMH A;  5C05 A;  3PH7 A;  2J1P A;  2ONH A;  2E91 A;  2F92 F;  2Q58 A;  3VJB A;  1YYR A;  4DWB A;  3MZV A;  2AET A;  2F8Z F;  2AZL A;  3KRA A;  3CC9 A;  5IKA A;  4GA3 A;  4MC8 A;  3ZCD A;  5ILK A;  3WJN A;  5DIQ F;  4GAX A;  2PS5 A;  5ILH A;  2Z4W A;  3N1W F;  3WEI A;  1YYS A;  3PDE A;  4QXS F;  3WCL A;  3LJI A; 
#chains in the Genus database with same CATH homology
 3NF2 A;  4PVX F;  2VF6 A;  3WCG A;  3WCF A;  5B0L A;  3S9V A;  5B0J A;  5IM1 A;  3M01 A;  2F89 F;  4LFG A;  4PVY F;  3QQV A;  4RXE A;  5ERN A;  1RQI A;  5ILI A;  3WCD A;  5A0J A;  4LFV F;  3WE9 A;  3WEH A;  1VG7 A;  2Z52 A;  2OA6 A;  1HX9 A;  3PYB A;  2PS8 A;  2Z4X A;  2OPN A;  4KQ5 A;  4RXC A;  4H5C F;  3RYW A;  5IK9 A;  2E90 A;  2Z4Y A;  3P5R A;  5B0M A;  2E8X A;  1N24 A;  3KB9 A;  1WL1 A;  2F7M F;  3MAV A;  2ZEV A;  1WMW A;  3WCB A;  4NFJ F;  4KVY A;  5AFX A;  5H9D A;  1N20 A;  4LOB A;  2H8O A;  2ONG A;  2ZCR A;  3M00 A;  1HM7 A;  3TFP A;  3DYF A;  4KKM A;  2F9K F;  4LZC A;  3B7L A;  3WEK A;  5AEL A;  3RYE A;  1DGP A;  1V4I A;  3KRC A;  3PKO A;  5EAT A;  3WCC A;  3KRA B;  5IL3 A;  3LVS A;  1YYQ A;  3N46 F;  4KK2 A;  3ICZ A;  3Q2Z A;  3WCJ A;  3EZ3 A;  5DGN F;  2O1O A;  3IBA A;  3W7F A;  5E8H A;  1N1Z A;  3OYR A;  2Z78 A;  1KIZ A;  4NFI F;  3CKE A;  2E8U A;  3UCA A;  4DXJ A;  3EFQ A;  1JFA A;  3Q1O A;  5E8K A;  5KSX F;  1WL0 A;  3LOM A;  1RQJ A;  3SAE A;  5B0I A;  2P1C A;  2RAH A;  2E8T A;  1YJ4 A;  2ZCO A;  4LA6 A;  3SDV A;  3LSN A;  3LMD A;  1WKZ A;  3TFN A;  5JV2 F;  3RBM A;  3N49 F;  3LZ9 A;  4NKE A;  3N3D A;  5I1U A;  5IKH A;  4NG6 A;  4LZ0 A;  3EGT A;  4E9Z A;  4LTV A;  4JZB A;  1DI1 A;  4RNQ A;  5ER8 A;  4LPG F;  2QIS A;  2EWG A;  4P0V A;  4H5E F;  3LGZ B;  4DZW A;  3WEF A;  5DGS F;  2Z50 A;  3N6K F;  1ZW5 A;  1KIY A;  5EAU A;  4OGU A;  3WCA A;  4LIX A;  5DHI A;  3WCI A;  3RMG A;  1VG2 A;  2PS7 A;  3PYA A;  4GP1 A;  4P0X A;  1UBV A;  3KBK A;  4H5D F;  4EA2 A;  3ACX A;  3TC1 A;  3ZOU A;  1HM4 A;  3WSB A;  1UBW A;  1YHM A;  3AQB B;  3G4D A;  4OMG A;  2Z4V A;  4KFA A;  2AEK A;  5B02 A;  3P5P A;  4KVI A;  3KRC B;  1HXG A;  3OAB B;  5IMP A;  3Q30 A;  5B0K A;  5HN8 A;  3ACY A;  3ZL6 A;  3WJK A;  2Q9Y A;  3KRO B;  1YV5 A;  3WSA A;  4LLT A;  3WEJ A;  4XQT F;  2Z4Z A;  3VJA A;  3NPK A;  1N23 A;  4LXW A;  5JUZ F;  4GP2 A;  4MC3 A;  4FJQ A;  3ICM A;  4JVJ F;  5DZ2 A;  5IK6 A;  3WCM A;  5B01 A;  3BNX A;  5B00 A;  1N22 A;  4L2X F;  4KPJ A;  4QPF A;  2J5C A;  4DWG A;  3KRF B;  3QKC A;  3V1X A;  3ID0 A;  4Q23 A;  1HXC A;  3LG5 A;  3SDR A;  1YHK A;  3DYG A;  5DGM F;  3P8L A;  3SDQ A;  1YYU A;  3P8R A;  4K10 A;  4DI5 A;  3N0G A;  3OAB A;  4F6V A;  4F62 A;  5IVG A;  3KRO A;  1VG3 A;  4UMJ A;  3LK5 A;  4LPH F;  5JV0 F;  3TS7 A;  5HN7 A;  3ZMC A;  3VJC A;  3LLW A;  5JV1 F;  4KPD A;  4JYX A;  4XQR F;  5B03 A;  1VG4 A;  3KRF A;  2OGD A;  1N21 A;  4RXD A;  1WL2 A;  2J1O A;  2ZCS A;  3N45 F;  4N9U A;  1UBY A;  4EA0 A;  1PS1 A;  3N3L F;  3VJ9 A;  2ZY1 A;  5IN8 A;  2E92 A;  2Q80 A;  2E8W A;  3N1V F;  3OAC A;  3P41 A;  3VJD A;  4LA5 A;  3V1V A;  5ILJ A;  5IK0 A;  4NUA A;  4LFE A;  3M02 A;  3AQC B;  3KRP B;  5DJP F;  3N0F A;  4N1Z F;  3TFV A;  5ILZ A;  4E1E A;  3V66 A;  4LZ3 A;  3ICN A;  4WK5 A;  3N5H F;  5E8L A;  3AQ0 A;  4KQS A;  3ICK A;  1YYT A;  3CP6 A;  3M9U A;  3NRI A;  3VJ8 A;  5ERM A;  5CG6 A;  4HD1 A;  5A0I A;  2FTZ A;  2Q9Z A;  4DHD A;  4OKZ A;  1WL3 A;  3SDU A;  3SDT A;  3LDW A;  3WEG A;  4P0W A;  2FOR A;  5IMN A;  4E9U A;  2PS4 A;  4F6X A;  2F94 F;  2PS6 A;  4KQU A;  4RYP A;  3LGK A;  4JXN A;  4OKM A;  5IL8 A;  4EA1 A;  5AHU B;  4KVW A;  3KRP A;  5HN9 A;  4LLS A;  2E94 A;  1YHL A;  4NKF A;  1YQ7 A;  4KWD A;  3ACW A;  1EZF A;  5A0K A;  5DJR F;  2OPM A;  2I19 A;  5EAS A;  3DYH A;  3Q2Q A;  5IMI A;  1V4E A;  3VJE A;  2F8C F;  2E93 A;  1N1B A;  2Z7I A;  4LTZ A;  3WC9 A;  1V4J A;  2E8V A;  3M0G A;  3AE0 A;  5CG5 A;  4KUX A;  5HNA A;  4MC0 A;  1UBX A;  1HXA A;  5DW7 A;  5ILY A;  3OAC B;  3LEE A;  3NPR A;  3WCE A;  1VG6 A;  3N5J F;  5DJV F;  5JA0 F;  3ADZ A;  3G4F A;  1RTR A;  3IPI A;  4RXA A;  2Z7H A;  3BNY A;  5AYP A;  4ZQ8 A;  3ASX A;  5ERO A;  1V4K A;  4XQS F;  3S4J A;  5ILD A;  2E4O A;  2DH4 A;  4KVD A;  5DHK A;  1FPS A;  4NFK F;  1WY0 A;  1V4H A;  2AEL A;  2ZEU A;  3WJO A;  3ZMB A;  4JXY A;  4DEM F;  1JFG A;  4JZX A;  2E95 A;  3APZ A;  4FP4 A;  2AZK A;  3WCH A;  2AZJ A;  2ZCQ A;  4LUU A;  4OMH A;  5C05 A;  3PH7 A;  2J1P A;  2ONH A;  2E91 A;  2F92 F;  2Q58 A;  3VJB A;  1YYR A;  4DWB A;  3MZV A;  2AET A;  2F8Z F;  2AZL A;  3KRA A;  3CC9 A;  5IKA A;  4GA3 A;  4MC8 A;  3ZCD A;  5ILK A;  3WJN A;  5DIQ F;  4GAX A;  2PS5 A;  5ILH A;  2Z4W A;  3N1W F;  3WEI A;  1YYS A;  3PDE A;  4QXS F;  3WCL A;  3LJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...