4RZ0A

Crystal structure of plasmodium falciparum putative histone methyltransferase pfl0690c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
114
Chain Sequence
IQKKIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDYLYEGKNYKLLPLGYGILYNHSDIPNAYVEIHKINTVSNNVMIVYAYNNIQKDDEILISYGHSWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Plasmodium falciparum putative histone methyltransferase PFL0690c
rcsb
source organism Plasmodium
molecule tags Transferase
molecule keywords PFL0690c
total genus 21
structure length 114
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4rz0A00
3RIBA 1N6CA 2W5ZA 5F59A 3OXFA 5EX3A 2JV0A 4YPEA 4QEOA 5F6KC 2QPWA 3KMTA 4YNMA 1H3IA 4YNDA 4I51A 4J7FA 5T5GA 1N6AA 3CBOA 3MO2A 5LSXA 3S7DA 3VV0A 4IJ8A 5JJ0A 3S7FA 3RQ4A 4IJDA 4Z4PA 3HNAA 4MI0A 3M58A 3FPDA 3M57A 2G46A 3SWCA 1N3JA 3QWWA 4J7IA 2RFIA 4QEPA 3M54A 1XQHA 3OXLA 5TEGA 1O9SA 5JIYA 5AYFA 3M56A 4C1QA 3S7BA 4BUPA 2BQZA 4JDSA 3MEKA 3TG5A 4J8OA 3M59A 3QWVA 3RJWA 5KJMA 3CBMA 3K5KA 5JINA 3OPEA 5KJNA 3RAYA 3KMJA 3S8PA 4QENA 1PEGA 4H12A 4E47A 2O8JA 4LDGA 3TG4A 3VUZA 3DALA 5KJLA 3F9WA 3IHXA 1ML9A 3F9ZA 3MO0A 3M53A 3F9YA 1ZKKA 3MO5A 4WUYA 5JHNA 5HQ8A 3F9XA 3KMAA 3M55A 3QWPA 4NVQA 4YPUA 5T0KA 2R3AA 5HI7A 5CCLA 3DB5A 4J83A 2IGQA 5ARGA 3S7JA 4RZ0A 5TTFA 4O30A 3PDNA 4AU7A 3RU0A 5F6LA 3CBPA 1MUFA 2W5YA 1MVXA 5CPRB 5F5EA 5T0MA 3EP0A 4O6FA 2F69A 5TH7A 3OS5A 3OOIA 4FMUA 4JLGA 5KJKA 5LSZA 4NJ5A 5EX0A 5ARFA 4YPAA 3N71A 4YNPA 5EG2A 1MVHA 3SW9A 4MI5A 3M5AA 5CCMA 3OXGA 1MT6A 3BO5A
chains in the Genus database with same CATH superfamily
3RIBA 1N6CA 2W5ZA 5F59A 3OXFA 5EX3A 2JV0A 4YPEA 4QEOA 5F6KC 2QPWA 3KMTA 4YNMA 1H3IA 4YNDA 4I51A 4J7FA 5T5GA 1N6AA 3CBOA 3MO2A 5LSXA 3S7DA 3VV0A 4IJ8A 5JJ0A 3S7FA 3RQ4A 4IJDA 4Z4PA 3HNAA 4MI0A 3M58A 3FPDA 3M57A 2G46A 3SWCA 1N3JA 3QWWA 4J7IA 2RFIA 4QEPA 3M54A 1XQHA 3OXLA 5TEGA 1O9SA 5JIYA 5AYFA 3M56A 4C1QA 3S7BA 4BUPA 2BQZA 4JDSA 3MEKA 3TG5A 4J8OA 3M59A 3QWVA 3RJWA 5KJMA 3CBMA 3K5KA 5JINA 3OPEA 5KJNA 3RAYA 3KMJA 3S8PA 4QENA 1PEGA 4H12A 4E47A 2O8JA 4LDGA 3TG4A 3VUZA 3DALA 5KJLA 3F9WA 3IHXA 1ML9A 3F9ZA 3MO0A 3M53A 3F9YA 1ZKKA 3MO5A 4WUYA 5JHNA 5HQ8A 3F9XA 3KMAA 3M55A 3QWPA 4NVQA 4YPUA 5T0KA 2R3AA 5HI7A 5CCLA 3DB5A 4J83A 2IGQA 5ARGA 3S7JA 4RZ0A 5TTFA 4O30A 3PDNA 4AU7A 3RU0A 5F6LA 3CBPA 1MUFA 2W5YA 1MVXA 5CPRB 5F5EA 5T0MA 3EP0A 4O6FA 2F69A 5TH7A 3OS5A 3OOIA 4FMUA 4JLGA 5KJKA 5LSZA 4NJ5A 5EX0A 5ARFA 4YPAA 3N71A 4YNPA 5EG2A 1MVHA 3SW9A 4MI5A 3M5AA 5CCMA 3OXGA 1MT6A 3BO5A
chains in the Genus database with same CATH topology
3RIBA 1N6CA 2W5ZA 5F59A 3OXFA 5EX3A 2JV0A 4YPEA 4QEOA 5F6KC 2QPWA 3KMTA 4YNMA 1H3IA 4YNDA 4I51A 4J7FA 5T5GA 1N6AA 3CBOA 3MO2A 5LSXA 3S7DA 3VV0A 4IJ8A 5JJ0A 3S7FA 3RQ4A 4IJDA 4Z4PA 3HNAA 4MI0A 3M58A 3FPDA 3M57A 2G46A 3SWCA 1N3JA 3QWWA 4J7IA 2RFIA 4QEPA 3M54A 1XQHA 3OXLA 5TEGA 1O9SA 5JIYA 5AYFA 3M56A 4C1QA 3S7BA 4BUPA 2BQZA 4JDSA 3MEKA 3TG5A 4J8OA 3M59A 3QWVA 3RJWA 5KJMA 3CBMA 3K5KA 5JINA 3OPEA 5KJNA 3RAYA 3KMJA 3S8PA 4QENA 1PEGA 4H12A 4E47A 2O8JA 4LDGA 3TG4A 3VUZA 3DALA 5KJLA 3F9WA 3IHXA 1ML9A 3F9ZA 3MO0A 3M53A 3F9YA 1ZKKA 3MO5A 4WUYA 5JHNA 5HQ8A 3F9XA 3KMAA 3M55A 3QWPA 4NVQA 4YPUA 5T0KA 2R3AA 5HI7A 5CCLA 3DB5A 4J83A 2IGQA 5ARGA 3S7JA 4RZ0A 5TTFA 4O30A 3PDNA 4AU7A 3RU0A 5F6LA 3CBPA 1MUFA 2W5YA 1MVXA 5CPRB 5F5EA 5T0MA 3EP0A 4O6FA 2F69A 5TH7A 3OS5A 3OOIA 4FMUA 4JLGA 5KJKA 5LSZA 4NJ5A 5EX0A 5ARFA 4YPAA 3N71A 4YNPA 5EG2A 1MVHA 3SW9A 4MI5A 3M5AA 5CCMA 3OXGA 1MT6A 3BO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  1N6C A;  2W5Z A;  5F59 A;  3OXF A;  5EX3 A;  2JV0 A;  4YPE A;  4QEO A;  5F6K C;  2QPW A;  3KMT A;  4YNM A;  1H3I A;  4YND A;  4I51 A;  4J7F A;  5T5G A;  1N6A A;  3CBO A;  3MO2 A;  5LSX A;  3S7D A;  3VV0 A;  4IJ8 A;  5JJ0 A;  3S7F A;  3RQ4 A;  4IJD A;  4Z4P A;  3HNA A;  4MI0 A;  3M58 A;  3FPD A;  3M57 A;  2G46 A;  3SWC A;  1N3J A;  3QWW A;  4J7I A;  2RFI A;  4QEP A;  3M54 A;  1XQH A;  3OXL A;  5TEG A;  1O9S A;  5JIY A;  5AYF A;  3M56 A;  4C1Q A;  3S7B A;  4BUP A;  2BQZ A;  4JDS A;  3MEK A;  3TG5 A;  4J8O A;  3M59 A;  3QWV A;  3RJW A;  5KJM A;  3CBM A;  3K5K A;  5JIN A;  3OPE A;  5KJN A;  3RAY A;  3KMJ A;  3S8P A;  4QEN A;  1PEG A;  4H12 A;  4E47 A;  2O8J A;  4LDG A;  3TG4 A;  3VUZ A;  3DAL A;  5KJL A;  3F9W A;  3IHX A;  1ML9 A;  3F9Z A;  3MO0 A;  3M53 A;  3F9Y A;  1ZKK A;  3MO5 A;  4WUY A;  5JHN A;  5HQ8 A;  3F9X A;  3KMA A;  3M55 A;  3QWP A;  4NVQ A;  4YPU A;  5T0K A;  2R3A A;  5HI7 A;  5CCL A;  3DB5 A;  4J83 A;  2IGQ A;  5ARG A;  3S7J A;  4RZ0 A;  5TTF A;  4O30 A;  3PDN A;  4AU7 A;  3RU0 A;  5F6L A;  3CBP A;  1MUF A;  2W5Y A;  1MVX A;  5CPR B;  5F5E A;  5T0M A;  3EP0 A;  4O6F A;  2F69 A;  5TH7 A;  3OS5 A;  3OOI A;  4FMU A;  4JLG A;  5KJK A;  5LSZ A;  4NJ5 A;  5EX0 A;  5ARF A;  4YPA A;  3N71 A;  4YNP A;  5EG2 A;  1MVH A;  3SW9 A;  4MI5 A;  3M5A A;  5CCM A;  3OXG A;  1MT6 A;  3BO5 A; 
#chains in the Genus database with same CATH topology
 3RIB A;  1N6C A;  2W5Z A;  5F59 A;  3OXF A;  5EX3 A;  2JV0 A;  4YPE A;  4QEO A;  5F6K C;  2QPW A;  3KMT A;  4YNM A;  1H3I A;  4YND A;  4I51 A;  4J7F A;  5T5G A;  1N6A A;  3CBO A;  3MO2 A;  5LSX A;  3S7D A;  3VV0 A;  4IJ8 A;  5JJ0 A;  3S7F A;  3RQ4 A;  4IJD A;  4Z4P A;  3HNA A;  4MI0 A;  3M58 A;  3FPD A;  3M57 A;  2G46 A;  3SWC A;  1N3J A;  3QWW A;  4J7I A;  2RFI A;  4QEP A;  3M54 A;  1XQH A;  3OXL A;  5TEG A;  1O9S A;  5JIY A;  5AYF A;  3M56 A;  4C1Q A;  3S7B A;  4BUP A;  2BQZ A;  4JDS A;  3MEK A;  3TG5 A;  4J8O A;  3M59 A;  3QWV A;  3RJW A;  5KJM A;  3CBM A;  3K5K A;  5JIN A;  3OPE A;  5KJN A;  3RAY A;  3KMJ A;  3S8P A;  4QEN A;  1PEG A;  4H12 A;  4E47 A;  2O8J A;  4LDG A;  3TG4 A;  3VUZ A;  3DAL A;  5KJL A;  3F9W A;  3IHX A;  1ML9 A;  3F9Z A;  3MO0 A;  3M53 A;  3F9Y A;  1ZKK A;  3MO5 A;  4WUY A;  5JHN A;  5HQ8 A;  3F9X A;  3KMA A;  3M55 A;  3QWP A;  4NVQ A;  4YPU A;  5T0K A;  2R3A A;  5HI7 A;  5CCL A;  3DB5 A;  4J83 A;  2IGQ A;  5ARG A;  3S7J A;  4RZ0 A;  5TTF A;  4O30 A;  3PDN A;  4AU7 A;  3RU0 A;  5F6L A;  3CBP A;  1MUF A;  2W5Y A;  1MVX A;  5CPR B;  5F5E A;  5T0M A;  3EP0 A;  4O6F A;  2F69 A;  5TH7 A;  3OS5 A;  3OOI A;  4FMU A;  4JLG A;  5KJK A;  5LSZ A;  4NJ5 A;  5EX0 A;  5ARF A;  4YPA A;  3N71 A;  4YNP A;  5EG2 A;  1MVH A;  3SW9 A;  4MI5 A;  3M5A A;  5CCM A;  3OXG A;  1MT6 A;  3BO5 A; 
#chains in the Genus database with same CATH homology
 3RIB A;  1N6C A;  2W5Z A;  5F59 A;  3OXF A;  5EX3 A;  2JV0 A;  4YPE A;  4QEO A;  5F6K C;  2QPW A;  3KMT A;  4YNM A;  1H3I A;  4YND A;  4I51 A;  4J7F A;  5T5G A;  1N6A A;  3CBO A;  3MO2 A;  5LSX A;  3S7D A;  3VV0 A;  4IJ8 A;  5JJ0 A;  3S7F A;  3RQ4 A;  4IJD A;  4Z4P A;  3HNA A;  4MI0 A;  3M58 A;  3FPD A;  3M57 A;  2G46 A;  3SWC A;  1N3J A;  3QWW A;  4J7I A;  2RFI A;  4QEP A;  3M54 A;  1XQH A;  3OXL A;  5TEG A;  1O9S A;  5JIY A;  5AYF A;  3M56 A;  4C1Q A;  3S7B A;  4BUP A;  2BQZ A;  4JDS A;  3MEK A;  3TG5 A;  4J8O A;  3M59 A;  3QWV A;  3RJW A;  5KJM A;  3CBM A;  3K5K A;  5JIN A;  3OPE A;  5KJN A;  3RAY A;  3KMJ A;  3S8P A;  4QEN A;  1PEG A;  4H12 A;  4E47 A;  2O8J A;  4LDG A;  3TG4 A;  3VUZ A;  3DAL A;  5KJL A;  3F9W A;  3IHX A;  1ML9 A;  3F9Z A;  3MO0 A;  3M53 A;  3F9Y A;  1ZKK A;  3MO5 A;  4WUY A;  5JHN A;  5HQ8 A;  3F9X A;  3KMA A;  3M55 A;  3QWP A;  4NVQ A;  4YPU A;  5T0K A;  2R3A A;  5HI7 A;  5CCL A;  3DB5 A;  4J83 A;  2IGQ A;  5ARG A;  3S7J A;  4RZ0 A;  5TTF A;  4O30 A;  3PDN A;  4AU7 A;  3RU0 A;  5F6L A;  3CBP A;  1MUF A;  2W5Y A;  1MVX A;  5CPR B;  5F5E A;  5T0M A;  3EP0 A;  4O6F A;  2F69 A;  5TH7 A;  3OS5 A;  3OOI A;  4FMU A;  4JLG A;  5KJK A;  5LSZ A;  4NJ5 A;  5EX0 A;  5ARF A;  4YPA A;  3N71 A;  4YNP A;  5EG2 A;  1MVH A;  3SW9 A;  4MI5 A;  3M5A A;  5CCM A;  3OXG A;  1MT6 A;  3BO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...