4RZ4A

Fructose-6-phosphate aldolase q59e y131f from e.coli
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
b'HELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAEVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPFVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-6-phosphate aldolase 1
molecule tags Lyase
source organism Escherichia coli
publication title Acid Base Catalyst Discriminates between a Fructose 6-Phosphate Aldolase and a Transaldolase
doi rcsb
total genus 85
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.-:
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rz4A00
3LHTA 2EGZA 5CPMA 3W7RA 1EX5A 1Y0EA 1TPVA 3LXCA 3EWXA 2V8ZA 1HG3A 3UWZA 1FWTA 1XFBA 3PSVA 4LS0A 1JRBA 4H6KA 1X8FA 5E0KA 1B57A 1C9DA 2CU0A 2ZRZA 4EF9A 3A23A 1KFBA 5K9DA 4K36A 3NQDA 2H6RA 2E5DA 3LTYA 3CU2A 3S1VA 4ZQRA 3SR7A 1IXQA 1HO4A 1FWRA 4Z1AA 4JEQA 2OMAA 3E0IA 5F2LA 3PR2A 3TCEA 2GVJA 3TMLA 3SGUA 3S5NA 1BWKA 4XQ6A 1TJRA 1XXXA 3KHJA 3N19B 4IXXA 2R94A 1TV5A 4JS3A 4LT9A 2FPVA 1VCFA 4Z0SA 1TQJA 4JX4A 4PH6A 1W0MA 1TPUA 3CTLA 2CW6A 3QYQA 1VYPX 3WK1A 4Y8FA 3TA6A 2H3BA 2WNNA 2Y61A 3UZ5A 3PBVA 4RR4A 4KFNA 1ALDA 1E51A 5KITA 3LTPA 2J88A 1SO3A 5HULA 3W7EA 2Z6JA 3EX2A 2GJNA 3LLFA 5LSMA 3E02A 1G7VA 3B4UA 1LROA 3BLFA 4BK9A 1CX9A 4CLMA 3KVLA 4RCXA 4JY9A 3RNDA 1LLWA 4DPQA 3QPZA 3TE9A 4U28A 4JDBA 1KFJA 5D03A 4AEOA 4XUGA 1NFBA 4K8HA 4WX2A 2X2GA 3S1UA 3FJ6A 3N9RA 1GVOA 1TPWA 3YPIA 3EXRA 4JX6A 3I6RA 3P62A 5LNRA 4QISA 2QCGA 1XC4A 4UMCA 2CLEA 1TREA 3NEVA 4HNNA 4O54A 3W83A 2ISWA 2ZA2A 3PM6A 2VELA 3TXVA 4DO5A 3C56A 3GVGA 4LVAA 3ABQA 1YPFA 2VEMA 4S2BA 1OX4A 3W1MA 3G0UA 1AK5A 3FLUA 4BI5A 4Y90A 1R2RA 3U8GA 2B7OA 3WK2A 3JS3A 5IBXC 2J27A 2WNQA 3GZ3A 3MYPA 4P2VA 5HUOA 3M5ZA 2I1OA 4DQWA 4LS2A 3CC1A 3HMJG 2Y85A 4AF0B 2YZRA 2I9EA 4LUIA 1D9EA 1DVJA 1I2OA 1JUEA 1JUKA 1OYCA 2JKAA 2WPBA 1B3OA 1DQXA 3GX9A 3G1YA 1S5VA 2YW3A 1SO6A 3LCFA 3RF9A 3G1XA 3BK0A 5J5RA 5G1YA 5LZLA 4WY0F 1LZOA 3A5FA 2A7NA 4XZ9A 5D02A 3RFAA 5F4WA 5D09A 3EWUA 2X1RA 4PC8A 4JTGA 1GVRA 1H1ZA 4IGHA 1W37A 1EP3A 4GXMA 4I7VA 1HTIA 1SZFA 1O5KA 4LRTA 1UBSA 3HGOA 1H7PA 3SY5A 2OZ0A 2CZDA 4M6PA 1QDSA 1FCUA 3A21A 1O60A 1WBJA 1SO5A 4RZ6A 1K8XA 5C55A 5LGXA 3M5YA 3MMTA 5BMXA 4RXGA 4AMAA 4Z0JA 2ZZ2A 5FEPA 5KZEA 2OCZA 4PA8A 4A21A 2P10A 4GWEA 2DZVA 2XN2A 3MHUA 2C15A 4LOCA 3GDRA 1YLVA 1WA3A 3GXNA 2BX7A 1W3NA 4P61A 1KBJA 5AOUA 1DBTA 1FUYA 5F2MA 3WJZA 1F2JA 1SW7A 4PTNA 4N4QA 2PCQA 4Q4KA 5HWMA 3HB9A 1GQNA 3BW3A 3MP5A 1GTHA 1JCYA 2Y70A 3PY2A 1OX4B 2OX1A 5HNRA 1ADOA 4FNUA 4BR1A 5HMSA 1HL2A 4I7UA 3TX9A 5D2VA 1ONRA 1ICSA 1NSJA 5I3GA 1TSIA 1P0KA 4UFKA 3C52A 4O1DA 2V5LA 3KX6A 3IIVA 4UTLA 1SSDA 2Y63A 3AJXA 4RZ4A 1VHCA 4DF0A 3ZWTA 4R34A 4MLJA 2RDUA 4YMZA 1KM4A 2FDSA 3BO9A 1JCMP 4UMAA 4MLRA 4N2YA 5AC6A 3OVPA 1H7XA 2VFEA 4KFPA 3CHVA 3W86A 1UUMA 3W7GA 2E5BA 1JCJA 1XKYA 1H63A 2YX0A 5DXYA 3HGRA 4O18A 1AMKA 4GRSA 3C2RA 2FB2A 3SI9A 1YTEA 1ZENA 3SFKA 1TV7A 3DAQA 4O16A 2V0TA 1XBYA 2QCDB 2VFFA 3NR0A 1SFLA 4AXKA 1AL8A 2QUUA 1TIMA 1Z41A 3IGXA 1LRTA 2QDGA 3FA5A 1W56A 1R47A 1VJIA 2QKFA 1ME9A 1I45A 4YCPA 3W22A 1TTQA 3ELFA 2HSAA 1I4NA 4Z1BA 1F73A 4ZVJA 4DO4A 2C1HA 1B4EA 3M0ZA 2C16A 3PS7A 5KINA 3PSWA 5LHEA 3W2UA 1FCVA 3W73A 1ZY9A 2Z2UA 3Q37A 1GZGA 1R30A 4YLWA 2FPYA 1OFEA 5CKSA 1FXPA 2RDTA 1KLYA 3QSTA 3NNTA 4K6AA 5LGZA 3W7NA 4JTUA 2E6YA 3GK0A 5FF7A 4WY0A 3G1VA 2QCEA 1GG1A 3B8DA 5F2IA 3HG5A 5LKYA 3P81A 1T8XA 3DFOA 3R13A 3NYZA 5J5DA 3QRHA 4I9AA 1H7RA 3HO8A 2IQTA 1J2WA 4FX7A 4KFOA 4HNUA 2Z0IA 2CLMA 2ZRUA 1IF2A 2JK2A 4OV9A 3W23A 1ZHAA 3THQA 5KMYA 3TFXA 3W1TA 3KRZA 4IX2A 1MSSA 3GR8A 1AW5A 2V2HA 4ML9A 3LERA 2YR1A 1WXJA 4DBEA 3A9IA 5C5YA 2WNZA 4JICA 3WFAA 1LM1A 2NV2A 3FKKA 1F7BA 3B03A 5C54A 1GVSA 3M47A 4N9DA 2V30A 3O07A 3DHDA 3IIOA 2ISSA 3BGJA 3N2MA 2JBMA 2G96A 2ABBA 4JTKA 5FF3A 2WJZA 1H61A 4FNPA 1OFRA 2V2DA 4O8RA 5GVJA 3B04A 4MFDA 4RX0A 2YYUA 4A3UA 4A29A 3GDLA 3KXQA 1MZHA 3CWNA 3NQ8A 3NGJA 1DHPA 3TIMA 4UR7A 1W8SA 4X3ZA 2A4AA 3PULA 2RDWA 3P80A 3RU6A 4IMFA 2W79A 1ZJIA 4UTIA 3TUUA 5CPLA 3LOTA 1LRQA 1UUOA 4PL1A 3P84A 4JYFA 3W7QA 5G4WA 1X7FA 1OHLA 3HG3A 3W1RA 3M6YA 3O06A 2Y7GA 1S5WA 1JCLA 1I2QA 4Y6GA 1S3HA 3LBMA 1RQEA 3OVRA 3EKLA 4O52A 1VH7A 5I3JA 4FNQA 5EMUA 4NUWA 3W84A 4QM1A 4R7JA 3NQ7A 2ATMA 1EEPA 3DH7A 2DZTA 4WZHA 3VCRA 3NL2A 4IXHA 1XBVA 2H8XA 2J9XA 1VCVA 3DKLA 1A5AA 3GKFA 1L2UA 4FX8A 5I3IA 3BG5A 3L5MA 3C8FA 3RLVA 3UPWA 3W87A 2NXGA 3W7JA 2WOQA 1ICQA 1PHQA 2YSWA 1KTCA 4E2DA 1KA9F 4K38A 5HUPA 4TIMA 3R2GA 1W3TA 4ZQPA 3TC6A 1FXQA 1PVNA 1PL9A 2ZRWA 4JTEA 5ABTA 1RR2A 1EPXA 1R2TA 4HSNA 3RK8A 1Q6OA 1G4SA 2Z1BA 4MYXA 1EWDA 1QPQA 4N02A 3UY8A 1FY6A 2EKCA 3CEUA 4NNBA 2C3ZA 4OT7A 4O14A 5D2TA 2Q3RA 3LCLA 3P5YA 3P7YA 1FX6A 3IIXA 4A2SA 3LHYA 3STGA 3S5OA 4DELA 1V5XA 3MO7A 3GKAA 4ADSA 4RJEA 5CZSA 1VYSX 3I7QA 3PC0A 5LNSA 3DGRA 3UWQA 2W0UA 4JTIA 4J9JA 1CI1A 1WV2A 5CPOA 3UD6A 4ORIA 2NX3A 3USBA 3Q94A 1OYAA 1VYRA 3BVJA 4FXSA 3SGZA 1NVMA 1FBAA 3G22A 3L68A 3KFTA 2LLEA 2B0MA 3FEMA 4M7SA 3O6DA 4MKNA 3LHWA 3TNOA 1LCOA 2NZLA 3C2EA 1FWSA 3T78A 3WK0A 1KBIA 2G95A 1XUUA 1TRIA 1N7KA 1DQWA 1TPFA 3P5ZA 1RD5A 5K7JA 3BPWA 2VEPA 1C29A 1G67A 3LCIA 1QPRA 4HN4A 2E68A 1FWNA 3IVUA 5BNKA 2A85A 4XKYB 3HQ1A 3QM3A 3E96A 2VOMA 1DJQA 3C6CA 4NJJA 3I7SA 4H4IA 3W7MA 4TO8A 4PL2A 3INPA 2WSQA 3CQ0A 5D04C 4Q32A 3ABOA 1W31A 4NJGA 2E1DA 4JTSA 3FFSA 4DXVA 4XWUA 2X1SA 1HUVA 2AQWA 3EWZA 4N4PA 4WXYA 4RZ5A 5HWJA 2X1TA 2FJKA 3C61A 3M5VA 5EKYA 1KTBA 3MJYA 2BTMA 2RKXA 3HGJA 1P0NA 5TIMA 4DF1A 1F74A 1LDCA 3QMRA 4O50A 3EKZA 1W5NA 4TX9A 3LHZA 1GVFA 3QMTA 3UPBA 4GC4A 2FPTA 3B05A 3TAOA 3SJ3A 5AB3A 2ZA3A 5FI8A 5F4SA 4MJMA 2DZUA 3H54A 4ZL1A 4JTFA 4WXZA 5AHIA 3B0UX 3R8RA 4MUZA 3MBDA 5D30A 4WOQA 3TW7A 1SW0A 4HT3A 4QNEA 2WSRA 3KVMA 2ISVA 1A5BA 4N6FA 4YXGA 3C0JA 5CZJA 1LP6A 4LY8A 4PCFA 5DXXA 4JIPA 2ZBTA 3DBPA 4BWLC 3G0XA 4MVAA 5DY2A 3H55A 4EF8A 5I3FA 3GXPA 3N73A 3UY7A 4MY8A 2WQPA 2I14A 1BKSA 4XBKA 3T7VA 1YXCA 2O7SA 3EXTA 5AHMA 2J9YA 5D37A 3VE9A 1AW1A 1GT8A 1ZAHA 4NXSA 4N9CA 4JDYA 1X1OA 3EX1A 4UTMA 4EIVA 3BLIA 3STEA 3KVKA 2GPTA 3P60A 2QCLA 4NXKA 4NZJA 3NQFA 2E5CA 2Y89A 1KW1A 4TMCA 3NM3A 1H7NA 1ZNNA 1XUZA 1T0OA 3IIZA 8TIMA 2VFGA 5E1QA 4LU0A 3QEZA 4IUOA 4RXFA 2QR6A 4UUIA 4LC8A 1NAL1 1FCQA 3IVTA 3P61A 3DFQA 2V2CA 1NEYA 3S42A 1UJPA 5HR7A 2HS6A 4C1KA 3MUXA 4FXRA 3DI0A 3P67A 5A8GA 4Z08A 1H5YA 4M5PA 1P4CA 3W7CA 5SWUA 2BLEA 4FNTA 1NF7A 4IOTA 5EYWA 1Z44A 3M1ZA 1H50A 1KM0A 5DN1A 3ZWSA 5BOOA 3O6YX 3W7LA 2PRMA 3UXDA 2Y7DA 1ZAJA 1U83A 4UFIA 5C2XA 5F1VA 5D32A 3OIXA 1MEHA 5AYZA 2B7NA 4AB4A 3LCXA 4UTUA 5EL1A 2J6XA 5F4XA 2GQ9A 1QOPA 4GBUA 4IJBA 3ZS4A 1VC4A 1DV7A 3M43A 1GOXA 3NAVA 5K2ZA 4RKAA 4UFLA 4NNAA 3NQAA 4S2CA 4HHPA 3PBWA 4O19A 3W72A 2A5HA 1VR6A 1XBZA 2OT1A 2Q8ZA 1TCDA 4EWND 3W74A 4CNOA 4MIMA 4ZQCA 3W1XA 3O8AA 1SSGA 2B7QA 3NPWA 3O15A 3N34A 3NQCA 1ZALA 2ZZ5A 2EAWA 1PCKA 4X9SA 4YCOA 1GYLA 3NQVA 1LBLA 3S0CA 3GDKA 4AWSA 5K9XA 3WJXA 2RHGA 2Y7EA 3IGUA 2GOUA 4K8EA 3M9YA 1SFJA 3NL6A 2DZWA 2A1YA 5D05A 1ZAIA 1YDOA 1KM6A 5IBXA 1P1XA 5HQEA 3DU0A 2WV8A 2BZNA 4FHAA 3NPXA 1I2RA 3C2FA 3FYOA 2RH9A 5DY3A 4RLIA 2NWSA 2BSLA 3NL5A 3WJSA 1OYBA 1QAPA 1QPOA 1EIXA 3L9CA 4K7YA 4UFHA 3W75A 6TIMA 3LV6A 1WBHA 5TBOA 1CW2A 3MI6A 1XDMA 2G5WA 5AHFA 3GAYA 4JTTA 2NX9A 2CZFA 3W76A 3PB2A 2ZZ6A 5I3HA 4UFMA 4O1AA 2QJHA 3MP3A 3W7KA 4DEFA 1OJXA 3QW4B 1KM1A 3VKJA 3B0VC 1L6YA 3HPXA 4E38A 1F76A 3TXZA 2VENA 3CPRA 5AHEA 5AC8A 2FB3A 1QO2A 2GQ8A 2NLIA 1L6WA 3T4CA 2FLIA 4IWWA 3PUDA 1FDYA 4HNTA 3L66A 1TPDA 3G1SA 4MY1A 2JKPA 2FQIA 4UCGA 3C4UA 5TQLA 3B0PA 1O4UA 1RQHA 2F7FA 5DELA 1XI3A 3QF0A 2FIQA 2E6AA 2CZEA 2WKJA 5K4ZA 5KZDA 3TKFA 3TC7A 5K3VA 3LCGA 4AHPA 3WJWA 4OGZA 4OU1A 3O16A 1X1ZA 1XM3A 1SUXA 1LBFA 1H7WA 2YFOA 3BARA 4MPQA 1RV8A 3IV3A 3W7OA 3GAKA 4X22A 2A21A 5FEZA 1GVQA 3TMQA 3HIJA 4OQVA 1MXSA 2FFCA 1K03A 1IXPA 2CLKA 3M5XA 3GDTA 3T55A 3QMSA 3LCWA 2VC6A 3HG2A 4R53A 1G7UA 2H90A 3Q58A 1JR1A 5L6UA 3QC3A 5H2ZA 4GUHA 1PIIA 3PBYA 2GUUA 1SO4A 3BG3A 2QCDA 3S1XA 3TV8A 4A2RA 3KAOA 2J24A 1RZMA 1ME7A 4JR5A 3PWAA 3A22A 1OFDA 1QMLA 4NX5A 3PG8A 3S1WA 4LTSA 1EB3A 4O0ZA 3TQVA 3S9YA 5C6MA 1HFBA 2QUTA 2ABAA 1QO5A 1OFBA 3KRSA 3HJZA 3TU9A 1T96A 2CFFA 2YXGA 1K7EA 3QQ1A 2B4GA 2C13A 4LV9A 4LVBA 3W2LA 2HTMA 1K02A 3DFNA 4ZQMA 1K3UA 4EOUA 3M44A 4PFMA 3V75A 3OHIA 4DO6A 3V1PA 3UYCA 1N8FA 3LM7A 4MJZA 1SZGA 1JUBA 1FDJA 4L4LA 2CLFA 4FB7A 4POCA 1EP2A 1VRDA 2X16A 2A6NA 3W1AA 2YDAA 2YW4A 2EHHA 4GJ1A 2PURA 4ORMA 1LORA 2VKZG 3DHFA 3HPSA 4ONVA 4WQ6A 3NM1A 1LLZA 1DKWA 2VEIA 4IPIA 5DCBA 3F1QA 1TPB1 4O10A 3TJXA 3QZEA 3W3OA 1O5XA 5G2HA 5U7SA 1KM5A 3ANYA 4UC5A 2V82A 2JGYA 2XFWA 1TYGA 2NXIA 3GB6A 5LHFA 5AC7A 3G3MA 1SPQA 3DI1A 1WOAA 4TR9A 1SZNA 4WJEA 4AAJA 2YCEA 4UTWA 1OVDA 1EA0A 1THFD 1K8YA 2QUVA 3TDFA 1EWEA 3THAA 2QAFA 1RQBA 4CCCA 4LC6A 3G1FA 2DJLA 1OX5A 2DP3A 4XBSA 5AYYA 2P0OA 3PUOA 3NQGA 2QJGA 2ZRYA 3E12A 2DZPA 1BWLA 2QJIA 1XBXA 3EX4A 1TRDA 3GYEA 3R5EA 4MFEA 5KZMA 3IGSA 1DL3A 4FNSA 2YPIA 1L6SA 2H8ZA 1LOQA 5FF4A 3MYOA 4UTHA 4ALDA 1FDZA 1VLIA 3MP4A 5LNVA 4CNNA 3OA3A 1JCNA 4IQLA 4LW7A 1GYNA 4UIOA 4IX0A 3W71A 1G4EA 3W7IA 2HS8A 3LTSA 4NU7A 4Z1DA 2C0AA 2CLIA 3S5YA 4ZQOA 1N55A 3I65A 3CM4A 2Y6ZA 1XDLA 4Z1CA 2PC4A 3G1HA 3GLCA 4IMEA 4LUJA 3LI0A 3DFTA 3OVQA 4WD0A 1B9BA 3WJYA 4GUIA 3BV4A 4CCDA 1TPEA 3QSRA 1J5TA 1NF0A 1SZEA 3C2OA 2VFDA 4O11A 3ABRA 3M16A 2QCFA 4JXCA 4QSHA 3UWWA 3W2NA 1S5TA 3L67A 3UNDA 1KFCA 2C6QA 2NX1A 2QEZA 3K30A 1QOQA 1PCWA 4BWLA 2QDHA 4WUIA 2NUWA 1O94A 4N6EA 2DZXA 1UASA 3G3DA 4UTWC 4BI6A 1W5MA 4XTIA 3A24A 4Q33A 4JTHA 1H51A 1YXDA 5K4XA 2QCNA 3FYPA 5FEWA 2CLOA 2CZ5A 1Z42A 4FX6M 4UMBA 4O15A 3EXSA 5CZ0A 2VFHA 4CQ9A 1M5WA 3L0KA 3CWOX 2GVGA 4XKYA 1A53A 4LVFA 4M7TA 4HPXA 3NPVA 1QCWA 4ZMGA 3VE7A 3LXBA 3TK7A 4QITA 1W5QA 3PF3A 4B5NA 3LHVA 1ZFJA 3QPYA 3EX3A 5DBUA 2J9ZA 4FNRA 1DOSA 4FF7A 3MBFA 4JGDA 3HBLA 2DU2A 3F03K 3C3NA 4ZZ9A 4O17A 1G4PA 4O4VA 1W1ZA 1PV8A 5EA9A 1SU5A 1KV5A 2TSYA 3BGGA 1B4KA 3MHFA 3LCHA 3HG4A 3P8IA 5KTLA 4MZ8A 3DENA 1AL7A 3NG3A 2OJPA 1XL9A 5MHBA 4AWUA 1YTKA 4M6QA 2GJLA 3GDMA 1IXNA 1AG1O 3IEBA 5H91A 1OF6A 4E0CA 5CG7A 1LRNA 1QR7A 3M41A 3GXTA 1D3GA 1R46A 4JIQA 2E6FA 3QQ0A 3IVSA 4DF2A 4M6VA 2EPHA 4E2BA 1KFEA 3TROA 3LRLA 2E09A 3CB8A 3Q2DA 4K7VA 2O7QA 1D3HA 1YADA 3KRUA 3QFEA 3DFSA 1M6JA 4RV8A 4NQ1A 3G18A 4O0KA 5CPNA 1XCFA 1Q6RA 4BF9A 2ZA1A 3NO5A 5EY5A 4LVGA 1W3IA 4MYAA 3MW7A 3S6DA 3W7HA 3BG9A 4R33A 3QJAA 2R91A 3SW6A 3AO0A 3STFA 1G4TA 1AW2A 2A2IA 5AHLA 4ADUA 1TQXA 2B7PA 2QCCA 3G24A 1TO3A 1JQVA 1GG0A 2ZFAA 4PEKA 4EVZA 1L9WA 3TFCA 3NZRA 3BW4A 3NVTA 1GEQA 1LOSA 1WX0A 3EWBX 4AWTA 5D2YA 2ZZ7A 7TIMA 4UTTA 1ZCOA 3NOEA 2PRLA 1W5PA 3L21A 3W1UA 3OG3A 3L5AA 2CLHA 3R12A 4LWWA 4O13A 2VFIA 4LVDA 5DLCA 4UNKA 3OEXA 1ICPA 2JGQA 3EWYA 5AFDA 2X30A 4KWVA 4LS1A 1F5ZA 4DPPA 3GNNA 3DXIA 3N14A 5G2IA 1MEIA 5EBUA 4RK8A 2CLLA 3HPZA 4GNJA 2GQAA 2R8WA 5I3KA 3ABSA 3LX9A 4UFJA 2DZSA 1KM3A 3C2VA 2G97A 1VPXA 3NPUA 1UB3A 3U2OA 3TH6A 1J4EA 1HO1A 1EUNA 4M19A 2E77A 5BRBA 3RMJA 4I7WA 5CGQA 2A7PA 3FKRA 5FEXA 1PE1A 1A50A 4OWGA 3JR2A 3CT7A 5HINA 5U4NA 3L65A 2WSYA 3W88A 3CIXA 3F4WA 3QW3A 1OFAA 1WOBA 3F4NA 3PG9A 4NT0A 3W7DA 4NJIA 3W6YA 2NWRA 4AVFA 2C18A 5IM51 1A5CA 1PS9A 2UV8G 1TMHA 1ML1A 3TQKA 2DJXA 2P1FA 4H3DA 1WQ5A 2ZZ4A 1T99A 3NQMA 5FF2A 3UZJA 2WO5A 1C8VA 1TJPA 4Y96A 4MY9A 3DZ1A 4S1FA 3G1AA 3VI2A 1Z48A 3H53A 2KZHA 5DCDA 1MO0A 3O1NA 4N9EA 1I2NA 1KV8A 3W70A 1FWWA 3GNDA 1IIGA 3CLMA 4DBDA 5AYXA 2XN1A 2TYSA 5D33A 4CQAA 3LRMA 3N2XA 3P82A 1H62A 1BEUA 3LHUA 5KSWA 4NJHA 4JYDA 1DORA 1IXOA 3TSBA 4U4MA 3MI3A 4UR8A 4JY8A 4O28A 3EX6A 1Q45A 4WY0B 4BI7A 3DKJA 3TSDA 2E6DA 2V81A 5F2GA 1KFLA 4LV4A 1F6PA 4NJKA 3VNDA 1W54A 5AN7A 4BFAA 3IIPA 1GWJA 1GPWA 3UWUA 2GVLA 1Q3NA 4W9TA 1YPIA 2CWNA 1G6CA 2YGYA 3KVJA 3WK3A 5EPDA 3L0NA 1VHNA 3L2IA 3MWAA 3N9SA 1QFEA 4OV4A 1TV8A 1VQTA 2FTPA 3JRKA 4LNYA 4A22A 2JKEA 2TMDA 5HJLA 4K39A 1V7YA 4TU1A 1LOLA 2C19A 4IPJA 3ATZA 2ZCGA 4MZYA 4FIQA 2V5BA 3W2MA 1OK4A 2ZRXA 5CSRA 1TPC1 3TW6A 4Y9AA 3FJLA 1LBMA 1H7OA 2DORA 4O4WA 1Q6QA 4JTJA 1OX6A 2ZZ3A 4PODA 4O1BA 2X1UA 2YYTA 4CNPA 4NNCA 1IIHA 5E93A 3LB0A 3T44A 4L4MA 3E9AA 2ZQ0A 5D2WA 4AHOA 4FO4A 3L0GA 3W2KA 1K8ZA 4QAIA 3W7PA 1KLZA 1QNVA 1G69A 3L5LA 1A5SA 4UXDA 5A5WA 3D0CA 1X6UA 1K7XA 2NV1A 3G8RA 5G1TA 3HF3A 2VXNA 3QH2A 3R89A 1M7PA 4D2JA 3BLEA 1YDNA 1VLWA 4KKXA 3W85A 4GUGA 1VS1A 4GUJA 1JJKA 5L9FA 4G1KA 2AAMA 3CIWA 5K9CA 4OE7A 3W1PA 4NVTA 4UTJA 2YFNA 4JNMA 3OBKA 2BWGA 5F1UA 2RFGA 3SECA 3LRKA 5D2XA 3PUEA 1LTDA 4HPJA 2ZRVA 2NUYA 3U6WA 1RVGA 4HKPA 1OFOA 4O53A 6ALDA 4IMDA 3UWYA 2AGKA 5HR6A 1EP1A 4C1LA 3TR2A 2Q3OA 2D73A 3DFPA 1WYIA 3GR7A 1SQ7A 1OK6A 2ATSA 1R2SA 3NXFA 4ZQNA 4JYEA 2H3DA 5G2WA 2VEKA 3SZ8A 3W1LA 4YWIA 2PRHA 4N9BA 1ME8A 1OFPA 2Y88A 3PVFA 1SW3A 4YL2A 3SIZA 3W9ZA 1FQ0A 4NZFA 4UTTC 2C14A 4CQ8A 3TSMA 3EB2A 3FOKA 1JQXA 1WAUA 1MEWA 5D38A 1H60A 1BTMA 2V9DA 3M7WA 1JULA 4O12A 3S5ZA 4X2RA 1GJPA 1FCBA 2ZYFA 4CCEA 5LNUA 4UTKA 3I68A 3UWVA 2Y62A 4HSOA 4GUFA 3NZ1A 2ZZ1A 1W5OA 3PBUA 3IRDA 3CEPA 3E49A 2OT0A 5HWNA 3PB0A 1UCWA 3LGEA 1K7FA 3MHGA 3S8HA 2A6LA 3N3MA 3LXAA 3G8EA 2ALDA 4GFSA 1KM2A 1Q6LA 2QF7A 2ZDRA 1DJNA 1YDVA 1IGSA 3HOJA 3FIGA 3W1NA 1OF8A 5BMWA 1P5BA 1JCXA 3PAJA 3ZFHA 2W6RA 1TTPA 4QJ1A 4JN6A 3NQEA 1KTNA 2TPSA 1O95A 1LYXA 4JX5A 4LRSA 3P74A 4XTDA 4ADTA 1PHWA 2Q8LA 3FS2A 1KFKA 1TB3A 5DBTA 3SSJA 4IMGA 4ICNA 3O6CA 5G4EA 3TQ0A 1QWGA 4AF0A 3HGSA 4QQ3A 4OHQA 4OBTA 2ZTKA 3UXAA 2BXVA 1TTIA 2NUXA 3LBCA 3VFLA 1TPH1 2Z6IA 4IMCA 1VCGA 4JD4A 3NQ6A 3G1DA 4QIUA 5CZTA 3NDOA 1TTJA 1YYAA 1GTEA 3STCA 3MI2A 5CSSA 4JTLA 2TRSA 2A0NA 3TAKA 2QCMA 2QCHA 4TMBA 1VGAA 1OABA 2NXHA 3KOFA 3RLUA 5AHNA 4K37A 2A7RA 3EWWA 4GE8A 5T26A 2XN0A 3W1QA 3NA8A 1H1YA 4O1CA 3ZR4A 3GIYA 1JRCA 4UNLA 5G5IA 5DCEA 3I7RA 3O05A 4FIRA 1M7OA 4O57A 2F84A 3NL3A 2HMCA 3NQ2A 3UQNA 4FEZA 1OG0A 4WOZA 5BW6A 4KWWA 5FF0A 1F05A 1JVNA 4MZ1A 1YTDA 3G0SA 1F6KA 3BW2A 1EUAA 1YXYA 3W2JA 1QPNA 2PE4A 3TJLA 4QNWA 3A5VA 4NX0A 1SR9A 2R14A 3LV5A 1VZWA 5FESA 3B06A 5LNWA 2EF9A 1RPXA 2QAPA 3P8JA 4MOZA 3T40A 4AH7A 1I2PA 3ATYA 1WDWA 1U5JA 3LI1A 4HNVA 3LDVA 3LLDA 4HIBA 3W07A 3EEGA 1I8JA 2ZTJA 4AHQA 3O63A 1OFQA 2Y7FA
chains in the Genus database with same CATH superfamily
2EGZA 2WK2A 1TPVA 2VURA 3ZLGA 2V8ZA 4MB3A 1FWTA 1XFBA 3ITGA 2PDPA 5E0KA 3TYZA 1B57A 3H2MA 4EF9A 1PIFA 3A23A 1CB7B 5C9XA 4H8UA 1YHTA 2H6RA 1HJUA 1WKYA 3JUGA 3SR7A 2O9OA 1V6YA 3V5OA 1FWRA 2ZXAA 4PTWA 3PR2A 1UD8A 1BWKA 4L1WA 1TJRA 3KHJA 2GJXB 3N19B 4KEVA 4IXXA 3P2VA 1GOWA 1T7LA 4LT9A 2FPVA 3F2BA 3QOKA 4PH6A 2BOGX 1TPUA 4B5SA 3BH4A 2W91A 4J1OA 2ZOXA 3QYQA 1E6QM 2WNNA 1NQKA 3UZ5A 4RR4A 1JYWA 1VENA 1XRTA 1ALDA 1E51A 3OB8A 1SO3A 2WVTA 3ORWA 4AX6A 4E8GA 2Z6JA 2GJNA 2P88A 4EWJA 4Z2HA 3NDYA 1Z6KA 3E02A 1FH8A 1CX9A 1OWQA 4GO9A 3KVLA 4CLMA 3VGFA 4W84A 4DI9A 4U28A 4JDBA 4AEOA 3BOFA 4XAFA 1NFBA 4K8HA 4WX2A 1J10A 3N9RA 4Q8UA 3D6NA 3EXRA 1Z8AA 1UBPC 3I6RA 1BQGA 1ZP3A 2GL5A 4O54A 1QNSA 1PKMA 3PM6A 3C5QA 4FXJA 1DYSA 4RDYA 2VELA 5D8WA 4DO5A 4LUSA 4S2BA 1HP4A 2L5HA 3OLGA 3SN4A 4BI5A 3WK2A 4WF7A 2P8BA 2XIQA 1UKSA 2J27A 2CPUA 1V02E 2CXEA 4P2VA 4PRRA 4FF5A 3WL0A 4LGXA 1GOIA 1SVDA 6A3HA 3CK5A 2FDMA 1ZU8A 1DVJA 3VZZA 2JKAA 1DQXA 4DBUA 2V3FA 4V2XA 1UIPA 2PUZA 3LCFA 3RF9A 3WQ5A 4QP0A 1SMAA 3LA4A 3D5HA 4AQLA 5LZLA 3TOYA 4ZEPA 3E0VA 2A7NA 5D02A 3DX5A 2WZMA 4ZFMA 4EPBC 3URBA 2BHZA 4JTGA 1ZLPA 2E9LA 5I23A 1TCMA 2DSVA 2VR2A 3M0XA 2WC3A 4P7LA 2CHRA 1UBSA 5GNYA 4ACZA 2OZ0A 2CZDA 3A21A 5I07A 1WBJA 4RZ6A 2DIJA 1ADDA 1K8XA 3M5YA 3WQEA 4HA4A 2OTDA 3MMTA 2IQ0A 2OCZA 4KRUA 2V5DA 2QQ6A 5HNTA 2V63A 2OO6A 4QBXA 1EJRC 5AOUA 2EG8A 3EBVA 5F2MA 4MGGA 1SW7A 5HWMA 4QLKA 1GQNA 1O12A 3PN8A 3KL3A 4OBSA 4WDUA 4FNUA 1GHRA 3PUGA 3BCJA 3ARXA 1LG1A 4I7UA 1FHUA 1DWGM 2VNCA 3OZMA 1TUFA 4GZIA 4HSHA 3E2SA 2FHFA 1ODZA 2BVWA 3SFWA 4UFKA 2YDQA 3SEPA 2V5LA 1SSDA 1NU5A 1WXYA 1JPDX 2YA2A 2Y63A 4RZ4A 4DF0A 4R34A 4MDPA 2FDSA 3BO9A 4E3VA 2IKIA 3WMBA 3SUTA 3BJTA 4N2YA 5AC6A 4AW7A 3KCOA 2VFEA 1XRSA 1V6WA 2J7CA 3W86A 5CC7A 4X63A 3ZT5A 3CQKA 3HURA 1JCJA 4R7WA 4RW5A 1ONEA 3AI0A 3HGRA 3B8WA 3PK7A 1TV7A 3TTOA 2RJGA 3HTWA 2QCDB 4AXKA 1AL8A 4JQ3A 2WHLA 1Z41A 1OT2A 1UWIA 2QDGA 5TF0A 1W56A 1R47A 4NYUA 4S3FA 1FKXA 3SRDA 1I45A 3RO6A 3K8LA 3JW7A 1C91A 2Z26A 7CGTA 2C1HA 2CXGA 1Z7AA 1VBRA 3WFZA 3PS7A 3PP7A 2H9AB 3C8NA 1GZGA 2WANA 4S3CA 2RDTA 1G9HA 1KLYA 3FN9A 3PZ9A 3QSTA 1IT8A 4AIBA 1U33A 2V5JA 4JTUA 2G41A 5FF7A 5F2IA 4BEUA 3H2OA 3IS4A 2C91A 3HG5A 2FH6A 5HMDA 1ITXA 5J5DA 3HO8A 4FX7A 4KFOA 3WQ6A 2Z0IA 4PEEA 3OQ8A 3TA9A 3HPAA 1X38A 2PDJA 2A3HA 3R10A 3GR8A 3KDNA 1JNEA 2OGYA 4ML9A 3SY1A 3RJXA 1RUSA 1NTHA 1DTUA 3FK4A 4XZMX 3BLLA 5C5YA 2X0SA 3WFAA 3MCOA 2QIIA 2QV5A 4AZ5A 1WUFA 3WD4A 5C54A 4YWSA 4IP4A 1GVSA 4B9ZA 1RK6A 3O07A 3AS2A 1R86A 1PB0A 3BGJA 1Q66A 3N2MA 3GVWA 1M03A 5C2GA 1CZ1A 4AY1A 4FLQA 1YRRA 3CL6A 1A0EA 2C8NA 7PTDA 3M4HA 4GZJA 1OFRA 3CYVA 2V2DA 5GVJA 1TWZA 8XIAA 4RX0A 4YTRA 4A29A 1J9YA 3NGJA 2CHOA 3TIMA 4UR7A 4LH8A 2A4AA 1UJQA 3RU6A 5JBEA 4OJYA 3EDJA 1JD9A 5CPLA 3A3WA 2OSYA 4JTQA 3P84A 2DQXA 4JYFA 1X7FA 4C5YA 3HG3A 3W1RA 3O06A 2ON3A 4Y6GA 2J77A 3HN3A 1U5HA 3VMPA 2NQJA 3T07A 4Z2JA 3ITLA 4JKLA 4DJED 1XCWA 3KTXA 3T0DA 4ZE4A 2F38A 4GVHA 4ZSTA 3FX4A 4H41A 4C1NB 2IKHA 1VCVA 2V5KA 3DKLA 1A49A 3H24A 1Q4NX 4KERA 1L2UA 1VFLA 4H9TA 2W5FA 5BXTA 3S47A 3C8FA 1EX1A 4KWOA 1JZ8A 4DXKA 1W2PA 2VCAA 4TVDA 3L4ZA 1PHQA 5FD0A 2YSWA 1KA9F 4YTQA 5HUPA 1GW1A 1CGYA 4B3LA 1W3TA 2CCRA 1P7TB 2PWEA 3CUJA 5ABTA 3KLLA 3UXKA 4TV6A 4WSJA 4D6HA 2Z1BA 2B31A 1E71M 1EWDA 1QPQA 4N02A 2C3ZA 5D2TA 4O14A 2EO7A 3KHDA 3ZQ9A 3P7YA 5CQ1A 2Q02A 1TV2A 4EANA 5XIAA 1VEPA 4ADSA 1JXKA 3K2GA 4MB5A 1Q4WA 3DGRA 4JTIA 4J9JA 3GUWA 3UESA 1CI1A 4C6JA 1WV2A 3UD6A 4GABA 4XSMA 4QCFA 1VYRA 4WHBA 1CGXA 1UKPA 3CZLA 3BAWA 4EXQA 1NVMA 3G22A 4BHYA 3O6DA 3LHWA 2NZLA 3OYXA 4XBJA 3VNJA 3LCIA 1QPRA 3ZT6A 3VGHA 5BNKA 1V0NA 2XM2A 1EYWA 3HQ1A 3QM3A 1RLCL 4H4IA 3WUFA 1T40A 3W7MA 4JAWA 4TO8A 1IZKA 5D04C 3ABOA 2VOTA 4H6QA 3FFSA 4DXVA 3PWIA 2AQWA 3ZSSA 5GNZA 1OBAA 4GLEA 2X1TA 3C61A 4AD0A 1XSJA 1KTBA 2OYMA 3MJYA 2BTMA 3HGJA 1P0NA 1E4MM 5TIMA 4MWAD 3QMRA 4O50A 4FLOA 1KXVA 1W5NA 1QWKA 3H23A 3CV7A 4CN1A 3SJ3A 3LPGA 1U1JA 4L65A 4AXNA 2DZUA 3H54A 2Q09A 1EDGA 5AC5A 4OIFA 2EXOA 4WXZA 4BKNA 1JDCA 5AHIA 3B0UX 1M41A 3BOLA 3LY0A 4D9PA 3SCUA 4BA0A 3NZGA 4HT3A 1EC8A 3GVQA 3AS1A 3H4GA 5FOOA 1A5BA 1XYAA 5H8UA 5CZJA 3TYUA 1UA7A 5DXXA 3DBPA 1JL8A 1BF6A 3B8UA 1FKWA 4EF8A 3N73A 3UY7A 2PEVA 2E1WA 1G01A 3REQA 1CXHA 2GSHA 1AD4A 3GG8A 1XLJA 3R0KA 1AW1A 4N9CA 4JDYA 4OOUA 2V67A 4NXKA 3BJSA 4PMYA 3NQFA 2YA1A 1CGTA 2Y89A 1KW1A 9XIMA 1H7NA 1F8IA 4CD4A 8TIMA 4FZIA 3QEZA 5C7VA 1NAL1 1FCQA 1FOBA 4ES4A 3GXFA 2X05A 5HR7A 4H00A 1YDYA 3MUXA 3WL1A 1E6XM 3DI0A 2KAUC 3RXZA 5A8GA 4C6FA 1MXGA 1H5YA 4OUEA 4QG6A 1R3SA 3K4AA 3W7CA 5SWUA 3UCQA 2BLEA 4Z2GA 1PZ1A 3TQPA 1LLOA 4TTUA 3A4JA 5DN1A 2ZX7A 3ZWSA 3K8KA 2PRMA 3UXDA 4R85A 4UFIA 3UCDA 5C2XA 4EAMA 5AYZA 3TC3A 4GH1A 3H6OA 2J6XA 1YEYA 3FVMA 2WJFA 1J0IA 1XYBA 4GBUA 3ZS4A 3DYOA 1DWHM 3GHRA 3CJPA 4ATLA 3TTYA 5BRQA 1H2JA 4NNAA 3WN6A 1JGMA 3NQAA 4LCRA 1XKJA 1XQKA 3UWEA 1BKHA 1XBZA 2OOGA 2Q8ZA 1TCDA 4EWND 4XAPA 4CNOA 3ITXA 3W1XA 3DFYA 1SSGA 2B7QA 3G77A 3NPWA 1REQB 4JHOA 3NQCA 3BOXA 4XAZA 3THCA 2PDQA 2FHBA 3NQVA 1NP0A 4AWSA 3WJXA 1GJWA 4GKTA 2GOUA 1BD0A 1SFJA 1R87A 3NL6A 4JNYA 1QBAA 3FYOA 2PZ0A 3NL5A 4PYSA 2ZXDA 2HK0A 5I00A 2DVXA 4K7YA 4L9YA 4UFHA 2E0PA 2DSWA 4FP1A 4F2BA 6TIMA 3VVGA 4XZHA 1Q6EA 5TBOA 3VINA 1CW2A 3MI6A 2NX9A 4PMDA 5EMJA 1P0DA 4REQB 2YXXA 4GVIA 3GW3A 4UFMA 1IEXA 2BXYA 3MP3A 1LJYA 4GNVA 4DEFA 4Q4PA 3MUZ1 1YNQA 5C9UA 1P0BA 3B0VC 1L6YA 3IARA 4JFUA 1N82A 4ATWA 2D0GA 1F76A 3CPRA 4UOJA 5AC8A 2A3CA 4PB3A 1L6WA 2ZC8A 4Y9NA 3ALFA 3T4CA 1E5NA 4HNTA 2ZE3A 1E1CA 1RJQA 4MY1A 3EDDA 2JKPA 1JEZA 3B0PA 1RQHA 4RDZA 2REQA 2E6AA 4MAZA 3TKFA 3OVGA 1VFUA 2I17A 1X1ZA 1O66A 4XX6A 1W1A1 4U5KA 2YFOA 3BARA 4MPQA 3IV3A 4ROPA 1HL8A 2A21A 1LWHA 3TMQA 3CV1A 3M5XA 3UJFA 1A5OC 4KQNA 1J5SA 1VBJA 2ZUSA 3HG2A 4F48A 1G7UA 2KX9A 3AIBA 1VAHA 3PBYA 1PUDA 1W9DM 3BG3A 3ARVA 1J11A 3TV8A 4A2RA 3KAOA 1RZMA 1ME7A 3WNLA 3PWAA 1ITQA 3A22A 4KS0A 1OFDA 1QMLA 3KUMA 2NQHA 3AMLA 2VMFA 4QTGA 4O0ZA 5C6MA 4HNOA 1RJRA 1M04A 1XH0A 2OG9A 1OFBA 3TU9A 1T96A 4X0VA 2Y8VA 4JPGA 3WEOA 3DFNA 1K02A 4DZ5A 3M7SA 4ZQMA 4GI4A 4PFMA 5ABFB 3UR2A 3ZYZA 3LM7A 1SZGA 1N2VA 3G2GA 2GVEA 4FB7A 2VI0A 1EP2A 3PZUA 3NCOA 4AVNA 1W1VA 2YDAA 3LSBA 2EHHA 2QF8A 2VTFA 5I3DA 4IGNA 1NELA 3NM1A 1LLZA 2VEIA 3Q4DA 1MI3A 2Z29A 1TPB1 4O10A 4S3DA 3W3OA 3WY1A 3IUDA 3G1RA 1KM5A 2QGYA 3IPWA 3SCVA 2DSKA 2V82A 2XFWA 3RJYA 4M8UA 5I09A 2GSJA 5AC7A 3G3MA 1M65A 4UQAA 2VD9A 4UTWA 1R7AA 1EA0A 1GVIA 4XVEA 5C9WA 2J7GA 3MV01 4ZO6A 3M0YA 3TDFA 5JIWA 4LXFA 4O1FA 1TFVA 4XVDA 4CCCA 5A6LA 3QBUA 4JQ4A 1LQ2A 2DP3A 2VT0A 3VNYA 3RMEA 1UMLA 2DZPA 3H12A 1JZ5A 2QJIA 4R3UA 1ZJHA 4U33A 3VKKA 4F9DA 1ISWA 1M3UA 2NT0A 1DL3A 2H8ZA 2GJPA 4RNFA 4UTHA 1VLIA 3QKEA 3LPOA 4I9MA 1UH4A 1PWLA 3DC8A 3VKDA 1G4EA 1TZ9A 5IFPA 4LFYA 2HS8A 1LWJA 1EGVA 4Z1DA 2C0AA 4IISA 1VIZA 2CLIA 1N55A 4Q8MA 2PSNA 3I65A 3CM4A 4IFKB 3G1HA 5EFDA 4NSBA 5A95A 3F2DA 3W24A 1KB3A 3URQA 3DFTA 2BNJA 1FWFC 3EB3A 3SUSA 3WJYA 3MUCA 4GUIA 4MAVA 4CCDA 2V68A 4D8ZA 2OO0A 1CGVA 1SZEA 2VFDA 4O11A 5HATA 4L5ZA 4W7UA 3U57A 4JXCA 3AICA 3UWWA 5A6BA 1QVBA 3L67A 3K30A 1PCWA 4WEVX 4WUIA 2XVPA 4XTIA 3A24A 3SSZA 1XYFA 3L4XA 1JF5A 3ALGA 3L4VA 5K4XA 1EOMA 3FYPA 1Y65A 3U2CA 2CZVA 2VM8A 4O15A 3VCCA 3CWOX 3NWRA 1X1NA 3A12A 1A53A 2Z2BA 4LVFA 1XLIA 3NPVA 4L6OA 1QCWA 2O9RA 4B5NA 2HROA 2BY1A 4H7VA 3L4YA 3LNMA 2WHMA 4QDMA 1IWPA 3GNXA 3M6DA 1G4PA 3QV9A 3S6TA 2WZHA 1R9XA 5B7ZA 2UY3A 4F4RA 5DANA 3HG4A 5CJ5A 4G9PA 1CLKA 1GJUA 3CZGA 1OGSA 3EMQA 3NG3A 5EBAA 1XL9A 1E55A 3QFWA 4AWUA 1UOKA 2YL6A 5CGMA 1AG1O 2OEJA 1XLMA 3GE7A 4DUWA 1N8IA 1D3GA 4ZB2A 4F3HA 1I60A 2HEJA 4NZ1A 3ARPA 1H09A 2CESA 3RPMA 1P6CA 2O7QA 2VGIA 3T1GA 1JPMA 5C8BB 3KRUA 2CLPA 4TV5A 3QFEA 4RV8A 1Q6RA 3A6OA 4BF9A 3UR5A 2ZWZA 3N1AA 4I6KA 2X2YA 3SW6A 4D6CA 5J04A 1G4TA 1AW2A 2A2IA 4ADUA 4JTDA 1H11A 3WDRA 1NARA 3R0UA 4MSSA 1X8CA 2PDYA 4EVZA 3W0KA 3NVTA 1K8CA 1HX0A 1K6WA 3W02A 3WX7A 4AWTA 4JFSA 1K70A 1FWIC 1HL9A 4FLRA 2WHKA 1JYXA 2W66A 3W1UA 3QY6A 3OGVA 3R12A 4LWWA 1L6FA 4UCFA 4H9VA 3E6EA 1ZQ5A 3OJGA 5G2IA 4PUNA 2XINA 6XIAA 4AZ7A 4DJFA 5I5RA 1KM3A 3C2VA 1JDAA 4GISA 3NO1A 3WF3A 1SJDA 3OZPA 4M19A 5H6HA 2VDIA 4JBRA 2X8RA 4LY4A 4IG2B 3SJNA 4NYYA 3CT7A 4L56A 3KCLA 5U4NA 3CIXA 4YTTA 2J7BA 2J7EA 3FAWA 2VZOA 3F4CA 1XHGA 3PG9A 4NT0A 4S3JA 4DWSD 1C93A 3W6YA 1I6NA 1OG6A 2EPNA 4GYFA 1OIMA 2UV8G 2FH8A 3TQKA 2DJXA 2UY2A 2WZEA 1WQ5A 2ZZ4A 1XD1A 5I03A 2WBKA 3IK4A 3K4DA 4TVUA 5KZ6A 3PNUA 1ZSXA 2WO5A 3MJMA 4GO8A 5GJNA 3DG3A 1MDLA 2CBJA 3DOPA 3R79A 5AZ0A 1FWDC 3MDWA 3G1AA 3VI2A 3WLHA 2R1MA 1MO0A 1KV8A 1RD6A 4WCJA 2G4FA 3P82A 4AIEA 4GCXA 1PKYA 1JCTA 4AVOA 5KSWA 3UZXA 3VNMA 1IXOA 4IZGA 4W7WA 4IPLA 2O56A 1CENA 3QKZA 5FJPA 2HE8A 3B9OA 3EX6A 1Q45A 4WY0B 4BI7A 2E6DA 3DGBA 4LV4A 1C8YA 5AN7A 4BFAA 4RNIA 4PMUA 3NEHA 2R9RA 3FYYA 2VHLA 1MNZA 1UWSA 1G6CA 3B4YA 3CUIA 4EPDC 3MWAA 4M6UA 3AALA 1OC7A 2WZIA 1NP2A 4M82A 4OV4A 1TV8A 1RCQA 1VQTA 5HJLA 1DQUA 2FZMA 3SUVA 1V7YA 2JEQA 1LOLA 2C19A 4MNLA 4LYPA 4FIQA 5EMKA 1UZ4A 3O9NA 1KWKA 1SGJA 1OK4A 2G3MA 3R6IA 1XG4A 3TW6A 3N3TA 3QC0A 4B5WA 4PCSA 2WZTA 4Y9AA 1SMDA 3K1DA 5FACA 3FNDA 2HVNA 3HFTA 3MKCA 2XPKA 4C6CA 4HN8A 2X1UA 4CNPA 5E93A 4F0HA 3PPGA 4AHOA 1YKWA 1JXJA 1SZRA 2Z1XA 3EYPA 1MUWA 4AIUA 1NM9A 1EO5A 2WWCA 4ZTXA 4ICMA 1KLZA 3I3DA 3LUTA 3OYZA 1G69A 1AJZA 1PBGA 5LIKX 4JIHA 3FGCB 5A5WA 1AMYA 1OD8A 3TN3A 2NV1A 4J2MA 3GXDA 3QH2A 4JHMA 4Z1YA 1H49A 1WZKA 2WVUA 3FA4A 4S3GA 4CD5A 4GY7A 2X7VA 5L9FA 1XYMA 2AAMA 1MW3A 3GH4A 1FWHC 5I7GA 4UTJA 2YFNA 3ZZ1A 2WXDM 1KD0A 2BWGA 1QK0A 1UROA 5D2XA 4AZGA 1K77A 4HPJA 2ZRVA 1T6MA 1BGGA 3U2ZA 4HKPA 4O53A 4IMDA 3ANVA 1PTGA 2WLZA 1WP6A 3TR2A 4ERIA 1L8PA 1WYIA 2ATSA 1BHGA 3QR0A 1FHVA 3W27A 1DTNA 3WDPP 2PRHA 2Y88A 1QHZA 3PVFA 2CWXA 4PBFA 1SW3A 1UYQA 4W8AA 4DUXA 4CQ8A 1JQXA 3USZA 3GQYA 1XIDA 2DIKA 3V7PA 2FVMA 1Q65A 1BTMA 2V9DA 2V38A 3S5ZA 4MPKA 5A8NA 5IHSA 1GJPA 3WBEA 2ZYFA 3VX0A 1UWRA 2XVLA 3WF0A 3I68A 2Y62A 2WC4A 1BQCA 3RU8X 2ZZ1A 5H8PA 3PBUA 2YL9A 1UCWA 3MHGA 2AKMA 3H70A 4MDOA 2A6LA 3N3MA 2RGLA 3G8EA 4MNMA 2WMGA 4GFSA 2QIWA 3SRHA 1DJNA 5HQLA 4IGMA 5BMWA 4TX6A 1JCXA 3ZFHA 5AZ1A 2W61A 4K2SA 2WM0A 2YCLB 1O95A 3GNOA 2YDRA 1TB3A 2CIPA 4ICNA 3W6MA 3G5EA 2NW0A 3S46A 3WSUA 1QWGA 4AF0A 1TV3A 4OHQA 4DLMA 2PF8A 2BXVA 3LENA 3CUFA 1AH0A 1TPH1 4IMCA 7XIMA 5ECVA 4C6DA 2PGEA 3VOGA 4QIUA 3OP2A 4JN7A 5CZTA 3WH5A 4LUYA 1MW1A 1XLBA 1Q7ZA 1J2BA 1CIUA 2TRSA 2WSPA 4C6PA 1VGAA 3SDOA 1OABA 2GLKA 4K37A 5AHNA 2A7RA 2XIJA 1FFQA 2I7GA 3VIGA 4HYRA 1H1YA 1V3KA 2GGIA 5G5IA 2R82A 2Q6ZA 3H7UA 3R43A 1S38A 4O57A 3HPFA 4G1NA 1OG0A 4KWWA 3VOIA 1JVNA 1R8LA 3BE7A 3ARZA 3G0SA 1YXYA 4AD2A 4F79A 1TJ2A 4QNWA 4AYSA 1SR9A 4R7OA 5FESA 5LNWA 1RPXA 2QAPA 4FPSA 4QG8A 3LLDA 4HIBA 3W07A 5BXPA 4AFYA 3EEGA 1A4MA 4AHQA 3KBNA 1IEIA 4CN6A 3MCMA 1CT5A 3KWSA 1EBGA 1EX5A 1HG3A 4HZ6A 3WH9A 2NQZA 2FVKA 1C9DA 2CU0A 4L9ZA 2ZRZA 4IUGA 2WCSA 3ME3A 4K36A 3WLIA 3V35A 3WQOA 1G0CA 2FHCA 3S1VA 4ZQRA 1NFPA 3WDQA 1GZ1A 1HO4A 2OLHA 2WW5A 4G8TA 4QRNA 2BB0A 5FJUA 1V6XA 2JFEX 2JF6A 4W8BA 3S5NA 2Y24A 1XXXA 4MMWA 1EEXA 3ZJKA 1DWIM 5HOSA 1BRLA 1QI5A 1TQJA 4JX4A 1VFMA 3V18A 3PAOA 1QNOA 2VR5A 1WDRA 4TXEA 1WKFA 2XIBA 4LEFA 2HRWA 3WIJA 1Q5MA 4KESA 2G3JA 3T8LA 2Y61A 4DWSB 4HP5A 1W1IE 2P3EA 1OSEA 3L2MA 2VVNA 3WF4A 4GYPC 5HULA 5A8QA 3W7EA 4X9YA 4LBUA 2J25A 3KBVA 5LSMA 2PWGA 3S9IA 3B4UA 3FV9A 2XISA 5CC5A 2PDCA 4J40A 5DMYA 3V5CA 4DPQA 1IEVA 3TE9A 4JKKA 1BWVA 2WAGA 2CKRA 3T0AA 4M3PA 2X2GA 3OBEA 3FJ6A 4J27A 1GVOA 1YMYA 3YPIA 3VD9A 2ZE0A 4QFUA 3P62A 5D9OA 5LNRA 3OU8A 3TR9A 2QCGA 2DT0A 5A8MA 4HNNA 2ZA2A 4M1RA 4IT1A 1X7IA 3TXVA 3C56A 5FAJA 2PTDA 1RXOB 3PZVA 4LVAA 1OX4A 1BF2A 5IFTA 4PTVA 5BOEA 3G0UA 1AK5A 3FLUA 3U8GA 2OLSA 3JS3A 2X42A 2FGZA 2BVDA 4MNKA 4L4OA 1V3HA 4U3AA 3GYCA 1O6IA 4UB9A 1FWAC 1TWWA 3O0KA 4Q4RA 3W25A 2YZRA 4UWMA 3WQDA 1I2OA 4XIAA 1TVNA 2P53A 5B7YA 1Q2RA 1S5VA 4GBDA 3G1XA 4GI9A 1AQ0A 4HU3A 4MJ2A 2ZIDA 1W3KA 4XZ9A 4E3TA 4UZUA 3RFAA 3TNBA 1V77A 5F4WA 3EWUA 3OO2A 4PC8A 2W63A 1JPHA 1HKJA 1H1ZA 1D8WA 1CXEA 2YKKA 4B16A 1YE4A 1WZMA 1B9ZA 2ZUNA 1SZFA 1HTIA 3GTNA 3O2LA 2VGGA 5FIPA 3H2EA 3HGOA 4XD3A 4M6PA 1QDSA 3SQLA 1O60A 1SO5A 1V51A 1XYCA 3PZQA 5LGXA 3AXKA 4CEUC 3B97A 5LA0A 1J96A 5ABGA 5BMXA 4RXGA 3SCSA 3EPOA 1UR4A 2DZVA 3A64A 5I06A 4LOCA 4O1EA 3KTSA 4B9YA 7TAAA 1KBJA 4I3GA 4ERAA 3WJZA 3JZUA 1F2JA 1BSLA 4V28A 1C9WA 2PCQA 4Q4KA 2YLLA 3HB9A 1W3JA 4GMEA 3Q65A 3TEVA 4J28A 3MP5A 4CNTA 5BCAA 3PY2A 4QEEA 4BR1A 5HMSA 3TX9A 4DXXA 5D2VA 3IRSA 4HZ8A 1J79A 3KBWA 1RVKA 4ZOBA 4WRHA 1L0PA 5CGTA 3C52A 3HMCA 3TWAA 3KX6A 3AZTA 3PTDA 2RDUA 1KM4A 4P8WA 1QW8A 3BUVA 3WFLA 1PTAA 1HN1A 4UMAA 1LL6A 5CXPA 3VNKA 1SJBA 3SCQA 2YB4A 2NVCA 4F2UA 3EDKA 1I0DA 3ZR5A 1UUMA 2CERA 5CH9A 2I5GA 5FJIA 1O5RA 3QHMA 3SRFA 1DIOA 2XFRA 5DXYA 2VWTA 4O18A 3OGSA 1ZENA 3SFKA 4I9TA 4O16A 2V0TA 4Q7NA 3NR0A 4X61A 2EG6A 4KW2A 2I5QA 3VNIA 2WWDA 3J7HA 3FA3A 3FA5A 4GACA 3WZ0E 1VJIA 4NKCA 2QKFA 1GK8A 1KCZA 2VC9A 3IANA 3ELFA 3HFYA 4Z1BA 1F73A 1RA0A 4AD4A 3M0ZA 2C16A 4B92A 1IEQA 3PSWA 1FCVA 2J7FA 1ZY9A 2Z2UA 2D1ZA 4YLWA 1FXPA 4FOJA 1E1FA 5BOFA 3T08A 4LX4A 3NNTA 5LGZA 4L6HA 3VD5A 3B8DA 4ICCX 1V93A 4DYEA 3D46A 3DFOA 3R13A 3W28A 4AEEA 4KCTA 2HXUA 4I9AA 4JFVA 1HT6A 3VZXA 1H7RA 3BC9A 1R5YA 2GZXA 3S5SA 3WENA 1BG9A 3VGDA 2ZRUA 4OV9A 2I5IA 3KRZA 4IX2A 1ZUAX 3HA1A 3WBWA 2XH7A 2V2HA 1YE6A 4HTBA 2WNZA 3BAYA 5T8GA 1IV8A 2PD5A 1LM1A 4XG1A 3XIMA 4ZENA 3U0HA 1XYZA 2BASA 3S83A 3M47A 4PCPA 1UPPA 3CHEA 3CLWA 2VO5A 2ISSA 2G37A 1LQAA 1B0IA 2CHNA 3VNLA 3N2OA 3RPDA 2WJZA 3FHQA 1H61A 2Q01A 4FNPA 2E4TA 4Y9MA 3AU6A 3B0XA 1NOUA 4MFDA 5DRCA 1R3YA 5BWAA 3ZXWA 1XC6A 4KCWA 4A3UA 4XZWA 2P8CA 4PZVA 2ACUA 4XD4A 4XUYA 3WH7A 2MUCA 4ZB0A 2VRKA 4IMFA 4TQTA 3LOTA 3GRIA 4OUIA 3I3EA 3I6TA 3WYZA 1XLEA 1JCLA 3LBMA 4S3EA 1VH7A 5I78A 1EQPA 2C1IA 4Z2LA 3W84A 5H1WA 4ZO9A 2ATMA 2J4GA 1EEPA 2DZTA 5E0FA 3SO7A 3R58A 3C2YA 3H21A 4IXHA 1XBVA 5I77A 4HQVA 4B4FA 4C6IA 1Q85A 3EOSA 6TAAA 1A5AA 4FX8A 3AMGA 3N6QA 5JH1A 4DJDA 4AISA 5A6JA 4WDWA 3ZVHB 4RV3A 3DHUA 3WLSA 2WLYA 4XISA 1NQ6A 2PAJA 3S2CA 3UPWA 4UQBA 2PZNA 5M17A 2WOQA 5CBJA 3MVIA 1KTCA 1U5VA 1EIBA 4KCUA 4TIMA 3R2GA 1XLCA 2ZVIA 1HZYA 2CETA 4W93A 4ZQPA 3CO4A 1GOMA 4JTEA 1RR2A 1EPXA 3RK8A 1Q6OA 3OOQA 3HQOA 3KP1A 2F6KA 3UY8A 4ZXLA 1FY6A 2OWCA 4JL1A 4L1XA 1XG3A 2Q3RA 3LCLA 3P5YA 5M2FX 2Y1HA 2PP3A 3LHYA 2P5NA 3OHMB 3VMOA 4DELA 5CZSA 1VYSX 3ZM8A 5LA1A 3PC0A 6CGTA 2QYGA 2W0UA 1FHDA 3CAWA 3U5YA 1HKWA 5CPOA 2NX3A 3LU2A 1CXFA 2O4MA 1OYAA 3Q94A 2IW0A 3TW9A 4P8VA 4JIEA 3VDCA 1MUCA 2OR2A 2YJQA 1FBAA 4H7ZA 3SQSA 3F4VA 3L68A 4AZCB 2LLEA 4MWAC 4M7SA 1SJCA 4H83A 4JOMA 5A6KA 3GD6A 4MKNA 1QATA 3T78A 3LK6A 1K4GA 2BGQA 4PGLA 3MWCA 2RUSA 1J6OA 1N7KA 1TPFA 3P5ZA 5K7JA 1VEOA 2VEPA 1C29A 4J7RA 1RP9A 1MQPA 2A85A 2OXNA 2VOMA 3UR7A 2ZX6A 1PKLA 3CAVA 2OZTA 2V3GA 3AMKA 3OQEA 2WSQA 4Q32A 4GJIA 2CC0A 4GK8A 2E1DA 4CD7A 2PP0A 4RDVA 3P3BA 4WLCA 3RRXA 3FDGA 1HUVA 4D72A 2PGWA 4WVXA 5EKYA 2VDGA 4V1YA 4MTVA 4CU7A 5XINA 2QW5A 1F74A 1BRLB 1OZMA 4B90A 3EKZA 3LHZA 1IQ8A 1JD7A 2FPTA 4NZCA 3TAOA 3VIJA 1RLDA 5CBIA 4MJMA 1XLFA 1DJIA 1SR0A 4DZIA 1KRMA 1WCGA 2PDMA 3LPPA 3MBDA 4R88A 2OYKA 2E8ZA 5BU6A 3WEZA 5LYRA 4K1GA 2VQUA 2WSRA 4US5D 3TYBA 2ISVA 3WLPA 4ZTYA 2WVVA 4YXGA 1GQKA 1HQTA 2IQDA 2VEFA 4EK7A 4C5ZA 3WD2A 3VIHA 2OFJA 2D24A 1W1B1 4PCFA 2ZBTA 2PS2A 4EKJA 1Z89A 4LPCA 1KGUA 5DY2A 3H55A 1Y5WA 1AQFA 2DQWA 1UWQA 4GGHA 4OZOA 1AJ0A 3GUGA 1Z3NA 2I14A 2D2GA 2O7SA 3A4XA 2UBPC 1ZAHA 1XW8A 1X1OA 4EIVA 3E38A 3HJEA 5CPQA 2E5CA 4ZO7A 5E9AA 3IIZA 4HU0A 3M0MA 1BYDA 4W87A 4IIDA 3MSGA 1UA3A 5DEZA 4Z17A 3CQJA 4S39A 1NEYA 1UJPA 2OU4A 2HS6A 3H4WA 3P67A 4J3XA 3L12A 4M5PA 1NJJA 4NL1A 3URAA 3M0JA 3CAKA 5EU9A 1AA1B 4IOTA 3BMXA 4FLSA 4UZSA 1ITCA 3QV8A 1WO2A 5A94A 4IFRA 4LYRA 2GDUA 3NXLA 2ZADA 4F0SA 2HISA 1HNYA 3LCXA 1CLVA 3BSHA 1ITUA 1QOXA 4FS9A 1QW9A 2WMFA 2GQ9A 3IAQA 3PPHA 2R1PA 3NAVA 1XINA 4RKAA 2RGMA 3I3BA 3NUKA 3T4WA 4PN2A 3PJUA 3CUGA 2HPIA 1NDWA 2BDQA 4O19A 1TR1A 5C0QA 1VR6A 3N4FA 3W74A 4ZQCA 3ERPA 2YZ5A 3IJ7A 3P14A 2ZZ5A 1PCKA 1ZJBA 1TWDA 1LBLA 3GDKA 3V3WA 5K9XA 2RHGA 2Y7EA 3M9YA 3BANA 2G8ZA 1ZAIA 5D05A 1A5LC 1XICA 5IBXA 3WD3A 5HQEA 2WV8A 4FHAA 1TE1A 2X7WA 1JIBA 2XIIA 1JZ6A 4RLIA 4H01A 1OYBA 1K9DA 3TZNA 4JCMA 4C7GA 2PCEA 1EIXA 3GFZA 4LAOA 4H6RA 1FWCC 3CHCA 2HK1A 4H8VA 3LS9A 1E6RA 3ZJ8A 1XDMA 1EC7A 3L4UA 2WB5A 5AHFA 3GAYA 4FK9A 2ZZ6A 1V03A 4IF2A 4DZHA 4I9JA 4GZ7A 1VKFA 2QHAA 1R3RA 1OJXA 3QW4B 3TXZA 1ZGDA 1FA2A 4HHLA 2FB3A 5LXXA 2GQ8A 2F9RA 2UY4A 4LUSB 3B8VA 3UA4A 2VZSA 2AKZA 3PUDA 1FDYA 1M68A 3G1SA 4UCGA 2F7FA 3VDGA 2YL8A 5D4YA 2CZEA 2WKJA 5KZDA 5I24A 1CBGA 2DH2A 2FTYA 3LCGA 3QR3A 4OGZA 3WJWA 3AYVA 4GXPA 1U2YA 3GAKA 5I79A 1WUEA 1V4YA 3OLEA 4X22A 1EHAA 3HIJA 1IXPA 3NURA 3LCWA 3CH9A 2H90A 3Q58A 1JR1A 5L6UA 3QC3A 5A6SA 3PZOA 2GUUA 4PMJA 2OSXA 1UD5A 1ISZA 4W4QA 3PZNA 2QNEA 2XVGA 1XLDA 3CUXA 2IKGA 3UZYA 1PDYA 3A9BA 5E0CA 3FSTA 1NIUA 4LTSA 3U4AA 3TQVA 1UR0A 1E3XA 5JVLA 1HFBA 2ABAA 4GOAA 3KRSA 2C13A 4NF7A 2HTMA 3S2NA 2J7DA 1X98A 1K3UA 3A13A 4JHZA 3M44A 2YBUA 3UYCA 1N8FA 2GFTA 4IICA 4H1ZA 4R9OA 3UG3A 1IT0A 2VP8A 3R25A 4GJ1A 4D6FA 3B8TA 4ORMA 3B8IA 4TVCA 2VUNA 3HPSA 4WQ6A 5I0DA 1DKWA 4IPIA 1V3JA 3ITCA 3RG6A 1E0VA 4MUPA 2PU0A 1O5XA 2ZUMA 1E4NA 1J6PA 4HD5A 5CPTA 1XIFA 1TYGA 2NXIA 1DWFM 3VGGA 5LHFA 4TR9A 1SPQA 2DT3A 4HMEA 4WJEA 2YCEA 3II1A 3UA3A 4D6DA 4XO6A 1K8YA 4QJ3B 4F0KA 2QJJA 3T9PA 3THAA 3PFRA 4CQDA 4LC6A 4HK7A 1X97A 3BLDA 4AZ6A 3GG1A 2P0OA 3PUOA 2QJGA 5C70A 3FY1A 3E12A 3CS2A 4F9JA 4A8IA 3EX4A 3OBAA 1TRDA 5BROA 5KZMA 4MFEA 4FNSA 1LOQA 5FF4A 1ZB5A 3TYEA 3LMZA 3KM8A 4LW7A 4IQLA 2DUZA 4IX0A 5TNVA 3EOLA 1MFUA 3S5YA 1REQA 2Y6ZA 1XDLA 4HPGA 1J12A 4Z1CA 4IL2A 5MF5A 2PC4A 2PTWA 1KCKA 2GGHA 3K4WA 3WQFA 4ZA0A 1B3XA 1F9CA 3AIUA 5FL0A 5HJXA 1LL4A 3BV4A 1PZ0A 2FGBA 1NF0A 3KBMA 4AU0A 2QCFA 1S5TA 3NYDA 1KFCA 1I9CB 1RHCA 2QEZA 3ZT7A 2PMQA 1QOQA 1JFXA 2XFFA 1MVYA 2QDHA 2NUWA 4LCSA 4JQ1A 3AOFA 4N6EA 1UASA 4QS6A 4UTWC 3UXIA 2F8QA 4PTMA 1YXDA 3VKCA 5FEWA 2CZ5A 2OKTA 3EXSA 1UZDA 4CQ9A 3L0KA 3VK5A 2NQ5A 4PBEA 3UJSA 3FDKA 1MUMA 2GUBA 6PTDA 1XIHA 2DSZA 4HPXA 4QHRA 2PDBA 4ZMGA 3LXBA 2O92A 4EXBA 3UETA 1ONWA 3MKVA 3PZIA 3WQWA 2WCGA 3IGHX 1BSIA 4H2CA 3UGRA 3EX3A 1M7XA 1DOSA 4ECLA 3HBLA 2WHJA 3F03K 3CUZA 1E56A 4ZZ9A 3IAPA 1PV8A 3W82A 2WSKA 4IJCA 3CTTA 3VIPA 2TSYA 1B4KA 4HCLA 1XISA 4IQDA 4K1WA 4JN8A 4HBKA 3MS8A 3B9AA 1H4PA 1P48A 2PP1A 4Q8VA 4BZYA 3OPSA 1UKOA 1K9TA 1WDDA 3VXGA 3IEBA 1D8CA 5EFFA 1A4LA 4E0CA 5CG7A 1QR7A 1DWAM 2OQLA 4D6EA 4S3AA 4DF2A 4M6VA 5ECUA 3T8QA 2VGBA 1EKOA 1V8EA 3TROA 1UC4A 3M46A 3CB8A 3Q2DA 3QV7A 1W32A 2HNEA 4K7VA 4MKSA 1XIEA 4V15A 2PFHA 2G3FA 2PGFA 3G18A 5CPNA 1XCFA 2IPFA 4C6MA 5CC6A 1TX0A 2ZA1A 1UZHA 5EY5A 1OC5A 2D2OA 4LVGA 4U5IA 4MYAA 3RR1A 1E4LA 3W7HA 4QROA 4XD5A 1TZ7A 3QJAA 4R33A 2R91A 4PMXA 4C65A 3STFA 4H6EA 3ITTA 3T2OA 5HDRA 2YDSA 3DG7A 1TO3A 5AYBA 4PEKA 3BW4A 3NZRA 1P1MA 2BBFA 3H2AA 2ZZ7A 1TV4A 1J0YA 2AQOA 2ZX8A 5E6YA 4UTTA 1ZCOA 2PRLA 1G1YA 1W5PA 2WMIB 3AC0A 4EE9A 2CITA 4I5RA 4W85A 1S5MA 3EWYA 2X30A 4LS1A 1B3ZA 4KRTA 4DPPA 3GNNA 3GTIA 5BZAA 3IJ9A 5EBUA 1A3HA 4RK8A 3AIEA 2CLLA 3HPZA 1Z69A 4GNJA 2GQAA 1XV8A 5I3KA 2QXWA 2D23A 1TELA 3ABSA 2XGIA 4UFJA 2G97A 1UB3A 1J4EA 1HO1A 3TTSA 1F4HA 5BRBA 5CGQA 3W37A 3ZLFA 4AMCA 2PDKA 1PE1A 1MQRA 1XWYA 1A50A 4OWGA 3QHNA 5H8MA 3KRBA 3WLQA 1OCNA 4WJXA 3QW3A 1OFAA 4AY7A 3GY1A 4A4AA 3QXBA 4DUVA 4Q8QA 4NJIA 1H1NA 1NDZA 2IPJA 4AY8A 4X0NA 2ASHA 1A5CA 4MHBA 2PGRA 1ELSA 2DDXA 2Y4SA 1LF1A 1E43A 1TJPA 4GFIA 4MY9A 1XSKA 2FGLA 2J79A 4R9XA 4A3RA 1FH7A 4MWAB 3H53A 2YL5A 4WGHA 3O1NA 1FWWA 3CAQA 1F3TA 3GNDA 3CLMA 2XN1A 4HOZA 1TX2A 4CQAA 2PDUA 1ZBVA 2EBNA 3NVDA 3RAOA 5C71A 4JYDA 4PMQA 1T41A 4AUBA 3U5UA 3HU7A 3POCA 1YQ2A 5GQBA 3DKJA 3WNKA 4NJKA 3VNDA 1W54A 1DXIA 4AX7A 1S1RA 4DZAA 4F66A 1YPIA 2YGYA 3KVJA 3WK3A 5EPDA 4G2DA 3L0NA 1VHNA 4C1NA 1DPMA 5ABFA 2YB1A 4A22A 1I1XA 3TYCA 4DNMA 4K39A 1PO9A 1R3WA 2PDFA 3CT2A 2OQHA 1J93A 4IPJA 3SIMA 3ATZA 5FCZA 4GYPA 4MZYA 3ARUA 3W2MA 2ZRXA 4DVOA 4QE4A 1A5KC 2FFIA 1PEZA 4LUTB 1L2QA 1QNQA 1Q6QA 1XDJA 5D8ZA 4FSAA 2ZZ3A 4YVVA 1M7JA 2YYTA 1IIHA 3VC6A 1F61A 3T44A 4YYCA 4AC1X 1CEOA 1GQIA 3V4BA 3SCWA 3AHXA 3RDKA 4FO4A 1YBQA 3O7UA 1A80A 2POTA 3WDJA 1QNVA 1QT1A 2PD9A 3AHYA 3MA8A 1FTXA 1E5JA 1R9YA 1X6UA 4PR4A 5G1TA 5M1TA 4JFWA 3R89A 1AZ2A 1M7PA 1HJSA 2XGZA 3W85A 3AIQA 1VS1A 1E72M 4GUJA 3ARSA 1JJKA 2P3ZA 1IHIA 1CPUA 2GQ3A 2ZXBA 3GU1A 3PTKA 4G1KA 3S1GA 1ENUA 2WMHA 5K9CA 9XIAA 3DHPA 4OE7A 2FZNA 4NVTA 4CD8A 4JNMA 2RFGA 4B4HA 4DM1A 5C9RA 3N2BA 1LTDA 4PUKA 2NUYA 4BQ5A 6ALDA 4NAEA 4C1LA 1TZZA 3EMCA 2Q3OA 3H2FA 1OK6A 1UC5A 4IL0A 2OEKA 4DWSA 4YWIA 1ME8A 1OFPA 2INFA 3GVVA 4NZFA 2QZRA 3TSMA 3EB2A 1WAUA 4HHMA 5D38A 5TD4A 5BYWA 2VDHA 3U3HA 1JULA 3L23A 1FCBA 2QULA 4CCEA 1KQYA 3UWVA 4GUFA 4RE2A 1W5OA 3ISIX 4NZ3A 1OD0A 3LGEA 3RO8A 3S8HA 3LXAA 2YBTA 2YOCA 3FAXA 2ZDRA 2ISDA 3HOJA 3FIGA 1OF8A 4ERGA 1P5BA 2WJDA 2W6RA 1ONXA 4QE5A 1KTNA 4JX5A 3SUWA 1OGGA 4GG9A 3FS2A 1KFKA 5DBTA 3W29A 2BY2A 2X09A 2ACRA 2PODA 3TQ0A 3BMVA 1P0EA 3HGSA 4G56A 1KXHA 4JCLA 3MB9A 2NUXA 4C7DA 3GC4A 2IPWA 1VCGA 4PFHA 3URNA 2UY5A 3G1DA 3OODA 1FWJC 3NDOA 1SM9A 3SN0A 2FJUB 3STCA 3MI2A 5CSSA 1XS2A 3W6LA 4ZFCA 3TAKA 1E70M 4W86A 2QCHA 3UJRA 4TMBA 2NSXA 2PDIA 4W5UA 2NT1A 3I4EA 3EA3A 1DEDA 1GOQA 4GE8A 4DB7A 2DIEA 2XU2A 3SAZA 4KH2A 4O1CA 2OWWA 5A6TC 5HXMA 2X0HA 1UR8A 5DCEA 3VX1A 4FIRA 3BDKA 1T8QA 1E73M 3NL3A 4FEZA 1B1YA 4RE4A 4JEJA 3KDOA 1HJXA 5FF0A 4MZ1A 2DGAA 3A4WA 1Q6CA 1F6KA 2DVUA 3W2JA 1DP0A 3TJLA 1W2VA 4IQEA 2E25A 4A8RA 2R14A 3LV5A 1VZWA 3R8HA 3MTWA 3U7BA 1M53A 4MOZA 4AH7A 2SFPA 3K5XA 1I2PA 1A0DA 3APGA 1OEPA 4HNVA 2AL2A 2JQXA 2VEGA 2XH4A 1IWBA 1P7TA 3GH5A 4JTCA 4PUJA 2J6VA 4ASTA 2GWNA 2FMOA 3LHTA 5IDZA 5CPMA 3W7RA 4QE1A 3KBSA 1Y0EA 3EWXA 1ZRQA 4JFTA 3UWZA 3PSVA 4LS0A 4H6KA 3KBJA 3GTHA 3B9NA 1Q2SA 1BG4A 5AY7A 2NVDA 4GQQA 1KFBA 1UR3M 3QGAC 5K9DA 3NQDA 3UPMA 3MVTA 4IM4A 2E5DA 3CU2A 3DEQA 4W5ZA 4JIIX 1Z32X 2BHUA 3M0VA 3EPMA 1W3HA 4JQ2A 3QTPA 4JEQA 2OMAA 3E0IA 4ZO8A 2DZBA 1I75A 2EJAA 1TV5A 4JS3A 3GXMA 1R3QA 3A3XA 1I1WA 4YTSA 1W0MA 4RZBA 2EG7A 3AZRA 3VOFA 2ZDSA 3RM8A 4C6QA 3CTLA 3TN5A 2JEPA 5CLTA 1DXEA 4Y8FA 1KKOA 2H3BA 3OGRA 3PBVA 2XJ7A 1LWIA 4KFNA 3WNNA 4DM2A 3SGGA 1F8MA 4ZSUA 3EX2A 3QQWA 4MADA 2GDQA 1G7VA 2ZXQA 4BK9A 4EPKA 3DYMA 4RCXA 2DFAA 4JY9A 1KO0A 4U2YA 4EACA 1KFJA 1D7FA 5D03A 4XUGA 4L6DA 5D9PA 4CEXC 1TPWA 3V0UA 2ZKMX 5DMNA 1XC4A 4UMCA 2OGJA 2CLEA 1OCJA 1TREA 3NEVA 4LF1A 3TVAA 3OLIA 1TE6A 5JU6A 3RUBL 3PZMA 3W1MA 2XWEA 2HQAA 4Y90A 1R2RA 5GPRA 3VD7A 3GZ3A 4KCVA 1MRQA 4US6A 3MMUA 1HVQA 4LALA 1FRBA 4DQWA 1MFVA 4LS2A 2GVYA 1VRXA 3CC1A 3HMJG 1UUQA 3HV8A 4AF0B 3AFBA 1HVXA 4GYJA 1D9EA 3IJQA 3ZOAA 1EFZA 1JUEA 5CG0A 1JUKA 1OYCA 2OVLA 2WPBA 3G1YA 2YW3A 3ARQA 4GY0A 5A8OA 3BK0A 3UG4A 5J5RA 5G1YA 1XF0A 3R7MA 1UKQA 3C0SA 1LZOA 3A5FA 2ZVRA 1IWAA 4PUUA 1HIZA 4S38A 1RBOB 5DRIA 7REQA 3PBGA 1Q6FA 1RALA 2QVHA 1AH4A 4I7VA 4ML4A 4LRTA 4C6NA 2Z7KA 3WQCA 1D3CA 4L61A 3WBYA 1FCUA 1X96A 1B54A 4NI3A 3WO8A 3ZSTA 4UNIA 3B8SA 1VD6A 2G0WA 4AG0A 2PF0A 3W26A 2AL2B 4Z0JA 4PA8A 1C7TA 4GWEA 2XN2A 2OYLA 2DH3A 3MHUA 3AIRA 3M64A 5MKGB 3EPNA 1WA3A 1D7KA 2BX7A 1UMYA 2AAAA 4X2PA 1MNSA 1XLAA 1DBTA 1W9XA 5DFAA 3IV8A 4XSLA 4N4QA 1N8WA 2BS9A 2DUXA 2HPMA 1GGOA 2Y70A 2OX1A 4AZIA 5HNRA 4MB1A 3BQ5A 5CCZA 1GCYA 1ICSA 1ONRA 4WR3A 3O0FA 4HOWA 1TSIA 1P0KA 3KWXA 3WDIA 2AQVA 3BICA 3VAVA 3QOMA 3RPTA 4B5XA 1RA5A 3S2JA 1EBHA 1B2YA 3ARRA 1EZ2A 1JCMP 1POJA 4MLRA 3OVPA 3VABA 2GK1A 2PTXA 1CTNA 4HK5A 4PUWA 2E5BA 4GQ0A 1EO7A 4ZBCA 1H63A 3P0XA 2D22A 2VUYA 3C2RA 3FJNA 3SI9A 2D20A 3WQPA 3NO3A 2PPGA 1XBYA 1W9VA 1B30A 3ZVIA 2VFFA 1QASA 3U4FA 1X39A 3UFYA 1IR1A 3VD3A 2QUUA 1NOFA 1S46A 1S1PA 1LRTA 1TG7A 3WUEA 1ME9A 4YCPA 1G94A 2NV9A 3PFMA 4H7CA 4Y9OA 2HSAA 4DO4A 1UR1A 1GQJA 3MQTA 4LSBA 3WEMA 5KINA 5LHEA 3W2UA 4YNGA 1A5UA 3ENLA 5DQPA 1R30A 1TJ0A 5CKSA 1KGXA 4AYGA 1BYAA 3AROA 1EGZA 4TOQA 4CN4A 7A3HA 5BXSA 1ESWA 2E6YA 4WY0A 1GG1A 5LKYA 3P81A 3NYZA 4J3SA 3V36A 4H9UA 4QQUA 9CGTA 2IQTA 1EQCA 1CWYA 2BGNE 1IF2A 3W23A 3THQA 5G4HC 1QNPA 3TFXA 1MSSA 3BCDA 1X6LA 3LERA 2YR1A 4DBEA 2QVNA 3A9IA 3ABZA 1QTWA 2BHYA 5T9BG 4XZNX 1DJXA 2NV2A 3FKKA 1F7BA 3ES8A 3B03A 4KEZA 4N9DA 2Y8UA 2Y5SA 3DHDA 1RSCA 4ZB5A 3EWCA 1BXBA 4Q8TA 2G96A 1PWMA 2ABBA 4ZR8A 4JTKA 4BQ4A 1UOZA 2FMNA 5FF3A 4HA0A 1E9YB 3RIKA 3B04A 2C71A 4BQ2A 5RUBA 2YYUA 1YBQB 3GDLA 3U7VA 1MZHA 2GOKA 3NQ8A 1XGZA 1TA3A 1W8SA 3NGFA 4X3ZA 3UZZA 1UHVA 4GKLA 3ZMRA 3TN4A 5A6MA 3P80A 2VR4A 3CUHA 2W79A 2OZ8A 4UTIA 5EMYA 1E9IA 3W01A 5MKGA 4MNJA 1QPKA 1QUMA 3E2QA 4KGLA 4G7EB 3M6YA 4INFA 1S5WA 1I2QA 1S3HA 3OVRA 2G50A 2ZUWA 5I3JA 1GPFA 3EB4A 4FNQA 5EMUA 3SN1A 2EPKX 5HBFA 3DH7A 4WZHA 3VCRA 5J8LA 3BWWA 3NL2A 3OW1A 2J9XA 3VU2A 3GKFA 4X60A 3DUGA 5I3IA 2FZ9A 1XH2A 3BG5A 3WKZA 3N6JA 3RLVA 1F4AA 3TOPA 3EKGA 5CZKA 4L80A 3W87A 2NXGA 3LLXA 3W7JA 1GW9A 1UWUA 5DT7A 2O55A 3DN5A 4E2DA 1QNRA 3GG0A 3UW6A 4GI8A 3QVQA 3TC6A 3GHSA 1PVNA 3LZ3A 2XYLA 3WLTA 3O6AA 4HSNA 2HV5A 1G4SA 1W8GA 1YIXA 4MYXA 3RR4A 2EKCA 4NNBA 4OT7A 3F5LA 1EHNA 3COTA 4Q7IA 1O5QA 3IIXA 1OZQA 1TA3B 3R4IA 4L9XA 3S5OA 4NAFB 4I6VA 1V5XA 3PJWA 4EAYA 1DJZA 2AGTA 4MWAE 4RJEA 3I7QA 1BVWA 2XSBA 4F0RA 4GXWA 4XV0A 5E5CA 1UQZA 2AMXA 2P0IA 4QDPA 3QYSA 4Q8PA 3USBA 4NRSA 2J78A 1J18A 3PWGA 3A4AA 3LNPA 1KRCC 3GC5A 4FXSA 4J35A 3SGZA 3WLMA 2Q8XA 4ENLA 2B0MA 1RK5A 4H19A 3WF2A 3GH7A 1LCOA 1FWSA 1VF8A 2ACSA 1XUUA 7ODCA 1TRIA 4JQAA 1EOKA 4CQBA 3BPWA 1G67A 2PLMA 4GD0A 1FWNA 3IVUA 4BF5A 5E6ZA 1DJQA 3M0LA 2AOSA 3C6CA 1M01A 5E70A 4PL2A 4Q6JA 3INPA 4OKDA 2BXZA 2X1SA 4Z42C 4DN1A 4N4PA 3T6CA 3S2LA 3QGKC 3M5VA 2IKJA 5JMUA 1UWTA 3CIVA 1WDQA 4AZBA 1EPVA 3AUJA 1TVPA 1P43A 3VKBA 1UH2A 4TX9A 2X1IA 1GVFA 3EEZA 3QMTA 4LAKA 4PB5A 4GC4A 1E40A 3B05A 1AUSL 2C1GA 3L4TA 5FI8A 1GEHA 3RX3A 3WNMA 1R3VA 4ZODA 4A3QA 3N2TA 5AKQA 4IFKA 4CQCA 4GQGA 4DJDD 3R8RA 3TTEA 4U2ZA 3SCRA 3TW7A 5D9MA 4K8GA 4QNEA 1BFNA 4JKMA 5C7HA 1Z9AA 3C0JA 4LY8A 2PTZA 4BWLC 1VFOA 5LA2A 3VNZA 4FA3A 3AS3A 2A3EA 4B5VA 2YCIX 3GXPA 1A0CA 3SQMA 4MY8A 5FA5A 3BLOA 2WQPA 3CZJA 3HV9A 1BXNA 1XP3A 3EWDA 1R38A 5FSDC 3CPUA 3EXTA 5AHMA 2J9YA 5IXEA 1KCXA 4HTYA 4NXSA 3GBDA 5JH2A 1U30A 2FKPA 4UOZA 1LQ0A 1HKVA 3KVKA 2GPTA 4NZJA 5C9ZA 3KOZA 3NM3A 1ZNNA 3W38A 5E1QA 1A5NC 1LT8A 2BV9A 3V1HA 4RXFA 2F61A 4YYFA 5FJTA 4UUIA 4RPPA 4LC8A 3IVTA 1PX8A 3M0HA 2OB3A 3P61A 2V2CA 3S42A 1PIGA 4DI8A 1PZ3A 4C1KA 2E67A 4FXRA 1FHLA 1P4CA 2WJEA 1NOWA 4FNTA 1OADA 4NP7A 1Z44A 1RH9A 1KM0A 5CAHA 2PDGA 5BOOA 3O6YX 4B2DD 3NDZA 4GQBA 1O68A 2E9MA 5D32A 1V6UA 2XSXA 2VC7A 2B7NA 4G5DA 4YHEA 4AB4A 4GIAA 4F2TA 4UTUA 4H9MA 5EL1A 4LNCA 5F4XA 3ES7A 3LSCA 4C6EA 1XRFA 4GX8A 2W27A 1QOPA 4U31A 4IJBA 3SCPA 1KR0A 1VP5A 2VX6A 1VC4A 1DV7A 3M43A 5K2ZA 4LB3A 1QBBA 1W1PA 1V6VA 3VIOA 3W72A 2A5HA 2JIWA 3H2NA 1XRVA 2QMKA 3O8AA 4HHHA 1AODA 4J3WA 4C6BA 3N34A 3TLQA 1KWGA 1ZALA 2EAWA 2UWFA 4ATDA