4RZ0A

Crystal structure of plasmodium falciparum putative histone methyltransferase pfl0690c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
114
Chain Sequence
b'IQKKIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDYLYEGKNYKLLPLGYGILYNHSDIPNAYVEIHKINTVSNNVMIVYAYNNIQKDDEILISYGHSWWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFL0690c
publication title Crystal Structure of Plasmodium falciparum putative histone methyltransferase PFL0690c
rcsb
source organism Plasmodium
molecule tags Transferase
total genus 21
structure length 114
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4rz0A00
4WUYA 5ARFA 3S7JA 1N6CA 4NVQA 5CCMA 4J7IA 5F5EA 5JIYA 4YNMA 1XQHA 5KJKA 5T5GA 3OOIA 4MI5A 2RFIA 3F9YA 2IGQA 4FMUA 4YPAA 3M5AA 3FPDA 3DALA 3CBMA 3S7DA 3N71A 4J83A 4QEPA 2BQZA 4H12A 3RJWA 5HI7A 3MO2A 4MI0A 1ZKKA 3DB5A 3OXLA 5JHNA 2R3AA 3MEKA 3RQ4A 4QEOA 4JLGA 3KMJA 1N3JA 3QWWA 5CPRB 1MVHA 3OXGA 3M58A 4IJ8A 4YNPA 5ARGA 4JDSA 3KMTA 1ML9A 5TH7A 3HNAA 5EG2A 3VUZA 5HQ8A 5KJMA 3RIBA 3RAYA 3M55A 5EX0A 3S8PA 5EX3A 3F9ZA 4J8OA 3RU0A 5JINA 5F6LA 4YPEA 3PDNA 3EP0A 1MT6A 5TTFA 1PEGA 3M59A 3OS5A 5F59A 5F6KC 4Z4PA 4E47A 3VV0A 5CCLA 3KMAA 4IJDA 2JV0A 3M56A 4YPUA 1O9SA 3F9WA 2W5YA 4LDGA 3S7FA 3SWCA 2F69A 1MUFA 5TEGA 3IHXA 3M53A 3S7BA 5LSZA 4YNDA 3M54A 4NJ5A 3MO5A 5JJ0A 4AU7A 2W5ZA 3OXFA 4RZ0A 2O8JA 3QWPA 3F9XA 4J7FA 3TG5A 3CBPA 5LSXA 5KJNA 5AYFA 3CBOA 1MVXA 4I51A 3TG4A 4BUPA 1H3IA 3SW9A 3MO0A 2G46A 3QWVA 3M57A 3BO5A 4C1QA 3OPEA 5T0KA 2QPWA 4O30A 5T0MA 4QENA 3K5KA 4O6FA 5KJLA 1N6AA
chains in the Genus database with same CATH superfamily
4WUYA 5ARFA 3S7JA 1N6CA 4NVQA 5CCMA 4J7IA 5F5EA 5JIYA 4YNMA 1XQHA 5KJKA 5T5GA 3OOIA 4MI5A 2RFIA 3F9YA 2IGQA 4FMUA 4YPAA 3M5AA 3FPDA 3DALA 3CBMA 3S7DA 3N71A 4J83A 4QEPA 2BQZA 4H12A 3RJWA 5HI7A 3MO2A 4MI0A 1ZKKA 3DB5A 3OXLA 5JHNA 2R3AA 3MEKA 3RQ4A 4QEOA 4JLGA 3KMJA 1N3JA 3QWWA 5CPRB 1MVHA 3OXGA 3M58A 4IJ8A 4YNPA 5ARGA 4JDSA 3KMTA 1ML9A 5TH7A 3HNAA 5EG2A 3VUZA 5HQ8A 5KJMA 3RIBA 3RAYA 3M55A 5EX0A 3S8PA 5EX3A 3F9ZA 4J8OA 3RU0A 5JINA 5F6LA 4YPEA 3PDNA 3EP0A 1MT6A 5TTFA 1PEGA 3M59A 3OS5A 5F59A 5F6KC 4Z4PA 4E47A 3VV0A 5CCLA 3KMAA 4IJDA 2JV0A 3M56A 4YPUA 1O9SA 3F9WA 2W5YA 4LDGA 3S7FA 3SWCA 2F69A 1MUFA 5TEGA 3IHXA 3M53A 3S7BA 5LSZA 4YNDA 3M54A 4NJ5A 3MO5A 5JJ0A 4AU7A 2W5ZA 3OXFA 4RZ0A 2O8JA 3QWPA 3F9XA 4J7FA 3TG5A 3CBPA 5LSXA 5KJNA 5AYFA 3CBOA 1MVXA 4I51A 3TG4A 4BUPA 1H3IA 3SW9A 3MO0A 2G46A 3QWVA 3M57A 3BO5A 4C1QA 3OPEA 5T0KA 2QPWA 4O30A 5T0MA 4QENA 3K5KA 4O6FA 5KJLA 1N6AA
chains in the Genus database with same CATH topology
4WUYA 5ARFA 3S7JA 1N6CA 4NVQA 5CCMA 4J7IA 5F5EA 5JIYA 4YNMA 1XQHA 5KJKA 5T5GA 3OOIA 4MI5A 2RFIA 3F9YA 2IGQA 4FMUA 4YPAA 3M5AA 3FPDA 3DALA 3CBMA 3S7DA 3N71A 4J83A 4QEPA 2BQZA 4H12A 3RJWA 5HI7A 3MO2A 4MI0A 1ZKKA 3DB5A 3OXLA 5JHNA 2R3AA 3MEKA 3RQ4A 4QEOA 4JLGA 3KMJA 1N3JA 3QWWA 5CPRB 1MVHA 3OXGA 3M58A 4IJ8A 4YNPA 5ARGA 4JDSA 3KMTA 1ML9A 5TH7A 3HNAA 5EG2A 3VUZA 5HQ8A 5KJMA 3RIBA 3RAYA 3M55A 5EX0A 3S8PA 5EX3A 3F9ZA 4J8OA 3RU0A 5JINA 5F6LA 4YPEA 3PDNA 3EP0A 1MT6A 5TTFA 1PEGA 3M59A 3OS5A 5F59A 5F6KC 4Z4PA 4E47A 3VV0A 5CCLA 3KMAA 4IJDA 2JV0A 3M56A 4YPUA 1O9SA 3F9WA 2W5YA 4LDGA 3S7FA 3SWCA 2F69A 1MUFA 5TEGA 3IHXA 3M53A 3S7BA 5LSZA 4YNDA 3M54A 4NJ5A 3MO5A 5JJ0A 4AU7A 2W5ZA 3OXFA 4RZ0A 2O8JA 3QWPA 3F9XA 4J7FA 3TG5A 3CBPA 5LSXA 5KJNA 5AYFA 3CBOA 1MVXA 4I51A 3TG4A 4BUPA 1H3IA 3SW9A 3MO0A 2G46A 3QWVA 3M57A 3BO5A 4C1QA 3OPEA 5T0KA 2QPWA 4O30A 5T0MA 4QENA 3K5KA 4O6FA 5KJLA 1N6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUY A;  5ARF A;  3S7J A;  1N6C A;  4NVQ A;  5CCM A;  4J7I A;  5F5E A;  5JIY A;  4YNM A;  1XQH A;  5KJK A;  5T5G A;  3OOI A;  4MI5 A;  2RFI A;  3F9Y A;  2IGQ A;  4FMU A;  4YPA A;  3M5A A;  3FPD A;  3DAL A;  3CBM A;  3S7D A;  3N71 A;  4J83 A;  4QEP A;  2BQZ A;  4H12 A;  3RJW A;  5HI7 A;  3MO2 A;  4MI0 A;  1ZKK A;  3DB5 A;  3OXL A;  5JHN A;  2R3A A;  3MEK A;  3RQ4 A;  4QEO A;  4JLG A;  3KMJ A;  1N3J A;  3QWW A;  5CPR B;  1MVH A;  3OXG A;  3M58 A;  4IJ8 A;  4YNP A;  5ARG A;  4JDS A;  3KMT A;  1ML9 A;  5TH7 A;  3HNA A;  5EG2 A;  3VUZ A;  5HQ8 A;  5KJM A;  3RIB A;  3RAY A;  3M55 A;  5EX0 A;  3S8P A;  5EX3 A;  3F9Z A;  4J8O A;  3RU0 A;  5JIN A;  5F6L A;  4YPE A;  3PDN A;  3EP0 A;  1MT6 A;  5TTF A;  1PEG A;  3M59 A;  3OS5 A;  5F59 A;  5F6K C;  4Z4P A;  4E47 A;  3VV0 A;  5CCL A;  3KMA A;  4IJD A;  2JV0 A;  3M56 A;  4YPU A;  1O9S A;  3F9W A;  2W5Y A;  4LDG A;  3S7F A;  3SWC A;  2F69 A;  1MUF A;  5TEG A;  3IHX A;  3M53 A;  3S7B A;  5LSZ A;  4YND A;  3M54 A;  4NJ5 A;  3MO5 A;  5JJ0 A;  4AU7 A;  2W5Z A;  3OXF A;  4RZ0 A;  2O8J A;  3QWP A;  3F9X A;  4J7F A;  3TG5 A;  3CBP A;  5LSX A;  5KJN A;  5AYF A;  3CBO A;  1MVX A;  4I51 A;  3TG4 A;  4BUP A;  1H3I A;  3SW9 A;  3MO0 A;  2G46 A;  3QWV A;  3M57 A;  3BO5 A;  4C1Q A;  3OPE A;  5T0K A;  2QPW A;  4O30 A;  5T0M A;  4QEN A;  3K5K A;  4O6F A;  5KJL A;  1N6A A; 
#chains in the Genus database with same CATH topology
 4WUY A;  5ARF A;  3S7J A;  1N6C A;  4NVQ A;  5CCM A;  4J7I A;  5F5E A;  5JIY A;  4YNM A;  1XQH A;  5KJK A;  5T5G A;  3OOI A;  4MI5 A;  2RFI A;  3F9Y A;  2IGQ A;  4FMU A;  4YPA A;  3M5A A;  3FPD A;  3DAL A;  3CBM A;  3S7D A;  3N71 A;  4J83 A;  4QEP A;  2BQZ A;  4H12 A;  3RJW A;  5HI7 A;  3MO2 A;  4MI0 A;  1ZKK A;  3DB5 A;  3OXL A;  5JHN A;  2R3A A;  3MEK A;  3RQ4 A;  4QEO A;  4JLG A;  3KMJ A;  1N3J A;  3QWW A;  5CPR B;  1MVH A;  3OXG A;  3M58 A;  4IJ8 A;  4YNP A;  5ARG A;  4JDS A;  3KMT A;  1ML9 A;  5TH7 A;  3HNA A;  5EG2 A;  3VUZ A;  5HQ8 A;  5KJM A;  3RIB A;  3RAY A;  3M55 A;  5EX0 A;  3S8P A;  5EX3 A;  3F9Z A;  4J8O A;  3RU0 A;  5JIN A;  5F6L A;  4YPE A;  3PDN A;  3EP0 A;  1MT6 A;  5TTF A;  1PEG A;  3M59 A;  3OS5 A;  5F59 A;  5F6K C;  4Z4P A;  4E47 A;  3VV0 A;  5CCL A;  3KMA A;  4IJD A;  2JV0 A;  3M56 A;  4YPU A;  1O9S A;  3F9W A;  2W5Y A;  4LDG A;  3S7F A;  3SWC A;  2F69 A;  1MUF A;  5TEG A;  3IHX A;  3M53 A;  3S7B A;  5LSZ A;  4YND A;  3M54 A;  4NJ5 A;  3MO5 A;  5JJ0 A;  4AU7 A;  2W5Z A;  3OXF A;  4RZ0 A;  2O8J A;  3QWP A;  3F9X A;  4J7F A;  3TG5 A;  3CBP A;  5LSX A;  5KJN A;  5AYF A;  3CBO A;  1MVX A;  4I51 A;  3TG4 A;  4BUP A;  1H3I A;  3SW9 A;  3MO0 A;  2G46 A;  3QWV A;  3M57 A;  3BO5 A;  4C1Q A;  3OPE A;  5T0K A;  2QPW A;  4O30 A;  5T0M A;  4QEN A;  3K5K A;  4O6F A;  5KJL A;  1N6A A; 
#chains in the Genus database with same CATH homology
 4WUY A;  5ARF A;  3S7J A;  1N6C A;  4NVQ A;  5CCM A;  4J7I A;  5F5E A;  5JIY A;  4YNM A;  1XQH A;  5KJK A;  5T5G A;  3OOI A;  4MI5 A;  2RFI A;  3F9Y A;  2IGQ A;  4FMU A;  4YPA A;  3M5A A;  3FPD A;  3DAL A;  3CBM A;  3S7D A;  3N71 A;  4J83 A;  4QEP A;  2BQZ A;  4H12 A;  3RJW A;  5HI7 A;  3MO2 A;  4MI0 A;  1ZKK A;  3DB5 A;  3OXL A;  5JHN A;  2R3A A;  3MEK A;  3RQ4 A;  4QEO A;  4JLG A;  3KMJ A;  1N3J A;  3QWW A;  5CPR B;  1MVH A;  3OXG A;  3M58 A;  4IJ8 A;  4YNP A;  5ARG A;  4JDS A;  3KMT A;  1ML9 A;  5TH7 A;  3HNA A;  5EG2 A;  3VUZ A;  5HQ8 A;  5KJM A;  3RIB A;  3RAY A;  3M55 A;  5EX0 A;  3S8P A;  5EX3 A;  3F9Z A;  4J8O A;  3RU0 A;  5JIN A;  5F6L A;  4YPE A;  3PDN A;  3EP0 A;  1MT6 A;  5TTF A;  1PEG A;  3M59 A;  3OS5 A;  5F59 A;  5F6K C;  4Z4P A;  4E47 A;  3VV0 A;  5CCL A;  3KMA A;  4IJD A;  2JV0 A;  3M56 A;  4YPU A;  1O9S A;  3F9W A;  2W5Y A;  4LDG A;  3S7F A;  3SWC A;  2F69 A;  1MUF A;  5TEG A;  3IHX A;  3M53 A;  3S7B A;  5LSZ A;  4YND A;  3M54 A;  4NJ5 A;  3MO5 A;  5JJ0 A;  4AU7 A;  2W5Z A;  3OXF A;  4RZ0 A;  2O8J A;  3QWP A;  3F9X A;  4J7F A;  3TG5 A;  3CBP A;  5LSX A;  5KJN A;  5AYF A;  3CBO A;  1MVX A;  4I51 A;  3TG4 A;  4BUP A;  1H3I A;  3SW9 A;  3MO0 A;  2G46 A;  3QWV A;  3M57 A;  3BO5 A;  4C1Q A;  3OPE A;  5T0K A;  2QPW A;  4O30 A;  5T0M A;  4QEN A;  3K5K A;  4O6F A;  5KJL A;  1N6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...