4RZ4A

Fructose-6-phosphate aldolase q59e y131f from e.coli
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
HELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAEVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPFVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acid Base Catalyst Discriminates between a Fructose 6-Phosphate Aldolase and a Transaldolase
doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Fructose-6-phosphate aldolase 1
total genus 85
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.-:
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rz4A00
3LDVA 4RZ4A 4NNCA 5DCBA 3HO8A 1DQXA 4UTKA 1TPWA 3GDMA 1JCYA 3BGGA 1EB3A 2WSQA 1RQHA 1K7XA 3DH7A 1FCVA 3R12A 4FNTA 5G2IA 3UWVA 1ZALA 2Y7FA 2X30A 5CPMA 5I3KA 2HS8A 4PTNA 4JTIA 4KWVA 4HT3A 4ZVJA 2C0AA 3S5YA 3OHIA 3MMTA 2Q8ZA 1XM3A 4M19A 1GPWA 4FIQA 4EIVA 3N34A 2FFCA 3MYPA 4UFIA 1RZMA 1A5SA 5TQLA 3N19B 1OF6A 4IMEA 2VFFA 3KX6A 4QNEA 3H54A 1YADA 1DJQA 2A21A 3NQ6A 1M6JA 1DHPA 2QCFA 5CZ0A 1I8JA 4ML9A 3G0UA 4PA8A 4X22A 1NVMA 1XBZA 4JX6A 3SW6A 4ALDA 2F84A 3CQ0A 4LVGA 5HWMA 3HG3A 3NZ1A 1OK4A 6ALDA 5TIMA 3UXAA 3KAOA 5BMXA 3KOFA 3O06A 5AHFA 1GWJA 4DBDA 1JJKA 1YPFA 2BTMA 4MIMA 2YFOA 3QW3A 4GUJA 4O19A 1QOQA 3B06A 4FNSA 1OX4B 1LLZA 5I3HA 1W56A 1ZHAA 1K8ZA 2ZQ0A 4JTGA 1O5KA 4JTEA 4HPJA 4BI5A 4MLRA 4FB7A 4Y9AA 3EX6A 5K9DA 1HG3A 3GKFA 4XZ9A 4FNUA 3PM6A 2WKJA 1N8FA 1K02A 3FA5A 1P0NA 4BWLA 3C0JA 1W5MA 3CT7A 4LUJA 3W74A 3O05A 3P80A 4CQ8A 4TR9A 3G1YA 1X8FA 1VC4A 2X2GA 5LGZA 3L9CA 1X7FA 4M6PA 2RH9A 3MI3A 4Z08A 2AAMA 2YCEA 4Z0SA 1QOPA 1SU5A 2QCHA 2R91A 4N6FA 4XWUA 1OABA 3FKRA 4MZ1A 3CWNA 2JGQA 3B8DA 2C14A 3O63A 5G1YA 4AWSA 5DXXA 4YCOA 2WNQA 5LNSA 4IPIA 2ABAA 3E0IA 1LLWA 2B7OA 5CKSA 3OG3A 3MJYA 5FF4A 3WJYA 2YDAA 1GVFA 1O95A 3IGSA 2CW6A 4DBEA 2G97A 4PFMA 2R8WA 1V5XA 4JIPA 5HWNA 1UUOA 3B0UX 1ALDA 1XUUA 3M1ZA 4RZ6A 4TU1A 1XDMA 4O52A 1I2QA 2VFHA 2YFNA 5GVJA 3CIXA 2DZPA 4H4IA 1I2NA 1Q6RA 1R2SA 1KFJA 4GUIA 7TIMA 5EA9A 3SECA 1SQ7A 3A5FA 3ANYA 1CX9A 3HB9A 1P5BA 2OCZA 3D0CA 3G24A 3IV3A 4WZHA 3M5XA 2CLOA 1ZAJA 1YDVA 3C61A 4YMZA 4LT9A 4WJEA 3SZ8A 2CLHA 3W84A 3VFLA 2WO5A 3OA3A 3BV4A 2VXNA 3DFQA 3RLVA 1EX5A 5J5RA 2A7PA 1A5BA 4OT7A 1H7NA 2EHHA 3T44A 3EXRA 3W73A 4ZQPA 1VJIA 2UV8G 2NXIA 2X1TA 5FEWA 4WXZA 3TSDA 3PUEA 1RV8A 1FXQA 3FLUA 4PH6A 4JYFA 2QUVA 1FDZA 1QO5A 3PWAA 1KFKA 2Y88A 1TCDA 4ZQMA 1DV7A 5EYWA 5H91A 1RD5A 1W5OA 1ONRA 1W5PA 3B4UA 1AW1A 3F03K 2FTPA 3A5VA 1KFBA 1Q3NA 2VEPA 2H3BA 1HUVA 1SR9A 1W3TA 4UTJA 3DZ1A 3HGRA 1FCQA 4WY0B 2ALDA 2ZZ7A 1DKWA 2ZRXA 5FF2A 5CGQA 4CQ9A 3L0KA 2ISVA 4LVBA 4N9DA 4TO8A 1VLWA 4ZQRA 5CZJA 3QRHA 4TMBA 1Y0EA 5D2TA 3NR0A 1WAUA 2TRSA 4WX2A 3EX4A 4AHQA 5KITA 3N2MA 2QCCA 4JD4A 4UR8A 2D73A 4YXGA 1IIHA 1YDNA 1PHQA 3C4UA 1SO4A 2WOQA 3U2OA 2YW4A 2VENA 1KM4A 3P8JA 1ZFJA 2VFGA 1JQXA 3TAKA 4O1CA 2ZFAA 3GXPA 1KLYA 4UFHA 3NQMA 4HIBA 4K6AA 4MOZA 4PL1A 2VOMA 4CCCA 1G69A 2RDUA 3G3MA 1SFJA 1J5TA 2C13A 2QJGA 2ZRUA 2J6XA 3BG9A 5G4EA 3DHDA 4NT0A 2RHGA 3N3MA 4MFDA 3THQA 4OE7A 3NO5A 1Z48A 1WX0A 5BMWA 3DFNA 4MZ8A 3RMJA 4AMAA 1MEIA 4IMDA 2JK2A 1YDOA 1KM6A 4AXKA 3PS7A 1O5XA 5F4WA 3H53A 4LRSA 2A0NA 4J9JA 1TQJA 3CEUA 1OFBA 5KZMA 1OYAA 4QSHA 2XN2A 2Y7GA 2BSLA 4XQ6A 1JCNA 5CPLA 1LTDA 4A2SA 1EWEA 4IJBA 3FKKA 4JTJA 1KM5A 3CB8A 3T4CA 3TE9A 2DZXA 1L6SA 3W71A 1G4TA 3LCXA 3PG9A 3EEGA 4L4MA 4DEFA 3WJSA 3QC3A 4HSOA 5L9FA 4N2YA 5D33A 5HJLA 3SI9A 3P5YA 2NX1A 4HHPA 3BG3A 3TKFA 3ABRA 4N9EA 1G4EA 3ZWSA 2NUYA 2DORA 1B57A 5D09A 3RFAA 3P84A 1PCWA 2EAWA 4NU7A 3SIZA 1WOAA 5C54A 1E51A 1JCMP 2VEIA 1MEWA 2DZWA 1B3OA 2WNNA 3QPYA 3B0PA 1XC4A 3T55A 4E2DA 5G5IA 1TTJA 1KTNA 3NQCA 1PE1A 2FLIA 5AYYA 3HOJA 4RV8A 4X3ZA 1QNVA 3G1XA 1H63A 3S5OA 3TMQA 1PL9A 3P61A 1EP3A 3M47A 4DPPA 4NJJA 2FIQA 1AK5A 2QF7A 3MBFA 4O4WA 3HBLA 1F6KA 1OG0A 4GFSA 4JYEA 1LRQA 1EIXA 2VEMA 4LC6A 3WK2A 4GUHA 2E1DA 3HQ1A 3LCGA 3C56A 1ZAHA 1U5JA 1P1XA 3OVRA 2QCGA 4QISA 3GNNA 5HNRA 3ZFHA 3WK0A 3KVJA 1JR1A 1OFOA 4IX0A 4O54A 1D9EA 3FJLA 4JTTA 2NX3A 1T0OA 4ORMA 2CLEA 3TW7A 4JS3A 2C16A 5G4WA 4OWGA 1NFBA 2J9ZA 5D2YA 5EKYA 3HG4A 1XBXA 3IGXA 3HJZA 3PG8A 1VQTA 3EB2A 3GDLA 5KTLA 4GXMA 4AB4A 4LC8A 4LU0A 4RKAA 3SY5A 2CWNA 5IM51 4DF1A 4O0KA 4O17A 1OFAA 1F7BA 5DY3A 1C29A 1W37A 2ZBTA 1OX5A 3A24A 5KMYA 3UPBA 3M0ZA 3W1RA 4A29A 1SZGA 4PCFA 3L21A 2O7SA 2X1SA 1W3NA 3P7YA 1LORA 4K7YA 3QSTA 2QDGA 3Q94A 1QO2A 1PV8A 1U83A 4NJIA 2A7NA 2IQTA 1M7PA 3W7RA 4DO4A 1H7OA 2I14A 2V2CA 2V5LA 4FO4A 5K9XA 3NQEA 1ZNNA 1Q45A 1RVGA 4DPQA 3G1FA 5I3GA 3HF3A 3DI1A 3M43A 3IIZA 3PB2A 1QWGA 5HWJA 1XFBA 4W9TA 2P1FA 2V8ZA 2FJKA 1DL3A 1S5VA 1QCWA 3W1LA 2FB3A 1IXPA 2ISWA 3W1PA 1C9DA 3GX9A 4M6VA 2A6NA 1GOXA 3TR2A 3ZR4A 4POCA 4LRTA 3LXCA 1XI3A 3UWUA 3O1NA 2DU2A 4JY8A 1PVNA 3BW2A 1AG1O 2YX0A 3KVLA 3VNDA 3B04A 1TTIA 2H3DA 3IGUA 1T96A 3R8RA 5HINA 3TROA 3G1DA 1QFEA 2H8XA 3LERA 5HR6A 2E09A 3P74A 4RLIA 3DI0A 3DFOA 3B03A 3EWUA 3LCLA 4CNOA 2DZVA 3S1WA 3W2KA 3CPRA 1EP1A 1TQXA 3NG3A 5C5YA 3QQ0A 2ZRYA 1H7XA 1FWWA 3STGA 1G4SA 1KBJA 3W88A 3W7KA 2B7QA 1XDLA 2RDTA 2BX7A 2NLIA 4JXCA 3KFTA 2B0MA 3P60A 5K3VA 3NPUA 5TBOA 5FEZA 3W83A 4O12A 3L5AA 3Q58A 4WD0A 1GVSA 2FPTA 3NNTA 3KRSA 3GR7A 2QUTA 3LTSA 3UWWA 4UTLA 3RNDA 3GLCA 4HSNA 1FWRA 3QPZA 2E6FA 3LCIA 4BI6A 5AHLA 3LXBA 5AB3A 3PUOA 3E9AA 1YTKA 4N9CA 4Z1CA 1FX6A 3STEA 5LSMA 2Q3OA 4O14A 4FXSA 1JCXA 4YCPA 4LVAA 1PIIA 1ZAIA 3W7JA 3PSVA 3TXZA 2QUUA 2ZZ1A 2PRHA 4TMCA 4N4PA 4ZQNA 2ZTJA 3FYOA 1ICPA 1W3IA 1X1OA 5CZSA 3W2UA 3LBCA 5I3JA 5LKYA 4GUGA 2E6YA 3DXIA 1VZWA 4ADSA 4DF0A 4Z1DA 4NZJA 1QPNA 1KFLA 5DBUA 3IEBA 1I2RA 4LOCA 4UMCA 2QAPA 1GT8A 3PBYA 1VRDA 4Z1AA 1KFCA 4GNJA 3GXTA 3E49A 3OBKA 3UD6A 1Z44A 1F73A 4UTHA 1L2UA 2V30A 1LP6A 1B4KA 1XBYA 4S1FA 3PULA 4QIUA 4XBKA 3QSRA 1W0MA 5AC8A 1ZJIA 3DU0A 2E6DA 2HMCA 2A4AA 1Z41A 3S42A 1ME7A 4OV4A 4IMGA 2BZNA 3BGJA 3QYQA 1XL9A 2GVGA 1SO6A 3IIVA 3PBUA 3NQ8A 3W7OA 1S5WA 2WSRA 1YXYA 1K8XA 4JN6A 3TA6A 1OFDA 1QPRA 2NUWA 5BW6A 5U7SA 8TIMA 3EX2A 4JDYA 4RXGA 4ORIA 2GVJA 5K9CA 4MPQA 3NPVA 5L6UA 4D2JA 2PC4A 4XUGA 2ZRWA 1A5CA 1YXCA 1SZFA 5E93A 3EWBX 3HPSA 1HFBA 4E0CA 1FDYA 1BEUA 3NOEA 3LI1A 4B5NA 2G95A 2NXHA 5J5DA 2V5BA 2TPSA 3GNDA 2ZZ6A 4RK8A 5I3IA 4ZQCA 6TIMA 4H3DA 5A8GA 3W6YA 5D05A 3I7SA 4A3UA 3TW6A 2OJPA 4IXXA 3S5ZA 3PBWA 4M5PA 3G1AA 3MP3A 4JR5A 3SJ3A 4HPXA 2Z1BA 2VEKA 4CQAA 3C8FA 4MY1A 3DFSA 3W3OA 3LLDA 3GB6A 3WJZA 3KVMA 3W7DA 5D2XA 4KFOA 4XKYB 3NQ7A 1TTQA 4JIQA 1H7WA 1O94A 1YPIA 3MBDA 4GE8A 2ZTKA 3C2VA 3TU9A 3JRKA 3GAYA 4XBSA 1PCKA 3R13A 4CNPA 3L0NA 3LHYA 2OMAA 3PR2A 5LGXA 3QZEA 3M6YA 3S1VA 2ZCGA 3ELFA 1TPEA 4FEZA 4IXHA 3OEXA 1SW3A 2VC6A 2FDSA 2DJLA 1LBFA 4JEQA 5F2MA 1YYAA 3UZJA 2ZZ4A 3TK7A 4YWIA 3IVSA 1SFLA 1AL8A 1SO3A 4ONVA 4OU1A 3LHZA 2WSYA 5KINA 1WOBA 3A9IA 1IXOA 4UTIA 5AFDA 5BRBA 1YXDA 1VCFA 4RJEA 1OYCA 1ML1A 4K38A 1F76A 3L2IA 1TV8A 2AQWA 3LTPA 3M16A 2BLEA 1TPC1 3G0XA 1L6YA 1OFPA 3DGRA 4JDBA 4O28A 1HTIA 1PHWA 4Y6GA 2GQ9A 4ZL1A 2EGZA 3H55A 1TV5A 2PURA 3PVFA 1NSJA 4JTHA 3NAVA 2NV1A 5F1UA 4MYXA 5AHNA 1GG0A 1C8VA 1G6CA 3HG2A 4DELA 2YSWA 3UPWA 1D3GA 3TIMA 3WFAA 1RQEA 3EWXA 2CLLA 3T7VA 3F4NA 3BO9A 3G1VA 3LOTA 1SUXA 3VKJA 3CWOX 1SZNA 4IOTA 2CFFA 1L9WA 2Y62A 1LBLA 4LWWA 3TC6A 4ADTA 4H6KA 2CLKA 4O57A 5E1QA 3UY7A 5D30A 3P8IA 4HNNA 2Y89A 5AOUA 3MI6A 1XXXA 2QJIA 3TJXA 3BARA 3N14A 1GZGA 2CZDA 3BLIA 4O0ZA 3O6CA 1AW5A 3LV5A 1MXSA 4S2CA 1UB3A 5A5WA 4QNWA 4MKNA 3S1XA 1GVOA 4P61A 2X1UA 4Z0JA 3TH6A 3BLFA 4KKXA 4DQWA 1A53A 3C3NA 4DXVA 1F6PA 1W5NA 2XN0A 5F1VA 3DFPA 4E38A 2W6RA 3LTYA 3USBA 1KV8A 4JTLA 4JX5A 3SFKA 3C2EA 3B0VC 3W07A 1JUKA 4ICNA 4JTSA 3HPXA 4KFNA 1ZENA 4MUZA 1V7YA 3T78A 2HS6A 4IPJA 3S6DA 1IXQA 2G96A 3TQKA 4YLWA 2E77A 1EPXA 3OIXA 3TDFA 1OFQA 2Z6JA 1TPDA 1MO0A 2E6AA 1TV7A 1TRDA 3MI2A 4EF8A 1FUYA 4Q33A 2E5BA 3LCHA 5U4NA 3TFXA 3NQ2A 3RK8A 3SGZA 1KW1A 1Z42A 5LHFA 1K03A 3LRLA 5FEPA 1IF2A 5K7JA 3M7WA 1NAL1 3NXFA 3S5NA 3IIPA 1IIGA 1VYSX 4DO5A 3S8HA 2FPVA 3W7LA 2QCMA 3BLEA 3MHUA 1SO5A 2J27A 4QQ3A 1K7FA 5D38A 4IMFA 3W9ZA 5DXYA 2FQIA 4GWEA 3NYZA 4IGHA 3I7RA 2QCDA 3JS3A 4DF2A 3C52A 3BVJA 4UTWA 3CM4A 3TX9A 3ZS4A 4TX9A 2VFIA 5BOOA 4WQ6A 4U28A 1F05A 5D32A 3L68A 3GZ3A 4MYAA 4LV4A 1CW2A 2ZRZA 4JTUA 4ZMGA 3NGJA 2P10A 4CLMA 4N9BA 2QEZA 4HKPA 2C19A 1OJXA 4LS1A 4NNAA 1LDCA 3N9SA 4P2VA 3BW4A 1FWTA 2H8ZA 4PEKA 5EMUA 1GJPA 3QMTA 4GC4A 5AHIA 1H60A 4O15A 2J88A 1TMHA 4TIMA 4I7UA 2Z0IA 1FCBA 3M41A 2WV8A 2Q8LA 5D2WA 1FBAA 1K7EA 5AC7A 1A5AA 2Y7DA 1WV2A 3QMRA 4PC8A 2Y61A 3W1TA 4O10A 3W7CA 1JRBA 1SSGA 2OZ0A 3L5LA 3I65A 3C6CA 1QDSA 3GDKA 3GK0A 1ICSA 4K7VA 4O13A 3OVQA 1KV5A 3O8AA 4MLJA 5CPNA 5ABTA 3DENA 5EPDA 3W1MA 3P82A 5LNVA 1BWLA 2YPIA 3DKLA 4LVFA 2YZRA 4LS0A 2WQPA 3STCA 4WUIA 3TJLA 1OHLA 1I2OA 3G18A 2AGKA 4X2RA 1QAPA 3SGUA 1K3UA 1TPVA 2V82A 2ZRVA 2CLMA 1EP2A 2GUUA 1H62A 4GUFA 2BXVA 3M5YA 3HG5A 3CIWA 4IX2A 1UCWA 4UUIA 1QMLA 2Y7EA 1Q6OA 2DZTA 4AWUA 1FXPA 4QITA 2O7QA 3DAQA 3LLFA 5FESA 2Y85A 3CTLA 4UMAA 1X1ZA 3GKAA 4UR7A 2PCQA 1DVJA 1VR6A 2EF9A 3O15A 2W79A 4YL2A 2QR6A 2Y63A 1TPB1 1KTCA 3G0SA 4FX7A 2NWSA 4BWLC 1H7PA 3I7QA 3VE7A 1G7VA 3W2JA 4JTFA 1SSDA 3N9RA 3RU6A 3LM7A 4UNKA 4XTIA 3DBPA 3HGSA 4C1KA 3RLUA 4O11A 5EY5A 1AL7A 1B9BA 2GJNA 3NZRA 3PBVA 5HUPA 3W7HA 4KWWA 3V1PA 3E12A 2YW3A 3LHTA 3O6DA 2B7NA 1I2PA 1GQNA 1W1ZA 2ZZ5A 3CU2A 3TQVA 4NJHA 5AYZA 2I9EA 4UFKA 4O1DA 3W7GA 5CPOA 3BK0A 4O53A 3CLMA 4N6EA 1K8YA 3PSWA 3M44A 3TXVA 3ABOA 1VCVA 3W72A 4UXDA 1DBTA 3KHJA 1W8SA 1J4EA 4O16A 1TTPA 5F2GA 3FOKA 5FI8A 5F4XA 3NL3A 3UWQA 3TFCA 1OF8A 1B4EA 3S0CA 3EXSA 4UTTA 1FWNA 5HQEA 1JCJA 1VCGA 3NDOA 4AWTA 5T26A 2YXGA 3LBMA 4Y8FA 3E02A 4S2BA 3L65A 2I1OA 3EWWA 2C15A 3W76A 3G8EA 1BKSA 3EKZA 3W22A 2J24A 1G67A 3IIXA 4OGZA 4JTKA 3LHVA 3LRKA 3FEMA 1P4CA 3UNDA 4I7VA 4Y96A 3GVGA 2F7FA 1QR7A 5FEXA 4RCXA 1EWDA 5LZLA 1TREA 3IVUA 4N02A 3TNOA 3MP5A 2WPBA 3UXDA 4FX6M 4Q4KA 2FB2A 1WXJA 2WNZA 2VKZG 4AH7A 4GRSA 5E0KA 3R5EA 1G4PA 5AC6A 3PB0A 4FXRA 1HL2A 3L67A 3W2LA 2H6RA 3C2FA 5LNUA 1LOSA 2BWGA 3W1AA 2NV2A 4K8HA 4G1KA 4M7TA 2QCLA 3PC0A 3W7NA 3LCFA 4NZFA 3TMLA 4BR1A 1WQ5A 3LB0A 1KM3A 2ABBA 2DP3A 1GTEA 1VLIA 2PRLA 4LNYA 4XTDA 3STFA 5LNWA 4C1LA 4NQ1A 1Q6LA 4AHOA 1M5WA 2V2HA 2RFGA 1LOQA 3W1NA 2GQ8A 1OVDA 1AW2A 1PS9A 2J9YA 4OQVA 4E2BA 3NQDA 4R34A 4MFEA 3KRZA 1F2JA 5BNKA 1LOLA 3LGEA 1FQ0A 3PF3A 5FF3A 3ZWTA 2X1RA 1WBJA 1OX4A 1JUEA 3NQAA 1OYBA 1H51A 2DZSA 3LHWA 3GDTA 3NQGA 1LM1A 1EA0A 2V2DA 1VS1A 2B7PA 2R14A 4OV9A 1R47A 2CLFA 3N2XA 3ABSA 3INPA 5D37A 4MJMA 3UZ5A 4Y90A 3AO0A 2NXGA 5CSSA 3DHFA 4UMBA 3O6YX 4NVTA 3IVTA 1OX6A 5G1TA 2ZA3A 3U8GA 4Z1BA 2QCDB 3MWAA 1THFD 3MHFA 4R7JA 1GTHA 2R94A 1HO1A 2WJZA 3CHVA 1UASA 1NF7A 3WK3A 1W31A 5HUOA 4UFLA 2JKPA 4RZ5A 1ICQA 3DFTA 1H50A 2DJXA 3L5MA 4LY8A 3QH2A 1R46A 3FJ6A 3G3DA 1LZOA 2VFDA 1R2TA 3LX9A 4HNTA 4JX4A 1DOSA 4M6QA 4UFJA 4A21A 3CEPA 4BF9A 2EPHA 4IMCA 3UYCA 2GOUA 3WK1A 3L0GA 3DKJA 2A85A 1P0KA 4MY8A 2QCNA 1LRTA 3QJAA 4A22A 4IQLA 4OHQA 4R33A 3W1UA 3MP4A 1XKYA 4NJKA 4LS2A 3VCRA 3SSJA 1OFEA 2A7RA 1NF0A 4AF0B 1KM1A 3P67A 1IGSA 2XN1A 3QQ1A 2HTMA 3LV6A 1G7UA 1MSSA 1RQBA 4UTWC 5FF7A 1W5QA 3Q37A 1JULA 4ADUA 3U6WA 2C1HA 3UWYA 2PE4A 5D2VA 1GVQA 1VHCA 2JGYA 1XUZA 2JBMA 3QMSA 3P5ZA 4HNUA 3NA8A 3TCEA 3HGJA 3MYOA 1ME8A 1NEYA 3JR2A 3MO7A 1TPH1 4JYDA 2HSAA 3NM1A 3ATYA 2H90A 4EWND 2OT1A 2RDWA 3W7IA 1W54A 1JRCA 5CSRA 5HR7A 2GVLA 2V0TA 3W7EA 3LXAA 2Z2UA 2GQAA 2A1YA 2A6LA 1CI1A 2VFEA 3CC1A 1H5YA 1WBHA 3N73A 4I7WA 3TAOA 2ISSA 5G2HA 4AF0A 4ZZ9A 1D3HA 1TJPA 3PAJA 2QDHA 1SZEA 1JUBA 2P0OA 1VGAA 3NVTA 4MJZA 3ABQA 4WOQA 1RR2A 4K36A 5I3FA 1TPFA 2VELA 4PL2A 5D04C 4K39A 1XCFA 4PODA 4NX0A 5HMSA 1KLZA 2CZ5A 3QM3A 5C55A 2GJLA 2TMDA 5H2ZA 4O1AA 1FY6A 2Y6ZA 4FIRA 4DO6A 3IRDA 1TIMA 3W1QA 4UTUA 2NX9A 4QJ1A 1KM2A 1IXNA 3M5ZA 3GAKA 1N55A 3RF9A 3L66A 5F4SA 4LVDA 3TC7A 1GVRA 1O4UA 3EWYA 4NUWA 3B05A 3NEVA 4NXKA 5AN7A 2QAFA 3K30A 1EUAA 1KM0A 3FFSA 3W86A 1KA9F 4QAIA 1VYPX 3VE9A 3NL6A 3QW4B 3YPIA 1KBIA 2YYUA 2JKEA 3W1XA 2ZDRA 5EBUA 1DORA 1WA3A 2CU0A 3MUXA 5MHBA 2NZLA 3C2RA 5LNRA 1R2RA 2TSYA 2NWRA 5C6MA 4NX5A 2E5CA 1J2WA 4UIOA 4I9AA 3A21A 1MZHA 1TRIA 1KFEA 2Q3RA 3THAA 4GJ1A 4M7SA 4O4VA 3HMJG 1KTBA 1H1ZA 3S9YA 1RPXA 2QKFA 4CNNA 1L6WA 3ATZA 3MW7A 4FNQA 2ATSA 1F5ZA 1BTMA 1LRNA 4MZYA 3C2OA 1MEHA 4JY9A 4JICA 4BK9A 3O16A 3QEZA 5LHEA 2LLEA 3GDRA 3GR8A 1O60A 2KZHA 3A23A 4MVAA 4BI7A 5AHEA 3FS2A 3HGOA 4FX8A 3EWZA 3W7MA 4HN4A 2YYTA 3FIGA 3R89A 4LUIA 3HPZA 4WY0F 1R30A 3W85A 3E96A 1GYLA 3GXNA 4UTMA 5CZTA 4O50A 3LI0A 2DZUA 3BPWA 1EUNA 4FF7A 2C18A 2J9XA 1WYIA 4K37A 1YTEA 1SW7A 1S5TA 2ZYFA 4O18A 3F4WA 1OFRA 2ZA1A 2E5DA 3SR7A 1H7RA 4UNLA 3GIYA 3WJXA 3KRUA 1QPQA 4FNRA 1ADOA 3TUUA 3GYEA 3I6RA 3A22A 4JGDA 4UC5A 1ZY9A 4NJGA 3LCWA 4IWWA 2GPTA 3P81A 1VPXA 1LYXA 3TV8A 3G1SA 4NXSA 3AJXA 5DBTA 4MY9A 2G5WA 1TPUA 1ME9A 1JVNA 3V75A 2OX1A 4Q32A 1H1YA 5CG7A 2B4GA 5G2WA 3LHUA 2V9DA 3P62A 3EX1A 4RR4A 5F2LA 3NPXA 4FNPA 4X9SA 4RX0A 3NL5A 1Q6QA 1JCLA 3F1QA 4EOUA 4LV9A 1ZCOA 3NM3A 1JQVA 2A5HA 3M5VA 3W7QA 4WY0A 1TYGA 4LTSA 3M9YA 1VHNA 1H61A 3QFEA 2CZEA 2QCEA 4UFMA 1YLVA 1I45A 2XFWA 2Z6IA 1TB3A 2RKXA 5D02A 1UJPA 1LCOA 4KFPA 1T99A 2PRMA 3UQNA 4L4LA 3UWZA 4FHAA 5SWUA 2TYSA 2A2IA 1QPOA 4A2RA 2ZZ3A 3W70A 4OBTA 4R53A 3W75A 4WXYA 3PUDA 1YTDA 3KVKA 5EL1A 4EVZA 3G22A 3W23A 2YGYA 3S1UA 3IIOA 3EXTA 1OK6A 4O1BA 3WJWA 2C6QA 1N7KA 2YR1A 2E68A 2NUXA 4CCEA 3UY8A 3OVPA 5K4ZA 5DCDA 4QM1A 4UTTC 5F2IA 3R2GA 4LW7A 3NL2A 5KZEA 5D03A 4NNBA 1VYRA 2W0UA 1FDJA 1GYNA 4HNVA 5DCEA 4AVFA 4AEOA 3NQVA 2ATMA 1DJNA 3FYPA 5KSWA 1TO3A 1SW0A 1GEQA 1F74A 3HIJA 5HULA 4RXFA 3LRMA 3W2MA 2X16A 2EKCA 3O07A 5IBXC 2V81A 3TQ0A 5AYXA 1WDWA 5C2XA 1SPQA 3T40A 5K2ZA 1A50A 1EEPA 4BFAA 1I4NA 3G1HA 4IUOA 4AAJA 1VH7A 2ZA2A 5DLCA 3VI2A 4GBUA 5IBXA 1XBVA 3W2NA 5K4XA 1T8XA 1AMKA 4CCDA 4EF9A 1HO4A 4AHPA 1BWKA 2JKAA 2OT0A 3PY2A 4K8EA 1FWSA 1GG1A 2CZFA 1UUMA 1S3HA 3TSBA 2ZZ2A 1TSIA 1LROA 3W7PA 1FCUA 3BW3A 4ZQOA 5FF0A 2Y70A 3EKLA 3Q2DA 3NPWA 5KZDA 1X6UA 5AHMA 3BG5A 1LBMA 3G8RA 5DELA 3EX3A 3QF0A 5DN1A 3I68A 3TSMA 3KXQA 2FPYA 2C3ZA 2QJHA 3NQFA 4XKYA 5DY2A 2CLIA 4N4QA 4O8RA 3W87A 3MHGA 4U4MA 1TJRA 4JNMA 4WOZA 1UBSA 4UCGA 1DQWA 1M7OA
chains in the Genus database with same CATH superfamily
1DJIA 1ONXA 1E71M 4NNCA 4RZ4A 3XISA 3AJ7A 4D6EA 3GDMA 3DFYA 1RQHA 2VVNA 1JXJA 3R12A 4FNTA 2X30A 4QAWA 4S3FA 3N6QA 2HNEA 3SAZA 4PTNA 3TLLA 4HYVA 4Y9PA 4ZVJA 3S5YA 2PDCA 2GK1B 3A3WA 3AZRA 1XM3A 5E6ZA 5LA0A 1FHUA 3N34A 2FFCA 4W87A 2XVNA 1J11A 1JGIA 2ZWYA 1V02E 2VFFA 3KX6A 3MKKA 1UD2A 1YADA 3LN3A 2ZC1A 3NQ6A 1M6JA 1FH9A 4JN7A 3TNBA 3CQ0A 1TUXA 3CMGA 4EX4A 1E9LA 2BOFX 3HV8A 3NZ1A 1E3ZA 3S46A 5AHFA 1GVIA 4YHGA 2BTMA 3RM9A 1QOQA 3B06A 4QEEA 1ZHAA 2HV5A 1E9ZB 4LB3A 2B81A 1K8ZA 2ZQ0A 1F07A 6XIAA 4JTEA 1AZ2A 3OQEA 4HPJA 1IWBA 4FB7A 3W0KA 3GKFA 4GIEA 2A3BA 1KKOA 4L9XA 1O5QA 3CLWA 3FA5A 3C0JA 1E0TA 2D0HA 2RGLA 3WUFA 4E8CA 1VC4A 3ARRA 3L9CA 3TTOA 3VKDA 1X7FA 4Z0SA 2AAMA 3TYDA 2QCHA 4ZO7A 4XWUA 1EDQA 2CBJA 3H22A 2V5DA 5ABGA 4WRHA 3CWNA 3AHYA 1ECQA 5AZ0A 4ML4A 2YDRA 2QXWA 3N4AA 3ITVA 2FMOA 2D22A 4QDMA 3WQEA 1GVFA 2YDSA 3H7VA 3IGSA 4PFHA 3RR1A 5EMMA 4DBEA 3N11A 4NASA 1UUOA 3AXHA 1ALDA 1XUUA 3ITGA 2VFHA 3VO0A 2DZPA 1R2SA 7TIMA 2QPXA 3ANYA 1XRSA 2X7WA 2CETA 4HHMA 2CLOA 1XH0A 3WF0A 1ZAJA 3CQIA 3CQHA 5I78A 2CLHA 2HK1A 3D3FA 3KBSA 4NHVA 1AH3A 2VXNA 3DFQA 5HXMA 5J5RA 3UA4A 3V36A 3CL6A 1H7NA 3EXRA 3EGJA 3OG2A 4A8LA 4NAEB 1DWIM 1RLDA 2X1TA 4EPBC 2BODX 3PUEA 1DXFA 1FXQA 1JFHA 4HHLA 4G7EA 2XISA 1CEOA 1MW1A 4JTCA 3GWQA 4KIRA 1TCDA 2YL8A 4ZQMA 1PJ9A 1ONRA 1W5PA 1J6PA 3F03K 3A5VA 1L6GA 3R11A 1FP8A 3BJFA 2D23A 1W3TA 3BE7A 3IJLA 2V68A 2WWDA 2PF8A 1XS2A 2ZRXA 3L0KA 2XIOA 2ISVA 4OKDA 3UXIA 5HATA 3BLDA 4AWEA 4TMBA 1QASA 3MB9A 4HHHA 1UR1A 4IM4A 4IGSA 3GTHA 3EX4A 1Y7VA 3EA3A 3S2NA 3CMFA 4JD4A 4DI8A 4C65A 4IFRA 1HW6A 1YDNA 1RPKA 2IXVA 3U2OA 2VENA 1KM4A 2QIWA 1XYCA 3P8JA 4GIYA 4HOWA 2VFGA 1VBHA 3TAKA 4O1CA 2ZFAA 3IUIA 3POCA 1KLYA 4MOZA 1J0JA 4CCCA 1G69A 1M7XA 2QJGA 2W9MA 3DHDA 1Y5VA 3BXWA 1IHIA 4D6GA 1WX0A 3DFNA 4G2DA 1V3HA 2JK2A 4D72A 1KM6A 2YJQA 3H53A 5IRPA 1TQJA 3CEUA 5CBIA 2OFJA 4QSHA 3C3UA 2BSLA 2I9UA 2DW7A 3UGVA 5CPLA 5IDZA 1XX1A 4IGNA 4IJBA 2DSZA 3M4HA 3VUSA 3GRIA 1L6SA 5FJTA 1QATA 5A6LA 2WLZA 3WBXA 1KCXA 3HMCA 5HJLA 2Z7KA 2VEFA 4GGHA 5ABFA 4HHPA 3OGSA 3NIYA 1U30A 1AH0A 4N9EA 1WZAA 4F0MA 3QOKA 3RFAA 3EDJA 3P84A 1PCWA 4NU7A 3T0DA 4AX6A 3O6AA 3KLKA 4F0HA 3URNA 1D2KA 1JCMP 2WXDM 3VZZA 3VNIA 5DT7A 1B3OA 3QPYA 1CIUA 4LAZA 1EYWA 1F6YA 2FLIA 3PBMA 1QNVA 3G1XA 3S5OA 4PMDA 1PL9A 2OZ8A 3P61A 3M47A 4GGBA 2AAAA 4NJJA 1XGEA 4O4WA 1F6KA 1OG0A 3KS6A 3FEQA 3EAUA 1LRQA 4AD0A 1EIXA 2VEMA 4AUBA 4LC6A 3WK2A 2E1DA 3N12A 5FCZA 2QCGA 5I2UA 1MW2A 3GNNA 3KWSA 3E2QA 3KVJA 4B91A 2CWXA 5FAJA 5LYRA 1CGWA 3OIHA 4XAZA 1M53A 5FJUA 1T0OA 4ORMA 3TW7A 1Z6KA 4L6HA 5G4WA 4OWGA 5DMYA 4NRRA 4KCVA 4A3HA 1QOXA 5D2YA 2ZVIA 1QVBA 3HQPA 3IGXA 2B31A 4FK9A 1L6FA 1HX0A 2F2KA 3PG8A 3EB2A 4C6CA 4GXMA 4PMJA 3OPSA 4DF1A 4A3QA 4URIA 1OFAA 5DY3A 1W37A 1IT7A 5KMYA 2QS8A 3W1RA 2PDPA 3L21A 1GKQA 1TWDA 4Q4RA 3QSTA 4JKMA 3CZLA 4KW2A 3QBUA 3QGVA 3LMZA 3R6IA 1M7PA 2WMGA 4DO4A 4IIEA 5CPQA 1ZNNA 3DI1A 3M43A 1QWGA 1TIWA 5HWJA 4W9TA 1ISWA 2P1FA 2FJKA 4KIEA 1S5VA 1QCWA 3UEQA 3W1LA 3WBYA 4L7ZA 2ISWA 2XTKA 1C9DA 3Q65A 4RW3A 1M9HA 1S1PA 3PJXA 2R24A 1MRAA 3UWUA 3O1NA 1QUMA 3BW2A 1AG1O 3WDQA 2Q8XA 1ITXA 1T96A 1PZ1A 3H70A 3TROA 3UJ2A 4JEJA 2H8XA 2V63A 3GHRA 3LERA 5HR6A 1E6SM 3LK6A 2J8GA 3UCDA 3S1WA 1PZ2A 3GW0A 1EP1A 4FZIA 5LIUX 1EBGA 5C5YA 3CT2A 2ZRYA 1F9CA 1G4SA 1KBJA 2QJMA 3W88A 4DXXA 3WCZA 2B7QA 3DG3A 4IL2A 2NLIA 4JXCA 3K1DA 2GWGA 4D6IA 3NPUA 4GY1A 2XM1A 5FEZA 3NTYA 1GVSA 3NNTA 3PZNA 3GR7A 2QUTA 4QX4A 1YMYA 2PMQA 3WQ8A 1G01A 3L4XA 4Z2GA 1KRMA 3UXKA 1HJWA 1ISXA 4UTLA 6PTDA 9CGTA 4HSNA 1FP9A 4U2YA 4BI6A 1BRLA 1X7IA 1XIJA 3LXBA 5A6BD 3E9AA 4N9CA 4L1WA 4P8UA 1G9HA 4FXSA 4IFKB 3WDIA 4LVAA 4TMCA 3TXZA 1UKPA 3WYZA 3KL3A 4KRTA 5CZSA 3W2UA 3WSUA 3TQPA 2ZXAA 1LQAA 1Q2SA 4DF0A 4Z1DA 4WLCA 2J13A 3N17A 2OODA 4B2DA 3TN5A 3UW6A 3DECA 4XG1A 4LOCA 3ONBA 4UMCA 2QAPA 3KP0A 1VEPA 5FD0A 1E4MM 4Z1AA 3AHZA 2WVVB 1F73A 3VIOA 4UTHA 1L2UA 4Y9NA 5LA2A 5BWFA 3NZPA 5CC7A 4XO6A 1LP6A 2YXXA 3L12A 4S1FA 7ENLA 3CO8A 3N13A 4F2BA 1W0MA 4FXFA 3SCOA 4MNJA 4HU4A 3T2OA 1Z41A 1AJ0A 3IGHX 5A94A 3KCJA 3OLEA 1IEVA 3WUBA 1M41A 1C8XA 1UA7A 3K5XA 3AIBA 2NVAA 3W7OA 3QR3A 5I6SA 1IR1A 2JEQA 3V5OA 3O9NA 1V3JA 3M0YA 2NUWA 5BW6A 5BYWA 4D6DA 2OSYA 4JDYA 3B0YA 4HD5A 1OC7A 4GHRA 4D2JA 3ARPA 4FS9A 1O6IA 4LAKA 4DWDA 1SZFA 5DRIA 1HFBA 1V79A 3JVAA 2XVGA 2VZUA 1BEUA 3EA2A 3NOEA 4PCTA 1PKYA 2WC4A 2TPSA 3EOEA 2ZZ6A 3VOCA 4H3DA 5A8GA 3W6YA 5D05A 4DUOA 1LG2A 4A3UA 2PWUA 2OJPA 1FFQA 3CH0A 1S5NA 3SJ3A 4HPXA 1VP5A 3C8FA 4MY1A 5C7HA 3KVMA 3W7DA 1JPDX 4KFOA 2VGIA 1H7WA 4DLFA 4UQCA 1NFGA 3HURA 4US5A 2ZTKA 5JH1A 4EK7A 1PBGA 3H2CA 3TU9A 4DBWA 3GAYA 4XBSA 1PCKA 4CNPA 3L0NA 3PR2A 4GX8A 3QZEA 5LGXA 2ZXQA 1TPEA 3KL5A 3VK5A 2VC6A 1W2VA 4XZLX 5TAOA 2DJLA 3Q67A 1J93A 5HANA 1QRQA 2FTWA 5BOFA 4F0LA 5C70A 1Y5XA 1UP2A 4F0KA 3KBVA 2PTYA 5BRBA 1JG9A 3ZT6A 1VCFA 4RJEA 1OYCA 4HBKA 2WHLA 3EDFA 1Q8AA 2YCIX 3WLRA 1MQQA 3L2IA 4C6EA 1TV8A 3T05A 4JDBA 4W84A 2CXEA 4ZL1A 3H55A 1TV5A 3PVFA 1NSJA 3NAVA 2NV1A 3GU2A 3KTXA 1GG0A 2BY2A 2YB1A 2YSWA 1V51A 1C9WA 4B4FA 3VKCA 3EWXA 1S2TA 4H9TA 3IJIA 1PTGA 4R7WA 3LOTA 2Z1SA 3VKJA 3S2LA 4LYRA 3TTSA 1P7TB 4IOTA 2CFFA 4MWAB 3ECQA 3VIGA 5E1QA 5FJPA 3UY7A 4Q7IA 5HMEA 2QJIA 1QW7A 4IIFA 3BLIA 4O0ZA 1XGZA 2PPGA 4F40A 4C6OA 1CXLA 2CESA 4JPGA 4S2CA 2WAGA 1IWPA 3S1XA 1GVOA 3WD2A 4Z0JA 3NO3A 3SGGA 1TWSA 4UQBA 3VDHA 3R1ZA 5F1VA 5EGRA 1OB0A 1V6UA 3ZO9A 3CHDA 3DFPA 4E38A 2I56A 2W6RA 3T4WA 3MANA 4JX5A 3VIFA 2AOSA 1BPLB 4ICNA 2BNJA 1C93A 1Q7QA 3HPXA 1IZKA 2XHYA 1ODZA 2FVMA 4IPJA 4ZFMA 3WBWA 1IXQA 2G96A 2Z6JA 1MO0A 1U5VA 1ZGDA 5D4YA 3HV9A 4Q33A 3RK8A 5M2FX 1K03A 4ATLA 1R3RA 4BQ4A 3LRLA 4HZMA 2WC7A 2XGZA 5FEPA 2Z27A 3GHSA 3M7WA 1UC4A 1P6BA 3AIRA 4IQDA 1IIGA 3VVGA 2FPVA 3UETA 4XAGA 1K7FA 4DX3A 3GZAA 4XIMA 3GYCA 2I5GA 2FQIA 1EF2A 2I57A 4GQGA 3UG4A 4Z2HA 3CM4A 3ZS4A 2VFIA 1ISZA 1HKWA 4KGJA 3LU2A 5IHSA 3M46A 4OOUA 3GZ3A 3B8TA 4Z42C 4R85A 3SCSA 2WK2A 4BQ3A 1CW2A 1TMLA 3CIVA 1MNZA 4JHMA 2QEZA 4N9BA 4KEZA 2D24A 3GD6A 2XFYA 2C19A 4GY7A 1BAGA 1TFVA 4NNAA 1Q63A 1FWTA 3PN8A 4MUPA 3QMTA 3KLLA 1WCGA 2BG5A 4O15A 4TIMA 2OELA 1FCBA 3D3AA 2BVWA 1GQKA 2Q8LA 5BXTA 3UF9A 1Q85A 4GKLA 5CLWA 2ZX5A 3QMRA 2Y61A 3GU1A 4J3WA 4HNLA 1W1B1 3VX1A 1JRBA 1SSGA 3KP1A 1V7AA 2BY3A 4O13A 5DT5A 3UG8A 3EEZA 4MLJA 3N4FA 3DENA 5LNVA 1BWLA 3TWBA 3DKLA 4KEMA 4LVFA 3U2CA 3PZQA 2WMIA 1XH2A 2AGKA 4X2RA 1T8QA 1QBAA 4HCHA 4CEUC 1B54A 2ZRVA 2IQDA 3CMJA 1EP2A 3M5YA 3NWRA 2AMXA 3LSCA 1XW8A 3UZXA 4ZXLA 3KW3A 1QMLA 2Y7EA 1IR2A 3E2VA 5FESA 2Y85A 3CTLA 2XIBA 4B3KA 1UBPC 3DG7A 1E6XM 3WENA 3O15A 1GCYA 1DJWA 3I10A 4FR6A 1TV3A 5AYBA 5A2CA 4GA8A 1CWYA 3UESA 3EPNA 3LM7A 4XTIA 3DBPA 1JYWA 3GHUA 1K9TA 1KQYA 2GJNA 5HUPA 5JBEA 5FJIA 4FF5A 3V1PA 4XZWA 1I2PA 2EEXA 3H23A 3WQGA 3K4AA 3TQVA 3E2SA 5FOOA 4O53A 1H49A 1K4HA 4N6EA 3RX3A 2E9LA 3M44A 3PSWA 3TXVA 3GFXA 3W72A 4X0NA 1W8SA 2Z25A 4O16A 3FA3A 4K3ZA 2GDQA 2QV4A 7XIMA 3OU8A 4DI9A 3EXSA 3GTXA 1EC7A 1SGJA 1VCGA 4QROA 3PFRA 5LA1A 3N2BA 2FMNA 4J3TA 1J10A 5T26A 3ARUA 4S2BA 3L65A 4NF7A 1BKSA 3EKZA 1ADSA 1G67A 3OVGA 4GQBA 4JTKA 1UHVA 3LHVA 1RHCA 3LRKA 1BKHA 3UNDA 1YX1A 4IQEA 3GVGA 4C7FA 3DIPA 2PDIA 1IV8A 3ZIZA 4AVOA 3KWXA 5HQMA 5FEXA 3GS6A 2AMGA 3GHTA 4GMEA 5FA5A 3UG5A 1GQIA 4GZ7A 4C90A 2FB2A 3GO2A 2WNZA 1GOIA 3DYMA 3WQWA 4KCUA 5E0KA 4V15A 3P2VA 4GISA 3PB0A 2WM1A 1F8MA 3W2LA 4YJ5A 2EPLX 4GJJA 3UPMA 1KRCC 2NV2A 1I6NA 1MW3A 4I9TA 5DMNA 1UR2A 4AZGA 3QR1A 3LCFA 4NZFA 3TMLA 2RUSA 4B92A 3BANA 4Q8OA 2WM0A 5JQ9A 3RU8X 4C1LA 1BVZA 3AALA 1QNOA 3I3BA 4WCJA 1W1PA 1LOQA 1AW2A 2J9YA 3UFYA 4YVVA 4DAIA 4MFEA 3B9OA 1F2JA 5CXPA 3WQ4A 5BNKA 1WBJA 3FY1A 3LHWA 4AG0A 1JAKA 3U57A 1S2AA 1VS1A 3S47A 1WNOA 1R47A 2CLFA 3N1AA 1YIXA 2C79A 2X09A 3O6YX 4DBSA 2OLHA 2ZA3A 3ZJ8A 5A6MA 4MB5A 4Z1BA 1DJHA 1F8IA 4R7JA 4WJ8A 3VIKA 3L4ZA 3WK3A 3CHVA 1NF7A 1NWRA 1W31A 1OC6A 2JKPA 4RZ5A 4J5NA 2PCEA 3AXXA 4LY8A 1TJ2A 1OWQA 2GGGA 3GUGA 1LZOA 1L8NA 3UR7A 1U2YA 1E4LA 5M17A 4HNTA 4FLSA 1LL4A 3FNDA 4LGXA 4H9XA 3VDGA 2EPHA 1Q65A 3M6DA 3DKJA 2HPMA 4EP8C 1P0KA 5AYIA 3MQTA 1QK0A 1LRTA 3SUWA 1TVPA 1OG6A 1XKYA 3MP4A 2ZWZA 1ISYA 2A7RA 3NURA 3VGGA 1NU5A 3ARTA 2QVHA 4ZO9A 1G7UA 3U4FA 3WNOA 5CSYA 3BSHA 3MCOA 4Q7NA 3WMLA 2WCAA 3U6WA 4KPLA 3WQCA 1GVQA 4TXEA 1XYAA 2JGYA 1QJWA 4JL1A 3QMSA 5FSEC 1TX0A 2P8CA 2ZUWA 3L4TA 2VTFA 2VD9A 2ZADA 1NEYA 4AU0A 1R3SA 1PTAA 1ZBKA 2Z7GA 3IAQA 3ZT5A 3T07A 2F6KA 2BY0A 1WB0A 3E2RA 2OT1A 3TN3A 3UWEA 3W7IA 3LMYA 4YPJA 2V0TA 4F3HA 3R8HA 2UY4A 2Z2UA 1MW0A 2ACQA 1PWMA 2VNCA 4YTSA 4QE5A 1F3TA 1B9ZA 4ZZ9A 3PAJA 1OCQA 1QNSA 1XLLA 1YNQA 1SZEA 1VGAA 3NVTA 2VYOA 3VOGA 4K36A 1TPFA 5D04C 1EL3A 4K39A 1EZ2A 4TTGA 4L9ZA 1R87A 2D20A 4NX0A 4WDXA 3R43A 5FL1A 1HJUA 4O1AA 4FIRA 3FHAA 4DO6A 3IRDA 1TIMA 3GIPA 4QJ1A 1KM2A 3GAKA 3L66A 5F4SA 2CEQA 1O7AA 1RLCL 3TC7A 2INEA 1O4UA 3RPDA 4I9JA 5DANA 3MSDA 3B9DA 2EQDA 5AN7A 2QAFA 1W3LA 2V5CA 1KA9F 3ARSA 2EJ1A 3BH4A 3W1XA 5EBUA 3B40A 3FAXA 3MUXA 1BVNP 4HMEA 1RJQA 4WSHA 3C2RA 3PZTA 3GR4A 2TSYA 2FHFA 3ENLA 2E5CA 2DSVA 1NDZA 5GJPA 2PLMA 1ZTVA 1Q7MA 3SRFA 4GJ1A 4S3AA 3H26A 1R7OA 1H1ZA 5JUVA 4HCDA 3T6CA 3WLKX 2WC3A 4PUDA 3MW7A 1LRNA 1N2VA 3ES7A 4I8DA 3UA3A 1AZ1A 4HQVA 1ZPTA 3O7UA 4HGXA 3KDOA 2LLEA 2CHOA 3GDRA 1J0IA 1W3JA 4JIHA 3P0XA 1O60A 4GI8A 2OQYA 4BI7A 5AHEA 2VURA 3EWZA 4LUIA 3N29A 1H0GA 1XINA 3W85A 3MMDA 2H9AA 1NDVA 4QSFA 2UZ9A 5IXEA 1JPHA 1RP9A 3SCQA 1JCTA 1DIOA 1R9XA 1EUNA 4D6HA 3H2FA 1WUFA 4HJFA 1XH1A 1POKA 2BGSA 3SY1A 1OFRA 4YIWA 3SR7A 4Q8WA 3WJXA 3EDDA 4PMYA 1Z9AA 2D0FA 3GYEA 3WZ0E 3I6RA 4U10A 4JGDA 4UC5A 3WF4A 3KEHA 2ODOA 4DZ5A 3RJXA 4LNCA 2YCLB 1RJPA 3WLJA 4MAVA 2BHUA 4MWAC 1M65A 1TPUA 4HNOA 3LYEA 4Q32A 1H1YA 3U7BA 4QFUA 3P62A 4RR4A 3NPXA 4HYRA 2AKZA 4IJCA 1Q6QA 3WD3A 3IJ7A 1PDYA 4L80A 5GJMA 3HQNA 3MZ2A 5JXQA 4LTSA 3V5CA 3MMWA 1KRBC 1IEXA 1YLVA 3DOPA 1DWFM 3AIWA 4QXIA 2YCLA 2DW6A 2FKPA 4KFPA 2E1WA 3BOFA 3T09A 3W26A 4EKJA 3LY0A 4EANA 1QPOA 3BICA 4AY8A 4OBTA 4E6MA 3F4DA 1XWYA 1W9XA 2BVDA 2CBUA 4CGTA 3KVKA 3SN0A 4EVZA 3G22A 1W1A1 2NV9A 1LUCA 4W86A 3I4EA 1UR0A 1YBQA 4MHBA 4ASTA 1BGAA 1U22A 4PBEA 3L2MA 4HTBA 3NL2A 5KZEA 2OYLA 4ATDA 4DM2A 1B3VA 1FDJA 1GGOA 4HNVA 3H7UA 4AVFA 1NP2A 4X9YA 2BOGX 3FYPA 8A3HA 1SMAA 4J35A 5C9RA 1GPFA 1F74A 3KTSA 1JZ7A 4IIDA 4Y8EA 5FL0A 2PP0A 3H12A 2EPOA 2R6OA 2CKSA 1WKEA 1QU4A 2GSJA 4HJWA 3TQ0A 1XLKA 4GI4A 4GVGA 3I3EA 5C2XA 1E9IA 3T40A 1M03A 5K2ZA 1EEPA 1AD4A 1VJZA 3VI2A 1T41A 4CCDA 4QHRA 3MC5A 4JBRA 2OT0A 3PY2A 4IP7A 4LJ3A 1HJQA 2CZFA 1CXEA 2QHAA 1S3HA 3ARZA 1VIWA 4RL3A 4NZ3A 3TSBA 4V1XA 4BF5A 4AFYA 4HMDA 4YTTA 5ABEA 5FF0A 2E8YA 5KZDA 1LQ2A 4ATWA 2Z1XA 3GG8A 1UROA 1EJ7L 3EX3A 3TSMA 3QKZA 3C5QA 3OLDA 2DZBA 3V16A 1WKDA 3NQFA 3EMZA 2Z28A 4O8RA 5AC5A 1UBSA 1EHNA 2JF7A 3ABXA 1M7OA 2GDUA 4NZ1A 3SCTA 1OCNA 1YPXA 2AKMA 5DCBA 3HO8A 1Q6EA 4HK7A 1JCYA 4BJHA 4TUFA 3BGGA 3DH7A 1MFUA 2SFPA 1ZALA 4IHCA 2Y7FA 5FJOA 5I3KA 4LYQA 2HS8A 4HNCA 3B8IA 3BMXA 4P7QA 2Z1KA 2X0YA 3BMWA 3N04A 2IPWA 2GSEA 1XPYA 4CQBA 4M19A 4MMWA 2YA2A 4XKMA 1ONEA 3L2LA 4FIQA 4EIVA 2KAUC 4UFIA 5A6SA 4GVFA 4AC1X 5TQLA 1XF0A 2I5IA 1OF6A 4QNEA 4GYPC 1XJBA 2OKOA 4NZCA 1DHPA 4ROPA 4F9DA 4ML9A 4PA8A 1RCQA 1SZRA 4JX6A 3QY7A 3RCNA 2HEJA 3PWGA 1EJSC 3MU7A 2CITA 4NAFA 1OK4A 3A9BA 1IE7C 2G3FA 3EDKA 1NARA 4GI9A 2V69A 3O06A 3LS9A 1JJKA 2R1KA 1YPFA 2RJHA 4BQ2A 4F48A 4MIMA 2XINA 1OX4B 5I3HA 1O5KA 3UYIA 5HK4A 1DIEA 1XLAA 3DEQA 4BI5A 2BV9A 4GLEA 3DYOA 4Y9AA 5ENLA 4FA3A 1HG3A 3GG0A 3KTCA 3OQ8A 4S3GA 4BWLA 4I3GA 4ZE4A 3FA4A 2VR5A 3CT7A 4LUTB 3W74A 1S5MA 3O05A 3P80A 1H2JA 1TE1A 4TR9A 3G1YA 3LA4A 2ZC8A 2RH9A 4ZENA 2YCEA 1SU5A 3LBOA 4WHBA 1UJQA 3QZAA 3FKRA 2WVTA 4RDVA 3B8DA 3O63A 1WXYA 1H41A 5G1YA 4AWSA 4YCOA 5LNSA 4IPIA 2ABAA 1E15A 1U1HA 2B7OA 3L4UA 3OG3A 1A0DA 4O1FA 3WJYA 1D8CA 5A3HA 3EYPA 4PFMA 4S3DA 2OU4A 3IK4A 5D9PA 5HWNA 2VL4A 4HA3A 1EOMA 4RZ6A 4IL0A 2D1ZA 3D47A 1J0ZA 2ANUA 3AMGA 4IG2A 3M07A 1I2QA 5GVJA 2F9RA 3LSBA 4H8UA 4GUIA 5EA9A 3ICJA 3SECA 1B0IA 8RUCA 1GHRA 2GUBA 5JIWA 2ZXDA 3DC8A 4M1RA 1UD6A 3U9IA 3ME3A 3M5XA 1FHVA 1CXIA 4R7OA 3WEMA 4LT9A 3AYVA 3AZTA 4AYSA 4WSJA 1Z8AA 1IYXA 3AMCA 2XH7A 3ITTA 1OM0A 2AQOA 2QJNA 2UV8G 1XP3A 1PKNA 3THUA 1Q5MA 4U2ZA 4PH6A 3WLOA 5I77A 1KFKA 4HZ8A 4MNMA 3B4UA 4CD8A 1PKMA 9XIAA 1KFBA 1Q3NA 1UKSA 2H3BA 2PDLA 4NZ4A 4A8RA 1SR9A 4ZE5A 4UTJA 3HGRA 3BOLA 4B5UA 4WY0B 3KCLA 2PWDA 1DKWA 1EX1A 4CQ9A 5CGQA 3EOUA 2EBNA 4TO8A 2ACUA 2XVLA 1VLWA 4ZQRA 3UCQA 5CZJA 5HPOA 2WJDA 4V2XA 2HVOA 5A6KA 3BAIA 4UR8A 3QY8A 5MKGB 3BUVA 4QLKA 1FWDC 4L1GA 4UWMA 1PHQA 1UR8A 2CHNA 4UB9A 2OX4A 2ZUSA 1ZFJA 3R25A 2WWCA 3ZQ9A 4MF4A 4PGLA 4UFHA 4HIBA 4Y2WA 3NQBA 2RDUA 2FVKA 2HXUA 4JHZA 1E6QM 2J6XA 4PZVA 4DM1A 2RHGA 4MFDA 3BCJA 4UR9A 3NO5A 6XIMA 3QR0A 1E1EA 3RMJA 4PB4A 3AXMA 4TVCA 3LGGA 3PS7A 1O5XA 1R9YA 5F4WA 4DJDA 4A3RA 3PANA 1OFBA 2W27A 2XN2A 2CZVA 4RE2A 1NP0A 4DWSD 1XSIA 1JDAA 4J27A 5H8MA 1EWEA 4JTJA 5CC5A 3QV8A 1G4TA 1GVEA 3EEGA 1HQTA 4YNGA 1HVXA 1WXZA 2AL1A 3FYYA 2OZ3A 3QC3A 3IUDA 2NQLA 5D33A 4RPQA 1MRQA 4L65A 1V0NA 1XKJA 3VXGA 1XD0A 4MPKA 1RXOB 3VNKA 2XUCA 2DORA 3DCPA 3LLXA 3PK7A 2GGIA 1WOAA 5C54A 2GVEA 1V6VA 2VEIA 1FVPA 4P7NA 4W8AA 2WNNA 4LCQA 2Z29A 4E2DA 5G5IA 3NQCA 4DYEA 1PE1A 5BU9A 4PMZA 1H63A 3TMQA 1T5AA 5AVNA 1QTWA 1AK5A 4CNUA 2FZNA 2WZHA 3HBLA 3CQKA 4ZODA 4Q8VA 3KM8A 5A69A 3SUUA 3HQ1A 1A47A 1U5JA 3OVRA 4DNHA 5HNRA 4QBXA 1JR1A 1OFOA 4IX0A 4JFUA 3TN6A 1GYMA 1D9EA 1OINA 1VFOA 1XLIA 1V03A 4J40A 1OEPA 2NX3A 2YL6A 1UWQA 1EC8A 2C16A 1W1VA 1EEXA 1NFBA 1PO9A 2R1PA 4M1BA 3Q4DA 4IZGA 2XH0A 1JZ4A 3VU2A 3V3WA 1VQTA 3AQUA 4BQ5A 4NY2A 4LH8A 3GVQA 3G2GA 1UPPA 4RKAA 3SY5A 2CWNA 3NSMA 4O0KA 3VNMA 2YLAA 3N2OA 3NO1A 1E4IA 1SJBA 3KS5A 4BZYA 1HIZA 3TEVA 4JQ4A 1GQLA 1EZWA 4A29A 4AYGA 3WQVA 2X1SA 2W62A 1W3NA 4K7YA 4GKTA 2Y4SA 1I1XA 3P0WA 4HB7A 2O4MA 2QDGA 1O5RA 3AS1A 4XD5A 3ZVIA 1A5NC 1IEWA 1OSEA 1O66A 4U3AA 4NJIA 3WUGA 2IQTA 2V2CA 4GO9A 3VGEA 3CUIA 1Q45A 1RVGA 1E6ZA 3G1FA 5I3GA 3HF3A 5REQB 3IIZA 3PB2A 3WLIA 4B9ZA 3B9AA 3GX9A 4M6VA 1GOXA 5D8WA 1Q7ZA 4FXJA 4LANA 3SO7A 3TR2A 3S1GA 3LXCA 1PIFA 2DU2A 3GC4A 3WD1A 1JYNA 2YX0A 3VNDA 3MSRA 1BHGA 1UWTA 3EWDA 4TVDA 4AW7A 4XK2A 5HINA 3VDAA 3G1DA 2J4GA 2ZUTA 4RLIA 2OQHA 3DI0A 4CNOA 3B03A 3LCLA 2DZVA 2VX6A 4C5ZA 3CPRA 1TQXA 3W4RA 1RVKA 3QQ0A 2UY5A 1H7XA 3STGA 3U5UA 4Q4OA 2E3ZA 1XDLA 2RDTA 3UCCA 2B0MA 1YBQB 5K3VA 5TBOA 4O12A 2PP3A 3KRSA 4GQQA 1FWRA 2E6FA 1BQCA 4PMXA 5AHLA 4W7VA 3PUOA 3PJTA 4FOKA 4Z1CA 2WANA 3R79A 5CPSA 2Q3OA 2OWCA 3KUMA 3MWCA 2VOTA 1M68A 1PIIA 4ICMA 4LBRA 3M0VA 2ZZ1A 1MI3A 3B4YA 2D0GA 2P53A 4GYJA 1PXGA 3FYOA 1J79A 5I3JA 5LKYA 2E6YA 3DXIA 2VGBA 4W8LA 1DJGA 3B8WA 1KFLA 3RG6A 1I2RA 1V3IA 2YZ5A 1TJ1A 7TAAA 1GT8A 1V4YA 1VRDA 4KT2A 1J2BA 3AAMA 4GNJA 3UXLA 2XSXA 3PNUA 3E49A 3OBKA 3UD6A 2V30A 1OGSA 3PULA 4QIUA 1JXKA 3HTWA 4XBKA 1VF8A 1WE5A 3QSRA 3DU0A 1TWWA 3WLNA 4H9ZA 1Z69A 2YL5A 2O9PA 2HMCA 2A4AA 2QYGA 3M64A 3UGRA 1R7AA 1V0LA 1X97A 1CGVA 1ME7A 4OV4A 2RAGA 5EFDA 2QVNA 2GVGA 3IIVA 2D3NA 3PBUA 1ADDA 1CGTA 4O8AA 2WSRA 3IJ8A 1YXYA 1K8XA 5CZKA 2PA6A 2E0PA 2Y0FA 1QPRA 5EBAA 2F2HA 3EX2A 1TG7A 4RXGA 4C6FA 4ORIA 3F4CA 3S5SA 1LUCB 2PC4A 4C6JA 2PDFA 3BGAA 4ES4A 1A5CA 4EPEC 1MVYA 2BMBA 1X6LA 4XV0A 1VFSA 3OJGA 1FDYA 4B5NA 2VO5A 2G95A 5J5DA 4RK8A 3KZSA 4N7QA 4B3LA 2VD8A 4ZQCA 2DQWA 1TZ7A 3ZSSA 3ITOA 3I7SA 1SFSA 2VC5A 3TW6A 3DHPA 2HE8A 4IXXA 3G1AA 4JR5A 2Z1BA 2RJGA 3DFSA 1NH6A 4XKYB 5ECUA 4JIQA 3RX2A 2HQAA 2Q02A 1TR9A 5BWAA 3M6YA 2C8NA 4FEZA 3OGRA 1KKRA 2ALRA 3FJNA 2CYGA 2WHJA 1YYAA 2OKTA 2J8TA 3UZJA 3EMQA 3IVSA 1AQFA 3IK2A 1GOOA 4AXNA 1SO3A 4ONVA 5I79A 5DX7A 5KINA 4I9MA 3TR9A 1O1HA 3PWIA 2OG9A 1YXDA 1ML1A 4M6UA 1XRTA 2D2GA 1K70A 5A8QA 2AQWA 3LTPA 3M16A 2BLEA 4MDPA 3SADA 1MUWA 3ISIX 4H6EA 2A3EA 1W1TA 3GDBA 1HTIA 1PHWA 3ARYA 1F61A 3PZ9A 1LWIA 4C6QA 1XLGA 5KETA 1D3GA 3TIMA 1XIGA 3WFAA 1R3TA 2P76A 3T7VA 4D1IA 3G1VA 3S2CA 3V7PA 5ABFB 3CAKA 3OB8A 3XINA 2QGHA 4L64A 2Y62A 1NWSA 2DIEA 4H6KA 4HOZA 2CLKA 3T42A 4C6NA 5D30A 3P8IA 1Y8BA 4HNNA 3AIUA 3TJXA 5HMFA 3NDYA 2X42A 1BLIA 1GZGA 4QE4A 3CB3A 3S6TA 1AA1B 3LNMA 6REQB 5G1MA 3TA9A 3UR2A 2IW0A 4MKNA 4P61A 2X1UA 1VFTA 3BLFA 5E0CA 1FHDA 3C3NA 4DXVA 1MYRA 1F6PA 1W5NA 1PWLA 3UG3A 4RNFA 3USBA 4U5IA 3PZGA 5DF0A 1V6WA 4JTSA 1UH2A 4KFNA 1TV2A 2C91A 1V7YA 1US3A 3T78A 4L5ZA 4LCRA 1E56A 4LF2A 1AJZA 4D6CA 3TQKA 2FZMA 2VWTA 1OFQA 1VFUA 2CPUA 4MM1A 1TV7A 1TRDA 3MI2A 1C7TA 1WDPA 2E5BA 3LCHA 3AWNA 3NQ2A 2EG7A 3SGZA 1GW1A 4QCEA 4IICA 5C2CA 1IF2A 1NAL1 1UWRA 3NXFA 3S5NA 2ZDSA 3W7LA 2QCMA 3BLEA 4AZ7A 2PDWA 1D3CA 2J27A 1PYFA 4HK6A 1KO0A 5D38A 4IG2B 4IMFA 3VD9A 3FAWA 5DXYA 1A3HA 3NYZA 2BS9A 3I7RA 2QCDA 1UMYA 4Q3MA 4AQLA 2NSOA 3QYSA 3C52A 3BSMA 3TX9A 5I09A 3WLLA 2WZEA 1F05A 3V5FA 4FP1A 2BFGA 1XIHA 2DZAA 4MYAA 1V08A 4LV4A 1DEDA 2P50A 2ZRZA 2P8BA 3VGBA 3RO6A 4US5D 3NGJA 1CB2A 2VR4A 3MSGA 4B90A 5BXSA 1SJDA 2IKGA 1K6AA 3N9SA 4P2VA 3BW4A 4GC4A 2QPUA 2OTDA 5AHIA 2J88A 2QJJA 4G8TA 5D2WA 4DO7A 3SCWA 4UTFA 1FBAA 3CZEA 5AC7A 2Y7DA 2NQ5A 1TJ0A 3BAXA 3W1TA 4ZSTA 3W7CA 4K8GA 3L5LA 5C71A 3GK0A 3NCOA 1ICSA 1KXTA 3AIVA 3TOPA 5CPNA 3P82A 1XG4A 1OT1A 2VQUA 3SCPA 4D6FA 2YZRA 2WQPA 4WVXA 4ERGA 3G18A 4X61A 4QDWA 2GUUA 1H62A 4GUFA 1CXFA 3W25A 4UUIA 2QLYA 2Z2BA 4LX4A 1J8VA 6REQA 1FXPA 4DVOA 3WO8A 3DAQA 3WG6A 1HKMA 3FV9A 4UMAA 3R0KA 1X1ZA 3GKAA 1HF6A 4UR7A 4PB5A 2PCQA 1VR6A 2EF9A 3WH9A 1TVLA 2WKGA 3ORWA 2QR6A 1B3WA 3WDRA 3H8AA 4C5YA 1E6RA 3CUXA 2EXOA 3ZLFA 2DSUA 5JBDA 4CN6A 3VE7A 1G7VA 1S39A 3ZVHA 1SSDA 3QHMA 4UNKA 3RLUA 4O11A 5EY5A 4I6KA 3RGTA 3NZRA 4B2DD 3W7HA 1XIDA 3URBA 2Y5JA 2WW5A 2B7NA 4Q4SA 3HN3A 2NT1A 1GQNA 1W1YA 3BV7A 3HQOA 1QI0A 1W1ZA 2YOCA 3DDMA 3B9NA 4JIRA 4NJHA 5I24A 2I9EA 3UZWA 3W7GA 5CPOA 3BK0A 1DJYA 1EKOA 4M3PA 3J7HA 2BASA 1K8YA 1OD8A 3ABOA 3AIEA 2E8ZA 3TZFA 4C6DA 1HKVA 2JE8A 3VDCA 1DBTA 2ZVRA 5A6TC 1J4EA 1TTPA 3FOKA 3UWQA 3NL3A 3H4GA 3SIMA 3TFCA 3LENA 1V3MA 4AY1A 4GVHA 4RDYA 2AQVA 1P6CA 3TVAA 3T0AA 4QDPA 4AWTA 3ZYZA 1L8PA 3LBMA 4Y8FA 2OYMA 2GZXA 1V0KA 2I1OA 3EWWA 2C15A 3TYUA 4H00A 3W22A 1XIBA 3TONA 3FEMA 4W5ZA 1U1JA 4WJXA 1A0EA 3T0TA 3LZ5A 4PUUA 3G5EA 3EPOA 2QDEA 2WPBA 2Q6ZA 7REQA 3UJEA 3GM8A 2V5JA 5D8ZA 4Q4KA 3UXDA 4GFIA 3PNZA 3SRHA 2DFAA 2VKZG 4G1NA 2PDHA 2OOFA 3EDEA 1G4PA 1EOKA 4FXRA 1KWGA 3L67A 5LNUA 3C2FA 4KEVA 4U5KA 3S2JA 4G1KA 1FWEC 2WMKA 3PC0A 3W7NA 4BR1A 3A12A 1CXKA 3LB0A 2ABBA 2DP3A 3ABZA 1GTEA 4GCXA 2PRLA 3ZR6A 3STFA 2C1IA 5LNWA 4AHOA 4L4PA 1M5WA 1JF5A 3SM0A 3KOWA 2RFGA 2GQ8A 2DQXA 4E2BA 3RITA 4FAMA 3NQDA 4R34A 3ES8A 3B9EA 2X1RA 1OX4A 1D7KA 1H51A 2DZSA 3H2MA 1B31A 3GDTA 3NQGA 1LM1A 5CPTA 2V2DA 3FJ4A 3NEHA 4J1OA 1EA0A 2B7PA 1J5SA 4OV9A 1B3ZA 3N2XA 3SN4A 3ABSA 3VOFA 3PPHA 1HN1A 3AO0A 2NXGA 3DHFA 4GYFA 1V3LA 4J3XA 4NP7A 1PYMA 1AODA 1J6OA 5A8PA 1OX6A 3EPMA 2DVTA 2GWNA 3F5JA 1WO2A 1PX3A 3IACA 3MHFA 3V18A 2R1LA 1GTHA 2R94A 2WJZA 2GLKA 4JCLA 4GK8A 1UR3M 1ICQA 3DFTA 4S3BA 2EPMX 2BHYA 2PDKA 3L5MA 1HZYA 1P7TA 3MJMA 2QQ6A 2VFDA 1R2TA 2ASHA 5EB8A 5PTDA 1GOWA 1DOSA 4M6QA 4M80A 4A21A 4FOJA 4LXFA 4IP4A 3A3HA 3LNPA 4DJED 1RD6A 2GOUA 3L0GA 3DERA 5IOBA 2VEGA 3QJAA 3S9IA 4R33A 1V77A 4CVWA 4LS2A 1IEQA 1YDYA 2HROA 1OFEA 4OIFA 4B5WA 1KM1A 4J4KA 1IGSA 3STPA 2XN1A 1HL8A 1L2QA 2HTMA 5A6JA 3LV6A 1A5UA 5M5DA 2WB5A 2INFA 1RQBA 1JULA 1G1YA 1XUZA 3CWHA 1XHGA 1IZJA 2JBMA 3P5ZA 1DTNA 1H5VA 3F2BA 1LT8A 1NIUA 2XFRA 3JR2A 5BU6A 1R0MA 4PTDA 2HSAA 2PD5A 3ATYA 3GW3A 2OGYA 1JDFA 4IIGA 2RDWA 1W54A 4B5XA 2FDMA 1U1UA 3W7EA 3LXAA 3MKVA 1B3YA 1QBBA 1VFHA 3W02A 3N18A 1CI1A 4H1ZA 1H5YA 3VMNA 4AF0A 5A2AA 1E6PA 1D3HA 3AZSA 1JUBA 4Q8QA 1UP0A 2P0OA 2XH4A 4MJZA 1ZB5A 1RR2A 4JQ3A 1CBGA 1VRXA 1US2A 4F66A 3OW1A 4PODA 3MVTA 2I7GA 2CZ5A 3TTYA 2P3EA 3QM3A 1TKKA 5C55A 2GJLA 2TMDA 3ZMRA 3QQWA 1FY6A 1S3TC 3EKGA 4Z2LA 1ZBCA 1H3GA 3WKZA 3IJ9A 3RF9A 3SFWA 2WMHA 3EWYA 4NUWA 1UWIA 1KXVA 2GJRA 3NEVA 3LZ3A 3VOJA 1KM0A 1RA5A 4QAIA 1VYPX 3VE9A 2QT3A 2J7EA 4JTAA 4E4FA 2OWXA 3CHFA 3JW7A 3W53A 1DORA 1WA3A 4DUWA 3BJSA 5CGMA 1O1ZA 2DGAA 2NWRA 4JIIX 4UIOA 2WVVA 2W63A 1TRIA 2Q3RA 3RHGA 4M7SA 1BYCA 3WQ6A 4CNNA 1BF6A 3ATZA 5F7UA 3BAYA 2QMJA 3OBAA 1QHPA 1BD0A 4JICA 2XWDA 4BK9A 3QEZA 2VZVA 3AMKA 4L1XA 1R38A 3GR8A 2VM8A 3A23A 3WF3A 3GE7A 2YDQA 4CD5A 4WY0F 4PMQA 1R3QA 3S6OA 3E96A 1GYLA 4UTMA 4UQEA 5CZTA 2IKHA 2DZUA 2Z00A 1TR1A 2J9XA 4L9YA 4H9UA 1WAWA 4W85A 3VIJA 2ZYFA 1J0HA 5HPCA 4PUMA 2E5DA 5REQA 1R3VA 1OQFA 3KRUA 1QPQA 4E2OA 1ADOA 3TUUA 4YTUA 3U0HA 3E3HA 3C8NA 3CL8A 4Z2IA 3LCWA 3GNRA 4IWWA 2GPTA 1T40A 4JFSA 3E5PA 1X6NA 3WLTA 2HVNA 4NXSA 3AICA 2OEMA 4GD0A 2G5WA 3UJSA 2OX1A 4M81A 5CG7A 2E25A 4IPNB 5G2WA 3LHUA 4QS5A 2V9DA 3RLHA 2PDBA 4GQ0A 2E9MA 4QG8A 5C9ZA 2DH2A 3PZOA 3F1QA 4CVUA 2X7VA 1KFWA 4LV9A 1ZCOA 4QS6A 2QGYA 1VPYA 1M1BA 1RAKA 3M5VA 4XISA 3P14A 3QN3A 1TYGA 2CIPA 3M9YA 1H61A 3QFEA 1W32A 5LIKX 4G5DA 1EPVA 4AY7A 1I45A 1CB7B 2XFWA 1UG6A 3UVAA 4UOJA 3F7JA 1LCOA 4H6QA 1S38A 4GX9A 4RUBA 3UWZA 1E1CB 2G0WA 4F0SA 3LM3A 3B8VA 4PSRA 2A2IA 1BRLB 5BCAA 3VYLA 2ZZ3A 1XQKA 3W70A 1ONWA 4R53A 3W75A 1J0KA 3FCPA 3PUDA 2E9BA 1YEYA 3GVVA 3CAVA 5HNTA 3WFZA 3EZ4A 3S1UA 5HJYA 1AH4A 1BYBA 3A6OA 3EXTA 1OK6A 4P8XA 3WJWA 3AC0A 2NUXA 1PEZA 2FHBA 1ZP4A 3UY8A 5K4ZA 5F2IA 1B2YA 4QM1A 3R2GA 4XZHA 4LW7A 4NNBA 4CU8A 4XAPA 3MUCA 5E0FA 4DZAA 1HL9A 4OBSA 3NQVA 1HP4A 2ATMA 1B3XA 1MZRA 5CSUA 2C1GA 3NSNA 2AL2A 2DIKA 2WBKA 3QHOA 3MSYA 3RYSA 1ZJBA 3LRMA 3ITCA 4MJ2A 1R3WA 3BAWA 1BQGA 2PTZA 2V81A 3BLPX 5AYXA 1BTCA 3RUBL 3POHA 1A50A 3T08A 5JVLA 1I4NA 3G1HA 4IUOA 1VH7A 2ZA2A 2OSXA 4GBUA 1XBVA 5K4XA 1AMKA 2WCGA 7PTDA 1NOFA 1BWKA 4AIUA 1RP8A 4S38A 4X63A 2Q09A 4NRSA 3UR5A 1TSIA 2Y8KA 1LROA 3KOYA 4ZQOA 3RJYA 4AZCB 2Y70A 3EKLA 5I0DA 2XU2A 3PJWA 4UZUA 3BG5A 3URQA 3G8RA 1XRFA 5DELA 5DN1A 3I68A 4H2HA 3U2ZA 1XRVA 2FZ8A 3GH7A 1XLCA 4JL2A 1P6WA 3GH4A 3TTQA 4WDTA 2ZX9A 5TF0A 2HNHA 3UZZA 3U4AA 1GKRA 1NWTA 2BDQA 2EPKX 3MHGA 4U4MA 1TJRA 3CAWA 2J25A 1MXDA 4CQCA 2Y2WA 3UZYA 3LDVA 3PHAA 3EOSA 3WLHA 1IT8A 2NT0A 1DQXA 5XIMA 1TPWA 4ICCX 3HPAA 4NZ5A 2WSQA 2ICSA 2G4FA 5G2IA 3UWVA 1K9FA 3BTNA 1UIPA 4S3EA 1Q8JA 3THDA 4JTIA 2PZNA 4HT3A 1GORA 2C0AA 3OHIA 1X96A 2Q8ZA 4GYKA 3GTIA 3QGKC 1YE6A 3LD5A 3QLLA 1GPWA 1X98A 1JYXA 2BY1A 1GW9A 3WNLA 1KB3A 2OSWA 3ERPA 3MYPA 1RZMA 1A5SA 3B97A 3N19B 3ITLA 4IMEA 1RY8A 1XIFA 4PRWA 1DJQA 1V93A 2QCFA 1FWBC 5CZ0A 4X22A 5AECA 3SW6A 4ALDA 4LVGA 5HWMA 3HG3A 3PP7A 3OP2A 2XIQA 2DH3A 2OO0A 3RPTA 1K1DA 3NZQA 3UXAA 4MB3A 1GWJA 2PDMA 4A8NA 1F3XA 1FWAC 4LUSB 5B7ZA 1LLZA 4XD3A 1LWJA 2WHMA 1OGBA 3IJ6A 2PU0A 3SRKA 1BF2A 4RZBA 1HT6A 2XSAA 2DSWA 1EXPA 4FNUA 2DUXA 1EFZA 3JUGA 3PM6A 3QFWA 1N8FA 1K02A 1P0NA 4A6GA 4LUJA 4H8HA 4CQ8A 2VQTA 4GIAA 2UY3A 4GG9A 3ARQA 3TWAA 3RM4A 3MI3A 4MG4A 4N6FA 4Z1YA 4QR6A 4CNSA 4MZ1A 2YA1A 3I4KA 2C14A 3SURA 4PRRA 5DXXA 4OTKA 3UNTA 5GNXA 4JQ1A 6TAAA 4F2TA 1LLWA 2GUYA 5CKSA 1VPQA 4Q4PA 5HA7A 6ENLA 2XG9A 2YDAA 4GNKB 1O95A 4NL1A 1KNWA 3R94A 1REQB 2CW6A 3EMCA 4IPLA 2G97A 3UU0A 2R8WA 1V5XA 3GUWA 4JIPA 3ZLGA 2ZICA 4XZNX 1QI3A 4TU1A 4O52A 2YFNA 4KEUA 1GOQA 3RAOA 3CIXA 2D2HA 1KFJA 4AZ6A 1SQ7A 1V6TA 2CXGA 3TW9A 1CX9A 3HB9A 2OCZA 3G24A 3T8LA 1QNPA 4WZHA 2PDQA 1XG3A 4DWSA 2HWGA 3C61A 4YMZA 3VUPA 3SZ8A 4DAFA 2PGEA 3W84A 1UA3A 2WO5A 3AMDA 1EX5A 3WLQA 3TCSA 2A7PA 2EHHA 3T44A 2NXIA 1CDGA 3DG6A 4EAMA 3WD4A 2PBOA 3LPGA 2QUVA 1FDZA 3M7SA 2NLYA 2Y88A 1DV7A 5H91A 1RD5A 3AXKA 4ACZB 1AW1A 2QW5A 2PDJA 1Y5WA 4KS0A 1ITQA 5FJRA 1MUMA 1FCQA 4C1NA 2ALDA 5GJNA 1P1MA 4A4AA 1WPCA 3K46A 4DWSB 3QRHA 1Y0EA 5D2TA 3NR0A 1WAUA 2TRSA 3NOYA 4WX2A 1A5OC 3N2MA 3CBWA 3IARA 3E5BA 1MUCA 1IIHA 2CC0A 1SO4A 3AYSA 4E8DA 4H01A 4M56A 3BQ5A 4MWAA 1JQXA 1JF6A 2VRJA 3GXPA 1REQA 3NQMA 3W6LA 4K6AA 3GXMA 1UQZA 4H9VA 3WDJA 1SFJA 1J5TA 2ZRUA 1EJUC 3N3MA 5HQLA 3THQA 3VINA 4OE7A 2PEVA 2EO7A 1Z48A 5BMWA 2BGNE 3CV2A 3MUAA 1MEIA 3WH7A 4IMDA 4CKQA 1CGYA 1RCOB 2FVLA 1UWAA 2WKLA 1VKFA 1AUSL 2A0NA 4LRSA 4ZEPA 2BB0A 5KZMA 1OYAA 2BXYA 2Y7GA 4PMNA 4XQ6A 3D6NA 5M3WA 1JCNA 4IP5A 2E4TA 2QULA 1VFFA 4R9XA 1ZSXA 3OA5A 1YNYA 4A2SA 1CPUA 4KWUA 4HVXA 1KM5A 3TE9A 4PRTA 2GGEA 3ITYA 3LCXA 3PG9A 1HVQA 4LPCA 3VIMA 4DEFA 3ALGA 1IT0A 4JCMA 4KF1A 4H83A 3SI9A 4NG3A 2NX1A 3WQDA 3ABRA 1SFTA 3WN6A 3ZWSA 3A47A 5I03A 1DWJM 4AVNA 5D09A 5J8LA 5AKQA 1S46A 2C0HA 3SIZA 2PC8A 1E40A 2DZWA 4DJFD 4BS0A 5LXXA 3RILA 5E9XA 1KBKA 4RDZA 1XC4A 5EMYA 3RRXA 3CPGA 3BZJA 3VGHA 1Q66A 2GQ3A 1UWSA 3HOJA 3QOMA 1NWUA 4X3ZA 3GXFA 1LWHA 1EP3A 5CAHA 3VPLA 1WZLA 5T91A 3E0LA 4DPPA 2FIQA 3A4WA 3MBFA 1HGWA 2FHCA 2PWFA 4GFSA 4C6LA 2DDXA 4Y9MA 4GUHA 4ENLA 3DN5A 4E4UA 3SDOA 2OO6A 4LAMA 1EJTC 1ZAHA 1P1XA 1E0XA 4QISA 4KESA 3ZFHA 3AS3A 3WNNA 2V3EA 3FJLA 3H2EA 3SB0A 1O12A 2XWEA 1GK8A 1H1NA 2CLEA 5I06A 4JS3A 1J01A 5EKYA 1M04A 1W17A 4R27A 4M51A 3A64A 3BLKA 3GDLA 5KTLA 2WZTA 2ISFA 4AB4A 4LC8A 4LU0A 3U2EA 1C91A 5IM51 2X8RA 2Z4GA 4AD3A 1JL8A 1RUSA 1VEOA 2ISDA 3WL1A 1QWKA 2ZBTA 3UPBA 2V6AA 2PU1A 4NKCA 3N4EA 5AZ1A 4PCFA 1UZDA 1XC6A 2O7SA 1UZHA 1LORA 3QC0A 4J2MA 2WVUA 3Q94A 3SCRA 3FHQA 4MDOA 1PV8A 3ZXWA 3R0UA 1U83A 1FA2A 2A7NA 2CERA 4JNZA 3VC6A 1PUDA 1H7OA 1UD4A 5K9XA 3NQEA 4GACA 1A3WA 1XLEA 4W4QA 1ENUA 3QTGA 2V8ZA 2HK0A 1DL3A 1BYAA 4PMVA 2YB4A 8CGTA 1IXPA 3W1PA 4JHOA 1PTDA 3ZR4A 4LRTA 1XI3A 4W7UA 3A13A 2PWHA 3VCNA 1TTIA 2PLJA 3SQMA 3IGUA 5G4HC 3KBNA 3R8RA 4UZSA 1HKJA 4AIEA 3NXLA 1QW9A 2Y1HA 1US0A 3BCFA 3P74A 2F8QA 4PB3A 4IPPA 1W8GA 3A4JA 4INFA 4Q6JA 3NG3A 4AD1A 2IKIA 3W7KA 2BX7A 3PZUA 3ZOAA 4MB1A 3W83A 2IPGA 3L5AA 3Q58A 3VA8A 3SQSA 4BEUA 4X0VA 3LTSA 3UWWA 3GC5A 4REQA 2XIJA 3QPZA 3JZUA 4Y7EA 1CT5A 3NFUA 3CS2A 2J7FA 3TLQA 4HP5A 1JI1A 5LSMA 3STEA 2UY2A 1DWGM 4LEFA 2JFEX 3BWWA 4YCPA 1FH7A 1ZAIA 4B4HA 3PSVA 2QUUA 2PRHA 2VVSA 3PTKA 1W3IA 1X1OA 4XD4A 2WBGA 2WSKA 4GUGA 3REQB 3ZSTA 1VZWA 1E5JA 4DRSA 3GFYA 5B80A 2F38A 4NZJA 4QG6A 3TTEA 1MQPA 2Q01A 5DBUA 3IEBA 1PZ0A 4PEEA 3PBYA 2ZOXA 1KFCA 2QMKA 4Q7BA 3S9ZA 3GXTA 1HGYA 1Z44A 3UVIA 4JQAA 3FSUA 1P0EA 2QIIA 1B4KA 4H2CA 2P3ZA 3EOOA 3OYZA 3RCYA 2BBFA 3D46A 5AC8A 2E6DA 2Y5EA 5IFTA 1UYQA 4C6IA 2I5QA 1DTUA 1C7SA 1DPMA 1JPKA 3S42A 5H6HA 4IMGA 4ZSUA 3BGJA 3QYQA 3H7RA 1SO6A 2DT2A 3NQ8A 4GZEA 3T2PA 1S5WA 3WNKA 2J75A 3TA6A 1OFDA 1PIGA 2V3DA 1R6WA 4TX8A 2FH6A 3W24A 3WIJA 2O9OA 1YRRA 1OGGA 7A3HA 1YXCA 1BXNA 4Q6XA 1QI4A 1R9ZA 3HPSA 4OOZA 4FLRA 2FYMA 4O0QA 2NXHA 2WSPA 5HDRA 6TIMA 1ZJAA 1X8CA 4M5PA 2GFTA 3MP3A 3CK5A 5CLTA 5FKYA 2VEKA 4CQAA 1H09A 3W3OA 1A3XA 3GB6A 2L5HA 5D2XA 3APTA 1XQLA 3NQ7A 1OADA 3EB3A 1YPIA 1FKWA 4GE8A 3JRKA 3TYEA 3R13A 3LHYA 1BXCA 2ACSA 2OMAA 4XZBA 3H21A 2ZCGA 3AHVA 3ELFA 3OGVA 4U31A 3OEXA 1SW3A 4C91A 2FDSA 1LBFA 2OLAA 3K13A 1C8QA 1KGUA 2ZZ4A 1SFLA 1EGMA 3W27A 4OU1A 3ONCA 4C6BA 3FGCB 1NJJA 1S1RA 3A9IA 3AXIA 1IXOA 2DT0A 5BRQA 5AFDA 1F76A 2OEKA 2HZGA 3MT1A 1KWKA 1DIKA 2Y5SA 4P7RA 3ZR5A 3G0XA 4HZ7A 1L6YA 3CQJA 3APYA 1V02A 4CN4A 4O28A 4Y6GA 2GQ9A 5XIAA 2PURA 4JTHA 4MTVA 4FSAA 4YS1A 1YKWA 2OOGA 1W6TA 4MYXA 5F1UA 5AHNA 1G6CA 3ZLHA 3HG2A 3KBMA 4DELA 3XIMA 1SVDA 1XIEA 2VZSA 3UPWA <