4RZ0A

Crystal structure of plasmodium falciparum putative histone methyltransferase pfl0690c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
114
Chain Sequence
IQKKIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDYLYEGKNYKLLPLGYGILYNHSDIPNAYVEIHKINTVSNNVMIVYAYNNIQKDDEILISYGHSWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Plasmodium falciparum putative histone methyltransferase PFL0690c
rcsb
source organism Plasmodium
molecule tags Transferase
molecule keywords PFL0690c
total genus 21
structure length 114
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4rz0A00
3RIBA 5KJNA 4FMUA 4O6FA 5JINA 4O30A 1ZKKA 3RU0A 3S7BA 2IGQA 3MO2A 4YPUA 3M5AA 3BO5A 3M54A 1XQHA 5LSXA 2O8JA 2W5ZA 3EP0A 3K5KA 5KJLA 1MVXA 2R3AA 5TTFA 3OXLA 5TH7A 4QEPA 3TG4A 5KJKA 5T5GA 1H3IA 3QWWA 4YNDA 5EX0A 3M56A 5EG2A 1MVHA 3VUZA 5KJMA 3CBMA 5F5EA 4NVQA 4RZ0A 5HI7A 3M55A 4YNPA 3OXFA 3PDNA 1N3JA 3KMJA 5JHNA 4NJ5A 5CCMA 3DB5A 5ARFA 3KMTA 3TG5A 3OS5A 4JLGA 3S7FA 3F9XA 4J7IA 3IHXA 3S7DA 4H12A 4J8OA 3OPEA 4IJ8A 5ARGA 4J7FA 3M59A 5HQ8A 5EX3A 3HNAA 4IJDA 2QPWA 2BQZA 3FPDA 5F6LA 4MI0A 5AYFA 3OOIA 3OXGA 5T0MA 3CBPA 4I51A 1MUFA 2F69A 4BUPA 1N6CA 2RFIA 1ML9A 3M53A 3QWPA 5JJ0A 3M57A 3SW9A 4YPEA 3S8PA 4MI5A 4YNMA 1N6AA 3F9WA 1MT6A 3MO0A 4YPAA 5CPRB 4JDSA 5LSZA 3RQ4A 2JV0A 5F6KC 3MO5A 4LDGA 3VV0A 4QEOA 4J83A 3F9ZA 3DALA 5F59A 3RAYA 1O9SA 3F9YA 4Z4PA 1PEGA 5T0KA 3N71A 4C1QA 5JIYA 3SWCA 3MEKA 3S7JA 3CBOA 3KMAA 4AU7A 3QWVA 4QENA 4E47A 5TEGA 3RJWA 4WUYA 2G46A 2W5YA 5CCLA 3M58A
chains in the Genus database with same CATH superfamily
3RIBA 5KJNA 4FMUA 4O6FA 5JINA 4O30A 1ZKKA 3RU0A 3S7BA 2IGQA 3MO2A 4YPUA 3M5AA 3BO5A 3M54A 1XQHA 5LSXA 2O8JA 2W5ZA 3EP0A 3K5KA 5KJLA 1MVXA 2R3AA 5TTFA 3OXLA 5TH7A 4QEPA 3TG4A 5KJKA 5T5GA 1H3IA 3QWWA 4YNDA 5EX0A 3M56A 5EG2A 1MVHA 3VUZA 5KJMA 3CBMA 5F5EA 4NVQA 4RZ0A 5HI7A 3M55A 4YNPA 3OXFA 3PDNA 1N3JA 3KMJA 5JHNA 4NJ5A 5CCMA 3DB5A 5ARFA 3KMTA 3TG5A 3OS5A 4JLGA 3S7FA 3F9XA 4J7IA 3IHXA 3S7DA 4H12A 4J8OA 3OPEA 4IJ8A 5ARGA 4J7FA 3M59A 5HQ8A 5EX3A 3HNAA 4IJDA 2QPWA 2BQZA 3FPDA 5F6LA 4MI0A 5AYFA 3OOIA 3OXGA 5T0MA 3CBPA 4I51A 1MUFA 2F69A 4BUPA 1N6CA 2RFIA 1ML9A 3M53A 3QWPA 5JJ0A 3M57A 3SW9A 4YPEA 3S8PA 4MI5A 4YNMA 1N6AA 3F9WA 1MT6A 3MO0A 4YPAA 5CPRB 4JDSA 5LSZA 3RQ4A 2JV0A 5F6KC 3MO5A 4LDGA 3VV0A 4QEOA 4J83A 3F9ZA 3DALA 5F59A 3RAYA 1O9SA 3F9YA 4Z4PA 1PEGA 5T0KA 3N71A 4C1QA 5JIYA 3SWCA 3MEKA 3S7JA 3CBOA 3KMAA 4AU7A 3QWVA 4QENA 4E47A 5TEGA 3RJWA 4WUYA 2G46A 2W5YA 5CCLA 3M58A
chains in the Genus database with same CATH topology
3RIBA 5KJNA 4FMUA 4O6FA 5JINA 4O30A 1ZKKA 3RU0A 3S7BA 2IGQA 3MO2A 4YPUA 3M5AA 3BO5A 3M54A 1XQHA 5LSXA 2O8JA 2W5ZA 3EP0A 3K5KA 5KJLA 1MVXA 2R3AA 5TTFA 3OXLA 5TH7A 4QEPA 3TG4A 5KJKA 5T5GA 1H3IA 3QWWA 4YNDA 5EX0A 3M56A 5EG2A 1MVHA 3VUZA 5KJMA 3CBMA 5F5EA 4NVQA 4RZ0A 5HI7A 3M55A 4YNPA 3OXFA 3PDNA 1N3JA 3KMJA 5JHNA 4NJ5A 5CCMA 3DB5A 5ARFA 3KMTA 3TG5A 3OS5A 4JLGA 3S7FA 3F9XA 4J7IA 3IHXA 3S7DA 4H12A 4J8OA 3OPEA 4IJ8A 5ARGA 4J7FA 3M59A 5HQ8A 5EX3A 3HNAA 4IJDA 2QPWA 2BQZA 3FPDA 5F6LA 4MI0A 5AYFA 3OOIA 3OXGA 5T0MA 3CBPA 4I51A 1MUFA 2F69A 4BUPA 1N6CA 2RFIA 1ML9A 3M53A 3QWPA 5JJ0A 3M57A 3SW9A 4YPEA 3S8PA 4MI5A 4YNMA 1N6AA 3F9WA 1MT6A 3MO0A 4YPAA 5CPRB 4JDSA 5LSZA 3RQ4A 2JV0A 5F6KC 3MO5A 4LDGA 3VV0A 4QEOA 4J83A 3F9ZA 3DALA 5F59A 3RAYA 1O9SA 3F9YA 4Z4PA 1PEGA 5T0KA 3N71A 4C1QA 5JIYA 3SWCA 3MEKA 3S7JA 3CBOA 3KMAA 4AU7A 3QWVA 4QENA 4E47A 5TEGA 3RJWA 4WUYA 2G46A 2W5YA 5CCLA 3M58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  5KJN A;  4FMU A;  4O6F A;  5JIN A;  4O30 A;  1ZKK A;  3RU0 A;  3S7B A;  2IGQ A;  3MO2 A;  4YPU A;  3M5A A;  3BO5 A;  3M54 A;  1XQH A;  5LSX A;  2O8J A;  2W5Z A;  3EP0 A;  3K5K A;  5KJL A;  1MVX A;  2R3A A;  5TTF A;  3OXL A;  5TH7 A;  4QEP A;  3TG4 A;  5KJK A;  5T5G A;  1H3I A;  3QWW A;  4YND A;  5EX0 A;  3M56 A;  5EG2 A;  1MVH A;  3VUZ A;  5KJM A;  3CBM A;  5F5E A;  4NVQ A;  4RZ0 A;  5HI7 A;  3M55 A;  4YNP A;  3OXF A;  3PDN A;  1N3J A;  3KMJ A;  5JHN A;  4NJ5 A;  5CCM A;  3DB5 A;  5ARF A;  3KMT A;  3TG5 A;  3OS5 A;  4JLG A;  3S7F A;  3F9X A;  4J7I A;  3IHX A;  3S7D A;  4H12 A;  4J8O A;  3OPE A;  4IJ8 A;  5ARG A;  4J7F A;  3M59 A;  5HQ8 A;  5EX3 A;  3HNA A;  4IJD A;  2QPW A;  2BQZ A;  3FPD A;  5F6L A;  4MI0 A;  5AYF A;  3OOI A;  3OXG A;  5T0M A;  3CBP A;  4I51 A;  1MUF A;  2F69 A;  4BUP A;  1N6C A;  2RFI A;  1ML9 A;  3M53 A;  3QWP A;  5JJ0 A;  3M57 A;  3SW9 A;  4YPE A;  3S8P A;  4MI5 A;  4YNM A;  1N6A A;  3F9W A;  1MT6 A;  3MO0 A;  4YPA A;  5CPR B;  4JDS A;  5LSZ A;  3RQ4 A;  2JV0 A;  5F6K C;  3MO5 A;  4LDG A;  3VV0 A;  4QEO A;  4J83 A;  3F9Z A;  3DAL A;  5F59 A;  3RAY A;  1O9S A;  3F9Y A;  4Z4P A;  1PEG A;  5T0K A;  3N71 A;  4C1Q A;  5JIY A;  3SWC A;  3MEK A;  3S7J A;  3CBO A;  3KMA A;  4AU7 A;  3QWV A;  4QEN A;  4E47 A;  5TEG A;  3RJW A;  4WUY A;  2G46 A;  2W5Y A;  5CCL A;  3M58 A; 
#chains in the Genus database with same CATH topology
 3RIB A;  5KJN A;  4FMU A;  4O6F A;  5JIN A;  4O30 A;  1ZKK A;  3RU0 A;  3S7B A;  2IGQ A;  3MO2 A;  4YPU A;  3M5A A;  3BO5 A;  3M54 A;  1XQH A;  5LSX A;  2O8J A;  2W5Z A;  3EP0 A;  3K5K A;  5KJL A;  1MVX A;  2R3A A;  5TTF A;  3OXL A;  5TH7 A;  4QEP A;  3TG4 A;  5KJK A;  5T5G A;  1H3I A;  3QWW A;  4YND A;  5EX0 A;  3M56 A;  5EG2 A;  1MVH A;  3VUZ A;  5KJM A;  3CBM A;  5F5E A;  4NVQ A;  4RZ0 A;  5HI7 A;  3M55 A;  4YNP A;  3OXF A;  3PDN A;  1N3J A;  3KMJ A;  5JHN A;  4NJ5 A;  5CCM A;  3DB5 A;  5ARF A;  3KMT A;  3TG5 A;  3OS5 A;  4JLG A;  3S7F A;  3F9X A;  4J7I A;  3IHX A;  3S7D A;  4H12 A;  4J8O A;  3OPE A;  4IJ8 A;  5ARG A;  4J7F A;  3M59 A;  5HQ8 A;  5EX3 A;  3HNA A;  4IJD A;  2QPW A;  2BQZ A;  3FPD A;  5F6L A;  4MI0 A;  5AYF A;  3OOI A;  3OXG A;  5T0M A;  3CBP A;  4I51 A;  1MUF A;  2F69 A;  4BUP A;  1N6C A;  2RFI A;  1ML9 A;  3M53 A;  3QWP A;  5JJ0 A;  3M57 A;  3SW9 A;  4YPE A;  3S8P A;  4MI5 A;  4YNM A;  1N6A A;  3F9W A;  1MT6 A;  3MO0 A;  4YPA A;  5CPR B;  4JDS A;  5LSZ A;  3RQ4 A;  2JV0 A;  5F6K C;  3MO5 A;  4LDG A;  3VV0 A;  4QEO A;  4J83 A;  3F9Z A;  3DAL A;  5F59 A;  3RAY A;  1O9S A;  3F9Y A;  4Z4P A;  1PEG A;  5T0K A;  3N71 A;  4C1Q A;  5JIY A;  3SWC A;  3MEK A;  3S7J A;  3CBO A;  3KMA A;  4AU7 A;  3QWV A;  4QEN A;  4E47 A;  5TEG A;  3RJW A;  4WUY A;  2G46 A;  2W5Y A;  5CCL A;  3M58 A; 
#chains in the Genus database with same CATH homology
 3RIB A;  5KJN A;  4FMU A;  4O6F A;  5JIN A;  4O30 A;  1ZKK A;  3RU0 A;  3S7B A;  2IGQ A;  3MO2 A;  4YPU A;  3M5A A;  3BO5 A;  3M54 A;  1XQH A;  5LSX A;  2O8J A;  2W5Z A;  3EP0 A;  3K5K A;  5KJL A;  1MVX A;  2R3A A;  5TTF A;  3OXL A;  5TH7 A;  4QEP A;  3TG4 A;  5KJK A;  5T5G A;  1H3I A;  3QWW A;  4YND A;  5EX0 A;  3M56 A;  5EG2 A;  1MVH A;  3VUZ A;  5KJM A;  3CBM A;  5F5E A;  4NVQ A;  4RZ0 A;  5HI7 A;  3M55 A;  4YNP A;  3OXF A;  3PDN A;  1N3J A;  3KMJ A;  5JHN A;  4NJ5 A;  5CCM A;  3DB5 A;  5ARF A;  3KMT A;  3TG5 A;  3OS5 A;  4JLG A;  3S7F A;  3F9X A;  4J7I A;  3IHX A;  3S7D A;  4H12 A;  4J8O A;  3OPE A;  4IJ8 A;  5ARG A;  4J7F A;  3M59 A;  5HQ8 A;  5EX3 A;  3HNA A;  4IJD A;  2QPW A;  2BQZ A;  3FPD A;  5F6L A;  4MI0 A;  5AYF A;  3OOI A;  3OXG A;  5T0M A;  3CBP A;  4I51 A;  1MUF A;  2F69 A;  4BUP A;  1N6C A;  2RFI A;  1ML9 A;  3M53 A;  3QWP A;  5JJ0 A;  3M57 A;  3SW9 A;  4YPE A;  3S8P A;  4MI5 A;  4YNM A;  1N6A A;  3F9W A;  1MT6 A;  3MO0 A;  4YPA A;  5CPR B;  4JDS A;  5LSZ A;  3RQ4 A;  2JV0 A;  5F6K C;  3MO5 A;  4LDG A;  3VV0 A;  4QEO A;  4J83 A;  3F9Z A;  3DAL A;  5F59 A;  3RAY A;  1O9S A;  3F9Y A;  4Z4P A;  1PEG A;  5T0K A;  3N71 A;  4C1Q A;  5JIY A;  3SWC A;  3MEK A;  3S7J A;  3CBO A;  3KMA A;  4AU7 A;  3QWV A;  4QEN A;  4E47 A;  5TEG A;  3RJW A;  4WUY A;  2G46 A;  2W5Y A;  5CCL A;  3M58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...