4RZLA

Dna recognition domain of the cytosine modification-dependent restriction endonuclease lpnpi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
227
structure length
227
Chain Sequence
b'HHHGKIYSFDTLANADLIIDAVYEGGSSGNASDDPISKIIKGIGNMGGFRSAGQGIFKKLIVLYTNMEDGDWPDSIDTSKGQFIYYGDNKHPGHDIHDTPRQGNATLKMLFDSTHNEKDARRIVPPIFIFVKYPTASSSRSVQFKGVAVPGYPGLSATDDLIAVWKTTNGQRFQNYRAIFTILNIPMVSRKWINSLFDPFGQDNSLNPFYQWKISGKADVLIAPSTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restriction endonuclease LpnPI
publication title Structure-guided sequence specificity engineering of the modification-dependent restriction endonuclease LpnPI.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Dna binding protein
total genus 57
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18062 RE_AspBHI_N Restriction endonuclease AspBHI N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.20 Mainly Beta Roll PUA domain-like PUA domain-like 4rzlA00
4F0PA 4R28A 4OC8A 4RZLA 4F0QA
chains in the Genus database with same CATH superfamily
4F0PA 2ZO1B 4RZLA 3DWHA 2ZKFA 2ZO0B 3FDEA 3F8IA 4PW6A 4NJ5A 4YGIA 3BI7A 3Q0DA 2ZO2B 4PW7A 2ZKEA 3CLZA 4PW5A 4F0QA 3OLNA 2ZKGA 3F8JB 4R28A 3Q0FA 2PB7A 3Q0BX 4OC8A 2ZKDA 3Q0CA
chains in the Genus database with same CATH topology
4F0PA 4R28A 3Q0FA 3Q0BX 4YGIA 4OC8A 4RZLA 3Q0CA 4F0QA 3Q0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0P A;  4R28 A;  4OC8 A;  4RZL A;  4F0Q A; 
#chains in the Genus database with same CATH topology
 4F0P A;  2ZO1 B;  4RZL A;  3DWH A;  2ZKF A;  2ZO0 B;  3FDE A;  3F8I A;  4PW6 A;  4NJ5 A;  4YGI A;  3BI7 A;  3Q0D A;  2ZO2 B;  4PW7 A;  2ZKE A;  3CLZ A;  4PW5 A;  4F0Q A;  3OLN A;  2ZKG A;  3F8J B;  4R28 A;  3Q0F A;  2PB7 A;  3Q0B X;  4OC8 A;  2ZKD A;  3Q0C A; 
#chains in the Genus database with same CATH homology
 4F0P A;  4R28 A;  3Q0F A;  3Q0B X;  4YGI A;  4OC8 A;  4RZL A;  3Q0C A;  4F0Q A;  3Q0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...