4RYWA

Crystal structure of the photoconverted green fluorescent protein nowgfp_conv (the variant of cyan cerulean) at ph 7.0
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
227
Chain Sequence
SKGEKLFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKMSLKFICTTGKLPVPWPTLKTTLMQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNAISGNANITADKQKNGIKAYFTIRHDVEDGSVLLADHYQQNTPIGDGPVLLPDNHYLSTQSKQSKDPNEKRDHMVLLEFVTAAGIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NowGFP_conv
publication title Structure of the green fluorescent protein NowGFP with an anionic tryptophan-based chromophore.
pubmed doi rcsb
molecule tags Fluorescent protein
total genus 61
structure length 227
sequence length 228
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4rywA00
5EJUA 3VICA 4P76A 4R6DA 4W7XA 3DQ6A 1JC0A 3RWTA 3WLDA 4KW8A 5DTYA 5FVFA 4J8AA 3DQJA 2QLHA 4DKNA 4W6RA 1C4FA 3KCSA 1B9CA 2H5QA 3SSLA 3GL4A 3EK8A 4L12A 3U8CA 1YJ2A 4OQWA 4UTSA 2QRFA 4W72A 4RTCA 3SSTA 3OSRA 2DDCA 1RMOA 5EB7A 3CGLA 3I19A 2H6VA 4KF5A 2Z6XA 2YDZA 2EMOA 4W6PA 5HZTA 1JBYA 2O29A 3DPXA 2G3DB 2POXA 4TZGA 4JEOA 3EVVA 3SSYA 3DQFA 5J2OA 2C9IA 3SSKA 4W6CA 2A47A 3ST2A 1H6RA 4W6OA 1QYQA 3DQNA 1RMMA 3CB9A 4W6TA 1XA9A 5DPHA 4KF4A 2H5PA 3PJ5A 4IK8A 1ZGOA 4RYWA 2EMDA 4KA9A 5EXUA 4DXOA 3O77A 1OXDA 2VAEA 2VVJA 1YZWA 3E5WA 4OHSA 3V3DA 4XL5A 1JBZA 4W75A 3BXBA 1CV7A 5BT0A 3NEZA 3DQOA 4ORNA 4EULA 1F09A 4KGEA 3DQ1A 3DQIA 4TZAA 1GL4A 4OY4A 4GESB 3SG4A 1Q4DA 3EK7A 2OKYA 3DQ7A 1YHGA 3PIBA 1YFPA 4ZB1A 2AHAA 2A53B 3OSQA 4ZBLA 4W7EA 3DQ9A 2AH8A 2ZMWA 4ZFSA 4LJDC 3CFFA 4JFGA 4W6BA 5LTQA 2H5OA 2GX0A 3DQ5A 4RYSA 3UG0A 4DXQA 5EXCI 3DPWA 1EMMA 3WLCA 3TMRA 2WSNA 4DXNA 4B30A 1H4UA 2G5ZB 3EVRA 4J88A 5DTXA 4J89A 1YHIA 3DQ2A 3H1RA 3SG5A 4U2VA 4W6DA 3PJ7A 5HZUA 3S05A 3ED8A 1ZUXA 2HGDA 2YE0A 3PJBA 5FVGA 3U0KA 3DQMA 5DPGA 2Y0GA 1W7SA 2A56B 5H88A 5KTGA 4LJDA 4OJ0A 4XOVA 5HGEA 3SG3A 1Q4EA 3CD1A 3U0NA 3EK4A 4W6NA 1KP5A 4W6MA 2JADA 4W7AA 3SVBA 4I2YA 5DU0A 2DD7A 3SSVA 4B30B 2B3PA 3RWAA 5BTTA 1KYPA 3LSAA 4HQ8A 2DDDA 2H8QA 5DPJA 1EMBA 4Q7RA 1ZGQA 4JC2A 5BQLA 2QLEA 4XVPA 3DQDA 2WURA 3U0LA 3SVOA 2EMNA 2AWMA 3DPZA 2WISA 4JF9A 2B3QA 1XSSA 3GEXA 4IK3A 5DTZA 1GGXA 3W1DA 5T3IA 3KCTA 4EMQA 1OXFA 3VK1A 1GFLA 4W6IA 4PPKA 3LA1A 3P8UA 5DPIA 4DXMA 4PFEA 1Z1PA 4IZNA 2VZXA 4AS8A 2H5RA 4H48A 2HQKA 3SVCA 5BTTB 3SG7A 4W7DA 1EMLA 3SVSA 3BXCA 1YHHA 4L1IA 3NT9A 4EN1A 4W73A 1Z1QA 2O24A 3LVCA 3WCKA 1RRXA 1JC1A 3P28A 5DRFA 4Q9XA 3O78A 5DTLA 1W7UA 4DXPA 3ZUJA 1EMAA 3SVEA 3DQCA 2Z6ZA 3G9AA 2G6XA 1OXEA 4ZF5A 4ZIOA 1EMCA 3SG2A 3SG6A 3DQEA 2HFCA 1QY3A 2O2BA 3TMTA 1QYFA 5DQMA 2HGYA 3DQAA 4H3LA 4ZINA 4LJBA 4W6JA 4PPJA 5DQBA 4B5YA 1RMPA 2ARLA 2DUFA 5DY6A 2A46A 4N3DA 3BX9A 4GOBA 4IK1A 3GB3A 4H3NA 3SSHA 3ST4A 2BTJA 1Q4CA 2WHUA 1EMGA 3M24A 1EMKA 2YE1A 4Q9WA 3DQLA 4R6BA 3EKHA 4W6SA 4H47A 4W7FA 1F0BA 3K1KA 4BDUA 2QT2A 2WSOA 3E5VA 1BFPA 2IOVA 3LVDA 4EDOA 2VVHA 3SVUA 4KPIA 4ZF3A 2IE2A 2VVIA 3U8AA 4P1QA 4W6KA 5EBJA 2RH7A 2G16B 2QU1A 2FWQA 2PXSA 2QLIA 3IP2A 3LF4B 2ZO7A 3UFZA 2V4EC 3SSPA 4AR7A 4KGFA 2OTBA 4W6LA 2HJOA 4DXIA 4LW5A 3MGFA 3U8PA 4W74A 3H1OA 4XOWA 2WHTA 3W1CA 5LTRA 2Z6YA 4LQTA 4ANJA 4LJCA 2G3OA 5EXBA 2ZO6A 4W7CA 3OGOA 2FL1A 2FZUA 1S6ZA 4Q7UA 3CFAA 2WHSA 2DUIA 1EMFA 4W77A 5H87A 3E5TA 2HPWA 1XAEA 3BXAA 4PPLA 2AWKA 3CBEA 4KW9A 2V4EA 3VHTA 3GJ2A 3A8SA 5H89A 3DQHA 3IR8A 5LK4A 1RM9A 1KYRA 3AI4A 4HVFA 2AWLA 3ZULA 2DD9A 3LVAA 2IB6A 3EVUA 2HCGA 4IK4A 4JGEA 1QYOA 4EDSA 3SVNA 2A52B 2Z1OA 1MYWA 1XQMA 5DRGA 1EMEA 5FHVA 3SV5A 4ZF4A 4HE4A 2PXWA 3SVDA 3ADFA 2Q57A 2OJKA 2IB5A 3AI5A 3NT3A 3DQ8A 1HCJA 4W6AA 2C9JA 2QZ0A 2V4EB 5EHUA 3VHTB 3ZUFA 3ZTFA 3NEDA 2A48A 1QXTA 2VADA 3CD9A 3SS0A 4Z4KA 4H3MA 2YFPA 4IK9A 2OTEA 3LF3A 1KYSA 4W6HA 2OKWA 2ICRA 2DUEA 5AQBB 5HZOA 3GJ1A 4W76A 3ST0A 2A50B 4L13A 2GW4B 1MOUA 1HUYA 4OGSA 1Q4BA 4NWSA 2GX2A 4XGYA 1MOVA 2OGRA 2P4MA 4LQUA 1UISA 3SRYA 2QLGA 5FVIA 5LTPA 1XMZA 4W6FA 4W7RA 3EKJA 5EB6A 4W69A 2ZMUA 2AWJA 2Q6PA 4HQ9A 4JRBA 2HQZA 4GF6B 2DUGA 3LS3A 3U0MA 4W6UA 5HBDA 4IK5A 1W7TA 5HZSA 2GW3A 4Q7TA 2WIQA 2G6EA 3CFHA 5HW9A 1ZGPA 2A54B 3EVPA 3M22A 4DKMA 1YJFA 3NF0A 2DUHA 4HQCA 1Q4AA 3DQ3A 2QLGB 3DQUA 4Z4MA 3SVRA 2G2SB 2G6YA 3DQ4A 2H9WA 5F9GA 3ST3A 1G7KA 4KF5C 4KEXA 4KW4A 3AKOA 1Q73A 4KAGA 2HRSA 4W6GA 3DQKA
chains in the Genus database with same CATH superfamily
5EJUA 3VICA 4P76A 4R6DA 4W7XA 3DQ6A 1JC0A 3RWTA 3WLDA 4KW8A 5DTYA 5FVFA 4J8AA 3DQJA 2QLHA 4DKNA 4W6RA 1C4FA 3KCSA 1B9CA 2H5QA 3SSLA 3GL4A 3EK8A 4L12A 3U8CA 1YJ2A 4OQWA 4UTSA 2QRFA 4W72A 4RTCA 3SSTA 3OSRA 2DDCA 1RMOA 5EB7A 3CGLA 3I19A 2H6VA 4KF5A 2Z6XA 2YDZA 2EMOA 4W6PA 5HZTA 1JBYA 2O29A 3DPXA 2G3DB 2POXA 4TZGA 4JEOA 3EVVA 3SSYA 3DQFA 5J2OA 2C9IA 3SSKA 4W6CA 2A47A 3ST2A 1H6RA 4W6OA 1QYQA 3DQNA 1RMMA 3CB9A 4W6TA 1XA9A 5DPHA 4KF4A 2H5PA 3PJ5A 4IK8A 1ZGOA 4RYWA 2EMDA 4KA9A 5EXUA 4DXOA 3O77A 1OXDA 2VAEA 2VVJA 1YZWA 3E5WA 4OHSA 3V3DA 4XL5A 1JBZA 4W75A 3BXBA 1CV7A 5BT0A 3NEZA 3DQOA 4ORNA 4EULA 1F09A 4KGEA 3DQ1A 3DQIA 4TZAA 1GL4A 4OY4A 4GESB 3SG4A 1Q4DA 3EK7A 2OKYA 3DQ7A 1YHGA 3PIBA 1YFPA 4ZB1A 2AHAA 2A53B 3OSQA 4ZBLA 4W7EA 3DQ9A 2AH8A 2ZMWA 4ZFSA 4LJDC 3CFFA 4JFGA 4W6BA 5LTQA 2H5OA 2GX0A 3DQ5A 4RYSA 3UG0A 4DXQA 5EXCI 3DPWA 1EMMA 3WLCA 3TMRA 2WSNA 4DXNA 4B30A 1H4UA 2G5ZB 3EVRA 4J88A 5DTXA 4J89A 1YHIA 3DQ2A 3H1RA 3SG5A 4U2VA 4W6DA 3PJ7A 5HZUA 3S05A 3ED8A 1ZUXA 2HGDA 2YE0A 3PJBA 5FVGA 3U0KA 3DQMA 5DPGA 2Y0GA 1W7SA 2A56B 5H88A 5KTGA 4LJDA 4OJ0A 4XOVA 5HGEA 3SG3A 1Q4EA 3CD1A 3U0NA 3EK4A 4W6NA 1KP5A 4W6MA 2JADA 4W7AA 3SVBA 4I2YA 5DU0A 2DD7A 3SSVA 4B30B 2B3PA 3RWAA 5BTTA 1KYPA 3LSAA 4HQ8A 2DDDA 2H8QA 5DPJA 1EMBA 4Q7RA 1ZGQA 4JC2A 5BQLA 2QLEA 4XVPA 3DQDA 2WURA 3U0LA 3SVOA 2EMNA 2AWMA 3DPZA 2WISA 4JF9A 2B3QA 1XSSA 3GEXA 4IK3A 5DTZA 1GGXA 3W1DA 5T3IA 3KCTA 4EMQA 1OXFA 3VK1A 1GFLA 4W6IA 4PPKA 3LA1A 3P8UA 5DPIA 4DXMA 4PFEA 1Z1PA 4IZNA 2VZXA 4AS8A 2H5RA 4H48A 2HQKA 3SVCA 5BTTB 3SG7A 4W7DA 1EMLA 3SVSA 3BXCA 1YHHA 4L1IA 3NT9A 4EN1A 4W73A 1Z1QA 2O24A 3LVCA 3WCKA 1RRXA 1JC1A 3P28A 5DRFA 4Q9XA 3O78A 5DTLA 1W7UA 4DXPA 3ZUJA 1EMAA 3SVEA 3DQCA 2Z6ZA 3G9AA 2G6XA 1OXEA 4ZF5A 4ZIOA 1EMCA 3SG2A 3SG6A 3DQEA 2HFCA 1QY3A 2O2BA 3TMTA 1QYFA 5DQMA 2HGYA 3DQAA 4H3LA 4ZINA 4LJBA 4W6JA 4PPJA 5DQBA 4B5YA 1RMPA 2ARLA 2DUFA 5DY6A 2A46A 4N3DA 3BX9A 4GOBA 4IK1A 3GB3A 4H3NA 3SSHA 3ST4A 2BTJA 1Q4CA 2WHUA 1EMGA 3M24A 1EMKA 2YE1A 4Q9WA 3DQLA 4R6BA 3EKHA 4W6SA 4H47A 4W7FA 1F0BA 3K1KA 4BDUA 2QT2A 2WSOA 3E5VA 1BFPA 2IOVA 3LVDA 4EDOA 2VVHA 3SVUA 4KPIA 4ZF3A 2IE2A 2VVIA 3U8AA 4P1QA 4W6KA 5EBJA 2RH7A 2G16B 2QU1A 2FWQA 2PXSA 2QLIA 3IP2A 3LF4B 2ZO7A 3UFZA 2V4EC 3SSPA 4AR7A 4KGFA 2OTBA 4W6LA 2HJOA 4DXIA 4LW5A 3MGFA 3U8PA 4W74A 3H1OA 4XOWA 2WHTA 3W1CA 5LTRA 2Z6YA 4LQTA 4ANJA 4LJCA 2G3OA 5EXBA 2ZO6A 4W7CA 3OGOA 2FL1A 2FZUA 1S6ZA 4Q7UA 3CFAA 2WHSA 2DUIA 1EMFA 4W77A 5H87A 3E5TA 2HPWA 1XAEA 3BXAA 4PPLA 2AWKA 3CBEA 4KW9A 2V4EA 3VHTA 3GJ2A 3A8SA 5H89A 3DQHA 3IR8A 5LK4A 1RM9A 1KYRA 3AI4A 4HVFA 2AWLA 3ZULA 2DD9A 3LVAA 2IB6A 3EVUA 2HCGA 4IK4A 4JGEA 1QYOA 4EDSA 3SVNA 2A52B 2Z1OA 1MYWA 1XQMA 5DRGA 1EMEA 5FHVA 3SV5A 4ZF4A 4HE4A 2PXWA 3SVDA 3ADFA 2Q57A 2OJKA 2IB5A 3AI5A 3NT3A 3DQ8A 1HCJA 4W6AA 2C9JA 2QZ0A 2V4EB 5EHUA 3VHTB 3ZUFA 3ZTFA 3NEDA 2A48A 1QXTA 2VADA 3CD9A 3SS0A 4Z4KA 4H3MA 2YFPA 4IK9A 2OTEA 3LF3A 1KYSA 4W6HA 2OKWA 2ICRA 2DUEA 5AQBB 5HZOA 3GJ1A 4W76A 3ST0A 2A50B 4L13A 2GW4B 1MOUA 1HUYA 4OGSA 1Q4BA 4NWSA 2GX2A 4XGYA 1MOVA 2OGRA 2P4MA 4LQUA 1UISA 3SRYA 2QLGA 5FVIA 5LTPA 1XMZA 4W6FA 4W7RA 3EKJA 5EB6A 4W69A 2ZMUA 2AWJA 2Q6PA 4HQ9A 4JRBA 2HQZA 4GF6B 2DUGA 3LS3A 3U0MA 4W6UA 5HBDA 4IK5A 1W7TA 5HZSA 2GW3A 4Q7TA 2WIQA 2G6EA 3CFHA 5HW9A 1ZGPA 2A54B 3EVPA 3M22A 4DKMA 1YJFA 3NF0A 2DUHA 4HQCA 1Q4AA 3DQ3A 2QLGB 3DQUA 4Z4MA 3SVRA 2G2SB 2G6YA 3DQ4A 2H9WA 5F9GA 3ST3A 1G7KA 4KF5C 4KEXA 4KW4A 3AKOA 1Q73A 4KAGA 2HRSA 4W6GA 3DQKA
chains in the Genus database with same CATH topology
5EJUA 3VICA 4P76A 4R6DA 4W7XA 3DQ6A 1JC0A 3RWTA 3WLDA 4KW8A 5DTYA 5FVFA 4J8AA 3DQJA 2QLHA 4DKNA 4W6RA 1C4FA 3KCSA 1B9CA 2H5QA 3SSLA 3GL4A 3EK8A 4L12A 3U8CA 1YJ2A 4OQWA 4UTSA 2QRFA 4W72A 4RTCA 3SSTA 3OSRA 2DDCA 1RMOA 5EB7A 3CGLA 3I19A 2H6VA 4KF5A 2Z6XA 2YDZA 2EMOA 4W6PA 5HZTA 1JBYA 2O29A 3DPXA 2G3DB 2POXA 4TZGA 4JEOA 3EVVA 3SSYA 3DQFA 5J2OA 2C9IA 3SSKA 4W6CA 2A47A 3ST2A 1H6RA 4W6OA 1QYQA 3DQNA 1RMMA 3CB9A 4W6TA 1XA9A 5DPHA 4KF4A 2H5PA 3PJ5A 4IK8A 1ZGOA 4RYWA 2EMDA 4KA9A 5EXUA 4DXOA 3O77A 1OXDA 2VAEA 2VVJA 1YZWA 3E5WA 4OHSA 3V3DA 4XL5A 1JBZA 4W75A 3BXBA 1CV7A 5BT0A 3NEZA 3DQOA 4ORNA 4EULA 1F09A 4KGEA 3DQ1A 3DQIA 4TZAA 1GL4A 4OY4A 4GESB 3SG4A 1Q4DA 3EK7A 2OKYA 3DQ7A 1YHGA 3PIBA 1YFPA 4ZB1A 2AHAA 2A53B 3OSQA 4ZBLA 4W7EA 3DQ9A 2AH8A 2ZMWA 4ZFSA 4LJDC 3CFFA 4JFGA 4W6BA 5LTQA 2H5OA 2GX0A 3DQ5A 4RYSA 3UG0A 4DXQA 5EXCI 3DPWA 1EMMA 3WLCA 3TMRA 2WSNA 4DXNA 4B30A 1H4UA 2G5ZB 3EVRA 4J88A 5DTXA 4J89A 1YHIA 3DQ2A 3H1RA 3SG5A 4U2VA 4W6DA 3PJ7A 5HZUA 3S05A 3ED8A 1ZUXA 2HGDA 2YE0A 3PJBA 5FVGA 3U0KA 3DQMA 5DPGA 2Y0GA 1W7SA 2A56B 5H88A 5KTGA 4LJDA 4OJ0A 4XOVA 5HGEA 3SG3A 1Q4EA 3CD1A 3U0NA 3EK4A 4W6NA 1KP5A 4W6MA 2JADA 4W7AA 3SVBA 4I2YA 5DU0A 2DD7A 3SSVA 4B30B 2B3PA 3RWAA 5BTTA 1KYPA 3LSAA 4HQ8A 2DDDA 2H8QA 5DPJA 1EMBA 4Q7RA 1ZGQA 4JC2A 5BQLA 2QLEA 4XVPA 3DQDA 2WURA 3U0LA 3SVOA 2EMNA 2AWMA 3DPZA 2WISA 4JF9A 2B3QA 1XSSA 3GEXA 4IK3A 5DTZA 1GGXA 3W1DA 5T3IA 3KCTA 4EMQA 1OXFA 3VK1A 1GFLA 4W6IA 4PPKA 3LA1A 3P8UA 5DPIA 4DXMA 4PFEA 1Z1PA 4IZNA 2VZXA 4AS8A 2H5RA 4H48A 2HQKA 3SVCA 5BTTB 3SG7A 4W7DA 1EMLA 3SVSA 3BXCA 1YHHA 4L1IA 3NT9A 4EN1A 4W73A 1Z1QA 2O24A 3LVCA 3WCKA 1RRXA 1JC1A 3P28A 5DRFA 4Q9XA 3O78A 5DTLA 1W7UA 4DXPA 3ZUJA 1EMAA 3SVEA 3DQCA 2Z6ZA 3G9AA 2G6XA 1OXEA 4ZF5A 4ZIOA 1EMCA 3SG2A 3SG6A 3DQEA 2HFCA 1QY3A 2O2BA 3TMTA 1QYFA 5DQMA 2HGYA 3DQAA 4H3LA 4ZINA 4LJBA 4W6JA 4PPJA 5DQBA 4B5YA 1RMPA 2ARLA 2DUFA 5DY6A 2A46A 4N3DA 3BX9A 4GOBA 4IK1A 3GB3A 4H3NA 3SSHA 3ST4A 2BTJA 1Q4CA 2WHUA 1EMGA 3M24A 1EMKA 2YE1A 4Q9WA 3DQLA 4R6BA 3EKHA 4W6SA 4H47A 4W7FA 1F0BA 3K1KA 4BDUA 2QT2A 2WSOA 3E5VA 1BFPA 2IOVA 3LVDA 4EDOA 2VVHA 3SVUA 4KPIA 4ZF3A 2IE2A 2VVIA 3U8AA 4P1QA 4W6KA 5EBJA 2RH7A 2G16B 2QU1A 2FWQA 2PXSA 2QLIA 3IP2A 3LF4B 2ZO7A 3UFZA 2V4EC 3SSPA 4AR7A 4KGFA 2OTBA 4W6LA 2HJOA 4DXIA 4LW5A 3MGFA 3U8PA 4W74A 3H1OA 4XOWA 2WHTA 3W1CA 5LTRA 2Z6YA 4LQTA 4ANJA 4LJCA 2G3OA 5EXBA 2ZO6A 4W7CA 3OGOA 2FL1A 2FZUA 1S6ZA 4Q7UA 3CFAA 2WHSA 2DUIA 1EMFA 4W77A 5H87A 3E5TA 2HPWA 1XAEA 3BXAA 4PPLA 2AWKA 3CBEA 4KW9A 2V4EA 3VHTA 3GJ2A 3A8SA 5H89A 3DQHA 3IR8A 5LK4A 1RM9A 1KYRA 3AI4A 4HVFA 2AWLA 3ZULA 2DD9A 3LVAA 2IB6A 3EVUA 2HCGA 4IK4A 4JGEA 1QYOA 4EDSA 3SVNA 2A52B 2Z1OA 1MYWA 1XQMA 5DRGA 1EMEA 5FHVA 3SV5A 4ZF4A 4HE4A 2PXWA 3SVDA 3ADFA 2Q57A 2OJKA 2IB5A 3AI5A 3NT3A 3DQ8A 1HCJA 4W6AA 2C9JA 2QZ0A 2V4EB 5EHUA 3VHTB 3ZUFA 3ZTFA 3NEDA 2A48A 1QXTA 2VADA 3CD9A 3SS0A 4Z4KA 4H3MA 2YFPA 4IK9A 2OTEA 3LF3A 1KYSA 4W6HA 2OKWA 2ICRA 2DUEA 5AQBB 5HZOA 3GJ1A 4W76A 3ST0A 2A50B 4L13A 2GW4B 1MOUA 1HUYA 4OGSA 1Q4BA 4NWSA 2GX2A 4XGYA 1MOVA 2OGRA 2P4MA 4LQUA 1UISA 3SRYA 2QLGA 5FVIA 5LTPA 1XMZA 4W6FA 4W7RA 3EKJA 5EB6A 4W69A 2ZMUA 2AWJA 2Q6PA 4HQ9A 4JRBA 2HQZA 4GF6B 2DUGA 3LS3A 3U0MA 4W6UA 5HBDA 4IK5A 1W7TA 5HZSA 2GW3A 4Q7TA 2WIQA 2G6EA 3CFHA 5HW9A 1ZGPA 2A54B 3EVPA 3M22A 4DKMA 1YJFA 3NF0A 2DUHA 4HQCA 1Q4AA 3DQ3A 2QLGB 3DQUA 4Z4MA 3SVRA 2G2SB 2G6YA 3DQ4A 2H9WA 5F9GA 3ST3A 1G7KA 4KF5C 4KEXA 4KW4A 3AKOA 1Q73A 4KAGA 2HRSA 4W6GA 3DQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJU A;  3VIC A;  4P76 A;  4R6D A;  4W7X A;  3DQ6 A;  1JC0 A;  3RWT A;  3WLD A;  4KW8 A;  5DTY A;  5FVF A;  4J8A A;  3DQJ A;  2QLH A;  4DKN A;  4W6R A;  1C4F A;  3KCS A;  1B9C A;  2H5Q A;  3SSL A;  3GL4 A;  3EK8 A;  4L12 A;  3U8C A;  1YJ2 A;  4OQW A;  4UTS A;  2QRF A;  4W72 A;  4RTC A;  3SST A;  3OSR A;  2DDC A;  1RMO A;  5EB7 A;  3CGL A;  3I19 A;  2H6V A;  4KF5 A;  2Z6X A;  2YDZ A;  2EMO A;  4W6P A;  5HZT A;  1JBY A;  2O29 A;  3DPX A;  2G3D B;  2POX A;  4TZG A;  4JEO A;  3EVV A;  3SSY A;  3DQF A;  5J2O A;  2C9I A;  3SSK A;  4W6C A;  2A47 A;  3ST2 A;  1H6R A;  4W6O A;  1QYQ A;  3DQN A;  1RMM A;  3CB9 A;  4W6T A;  1XA9 A;  5DPH A;  4KF4 A;  2H5P A;  3PJ5 A;  4IK8 A;  1ZGO A;  4RYW A;  2EMD A;  4KA9 A;  5EXU A;  4DXO A;  3O77 A;  1OXD A;  2VAE A;  2VVJ A;  1YZW A;  3E5W A;  4OHS A;  3V3D A;  4XL5 A;  1JBZ A;  4W75 A;  3BXB A;  1CV7 A;  5BT0 A;  3NEZ A;  3DQO A;  4ORN A;  4EUL A;  1F09 A;  4KGE A;  3DQ1 A;  3DQI A;  4TZA A;  1GL4 A;  4OY4 A;  4GES B;  3SG4 A;  1Q4D A;  3EK7 A;  2OKY A;  3DQ7 A;  1YHG A;  3PIB A;  1YFP A;  4ZB1 A;  2AHA A;  2A53 B;  3OSQ A;  4ZBL A;  4W7E A;  3DQ9 A;  2AH8 A;  2ZMW A;  4ZFS A;  4LJD C;  3CFF A;  4JFG A;  4W6B A;  5LTQ A;  2H5O A;  2GX0 A;  3DQ5 A;  4RYS A;  3UG0 A;  4DXQ A;  5EXC I;  3DPW A;  1EMM A;  3WLC A;  3TMR A;  2WSN A;  4DXN A;  4B30 A;  1H4U A;  2G5Z B;  3EVR A;  4J88 A;  5DTX A;  4J89 A;  1YHI A;  3DQ2 A;  3H1R A;  3SG5 A;  4U2V A;  4W6D A;  3PJ7 A;  5HZU A;  3S05 A;  3ED8 A;  1ZUX A;  2HGD A;  2YE0 A;  3PJB A;  5FVG A;  3U0K A;  3DQM A;  5DPG A;  2Y0G A;  1W7S A;  2A56 B;  5H88 A;  5KTG A;  4LJD A;  4OJ0 A;  4XOV A;  5HGE A;  3SG3 A;  1Q4E A;  3CD1 A;  3U0N A;  3EK4 A;  4W6N A;  1KP5 A;  4W6M A;  2JAD A;  4W7A A;  3SVB A;  4I2Y A;  5DU0 A;  2DD7 A;  3SSV A;  4B30 B;  2B3P A;  3RWA A;  5BTT A;  1KYP A;  3LSA A;  4HQ8 A;  2DDD A;  2H8Q A;  5DPJ A;  1EMB A;  4Q7R A;  1ZGQ A;  4JC2 A;  5BQL A;  2QLE A;  4XVP A;  3DQD A;  2WUR A;  3U0L A;  3SVO A;  2EMN A;  2AWM A;  3DPZ A;  2WIS A;  4JF9 A;  2B3Q A;  1XSS A;  3GEX A;  4IK3 A;  5DTZ A;  1GGX A;  3W1D A;  5T3I A;  3KCT A;  4EMQ A;  1OXF A;  3VK1 A;  1GFL A;  4W6I A;  4PPK A;  3LA1 A;  3P8U A;  5DPI A;  4DXM A;  4PFE A;  1Z1P A;  4IZN A;  2VZX A;  4AS8 A;  2H5R A;  4H48 A;  2HQK A;  3SVC A;  5BTT B;  3SG7 A;  4W7D A;  1EML A;  3SVS A;  3BXC A;  1YHH A;  4L1I A;  3NT9 A;  4EN1 A;  4W73 A;  1Z1Q A;  2O24 A;  3LVC A;  3WCK A;  1RRX A;  1JC1 A;  3P28 A;  5DRF A;  4Q9X A;  3O78 A;  5DTL A;  1W7U A;  4DXP A;  3ZUJ A;  1EMA A;  3SVE A;  3DQC A;  2Z6Z A;  3G9A A;  2G6X A;  1OXE A;  4ZF5 A;  4ZIO A;  1EMC A;  3SG2 A;  3SG6 A;  3DQE A;  2HFC A;  1QY3 A;  2O2B A;  3TMT A;  1QYF A;  5DQM A;  2HGY A;  3DQA A;  4H3L A;  4ZIN A;  4LJB A;  4W6J A;  4PPJ A;  5DQB A;  4B5Y A;  1RMP A;  2ARL A;  2DUF A;  5DY6 A;  2A46 A;  4N3D A;  3BX9 A;  4GOB A;  4IK1 A;  3GB3 A;  4H3N A;  3SSH A;  3ST4 A;  2BTJ A;  1Q4C A;  2WHU A;  1EMG A;  3M24 A;  1EMK A;  2YE1 A;  4Q9W A;  3DQL A;  4R6B A;  3EKH A;  4W6S A;  4H47 A;  4W7F A;  1F0B A;  3K1K A;  4BDU A;  2QT2 A;  2WSO A;  3E5V A;  1BFP A;  2IOV A;  3LVD A;  4EDO A;  2VVH A;  3SVU A;  4KPI A;  4ZF3 A;  2IE2 A;  2VVI A;  3U8A A;  4P1Q A;  4W6K A;  5EBJ A;  2RH7 A;  2G16 B;  2QU1 A;  2FWQ A;  2PXS A;  2QLI A;  3IP2 A;  3LF4 B;  2ZO7 A;  3UFZ A;  2V4E C;  3SSP A;  4AR7 A;  4KGF A;  2OTB A;  4W6L A;  2HJO A;  4DXI A;  4LW5 A;  3MGF A;  3U8P A;  4W74 A;  3H1O A;  4XOW A;  2WHT A;  3W1C A;  5LTR A;  2Z6Y A;  4LQT A;  4ANJ A;  4LJC A;  2G3O A;  5EXB A;  2ZO6 A;  4W7C A;  3OGO A;  2FL1 A;  2FZU A;  1S6Z A;  4Q7U A;  3CFA A;  2WHS A;  2DUI A;  1EMF A;  4W77 A;  5H87 A;  3E5T A;  2HPW A;  1XAE A;  3BXA A;  4PPL A;  2AWK A;  3CBE A;  4KW9 A;  2V4E A;  3VHT A;  3GJ2 A;  3A8S A;  5H89 A;  3DQH A;  3IR8 A;  5LK4 A;  1RM9 A;  1KYR A;  3AI4 A;  4HVF A;  2AWL A;  3ZUL A;  2DD9 A;  3LVA A;  2IB6 A;  3EVU A;  2HCG A;  4IK4 A;  4JGE A;  1QYO A;  4EDS A;  3SVN A;  2A52 B;  2Z1O A;  1MYW A;  1XQM A;  5DRG A;  1EME A;  5FHV A;  3SV5 A;  4ZF4 A;  4HE4 A;  2PXW A;  3SVD A;  3ADF A;  2Q57 A;  2OJK A;  2IB5 A;  3AI5 A;  3NT3 A;  3DQ8 A;  1HCJ A;  4W6A A;  2C9J A;  2QZ0 A;  2V4E B;  5EHU A;  3VHT B;  3ZUF A;  3ZTF A;  3NED A;  2A48 A;  1QXT A;  2VAD A;  3CD9 A;  3SS0 A;  4Z4K A;  4H3M A;  2YFP A;  4IK9 A;  2OTE A;  3LF3 A;  1KYS A;  4W6H A;  2OKW A;  2ICR A;  2DUE A;  5AQB B;  5HZO A;  3GJ1 A;  4W76 A;  3ST0 A;  2A50 B;  4L13 A;  2GW4 B;  1MOU A;  1HUY A;  4OGS A;  1Q4B A;  4NWS A;  2GX2 A;  4XGY A;  1MOV A;  2OGR A;  2P4M A;  4LQU A;  1UIS A;  3SRY A;  2QLG A;  5FVI A;  5LTP A;  1XMZ A;  4W6F A;  4W7R A;  3EKJ A;  5EB6 A;  4W69 A;  2ZMU A;  2AWJ A;  2Q6P A;  4HQ9 A;  4JRB A;  2HQZ A;  4GF6 B;  2DUG A;  3LS3 A;  3U0M A;  4W6U A;  5HBD A;  4IK5 A;  1W7T A;  5HZS A;  2GW3 A;  4Q7T A;  2WIQ A;  2G6E A;  3CFH A;  5HW9 A;  1ZGP A;  2A54 B;  3EVP A;  3M22 A;  4DKM A;  1YJF A;  3NF0 A;  2DUH A;  4HQC A;  1Q4A A;  3DQ3 A;  2QLG B;  3DQU A;  4Z4M A;  3SVR A;  2G2S B;  2G6Y A;  3DQ4 A;  2H9W A;  5F9G A;  3ST3 A;  1G7K A;  4KF5 C;  4KEX A;  4KW4 A;  3AKO A;  1Q73 A;  4KAG A;  2HRS A;  4W6G A;  3DQK A; 
#chains in the Genus database with same CATH topology
 5EJU A;  3VIC A;  4P76 A;  4R6D A;  4W7X A;  3DQ6 A;  1JC0 A;  3RWT A;  3WLD A;  4KW8 A;  5DTY A;  5FVF A;  4J8A A;  3DQJ A;  2QLH A;  4DKN A;  4W6R A;  1C4F A;  3KCS A;  1B9C A;  2H5Q A;  3SSL A;  3GL4 A;  3EK8 A;  4L12 A;  3U8C A;  1YJ2 A;  4OQW A;  4UTS A;  2QRF A;  4W72 A;  4RTC A;  3SST A;  3OSR A;  2DDC A;  1RMO A;  5EB7 A;  3CGL A;  3I19 A;  2H6V A;  4KF5 A;  2Z6X A;  2YDZ A;  2EMO A;  4W6P A;  5HZT A;  1JBY A;  2O29 A;  3DPX A;  2G3D B;  2POX A;  4TZG A;  4JEO A;  3EVV A;  3SSY A;  3DQF A;  5J2O A;  2C9I A;  3SSK A;  4W6C A;  2A47 A;  3ST2 A;  1H6R A;  4W6O A;  1QYQ A;  3DQN A;  1RMM A;  3CB9 A;  4W6T A;  1XA9 A;  5DPH A;  4KF4 A;  2H5P A;  3PJ5 A;  4IK8 A;  1ZGO A;  4RYW A;  2EMD A;  4KA9 A;  5EXU A;  4DXO A;  3O77 A;  1OXD A;  2VAE A;  2VVJ A;  1YZW A;  3E5W A;  4OHS A;  3V3D A;  4XL5 A;  1JBZ A;  4W75 A;  3BXB A;  1CV7 A;  5BT0 A;  3NEZ A;  3DQO A;  4ORN A;  4EUL A;  1F09 A;  4KGE A;  3DQ1 A;  3DQI A;  4TZA A;  1GL4 A;  4OY4 A;  4GES B;  3SG4 A;  1Q4D A;  3EK7 A;  2OKY A;  3DQ7 A;  1YHG A;  3PIB A;  1YFP A;  4ZB1 A;  2AHA A;  2A53 B;  3OSQ A;  4ZBL A;  4W7E A;  3DQ9 A;  2AH8 A;  2ZMW A;  4ZFS A;  4LJD C;  3CFF A;  4JFG A;  4W6B A;  5LTQ A;  2H5O A;  2GX0 A;  3DQ5 A;  4RYS A;  3UG0 A;  4DXQ A;  5EXC I;  3DPW A;  1EMM A;  3WLC A;  3TMR A;  2WSN A;  4DXN A;  4B30 A;  1H4U A;  2G5Z B;  3EVR A;  4J88 A;  5DTX A;  4J89 A;  1YHI A;  3DQ2 A;  3H1R A;  3SG5 A;  4U2V A;  4W6D A;  3PJ7 A;  5HZU A;  3S05 A;  3ED8 A;  1ZUX A;  2HGD A;  2YE0 A;  3PJB A;  5FVG A;  3U0K A;  3DQM A;  5DPG A;  2Y0G A;  1W7S A;  2A56 B;  5H88 A;  5KTG A;  4LJD A;  4OJ0 A;  4XOV A;  5HGE A;  3SG3 A;  1Q4E A;  3CD1 A;  3U0N A;  3EK4 A;  4W6N A;  1KP5 A;  4W6M A;  2JAD A;  4W7A A;  3SVB A;  4I2Y A;  5DU0 A;  2DD7 A;  3SSV A;  4B30 B;  2B3P A;  3RWA A;  5BTT A;  1KYP A;  3LSA A;  4HQ8 A;  2DDD A;  2H8Q A;  5DPJ A;  1EMB A;  4Q7R A;  1ZGQ A;  4JC2 A;  5BQL A;  2QLE A;  4XVP A;  3DQD A;  2WUR A;  3U0L A;  3SVO A;  2EMN A;  2AWM A;  3DPZ A;  2WIS A;  4JF9 A;  2B3Q A;  1XSS A;  3GEX A;  4IK3 A;  5DTZ A;  1GGX A;  3W1D A;  5T3I A;  3KCT A;  4EMQ A;  1OXF A;  3VK1 A;  1GFL A;  4W6I A;  4PPK A;  3LA1 A;  3P8U A;  5DPI A;  4DXM A;  4PFE A;  1Z1P A;  4IZN A;  2VZX A;  4AS8 A;  2H5R A;  4H48 A;  2HQK A;  3SVC A;  5BTT B;  3SG7 A;  4W7D A;  1EML A;  3SVS A;  3BXC A;  1YHH A;  4L1I A;  3NT9 A;  4EN1 A;  4W73 A;  1Z1Q A;  2O24 A;  3LVC A;  3WCK A;  1RRX A;  1JC1 A;  3P28 A;  5DRF A;  4Q9X A;  3O78 A;  5DTL A;  1W7U A;  4DXP A;  3ZUJ A;  1EMA A;  3SVE A;  3DQC A;  2Z6Z A;  3G9A A;  2G6X A;  1OXE A;  4ZF5 A;  4ZIO A;  1EMC A;  3SG2 A;  3SG6 A;  3DQE A;  2HFC A;  1QY3 A;  2O2B A;  3TMT A;  1QYF A;  5DQM A;  2HGY A;  3DQA A;  4H3L A;  4ZIN A;  4LJB A;  4W6J A;  4PPJ A;  5DQB A;  4B5Y A;  1RMP A;  2ARL A;  2DUF A;  5DY6 A;  2A46 A;  4N3D A;  3BX9 A;  4GOB A;  4IK1 A;  3GB3 A;  4H3N A;  3SSH A;  3ST4 A;  2BTJ A;  1Q4C A;  2WHU A;  1EMG A;  3M24 A;  1EMK A;  2YE1 A;  4Q9W A;  3DQL A;  4R6B A;  3EKH A;  4W6S A;  4H47 A;  4W7F A;  1F0B A;  3K1K A;  4BDU A;  2QT2 A;  2WSO A;  3E5V A;  1BFP A;  2IOV A;  3LVD A;  4EDO A;  2VVH A;  3SVU A;  4KPI A;  4ZF3 A;  2IE2 A;  2VVI A;  3U8A A;  4P1Q A;  4W6K A;  5EBJ A;  2RH7 A;  2G16 B;  2QU1 A;  2FWQ A;  2PXS A;  2QLI A;  3IP2 A;  3LF4 B;  2ZO7 A;  3UFZ A;  2V4E C;  3SSP A;  4AR7 A;  4KGF A;  2OTB A;  4W6L A;  2HJO A;  4DXI A;  4LW5 A;  3MGF A;  3U8P A;  4W74 A;  3H1O A;  4XOW A;  2WHT A;  3W1C A;  5LTR A;  2Z6Y A;  4LQT A;  4ANJ A;  4LJC A;  2G3O A;  5EXB A;  2ZO6 A;  4W7C A;  3OGO A;  2FL1 A;  2FZU A;  1S6Z A;  4Q7U A;  3CFA A;  2WHS A;  2DUI A;  1EMF A;  4W77 A;  5H87 A;  3E5T A;  2HPW A;  1XAE A;  3BXA A;  4PPL A;  2AWK A;  3CBE A;  4KW9 A;  2V4E A;  3VHT A;  3GJ2 A;  3A8S A;  5H89 A;  3DQH A;  3IR8 A;  5LK4 A;  1RM9 A;  1KYR A;  3AI4 A;  4HVF A;  2AWL A;  3ZUL A;  2DD9 A;  3LVA A;  2IB6 A;  3EVU A;  2HCG A;  4IK4 A;  4JGE A;  1QYO A;  4EDS A;  3SVN A;  2A52 B;  2Z1O A;  1MYW A;  1XQM A;  5DRG A;  1EME A;  5FHV A;  3SV5 A;  4ZF4 A;  4HE4 A;  2PXW A;  3SVD A;  3ADF A;  2Q57 A;  2OJK A;  2IB5 A;  3AI5 A;  3NT3 A;  3DQ8 A;  1HCJ A;  4W6A A;  2C9J A;  2QZ0 A;  2V4E B;  5EHU A;  3VHT B;  3ZUF A;  3ZTF A;  3NED A;  2A48 A;  1QXT A;  2VAD A;  3CD9 A;  3SS0 A;  4Z4K A;  4H3M A;  2YFP A;  4IK9 A;  2OTE A;  3LF3 A;  1KYS A;  4W6H A;  2OKW A;  2ICR A;  2DUE A;  5AQB B;  5HZO A;  3GJ1 A;  4W76 A;  3ST0 A;  2A50 B;  4L13 A;  2GW4 B;  1MOU A;  1HUY A;  4OGS A;  1Q4B A;  4NWS A;  2GX2 A;  4XGY A;  1MOV A;  2OGR A;  2P4M A;  4LQU A;  1UIS A;  3SRY A;  2QLG A;  5FVI A;  5LTP A;  1XMZ A;  4W6F A;  4W7R A;  3EKJ A;  5EB6 A;  4W69 A;  2ZMU A;  2AWJ A;  2Q6P A;  4HQ9 A;  4JRB A;  2HQZ A;  4GF6 B;  2DUG A;  3LS3 A;  3U0M A;  4W6U A;  5HBD A;  4IK5 A;  1W7T A;  5HZS A;  2GW3 A;  4Q7T A;  2WIQ A;  2G6E A;  3CFH A;  5HW9 A;  1ZGP A;  2A54 B;  3EVP A;  3M22 A;  4DKM A;  1YJF A;  3NF0 A;  2DUH A;  4HQC A;  1Q4A A;  3DQ3 A;  2QLG B;  3DQU A;  4Z4M A;  3SVR A;  2G2S B;  2G6Y A;  3DQ4 A;  2H9W A;  5F9G A;  3ST3 A;  1G7K A;  4KF5 C;  4KEX A;  4KW4 A;  3AKO A;  1Q73 A;  4KAG A;  2HRS A;  4W6G A;  3DQK A; 
#chains in the Genus database with same CATH homology
 5EJU A;  3VIC A;  4P76 A;  4R6D A;  4W7X A;  3DQ6 A;  1JC0 A;  3RWT A;  3WLD A;  4KW8 A;  5DTY A;  5FVF A;  4J8A A;  3DQJ A;  2QLH A;  4DKN A;  4W6R A;  1C4F A;  3KCS A;  1B9C A;  2H5Q A;  3SSL A;  3GL4 A;  3EK8 A;  4L12 A;  3U8C A;  1YJ2 A;  4OQW A;  4UTS A;  2QRF A;  4W72 A;  4RTC A;  3SST A;  3OSR A;  2DDC A;  1RMO A;  5EB7 A;  3CGL A;  3I19 A;  2H6V A;  4KF5 A;  2Z6X A;  2YDZ A;  2EMO A;  4W6P A;  5HZT A;  1JBY A;  2O29 A;  3DPX A;  2G3D B;  2POX A;  4TZG A;  4JEO A;  3EVV A;  3SSY A;  3DQF A;  5J2O A;  2C9I A;  3SSK A;  4W6C A;  2A47 A;  3ST2 A;  1H6R A;  4W6O A;  1QYQ A;  3DQN A;  1RMM A;  3CB9 A;  4W6T A;  1XA9 A;  5DPH A;  4KF4 A;  2H5P A;  3PJ5 A;  4IK8 A;  1ZGO A;  4RYW A;  2EMD A;  4KA9 A;  5EXU A;  4DXO A;  3O77 A;  1OXD A;  2VAE A;  2VVJ A;  1YZW A;  3E5W A;  4OHS A;  3V3D A;  4XL5 A;  1JBZ A;  4W75 A;  3BXB A;  1CV7 A;  5BT0 A;  3NEZ A;  3DQO A;  4ORN A;  4EUL A;  1F09 A;  4KGE A;  3DQ1 A;  3DQI A;  4TZA A;  1GL4 A;  4OY4 A;  4GES B;  3SG4 A;  1Q4D A;  3EK7 A;  2OKY A;  3DQ7 A;  1YHG A;  3PIB A;  1YFP A;  4ZB1 A;  2AHA A;  2A53 B;  3OSQ A;  4ZBL A;  4W7E A;  3DQ9 A;  2AH8 A;  2ZMW A;  4ZFS A;  4LJD C;  3CFF A;  4JFG A;  4W6B A;  5LTQ A;  2H5O A;  2GX0 A;  3DQ5 A;  4RYS A;  3UG0 A;  4DXQ A;  5EXC I;  3DPW A;  1EMM A;  3WLC A;  3TMR A;  2WSN A;  4DXN A;  4B30 A;  1H4U A;  2G5Z B;  3EVR A;  4J88 A;  5DTX A;  4J89 A;  1YHI A;  3DQ2 A;  3H1R A;  3SG5 A;  4U2V A;  4W6D A;  3PJ7 A;  5HZU A;  3S05 A;  3ED8 A;  1ZUX A;  2HGD A;  2YE0 A;  3PJB A;  5FVG A;  3U0K A;  3DQM A;  5DPG A;  2Y0G A;  1W7S A;  2A56 B;  5H88 A;  5KTG A;  4LJD A;  4OJ0 A;  4XOV A;  5HGE A;  3SG3 A;  1Q4E A;  3CD1 A;  3U0N A;  3EK4 A;  4W6N A;  1KP5 A;  4W6M A;  2JAD A;  4W7A A;  3SVB A;  4I2Y A;  5DU0 A;  2DD7 A;  3SSV A;  4B30 B;  2B3P A;  3RWA A;  5BTT A;  1KYP A;  3LSA A;  4HQ8 A;  2DDD A;  2H8Q A;  5DPJ A;  1EMB A;  4Q7R A;  1ZGQ A;  4JC2 A;  5BQL A;  2QLE A;  4XVP A;  3DQD A;  2WUR A;  3U0L A;  3SVO A;  2EMN A;  2AWM A;  3DPZ A;  2WIS A;  4JF9 A;  2B3Q A;  1XSS A;  3GEX A;  4IK3 A;  5DTZ A;  1GGX A;  3W1D A;  5T3I A;  3KCT A;  4EMQ A;  1OXF A;  3VK1 A;  1GFL A;  4W6I A;  4PPK A;  3LA1 A;  3P8U A;  5DPI A;  4DXM A;  4PFE A;  1Z1P A;  4IZN A;  2VZX A;  4AS8 A;  2H5R A;  4H48 A;  2HQK A;  3SVC A;  5BTT B;  3SG7 A;  4W7D A;  1EML A;  3SVS A;  3BXC A;  1YHH A;  4L1I A;  3NT9 A;  4EN1 A;  4W73 A;  1Z1Q A;  2O24 A;  3LVC A;  3WCK A;  1RRX A;  1JC1 A;  3P28 A;  5DRF A;  4Q9X A;  3O78 A;  5DTL A;  1W7U A;  4DXP A;  3ZUJ A;  1EMA A;  3SVE A;  3DQC A;  2Z6Z A;  3G9A A;  2G6X A;  1OXE A;  4ZF5 A;  4ZIO A;  1EMC A;  3SG2 A;  3SG6 A;  3DQE A;  2HFC A;  1QY3 A;  2O2B A;  3TMT A;  1QYF A;  5DQM A;  2HGY A;  3DQA A;  4H3L A;  4ZIN A;  4LJB A;  4W6J A;  4PPJ A;  5DQB A;  4B5Y A;  1RMP A;  2ARL A;  2DUF A;  5DY6 A;  2A46 A;  4N3D A;  3BX9 A;  4GOB A;  4IK1 A;  3GB3 A;  4H3N A;  3SSH A;  3ST4 A;  2BTJ A;  1Q4C A;  2WHU A;  1EMG A;  3M24 A;  1EMK A;  2YE1 A;  4Q9W A;  3DQL A;  4R6B A;  3EKH A;  4W6S A;  4H47 A;  4W7F A;  1F0B A;  3K1K A;  4BDU A;  2QT2 A;  2WSO A;  3E5V A;  1BFP A;  2IOV A;  3LVD A;  4EDO A;  2VVH A;  3SVU A;  4KPI A;  4ZF3 A;  2IE2 A;  2VVI A;  3U8A A;  4P1Q A;  4W6K A;  5EBJ A;  2RH7 A;  2G16 B;  2QU1 A;  2FWQ A;  2PXS A;  2QLI A;  3IP2 A;  3LF4 B;  2ZO7 A;  3UFZ A;  2V4E C;  3SSP A;  4AR7 A;  4KGF A;  2OTB A;  4W6L A;  2HJO A;  4DXI A;  4LW5 A;  3MGF A;  3U8P A;  4W74 A;  3H1O A;  4XOW A;  2WHT A;  3W1C A;  5LTR A;  2Z6Y A;  4LQT A;  4ANJ A;  4LJC A;  2G3O A;  5EXB A;  2ZO6 A;  4W7C A;  3OGO A;  2FL1 A;  2FZU A;  1S6Z A;  4Q7U A;  3CFA A;  2WHS A;  2DUI A;  1EMF A;  4W77 A;  5H87 A;  3E5T A;  2HPW A;  1XAE A;  3BXA A;  4PPL A;  2AWK A;  3CBE A;  4KW9 A;  2V4E A;  3VHT A;  3GJ2 A;  3A8S A;  5H89 A;  3DQH A;  3IR8 A;  5LK4 A;  1RM9 A;  1KYR A;  3AI4 A;  4HVF A;  2AWL A;  3ZUL A;  2DD9 A;  3LVA A;  2IB6 A;  3EVU A;  2HCG A;  4IK4 A;  4JGE A;  1QYO A;  4EDS A;  3SVN A;  2A52 B;  2Z1O A;  1MYW A;  1XQM A;  5DRG A;  1EME A;  5FHV A;  3SV5 A;  4ZF4 A;  4HE4 A;  2PXW A;  3SVD A;  3ADF A;  2Q57 A;  2OJK A;  2IB5 A;  3AI5 A;  3NT3 A;  3DQ8 A;  1HCJ A;  4W6A A;  2C9J A;  2QZ0 A;  2V4E B;  5EHU A;  3VHT B;  3ZUF A;  3ZTF A;  3NED A;  2A48 A;  1QXT A;  2VAD A;  3CD9 A;  3SS0 A;  4Z4K A;  4H3M A;  2YFP A;  4IK9 A;  2OTE A;  3LF3 A;  1KYS A;  4W6H A;  2OKW A;  2ICR A;  2DUE A;  5AQB B;  5HZO A;  3GJ1 A;  4W76 A;  3ST0 A;  2A50 B;  4L13 A;  2GW4 B;  1MOU A;  1HUY A;  4OGS A;  1Q4B A;  4NWS A;  2GX2 A;  4XGY A;  1MOV A;  2OGR A;  2P4M A;  4LQU A;  1UIS A;  3SRY A;  2QLG A;  5FVI A;  5LTP A;  1XMZ A;  4W6F A;  4W7R A;  3EKJ A;  5EB6 A;  4W69 A;  2ZMU A;  2AWJ A;  2Q6P A;  4HQ9 A;  4JRB A;  2HQZ A;  4GF6 B;  2DUG A;  3LS3 A;  3U0M A;  4W6U A;  5HBD A;  4IK5 A;  1W7T A;  5HZS A;  2GW3 A;  4Q7T A;  2WIQ A;  2G6E A;  3CFH A;  5HW9 A;  1ZGP A;  2A54 B;  3EVP A;  3M22 A;  4DKM A;  1YJF A;  3NF0 A;  2DUH A;  4HQC A;  1Q4A A;  3DQ3 A;  2QLG B;  3DQU A;  4Z4M A;  3SVR A;  2G2S B;  2G6Y A;  3DQ4 A;  2H9W A;  5F9G A;  3ST3 A;  1G7K A;  4KF5 C;  4KEX A;  4KW4 A;  3AKO A;  1Q73 A;  4KAG A;  2HRS A;  4W6G A;  3DQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...