4RZUA

Crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
206
structure length
205
Chain Sequence
GVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ADP bound dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords Probable thymidylate kinase
total genus 67
structure length 205
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rzuA00
5FR2A 1XU4A 4RVCA 4KO8A 1KDOA 5K8LA 2FSHA 4I1SA 4QKQA 3U3JA 1W44A 4AK9A 5EZ6B 4H1VA 3TQFA 1IN5A 1R4AA 4OI0A 3C41J 1RJ9B 4C7OB 1JR3D 3A1VA 1XX6A 1EWRA 2VLIA 4F38A 4RKFA 3TUJC 2GCOB 1ZBDA 3E5HA 2GCPA 2VA8A 3TMKA 1G7RA 5JWHA 3TIFA 4DSTA 1Z6XA 2RHDA 5EP2A 3G0HA 1CJMA 4Q4JA 5AK0A 1KK2A 1Z6TA 3GLFB 1TAGA 4TZ6A 1HH4A 4OHXA 4LJ8A 2OT3B 1W4CA 1NVXQ 3DPUA 3FHCB 1GTVA 3WMEA 1NBMD 4GP7A 4DCNA 2IX3A 2WMNB 3KUCA 2JJ8A 3W3ZB 3LAWA 4KXFB 4ZI2A 3IGFA 4B33A 3BBPA 2YV5A 3BK7A 4LDJA 1UBGA 4D0GA 1W36B 3CUEF 1R5BA 4JJKA 3KJHA 3UIEA 2W83A 1KY3A 3OE7D 4V0LA 3K70C 1EX6A 5HE8A 4BLSA 4N1AA 4URUR 4BLPA 3IIKA 1MO4A 3RS3A 2XXAA 3ASYA 1XRJA 1E32A 1N0UA 2VSOA 1RYFA 4LK2A 2ZUCA 3KXLA 4M21A 1COWD 4GNKA 2P0EA 4GOXA 3V00A 5HE9A 3BAFA 2GEDA 2J45A 5FBVB 3PITA 2DFKB 3U3RA 3X1WA 5L8VA 3ND8A 1XP8A 2F55A 1TU4A 2PEZA 4FCVA 3U4QB 2D2FA 4GZMA 4HZUB 4US1R 3NHAA 1G20E 1Z0FA 4NONA 2O8CB 1GZSA 2LCFA 2BC9A 3C8UA 3B9PA 2IYWA 3DM5A 3QXXA 4MRNA 2QBYA 1KHTA 2SHKA 1YHNA 5GJBA 1KNQA 2C03A 4RZ3A 4LV8B 4Q9HA 2OAQ1 4M1WA 2D7CA 2ODEA 3UG7A 1W2GA 1X1SA 1DOAA 2R6AA 1G6OA 5JRJA 4B76A 4PZYA 2ZAOA 1J99A 2BVNA 3QG5A 5FTLA 4PAQA 1JR3E 1WA5A 4KBGA 1JAIA 5KSOA 1SKYE 1WF3A 1RZ3A 1TNDA 3V4FA 1SVSA 2RGNA 3U7FB 1XTIA 2Q3HA 1OIVA 1FX0B 1OIWA 2AK3A 2P6RA 3QPWA 2VSFA 3AUYA 2AXPA 1WBBA 4MGZR 1ZD9A 5JSZB 4AG5A 1G1MA 2OBMA 4DJTA 4S2EA 4B3XA 1Z6YA 4JVMA 3TR0A 4X8OA 1Y63A 2CHVA 3T61A 4E09A 3KJEA 1NVVQ 4Q1FA 3CZPA 1XNJA 2H5EA 3B60A 2ZR7A 2IYYA 2IYSA 2ZI6A 3OFNA 3EW9A 2A5FA 3VNVA 2PH1A 4B43A 4ACBA 4BRWA 1RJ9A 2FGJA 4XSGA 5CIQA 1JAHA 2AD1A 2C77A 2IYRA 2BMJA 3L43A 1R6BX 3RS5A 1XCPA 4Z1MD 1CRQA 2W0MA 1N5JA 1PZNA 2CEAA 1OW3B 1WP9A 1HEIA 1P75A 1QHXA 3EARA 1NJGA 2VF7A 1RC8A 2H18A 4ESHA 2RB4A 3FKSD 1W1WA 1GILA 4TSFA 5HCIA 3PENA 4P4SB 1RYHA 3QF4B 4DC9A 1EFCA 2J0UA 2BV3A 4QBGB 1KOFA 1W0KD 4JBYA 3VR1A 3OFND 4LV6A 4EUNA 1OHHA 4PHHA 1NSFA 2KWIA 4B35A 1YZUA 2V1XA 3P27A 1S9HA 2GJAA 3ZVRA 2N42A 2CDNA 3BFXA 1H8ED 5KO2A 2HLDA 2QRZA 2IYXA 1G6HA 3EAQA 2Q3MA 3RLFA 2XTMA 1Q1QA 1TPZA 3MJHA 1XWIA 2CHQA 3WNBA 1B23P 3K09C 4N0EA 1NVUQ 1T0JB 3KB2A 1RRCA 2F3RA 3H4MA 3ZH9B 1ZC3A 2ZJZA 4DUGA 3UMFA 4TLCA 1W49A 3T1VA 3MAAC 4C0KA 4L9WA 4KITB 1QHGA 2HJVA 5G53C 4PC1A 2DB3A 2YOGA 4TL9A 1YZKA 4EPWA 1QDEA 2KSQA 2OILA 1VDZA 2GILA 3RHFA 2QL6A 3BIFA 3S1AA 3B13B 3EPLA 3LH5A 3QVVA 3GMTA 3LX8A 1UKEA 2CBZA 3DDCA 3FHTA 5K8UA 1GSIA 4RSGA 1NKSA 2OCPA 1G3RA 2QTHA 3B82A 4G5QA 4XJXA 3O47A 5FH9A 4K46A 3NH9A 4MYHA 2VH5R 4HB3A 4IDHA 1IN4A 1X3SA 1NVVR 3EA0A 1WB9A 3K8YA 5G3YA 2A5GA 2G1JA 3AV0B 5DO9A 3MJRA 4AWXA 2F43A 2CLSA 1LVGA 521PA 3BB1A 1SGWA 5L3QB 1U8YA 1KAOA 4V0KA 4BUJA 1E0JA 4FCTA 3X1DA 4MRPA 4I1UA 1NP6A 3W8NA 1JQLB 4IDNA 2XNSA 1MR3F 5TARA 4GPTA 5DHFA 1HT1E 3FPAA 2C5LA 2H1LA 3BD9A 1TQDA 4LHWA 4HATA 4FN5A 2WWIA 3VKHA 3GLIB 5LB4A 3B8HA 4FINA 1L4UA 1U94A 5FPSA 4LPSA 3FFBA 2E1RA 2Z4RA 1OXUA 1E3MA 3ZD7A 1M34E 2CE2X 1G17A 4MITA 3FFAA 1W36C 4XWKA 3AM1A 4TYPA 2XOKA 1E4YA 5CM8B 1KO4A 2B7BA 2C78A 2QM7A 4Q1CA 4JVLA 1DBSA 2FH5B 2J5XA 3X1ZA 1CF4A 1K5GA 3JVUA 1MO6A 2OM2A 1UM8A 2BCJQ 1W4AA 1XXHA 3W3AA 3PFIA 2C95A 2VIIA 1ZYUA 3GLIA 1Z28A 3BGWA 1F2TA 1X1RA 3EC1A 2QUZA 3IHLA 4M1OA 4HB4A 3SN6A 1ZU5A 5FFMA 2CK3A 1D9ZA 5CYPA 3CH5A 4HB2A 1BS1A 4NYIR 1HT2E 3TAUA 3TR5A 3A58B 3AKCA 3AF3A 3BB4A 4IW3B 4URYR 4WXPA 1ZM4A 2CK3D 1S8FA 4A92A 1EXMA 3MRSA 3NXSA 4B48A 2ZXUA 4DZZA 2HXSA 3GQBA 4NCNA 3K0EA 1EFHA 3AVUA 4B3DA 3LX5A 3GLGA 1ANKA 5KPJA 5EXTA 3DOEA 4M1SA 1NJFA 3DM9B 2AL7A 3V4RA 4LV5B 3P26A 2JJ1D 1ODFA 1G3IA 4OYHA 5AR1A 3U60B 4JLAA 2O8BB 3CPJB 1COWA 1A7JA 1KYIA 1I2MA 3KDSE 4M1YA 4OQLA 3V9PA 4LGMA 2ZJBA 4O2RA 2W6JA 1G4AE 4LZZA 3VTKA 1YZTA 1U90A 4CF7A 3NKVA 1AM4D 3THYB 3KUDA 2UKDA 3IUYA 1E9AA 4G0NA 5FR1A 1DE0A 5E7IA 4DLVA 2ZS7A 4TL6A 4BFUA 2KBEA 3U7EB 1G7SA 1IHUA 3IPYA 1Z47A 1Z2CA 4V0MA 3THWA 3TJZA 5CJPA 4L9SA 3SYNA 1Q1BA 5FBQB 4EFMA 4MKHA 2HYDA 1JNYA 3R9WA 1ZP6A 2BBWA 3AGPA 4Q9IA 2GEUA 2ZUDA 5KSZA 3FDIA 2HF8A 4AYXA 3BOSA 3OF5A 4MRVA 3OEED 3I5YA 2D74A 1KK3A 1EX7A 4B74A 3HR7A 1K5DA 3QY0A 4Z51A 1SVKA 2DBYA 2W58A 2ZSBA 1G18A 2QM8A 4P4SA 4RCYA 3QVUA 3RRMA 4DDVA 4JLVA 4JVSB 3THYA 3GEEA 1DADA 3VMFA 2XAUA 1XTSA 4C0LA 1NG9A 4LY6A 1EESA 3VKGA 5J4HA 1XPRA 1T5IA 2BBOA 3OEHD 3VU9B 3WMGA 3J81k 3AVOA 2RGAA 3TK1A 2O8BA 1CJTC 2CMKA 3U6KA 1VCIA 4AD8A 5JECA 2NOAA 5EZ5A 1CU1A 1S1CA 1X8KA 4C3ZA 1IXSB 2A30A 721PA 3AF1A 3AB3A 4LBWA 2WSMA 3CRW1 4NMMA 4V0OA 4JSTA 1KJYA 2G0NA 3UANA 3GLFE 5FTNA 4GP6A 4B3GA 1FZQA 4K8OA 2YWGA 4H1UA 2RHMA 3A1UA 4KFTA 4U7DA 2IS1A 2G6BA 4DHEA 3RRZA 3BS4A 3D8BA 3ZGXA 2WWYA 1PUIA 5DNYB 2Z43A 4LHYA 2NMVA 1G3UA 1U98A 3ND9A 4D0LB 1N2CE 1W2HA 2DHRA 3A4LA 2ASEA 3AH8A 1SXJC 4D6PA 1OF1A 3NG1A 4NKRA 1Q3HA 2FPMA 1P2UA 3JVVA 3GFOA 3NWJA 2W2TA 2ZR0A 5DI3A 5TY0A 4OJQA 1UKZA 3EZ7A 4BWYA 1XCMA 3EZ6A 5JZVA 1UAAA 5CLQA 4TT3D 5L3RA 1UJ2A 4IDQA 1EFRD 5KNCA 3WP0A 5EE9A 2W6JD 1MO3A 4RCZA 1GAJA 4QHYA 3AVXA 3QXJA 1F5NA 4II7A 5BN5A 3I8XA 2R65A 1W7AA 2QQEA 1GFIA 3W34A 2V9PA 1WRBA 4HZUA 3ADDA 2C99A 2FEOA 1G19A 6Q21A 1QVRA 5D3QA 4CT4B 3HYRA 2WAYA 3RRNA 5JCZA 4DB4A 4ZCIA 1S3SA 2N1BA 4Q7JB 5CB6A 2ORIA 4NCIA 5JLJA 3SJZA 1U0LA 1UDWA 3BWDD 4BGDA 4PC3A 1X8JA 3KTAB 1CULC 4A15A 2IUSA 2XXAB 4PSVA 3AVWA 3KZ1E 2ZYWX 2QRNA 1XMJA 5JS7A 5SZIA 1OKKD 4JYCA 4M0LA 2EFGA 1E0SA 5F3WB 4DB2A 1OH5A 4A1FA 3LBIA 3AP2A 3K0CA 3ZZUA 4TZ0A 4PC2A 3U3MA 3DEFA 3P32A 2RKOA 2QGZA 5F2EA 5BW8A 4UXHA 1M2OB 3GJXC 1N6HA 4Q5IA 2BOVA 3P20A 1CR2A 3RABA 1ZU4A 2VP5A 4OHVA 3KJIA 3MMPA 4RD0A 4QFMA 1KO7A 4Q4HA 4B32A 4NCHA 3VR2A 4D26A 1N6LA 2O5VA 3CX8A 2NO0A 5IK2A 3TKLA 3EZ9A 1OFIA 1IQPA 4FD2A 4ZDWA 2ZVPX 4G3XA 1ESNA 5TVKA 2IUTA 1UKYA 3HU1A 1EK0A 2GXSA 3WBKA 2FX3A 4WOPA 3B1XA 1RIFA 1I4DD 2JLWA 2DFTA 2X2EA 3Q5DA 1ZD8A 1GNQA 4HAWA 1QHNA 4FWIB 3QPUA 4Q66C 2HUPA 3PUXA 4CGZA 4HDCA 3UXMA 3RNLA 3ZVLA 3Q9LA 4Q7MB 5TB5A 3SJAA 3I32A 2OSBA 4C0BA 3U2QA 5JRZA 1OXVA 4OK6A 3K9GA 1JB1A 2IT1A 3RYTC 1ELOA 2VP4A 2FDCA 1T3LA 4B34A 2PJRA 2DY1A 2JJ2A 2WZQA 5GJVC 3D3QA 4CEHA 4WZ6A 1BO6A 1Z6GA 4EPRA 2FFBA 4HAXA 4TQAA 2GAOA 3R9XA 2VRWA 1NY5A 3GEHA 4C2UA 1BOFA 3GFTA 3LO5A 4E07A 1OYYA 4JLJA 3QKTA 3ZLJA 1EGAA 1M7GA 2FSIA 5FBLB 1RFLA 1NL3A 2GXUA 2GNOA 3FMPB 3GD7A 1S2MA 1NLZA 4U00A 4HDQB 1E2MA 1P72A 2D62A 2QT1A 2IF0A 1FP7A 3MD0A 1L7VC 3K0SA 1LNZA 3UWOA 1R2QA 1T8TA 1DVRA 3QBTA 4BFVA 1TL7C 4PPNA 2FA9A 2ANCA 1KSHA 4KYUA 4R2HA 3VHXA 3IIMA 4IOMA 4MYTA 5FOUA 2DFNA 5JJIA 2O0HA 3K0CC 4QGAA 1BKDR 2AD5A 1CJVC 4A8JB 2J3EA 2OFWA 3SHWA 2C9CA 3A4NA 4IFEA 1P2SA 5A4JA 2GESA 5J4KA 2AFHE 3RRYA 4DLTA 1YR6A 3NDBB 3SQWA 4RZUA 1A82A 1II9A 5FOSA 4TYYA 5AJZA 5EE1A 4MH0R 2QMEA 3BXZA 2UZ3A 1H8EA 4P31A 4CW7A 5JSZA 3GCGA 2C9YA 3DHWC 3AVYA 3ZQJA 4V02A 2Q21A 2IYLD 3K9LA 4JJZA 3SBEA 3NBYC 3OHMA 3WYGA 1W5TA 2A3RA 2ZRBA 2OFXA 1FX0A 2C9OA 2BBSA 5BYKA 1XCGB 1KI6B 2GJ9A 3Q5EA 4UNSA 3TSZA 3AKDA 4JMPA 5DHAA 5JI2E 2WBLC 4JSYA 3IQWA 5B2ZA 4DLWA 1JALA 2AFIE 4TYWA 1JPJA 4N3NA 2BMDA 1VYTA 5C4GB 4A0GA 3FMIA 4DEYA 2X2FA 4GOKA 1UPTA 3VAAA 1VPLA 1RPZA 4D25A 2ZU0C 2O8CA 2WPDD 5FL3A 2GBLA 5L3SA 4XTRA 2QE7A 2ZJ5A 1XTJA 4US0R 1NVWQ 4IKEA 2BEJA 1CR1A 1T6NA 4QGGA 4DSOA 4LCBA 3FMFA 1F6BA 3OIUA 1GIAA 5CLLA 1SVWA 2WWHA 2GETA 1NN1A 2JIZA 2P6NA 1KSGA 2Y8EA 2HF9A 1W48A 5HR5A 5BQ5A 4JT2A 2YOHA 4S35A 1CR4A 1G9XA 3BC1A 4BEBA 4QBHA 3LW8A 3LA6A 3PJRA 4NPHA 1PV4A 2HXYA 1EWQA 1OHHD 1N6OA 1L8QA 1XPUA 4BLTA 1CKEA 3KQNA 2V4ZA 1GRRA 1QHSA 5EXPA 2IYUA 3I72A 5B64A 3KKMA 3CH4B 3RVBA 3ICQB 2EW1A 3NEJA 5E7MA 3M1IA 3QKRA 1UDXA 1GOTA 4R7ZA 3RS2A 4B75A 4TSFD 4BEJA 3QKUA 1GM5A 4ZI3A 1BIFA 4AY2A 1Q44A 5HKKA 3L82B 4NYIQ 2ZRKA 3O8RA 3KJGA 2JLYA 3OEHA 4PZZA 5KDOA 1BH2A 2GCOA 4HSEA 4B6EA 2ZTSA 1A4RA 5TDHA 2ZSFA 3QOFA 4YONB 5KNDA 1IJEA 3HWSA 1HA3A 1E1QD 2FZ4A 5AJVB 5M04A 3RC8A 5KNBA 1G8HA 3NIBA 2Q9CA 5AJYA 3NBFA 5LD2B 2OO7A 3K1JA 4ZIRB 4IOJA 3C5HA 5KOYA 2X19A 2A5YB 2IBMA 5DLQC 4ZV4A 4ZCLA 2CL6X 2DYKA 4Q00A 4BFSA 1CBUA 1J70A 1RRGA 3CNNA 1XTRA 1SXJE 1T5LA 3LWNA 1GNPA 4BZQA 2AKYA 1E0KA 3U61B 2J0VA 3NC1C 1E2JA 3DVLA 3HP1A 1B0UA 2B6HA 3QENA 4WAUA 3K9HA 1I4TD 2QMUA 4AKGA 3ECCA 2QTFA 1ZM9A 1P5ZB 1I2DA 5J40A 5LD2C 4YMSA 4BFTA 1SKYB 2I3BA 1NRJB 3UK6A 4R71A 2WKPA 4EQ6B 5K8TA 1PLLA 1DELA 2GZHA 1S96A 2ZJAA 3W5JA 1IJFA 1ONBA 5FPKA 4M8NE 3D31A 4LJAA 3VHLB 4A0RA 2IS4A 2QN6A 2ZRDA 1AA9A 4DEXA 1KI8A 4QNMA 5EJEA 4EFLA 2CLDX 2C96A 4LJ7A 2VP6A 3W5IA 1E79D 5FI1B 2OBLA 2G0TA 1FUUA 3F8TA 3WY9A 2RCNA 2ZI5A 3FKQA 3LXRA 1XFAA 1P2TA 4DRZA 1W47A 3AGQA 1L4YA 2JJ2D 2A5DA 1WBDA 1C1YA 3LQRA 4OQXA 4JKIA 4IFBA 1H65A 2FV8A 1MV5A 1T3SA 1D2MA 2PL3A 2JAQA 2WHXA 4YMVA 1Q1ZA 1US8A 3OIVA 1W36D 2I1VB 3GJ0A 2L0XA 4HAUA 4B71A 4PSKA 2GJSA 4FIDA 1KO5A 5E7JA 4C30A 3KQLA 2QGNA 1FOEB 2BMEA 3L0SA 4GDFA 2P2LA 3MGCA 1OJLA 2R6DA 4QXAA 4B73A 3LY5A 1IY1A 1Z29A 3KL4A 4ABYA 4GFDA 4CRWB 4IVQA 2MMCA 3U7HB 4KLZA 4IDPA 5D3MB 4DLXA 2VHUA 2IL1A 2B92A 4DVGA 1YR8A 5FL7D 5FOTA 3SJCA 1Q21A 4BFYA 4R98A 3CRRA 4P32A 3GJ3A 1FFHA 2XZLA 3I5XA 2NG1A 2GDJA 4GT1A 2MSDB 1E2FA 2QPTA 2ZROA 5CITA 4LX0A 3R7WB 3EX7C 5IDVA 4DDTA 1IBRA 2G88A 4RZXA 3CWZA 4IDOA 1D5CA 4Q1AA 1NI3A 1S4QA 2ZRJA 4R9UC 1R0WA 5AUOB 5C1BA 1VG0B 1NG1A 2OXCA 1RE0A 2IHYA 4BLOA 3X1XA 1MABA 4LJYA 2QY9A 4HUQB 2BKEA 4PHTA 2VHTA 4V0NA 4BPBA 4QJ3A 3BJIC 2BHRA 2QT0A 2IUUA 2X77A 4BZXA 1E2EA 3N2IA 4RD3A 2V8OA 2GJKA 1R8SA 2YC4C 1J7KA 4TQ9A 3ZVMA 1XD2B 4JL5A 5EE0A 1CTQA 2Q6TA 4L5BA 1KKMA 4EKDA 5EP4A 2PJZA 5KSYA 3TE6A 4G5SA 5DYGA 4A0HA 3DKVA 2HDNB 1E69A 1AN0A 2ZJOA 4JYBA 2IEYA 1ZIPA 2ZSAA 2XITA 2H17A 3HU3A 1R0YA 1YU9A 4JLNA 3GPLA 4ZPXA 4AYTA 1OB2A 1R0ZA 1YRAA 1F2UA 4XH9B 3W6NA 3EWAA 1J90A 1BMFA 4NP6A 1ZCAA 1K6MA 1NF3A 4BECA 4RD6A 2XSZA 1AS2A 1Q12A 4KV9A 2J46A 1IAQA 4NBSA 1DO2A 4RD2A 4FW9A 3K09A 2V6JA 4ZO4A 1E2PA 2CCJA 2OG2A 2G1KA 4M22A 2WTUA 3VR4A 2A2ZA 4TMZA 4FMDF 4ARZA 1XXHE 3AEZA 1U9IA 4EPYA 4NU0A 5DSZA 2C98A 1D8TA 3K0AA 4Q1DA 5DISB 4HLQB 4MUBA 5HZHA 3AKEA 1G21E 2BBTA 1YR7A 3C15C 1OFTA 4XD7D 4BLRA 1XEXB 1N0WA 2VHQA 3THXA 4MDEA 4BFWA 4QRHA 4J0QA 2YWEA 3I73A 2PX0A 4TL7A 1LFDB 2VHCA 1ZM7A 2GEVA 3CX6A 4GZLA 4D80A 3QQ5A 2NO6A 2RGCA 4Q02A 5JS8A 3LQQA 1J2JA 2CLCX 4A82A 3DMNA 3QSYA 3KXKA 3OE7A 4LHXA 1GVNB 5FTJA 2CL0X 2OEPA 4Q4AA 4G5RA 4ASUD 1ZNWA 1GKYA 4G01B 4QGFA 1TQ4A 2FG5A 1AKYA 1KI2A 2FFHA 2ZANA 3B5JA 3O8DA 1ESMA 1KSJA 2MMGA 5F9FA 1Z0AA 2G77B 1IXZA 1M7HA 4PZLA 3QXCA 5G41A 221PA 4YDHB 3X1YA 5UKDA 1VYVA 2CJWB 4Z54A 3GLHE 3MLEA 4KAXA 3PUWA 3UMSA 4OQNA 2QAGB 3NEYA 3R9IA 4JVNA 1JI0A 2PT7A 4Q03A 1ZIOA 4OK5A 2ZR9A 3GFPA 1AZTA 3GLHB 2V55B 2OESA 3AF0A 2F1HA 1VG1A 1JECA 4M4SA 1R10A 2D7DA 4MGKR 1OH8A 2O8DA 2YWFA 1G16A 3GLHA 1P7CA 4JLDA 1CS4C 4MA4A 4O0MA 4ZKEA 4TMTA 2ZM5A 1SVLA 5JFGA 3CLVA 1FPMA 1TUIA 2QE7D 4RZ2A 1EFUA 4RD1A 1CRPA 2I4IA 2D06A 2RMKA 1UF9A 2CJWA 2F7SA 2VEDA 1AQYA 1E98A 4KI0A 4XSHA 5KPDA 3IBGA 1NBMA 1CXZA 3UWKA 1XEWY 2ZI9A 3QJYA 1IM2A 2JLRA 2ZSEA 4DT1B 1CP2A 2GA8A 5FPTA 1HQYE 2OXRA 3VFDA 4TT3A 1C4OA 3B1YA 3BRWD 3QUSA 3EASA 2QAJA 3UG6A 1IN6A 1DG1G 2ZRLA 4KU4A 4Q4AB 2ZJ8A 4GSYA 1D2NA 2QPAA 4A2PA 2IA5A 1E2NA 3DO6A 4D82A 2V7QA 3LBHA 4P4TA 1FQKA 4I81A 1A2KC 3TW8B 2PMKA 3W8RA 1Z83A 1SULA 2KJQA 4D4JA 1LY1A 5H8WA 1PVOA 121PA 3F3YA 5LBIA 2ZJYA 1ZJ6A 4TLBA 4CEJA 2AX4A 2WOOA 3C14C 3E1SA 3TW4A 4XD7A 4ZDIA 4W5WA 5AUQA 4IEEA 1DO0A 4W5HA 1N6KA 1XTKA 2ZYUX 4AKIA 1G8GA 1ZUIA 2CNWA 2Z4SA 4JBWA 4EPVA 4ERNA 4RY2A 2ORWA 2ZYTX 2FN4A 3CF6R 4EJSA 3IEUA 2O0JA 1KMHB 2OHFA 2J0SA 3Q72A 3KKQA 3L2OB 3ZZTA 3EC2A 1W5SA 3K0FB 4LSGA 4PAMA 2WV9A 4ZCMA 3T35A 2QMHA 2HLDD 1KAGA 1A5TA 2WJIA 3BH0A 4MKFA 4IXNA 1DAMA 1E9CA 1SVMA 1XDBA 4B3CA 5K8IA 2WM9B 1TEXA 2W2VA 3T1QA 1F2UB 4IXMA 4UJ3A 2R62A 4CEIA 2F6RA 4KODA 3IBYA 5G40A 5H70A 2WIAA 1UFQA 1AJEA 1KJZA 2V3CC 4AYWA 2QTVB 4PX9A 2FPLA 3VR5A 3K70D 1IONA 2ATVA 2GWHA 5C2JB 2ZEJA 4DLUA 2IYQA 3FKSA 1V5WA 3K0FA 4YXWD 4CIDA 1N5LA 1ZUNB 2ZQ5A 4MQBA 1XD2A 2Z5FA 2QSZA 2O0KA 1TQ2A 2OBNA 1KMHA 2ZE7A 3N2EA 621PA 1E9EA 4EJSB 4G1UC 3PEWA 2ZS8A 1MH1A 2XGJA 3CNOA 4HZIA 1WQ1R 5EE3A 4HUQA 4POAA 1Z0DA 3MG9A 4H9GA 4PO8A 1N3BA 2JEOA 4HAVA 3HDTA 1IN7A 3AVTA 2QORA 3LVRE 2P5TB 3A36A 4LRWA 2BWJA 1UKVY 1KY2A 3QG1A 421PA 4CEJB 4EIWA 3LBNA 2KBFA 1FW6A 4YMTA 1KK0A 3Q7PA 2ERXA 4X8LA 4FCWA 4I1VA 4BE7B 3W6OA 2ZVQX 4KJZA 4EJSC 1E2GA 1SZPA 2FMXA 3SC3A 5IK2D 1NIJA 1OH7A 2MSEB 3B1WA 5DIFA 5ANRB 4OK3A 4P33A 4MKIA 4MYCA 4W7SA 4WVFA 4X8MA 3SYLA 4DT1A 4E5UA 2V54A 4DLYA 3B7GA 5HTKA 3EPHA 1ZNXA 2GKSA 3CR8A 2QMOA 2XNDD 4DCSA 5FBWB 5LPNA 1XJCA 2RH5A 3Q8XB 3HPRA 4UNPA 1TUEA 1N6RA 4ESVA 3H2YA 3IEVA 3PV0A 1PUJA 4DUGD 5B57C 2ATXA 2QENA 4KHZA 3WMFA 1HQCA 3GP8A 4A36A 4DSNA 1E79A 2H92A 4NE2A 5EUQB 1AGRA 4UQOA 2PLFA 4Q9KA 1XEFA 3TSOA 3QXHA 3NTUA 2YOFA 4BQSA 1E99A 2ZRNA 3U44A 4OKSA 4LJ9A 4GOJA 1NNEA 2OFOA 1NLYA 3H0KA 4F91B 2WWWA 1S0UA 1G5PA 4JS0A 4XOIA 2YVUA 1TADA 2YWHA 3K70B 3SQXA 2WSSA 1SVOA 1L2TA 5KSPA 1YQTA 4U5XA 4UXJA 2J41A 1UEJA 2F3TA 2WJVA 4JLOA 4RFSB 1BYIA 1UBCA 3CWQA 4UNNA 4EPXA 2EFCB 1T0HB 2GJ8A 2QSYA 4JL6A 4B2IA 4FMBB 5CDFE 3T06B 3PUVA 2ANBA 3CRQA 4KFSA 4NL4H 4PFSA 4XIGS 2ZI3A 4G5OA 3C7KA 4IJMA 1XJQA 3PVSA 2REOA 4QOSA 2WKRA 4WZAE 4HLDA 3JZMA 2W0SA 4LYAA 5C4MA 2XJ9A 1Z0IA 4HLUA 4F4CA 1ZD1A 3EA5A 4XTCS 1KMQA 2ZRMA 5C18A 4LJ4A 4QHTA 1LTQA 5JEEA 2NZ8A 4PQRA 3CF0A 2R6CA 2JLVA 5AWFC 2Q9BA 2P67A 1LV7A 3QKSB 1NSTA 1XEXA 4Q19A 5FUVA 2ZSDA 1ZMXA 1QF9A 3LLMA 4KVAA 3TUZC 4US2R 3SZRA 1E1RA 1VCMA 3RWOA 3P4YA 1SXJA 2VTKA 3K0AB 2WWGA 2AHOA 2KI5A 1JEDA 2ONJA 5SZJA 5E95A 4LJ6A 1VMAA 4LYFA 3HPQA 4DLRA 1X6VA 1QHHA 3VX3A 2NIPA 4D4MA 1OPXA 1A2BA 4QM6A 3BB3A 3ETLA 2PZGA 4WW0A 3CKLA 5FPHA 5FI0B 4JT4A 2XEXA 2BM0A 2EVWX 2EFEB 3M4YA 3R8FA 2ZRIA 4UXIA 2VL7A 1IY2A 2FEMA 2ZJ2A 2FZLA 1WCV1 2VQSA 2IXEA 3H1TA 4DLSA 1MKYA 3PEUA 4UKDA 1N6NA 1CLUA 1T8UA 1QG2A 3MWKA 3SBDA 4PTLA 1CEEA 3WP1B 1VECA 3FB4A 1JR6A 1IXRC 1ZAKA 3L0IB 1E4VA 2Z6VA 1WE2A 2VPPA 3I61A 2CL7X 1SXJD 2FU5C 2PLRA 4D2IA 5HPYB 1R5OA 2NGRA 2IC5A 4FWTA 3TRFA 3QKRB 3CRMA 3IDQA 2GF0A 1G7CA 1AS0A 4TYQA 3GLIE 1FUKA 4BZPA 1O87A 3CR7A 3A1SA 3CRVA 3NDPA 4OHWA 2ODNA 4A2WA 5JJLA 2NO1A 3B85A 5B30A 3VR3A 1II8A 3EIHA 3PUYA 4NCKA 2GVDC 4BFXA 3R8CA 2JDIA 3PEVA 1U0JA 2BIFA 1X8LA 1VYUA 3I3SR 3A6PC 1R8QA 4TTPA 2OAP1 4KYIB 5FBRB 5FTMA 5KU1A 5AJXA 4MYUA 4F4IA 1P3JA 5GJCA 2XOKD 5SZKB 1SXJB 5CDFA 3T12A 1TU3A 4N0DA 4CVNA 2HCBA 1GITA 3DOFA 2QA5A 4KSBA 2RGXA 4L16A 2AXNA 2O8FB 4URZR 2PEYA 4BLQA 3TH5A 2F9LA 4PAOA 3Q7QA 5TXGA 3A37A 1OH6A 1GKIA 4I4LA 2JGNA 2ZPTX 3K53A 1FMLA 4LWZA 1KIMA 3K9NA 1OB5A 2FJUA 1KDRA 4NYMQ 3CBQA 3ZS8A 4M2LA 4ITRC 4TQUS 3EPKA 2JDID 1M74A 4M9QA 2ERYA 4GI7A 3TSWA 1KI7A 5CYOA 1EFTA 1M7BA 1OV4A 3CB4A 3KX2A 2RAPA 1GP2A 3B6EA 4O2LA 3RSOA 2NPFA 3KQKA 2O8EB 1E2DA 1OXSC 2RGDA 3D6TB 1GKUB 4QBFA 1YRBA 1YZQA 3R20A 4Q7KA 4EPTA 3IPXA 4C0SA 3MUFA 4DCTA 3TAHA 1G7TA 1T4GA 1T9HA 1US8B 3AUXA 3MCAA 1FNMA 4DKXA 2XB2A 1NY6A 4DBLC 2V1UA 2FFAA 4B44A 2IS2A 1NMXA 2V7QD 4F7WA 3LNCA 2C2HA 2J7KA 2BJVA 4DCUA 2PX3A 3T34A 4A8JA 2ZAMA 1GNRA 3FWYA 3U44B 2QG6A 3LD9A 4XWAA 3WRYC 2YKGA 3MSXA 1P60A 4XVQA 2WSSD 4R2IA 2DWOA 1VG9B 2F9MA 4JIMA 1OT3A 1S1MA 2IHBA 1FQJA 1RRPA 2RGBA 3B9QA 4M1KA 5G3ZA 1MT0A 5CM9C 1XTQA 4LYJA 3KFVA 4LHVA 2GXAA 1P73A 5H1YA 2ZRHA 3AQ4A 3RWMB 5FUYA 2ZUBA 2O8EA 3NC0C 1KNXA 3SOPA 2G3YA 2DPXA 1Q57A 4YMWA 3LFUA 2B7CA 4OL0A 3KQHA 2AR7A 3SEAA 2HT6A 1FP6A 4P3YA 1SQ5A 5JMTA 4Q48A 3ZQ6A 4B2PA 4AKEA 3O8BA 1XD9A 2GZDA 2BCGY 5DYIA 4URVR 1FMJA 4C0AC 1E2HA 2QQ0A 2H16A 4JLKA 2OLKA 5J47A 4QBIA 1OE0A 2V6IA 2O8FA 3OEEA 2FNAA 4DDUA 2WPDA 4ILEA 4PQFA 5DN6A 4NHOA 1JJVA 5GJWC 1F3OA 2GAAA 1G5RA 4FI3C 2BJWA 1OKKA 1Q0UA 3IQXA 3LW7A 4PHFA 3VR6A 1P9RA 1NN3A 3Q85A 3ZIAA 4B3FX 1OYWA 4WXRA 3M6AA 5J4LA 1P61B 1E2LA 1GWNA 5TV2A 2LKCA 4ZIRA 1QHYA 1II8B 2RGGA 1HY3A 1CJUC 3JZAA 5JJKA 4CYMA 2CNWD 1ZM3A 1X86B 4ACAA 4KFUA 4ASUA 5EP1A 2J9RA 2KE5A 3BORA 5JHGB 1VHTA 2F1RA 2R44A 4LYHA 4EFNA 3AVVA 1VCOA 1N6PA 3PIRA 3LDAA 4JBXA 2OLJA 3FYHA 1CJKC 1U0HC 3BH7A 3G82C 4D81A 3DZDA 3RAPR 5EXXA 4D4LA 4Z1MA 2ZE8A 5CK4A 1UBFA 1FTNA 2F1JA 3A8TA 1KTVA 3NVAA 1M6NA 5GVRA 4BFZA 3CPHA 2YHSA 1HURA 1XZPA 2QP9X 1GRNA 2QROA 4A0FA 4GRAA 4L4UA 1KDTA 4CEIB 1ZUHA 1OFUX 3U5ZB 4TTQA 1KJWA 2DFLA 2AN9A 2W00A 4LC1A 4RD4A 1Z6AA 2OCYC 4QL3A 5BN3A 4MDFA 1IN8A 1E1QA 5DI9A 3FMOB 2FFQA 1G4UR 1Z0KA 4PHGA 1J8MF 3GJ4A 2FWRA 3SHFA 3W90A 1V43A 1KI9A 1KDPA 3L0PA 4LBVA 4AIIA 1QHHB 2XNDA 4HI0E 4DSUA 4IOLA 3KTAA 2KB0A 1KI4A 3OIWA 4B2LA 4OJKA 1YZNA 2ZU6A 2EYUA 1G291 1VHLA 1XEWX 2QPOA 1F48A 1N5KA 4GMXA 4IHQA 4Q4LA 2IK8A 1YKSA 2RGEA 2IF2A 2BEKA 2NTYC 2ZYVX 3PR1A 4JLPA 4OI1A 5B58C 5GVSA 1Z2AA 4OI2A 1MRSA 3QKSA 2BM1A 3B2EA 5KUTA 4LOAA 2HJGA 2B8TA 2JCSA 1BMFD 2WOJA 1E94E 2ZI4A 3QEJA 2DCUA 2QZ4A 4Z8XA 4PPFA 1DG3A 1EFRA 2NO7A 3P4XA 2J7PD 4OI4A 2EWWA 4M53A 3DL0A 3M0EA 4NYJR 5CK5A 3RDPA 5BWMA 4YDSA 5DI3B 5DN6D 1E0AA 2P65A 2HT1A 1KI6A 1O3YA 3KXIA 1AS3A 1U81A 1Z07A 4K81B 1R5NA 4LBYA 1Q20A 2WWFA 3CPEA 4TLAA 4V0ME 3BERA 1LF0A 2GTPA 2OE2A 1DAEA 2J59A 2WJJA 4OQFA 5FOXA 1XJ0A 4DDWA 3DKPA 3KKNA 4LBZA 4RFSA 4C0HA 1AQUA 2J1LA 3C16C 2OCBA 5BN4A 1YZGA 3UPUA 3CO5A 2B21A 3AP3A 4QGHA 3VQTA 4YQFA 2ZRCA 2EFHB 3QEOA 4G5GA 1UEIA 3I1FA 4ON9A 4IOKA 4IEIA 4TLDA 1P9WA 2OV2A 4LC0A 2H57A 1NIPA 5A5GA 1XPOA 3PQCA 2O8DB 1DTSA 2LWIA 4JLMA 4Q1EA 1UADA 2VP0A 4TMVA 1JPNA 2IYZA 3ZS9A 1XMVA 1TF5A 3L0OA 1N6IA 1DAFA 3D7MA 1HYQA 1Z06A 4KCGA 2W6ID 2H7VA 1VG8A 2PZEA 4TYNA 1AGPA 4KFRA 3AF2A 2CXXA 2H8KA 3HJNA 1VIAA 3B78A 5EP3A 1N5IA 2JLSA 1JEEA 4HDOB 4YMUA 4NDZA 1R0XA 1P6XA 2GRJA 4Q21A 1RW4A 3PG5A 4NTZA 5IT5A 4O3MA 3T1OA 1P62B 1Z0JA 1E9RA 3SFZA 4B47A 5HZKA 4C9BA 1DEKA 3I92A 5SZHB 1GL9B 1H8HD 3U3OA 4BASA 3W6PA 1ZM2A 4FMCB 4KVGA 4TWZA 1ETUA 5AJWA 5FOVA 2WJGA 3FHOA 5EXSA 3WYAA 1G8YA 3RS7A 1OIXA 2FSFA 1OLOA 4RJLA 1RRFA 4FMCF 4PQYA 3UATA 2EYQA 1Z08A 3VNUA 2IEZA 4A6PA 3SDZA 4YXWA 3WNDA 5JBQA 3ADCA 2W2XA 1U8ZA 2LKDA 3TVDA 3W9YA 3THWB 2ZRFA 4TMXA 1NMZA 2N46A 2NO9A 4F93B 3SI7A 3ZD6A 4AURA 1DS6A 3ZYCA 1Q1EA 5KTYA 3EG5A 4I99A 4MRSA 2G9NA 4DXAA 2VP9A 1HE8B 3PCRB 3RS0A 1HTWA 2NPIA 4NYJQ 2J87A 3T5GA 4M9ZA 2GVZC 4E03A 5KHOC 1XMSA 2D3WA 3H86A 3E70C 4C0QC 2PZFA 1HUQA 1P2VA 3UMRA 4PXAA 1JR3A 2YINC 2TMKA 4QJ5A 4Q9JA 2IWRA 3VX4A 5ELXA 4OHYA 4GMDA 2QP3A 2ZETA 5JWOA 1KI1A 1FTSA 3CM0A 1IY0A 1NLFA 3CZQA 4Q4HB 1TTTA 1RKBA 2R6GA 5E3HA 5EQTA 3QI2A 2AK2A 1MRNA 3GLGB 1MO5A 2JA1A 3REFA 2WMOB 2VYFA 2CCKA 3T1TA 4PC7A 4Y0AA 1P9NA 3I4LA 1S9DA 3ZZ0A 3PXGA 3OAAD 5FUXA 5GADl 4BRUA 1KGDA 3RC3A 4Q01A 4QC2A 5J4YA 4URWR 1LB1B 4DWJA 3WNCA 1DAHA 3MWYW 2VP2A 1I4LD 1QVAA 2AKAB 4DLZA 2R2AA 3SU8A 1E96A 4PO1A 3GJ5A 5BXQC 5C46F 3ADBA 3N5CA 5KDLA 1GL6A 1IOZA 1KSFX 2REXB 1F2TB 3SR0A 1A1VA 1DAGA 2ZI7A 1J8YF 3MWJA 2FSGA 1G5TA 2ZRPA 4EDHA 2ODBA 2XB4A 2QNRA 4F4JA 1NN5A 5AUPB 1ZINA 2ZE6A 3FTQA 4HLCA 4DIDA 3G5UA 3KB1A 2E87A 3MFYA 1FNNA 4HYYA 1JBKA 4Q1BA 4XWOA 3EPJA 2ZREA 3HR8A 3SJBA 4PC6A 4TN1A 4UJ5A 3REGA 4V03A 2IWHA 4LPKA 2XZPA 3WHKA 1ZCBA 2VF8A 3H84A 4Y0VA 1YR9A 5FPYA 3EIQA 1H8HA 1AZSC 3CX7A 2GF9A 4X8HA 2GZAA 2BMFA 4LI0A 2JLXA 1XD8A 1T3HA 2Q3FA 3SYKA 1II0A 3WHLA 2WJHA 1G3QA 1GG2A 1JJ7A 2PCLA 2BDTA 2FF7A 2R8RA 4QJ4A 2CVFA 5D3MA 821PA 4JL8A 1W0JA 1ZNYA 2VBCA 4XVRA 1JXMA 4GL2A 2ORVA 3PEYA 4A8JC 3QBVA 3BH6A 3B1ZA 2CCGA 5F98A 5L3QA 3WYFA 3FGNA 4NYMR 4WA7A 1D6JA 1P4SA 2R9VA 2A5JA 3EXAA 4FMDB 4B6FA 1WMSA 2BKUA 2FOLA 3AVPA 4KSCA 1G3MA 2IYTA 3PUZA 4Q47A 1Z63A 4OQMA 2ZE5A 1BYUA 4KLNA 1ZRHA 1Z5ZA 1RVDA 1QHIA 2ZRGA 4O25A 4B3BA 5TMPA 5KDDA 4NZYA 5FOWA 1G8FA 3QPVA 1E2KA 3F5FA 2IW3A 2ZRAA 1E9DA 3A4MA 2DWPA 5KYKA 1U99A 2IS6A 4L8GA 3ZJYA 1KO8A 1OXXK 2GXQA 1KI3A 5JI3E 4DCVA 4WZBE 2PBRA 1VTKA 3E2IA 2O52A 1F60A 4TL8A 3S1AB 3ZVNA 3WRXC 3IO3A 3C5CA 2QAGA 3VU9A 1Z8FA 3BFVA 1KKLA 1YE8A 2NZJA 1Y3AA 2K5UA 5A0FA 3EWSA 2ODWA 4P0TA 4C4PA 5L3VA 2P3SA 3UKDA 3L8ZA 4LJ5A 2JATA 5DH9A 5DGXA 3GEIA 5H68A 3OESA 1MOZA 3GJ7A 3AVQA 4WBSA 4HEJA 3GJ6A 1W0KA 2F1IA 2JIZD 5FTKA 1GDDA 2FPKA 2YYZA 4OHZA 4RFVA 2ZITA 2Q9AA 2EFDB 4MGIR 4D4KA 2WVJA 2I1QA 4A4DA 3FOZA 2WKQA 1Q22A 1Z3IX 5CIWA 1TQ6A 2G83A 1DARA 5J5CA 1PLKA 3THOA 3ZDQA 2REBA 3AKYA 4MUAA 4A6XA 1KZ7B 3CIOA 3GLGE 2VO1A 2A78A 1XF9A 3X2SA 1U8AA 3A1WA 1WXQA 2GCNA 2D4HA 3THXB 3TQCA 2J0UB 5CB8A 5F9HA 1AIPA 2E9SA 3RS4A 1M1YE 1PJRA 2XX3A 4LHZA 4M9SA 4QG7A 1GL7A 4M1MA 3SFVA 3BFKA 4NCJA 4EAQA 1U2RA 3I8SA 2P5SA 1EG7A 2JJ1A 2IXGA 3CNLA 3LVQE 1FL9A 1N0VC 2QU8A 4P4UA 3RANA 4ARZB 3VKWA 1CIPA 2WIBA 3FE2A 4M9XA 2PMDA 3OAAA 3OIYA 3QXSA 3KQUA 4GBMA 1QZXA 4WIAA 1G64A 1QG4A 4QHSA 2IXFA 3LXXA 1YVDA 2J7PA 5J4VA 1TEVA 2A9KA 4TLEA 3SE0A 4C0JA 1KZGB 4JZKA 2RGNC 3ASZA 3U7GA 3LRPA 4HAYA 1TF2A 2CVHA 5BYJA 3C4JA 2XSZD 3ADKA 2EU8A 4UNRA 4LUCA 5JWRA 4HUTA 2WWXA 2VSXA 1E2QA 4FXPA 3TVTA 4W9MC 4D0NA 4ZDJA 2Q0HA 1W46A 2UZIR 2ECKA 2QEQA 1U9IC 3EZ2A 4F92B 2C04A 2HYIC 2QAGC 2FGKA 2XTNA 1K8RA 1KO1A 5E4FA 5P21A 3NBXX 3KKOA 3QE0A 3IIJA 5DE3A 4A9AA 2MSCB 1N25A 4A2QA 2OUKA 3SNHA 2HCJB 2HEIA 4Q9LA 5IF9A 2XZOA 2NQ2C 3EZFA 2PCJA 2AWOA 1WDTA 1DAIA 3DMDA 2CE7A 2AWNA 3IO5A 3ONWA 3U6BA 2GBLC 1D2EA 2YJTD 3FVQA 1YJ5A 3NHBA 2JLZA 5FL7A 4RKEA 5JEDA 2YNMA 3BE4A 3CW2A 2YC2C 4MGYR 2HV8A 1SVIA 1LW7A 1SHKA 3TLXA 4MRRA 1JXOA 1OXTA 1PLJA 1NN0A 1MABB 3HYTA 3QNUA 1DPFA 4PANA 1XXHB 4UNQA 5FUWA 5IRCD 4DIEA 4HLUC 3SS8A 4OBEA 4URXR 4CT5A 4PPGA 8OHMA 2W6IA 1VCNA 4PPQA 1W0JD 5HCNA 1DAKA 2CHGA 5AUNB 5CJ2A 2QBYB 3AP1A 3R7WA 1YZLA 2EQBA 1G41A 1T91A 3U4QA 2R6FA 1ZW6A 5L3SB 4I1OA 1LS6A 1E6CA 3KKPA 3P1JA 4ZKDA 3T15A 2A7QA 1GUAA 3NH6A 1SHZA 4TMWA 3IHWA 2Z0MA 2QP4A 1E9SA 2JLUA 4IRUB 3RSLA 1M8PA 3F0TA 4JLBA 3T5DA 5JCPA 1G8PA 1XB2A 1VKJA 5EE5B 2XJ4A 4U02A 2IYVA 3AF4A 3U3KA 4CZ2A 1E9BA 3B1VA 2B8WA 2VHJA 3ZIAD 3DZ8A 1AK2A 4Q7LA 5LDDC 2F43B 2XTZA 4ZDKA 4HB0A 3LV8A 1E1RD 4YC7A 1KK1A 1NKTA 4CDGA 4Z8YA 4E22A 1HV8A 1OSNA 1ZNZA 2Z83A 3I62A 1OFHA 2PT5A 2D2EA 1CR0A 1VIYA 4PSAA 4QNRA 3HU2A 3GLFA 4IVRA 4Q4JB 1JQJC 4HAZA 4AKHA 5HKKD 1ZVQA 2GK7A 3QIAA 3N70A 5JHHB 1AKEA 1S3GA 2OCAA 4XVUA 3QF7A 1QBKC 3IKJA 3CF2A 3EIEA 2GK6A 3NBZC 3OZXA 1D9XA 4C7OA 3ICEA 1E2IA 2DR3A 2X8AA 3MWLA 3TGPA 4M1TA 3CONA 2J0QA 1XZQA 1GRQA 2DWQA 3A1TA 3GJ8A 1QRAA 1TX4B 4QM7A 3L8YA 1E9FA 2WAXA 1Z22A 3TUIC 4AG6A 2JASA 1NBME 2OZEA 3Q3JB 4L15A 4AI6A 3TBKA 1Q3TA 1W4BA 1TMKA 1TF7A 1HE1C 2GHIA 4PR0A 3KFXA 2EWVA 4TMKA 1W4RA 3WBJA 1XMIA 3IILA 1UBEA 4JKYA 4C2TA 1C9KA 2WICA 2P6UA 4EQ6A 2X1VA 3O8CA 1ZC4A 1NMYA 2ZS9A 4YLGA 2ONKA 2FE4A 2QI9C 4IVPA 1LS1A 1R7RA 3TNFA 4Q18A 4CEHB 3LLUA 4NH0A 3WXMA 2WJYA 3QF4A 2YZ2A 1XBTA 4TTRA 2JLQA 1LF5A 4KBFA 5LB2A 2UVQA 1SKQA 4PO9A 5IHPA 4W5JA 2ZIAA 4MKGA 4AC9A 5EUMA 2C8VA
chains in the Genus database with same CATH superfamily
4U0KA 2VSNA 3U3JA 3G8CA 5HDQA 1KIAA 3EHEA 2VKQA 3ZNPA 3WLSA 3QUAA 4Q4DA 1K0UA 4RCVA 3UTCA 1RAGA 2VYCA 4O2AA 3QPAA 1CNEA 1IATA 1JWAB 4YV0A 3A1VA 4DR6B 4F38A 4RKFA 1Z5GA 3TUJC 2I2AA 5FA6A 2GCOB 1VBMA 1ZBDA 2P1RA 3ES9A 1YS4A 1WJGA 2ZBPA 1M2VB 1A3CA 2VA8A 5HSGA 1G7RA 2PWAA 3TIFA 1FSPA 4DSAA 2H4XA 4GWGA 1O89A 1CJMA 1URPA 4PVCA 4H6VA 5D2CA 1NBEA 4ZCQA 5AK0A 1J8QA 3G2HA 5ARDA 5JV5A 5U9CA 4TZ6A 4TKMA 1USWA 3F71A 1HH4A 1WOYA 3MIIA 1AE1A 5DTEA 1NVXQ 1P29A 1TYEB 1GTVA 1U7OA 1NBMD 3KKZA 3PL1A 5BSHA 2DAPA 3KUCA 1L7NA 2JJ8A 5LLTA 4KVFA 3H5AA 3Q8MA 1M75A 1VSBA 3ICVA 1YJCA 2NSYA 2PX4A 2HJSA 2CLKB 2CFSA 3BK7A 1UBGA 4D0GA 2AVNA 3CUEF 4DFDA 5AVXA 4R01A 1R5BA 1XFDA 2QV7A 3DO8A 3KJHA 2EIHA 1K66A 4YRPA 1V3VA 2UUAB 4QTXA 4WASA 4BLSA 1BMQA 1T9DA 3GBVA 3IIKA 3JD1A 1QV7A 1KP3A 3V4VB 3DNPA 1RYFA 4JGIA 2HBZA 2PRZA 3KXLA 4J1SA 2ZK7A 4IXDA 1OFUA 3W8DA 1PYOA 3ZDDA 4Z4IA 3JQ7B 2P0EA 1R9JA 1SAYA 4IQ4A 6AT1A 3BAFA 4NJMB 5L8VA 4JELA 1LSOA 4RJJA 2QL5A 1UP6A 3DH0A 3U3RA 1XP8A 4OQ4A 4PFJA 1A95A 3U4QB 1D8AA 2D2FA 5C5CA 1Z63A 1PYGA 3LT0A 4H2DA 4X6LA 4KUEA 3DM5A 2G8NA 4DYVA 1KHTA 3NYWA 1YHNA 3BGOS 4OU5A 1UZMA 5K9ZA 5GJBA 3I76A 4LV8B 3HI6A 4DGQA 4DZTA 4K6FA 1VFNA 2W2KA 2ODEA 5A6SB 1W2GA 1X1SA 1T3TA 1DOAA 3UG7A 3FZYA 1G6OA 3TOXA 1UFRA 2BHSA 3WGUA 1NQTA 3QG5A 1J2EA 3LQ2A 4I9HA 4RXMA 2H2GA 5K3FA 1JAIA 1XCBA 3TZQA 1WZUA 4MXDA 4O1HA 1WF3A 3ZK7A 1TCBA 2RHCA 4Z5XA 1F0KA 1SVSA 1TGYA 3ONNA 3U7FB 1OZHA 2Q3HA 1RWMA 2G8LA 3Q98A 1WOMA 2K7FA 1JT9A 2Q28A 2VR1A 1XHLA 2CFCA 3NPAA 3OQPA 4MJ7A 5EA2A 1Q2XA 3AUYA 4DA9A 5EIFA 5JSZB 4Q3BA 4JJFA 1S2GA 4QDTA 5FPPA 3D6FA 3F7MA 4S2EA 4NK4A 3DWEX 4N12A 3AG6A 4JVMA 3BCSA 1YBVA 3IAS6 3PGKA 3RSSA 1BOOA 4PLVA 1EWKA 4N41A 2CHVA 1DRUA 1MG5A 1R50A 1K3FA 1TA9A 3S68A 1NVVQ 6REQB 5CXUA 2NXJA 3ZDCA 1JNXX 2IYYA 1DIAA 5JD5A 16PKA 2A5FA 1WSAA 3SQLA 2PH1A 3X43A 2A1TR 2VT7A 5GM2A 2B36A 4WK2B 1RJ9A 2HIGA 4E32A 5K0CA 2QVGA 4IIYA 5CBPB 4MSUA 4CIBA 4ZO9A 2FFJA 1R9GA 1V47A 4J0GA 4FKZA 4FXOA 3L43A 5D86A 5LVAA 4IV8A 1N1MA 3VNUA 3RS5A 4LDRA 1XCPA 5HGJA 4RXUA 3TTUA 2W0MA 3UNXA 1AO0A 1TM3E 3SXUA 4I19A 3N7TA 5CLIA 3RC1A 2XE8A 3VR4D 2CLLB 5DKFA 3VMMA 1HEIA 3W5AA 3O1HB 4KDRA 2WB2A 2YXDA 2RB4A 4ZTUB 2KLBA 1SOVA 5I9BA 2XV1A 4P4SB 3WIVA 4ZCTA 1VCHA 1F06A 1VJCA 4XSVA 4QBGB 5JU6A 1PU2A 2NV2B 1PTKA 1V48A 4JBYA 3VR1A 1KYWA 5FWXB 5EHIA 3W3AD 1AB6A 3D8TA 2BELA 4LV6A 4C89A 4DM7A 4JP1A 1BXKA 4UFNA 1Z7WA 4D02A 3WYCA 1K27A 2V1XA 3I52A 1S9HA 5BSVA 3IDOA 3KQQA 4K0KB 3BFXA 2XVYA 3DF7A 2JGRA 3IOBA 3S2UA 1ZIXA 4E88A 3RLFA 1G6HA 2WT4A 2Q3MA 2BZSA 2NVWA 3MJHA 3PVZA 4I1PA 3M1LA 2XVXA 4N0EA 1LRKA 4HAIA 3SC2B 1C0IA 3SZOA 4ZI7A 5LJLA 2IIBA 3HRHA 1ULSA 1TLTA 1LC0A 2F3RA 5SY9A 4AJHA 1BVHA 2EJBA 3QEAZ 1WDLA 3LDFA 3AESA 4RVGA 2CLMB 3D7RA 3FTDA 3MZ0A 3DB1A 2OV6A 4P35A 3IPCA 2C2OA 1A9XA 2G1PA 4KITB 1QHGA 1ECCA 3I5AA 1LPOA 4PC1A 4ROSA 4CCYB 1CUVA 2YOGA 3T9BA 4QTUB 5C1DA 1V0JA 4EPWA 2KSQA 1J21A 2HBRA 2QL6A 4BATA 5HBRA 1B42A 1MAWA 3Q2IA 1CZLA 1NVKA 3QVVA 4S0ZA 5A0TA 2BFBA 3T1NA 3DDCA 5JIBA 2DQSA 2JGFA 4H4CA 2ZUTA 4X63A 5LUAA 3B3GA 4H31A 2QTHA 4G5QA 1M10A 2FOXA 1J09A 5BR8B 1QYWA 4HB3A 3HJRA 1X3SA 3U7RA 3OLWA 3K8YA 5G3YA 1TE2A 3NFRA 1AG9A 3F6RA 5KTTA 5BQOA 1SH7A 3SOZA 5HHTA 4MIOA 4FFWA 2F43A 2H0RA 4KNYA 1EQ2A 1RBQA 3BB1A 2QUJA 5CB4B 4FN4A 1H9BA 2ZUSA 3GDHA 4LTNA 1K9SA 3UMVA 4YP5A 2YHBA 1JP7A 3H8VA 3L7CA 5IFKA 2PSFA 4IIXA 3GB9A 2P3OA 1OY1A 1FRVA 1MR3F 1Y1QA 5TARA 1RQXA 4GPTA 4RL4A 2NACA 2XWJI 2Z09A 4K6CA 5CNIA 1CT9A 4NR0A 1ENPA 3F6PA 3KQMA 5EJ4A 3I0NA 5AVSA 2HU2A 1L7XA 4MX8A 2LVBA 2WWIA 2CDRA 2AC7A 4TT8A 2LBPA 4GVLA 1YFJA 4IDEA 1EVLA 1GTL1 4LN1A 3DYVA 4JWKA 4LPSA 4RIFA 1EPUA 2E1RA 2YJ5A 1IHYA 4FR2A 1OXUA 1IBMB 4ZALA 1E3MA 1L7OA 2CE2X 2V0NA 3QTBA 2BRUC 3TZBA 4B8YA 1VPVA 3FFAA 1KEWA 1W36C 5LYYA 4OP1A 3ZY4A 4XWKA 1HNWB 4TYPA 1ZOIA 1HNXB 3LYUA 5BN5B 1GKLA 1N8SA 1KO4A 3LDHA 2GT1A 2QM7A 3QE4A 2OA0A 1RM0A 4CUZA 3IULA 1K5GA 5EHNA 2V4UA 2OM2A 3K9QO 1XXHA 3PFIA 3GG2A 2C95A 2JAHA 2W22A 3L8FA 1ZYUA 1PGOA 4EECA 5J63A 5FLXA 4ZO6A 3QLJA 4OHUA 4KL8S 3RG2A 5BNWA 1OLXA 2ZAGA 5BNIA 4UE2A 1U2DA 2PHZA 1N1GA 2I29A 1X1RA 4JCCA 1JPUA 4QUBA 2QUZA 2E85A 3IHLA 3UH1A 2CLEB 2HNBA 3LUAA 5I3CA 1LK5A 3AEUA 3Q6NA 4J4TA 1V71A 4JVOA 4DKJA 1K8XB 5CYPA 5E1DA 2O2JA 4JUBA 3ABIA 1BS1A 2O20A 4HB2A 3T7KA 4NYIR 1SOAA 3TAUA 3SEZA 4HN2A 1A2QA 3A58B 3BB4A 5CB4A 1L7BA 1ZCZA 2K87A 2HJHA 4XX1A 3HB9A 13PKA 1ZVMA 3CTPA 3B48A 1BHJA 1PZFA 4Q93A 1RDFA 3HBJA 5E0OA 4FYPA 3RIXA 4CFZA 1EINA 1O94D 1X14A 3I9MA 5HS6A 3ZIDA 1JE1A 1E92A 1X80A 4MW4A 3ZWQA 3MBIA 1J0AA 3UUGA 1I36A 4Y1EA 4P22A 4M1SA 4G1BA 4EDFA 2QMQA 2FEAA 4UOZA 4LGVA 5DBIA 5ITSA 1G3IA 4N6GA 4OYHA 4KXMA 1JKJB 3DTNA 2F1KA 1SD5A 4JLAA 4D8UA 5FUMA 3U60B 1IM5A 5DZSA 5F7ZA 2A35A 1EWVA 3HB1A 5EZYB 1PN3A 1VMDA 1KYIA 1SU8A 1ENZA 5TT0A 3NHFA 3OTGA 4LGMA 4BX3A 3M6LA 4O2RA 2W6JA 5DCWA 1SCAA 2FWNA 4G0UA 2I66A 1V5IA 2K7ZA 2Z9CA 5DGIA 3U1TA 3NKVA 2ZYHA 2BFCB 3SF8B 4AKSA 2WF5A 4WNAB 5T4BA 5CTJA 3S6JA 2CWDA 2ORYA 3IUYA 1U7ZA 3NHKA 4L74A 4QJBA 4LHSA 1O03A 5F21A 4TL6A 1BVYF 2Q3LA 2PSDA 3IP5A 4GI1A 4BFUA 3NR2A 1IHUA 3PDUA 3IPYA 4JASB 2II6A 3LBFA 1Z47A 3TJZA 3QX3A 2VH2A 1Y1TA 1B73A 3NUZA 4H4EA 4LQLA 5CJPA 5E7QA 1Q1BA 5G4KA 1HFJA 1Z13A 4MKHA 1GTJ1 1RXWA 3R9WA 1ZP6A 2BBWA 4UBNA 4QWMA 5KTNA 3PE4A 1XALA 3RAFC 4DMGA 4HXGA 4DY4A 2X1LA 3TDKA 2WHEA 3P0FA 1KS9A 3QMWA 3E3LA 2O3QA 3FDIA 4NS4A 2GSDA 1VLJA 3K1TA 4M0DA 4ZQGA 3OF5A 3Q10A 1GEGA 3PPYA 3RUFA 4L8VA 1BXGB 1ISJA 3CC8A 5FOQA 4W1RA 4B74A 1K5DA 3A1NA 1VM6A 2DBYA 2QB5A 1REQB 2W58A 3SS9X 4BNYA 1G18A 4P4SA 4RPKA 1CUIA 1DGQA 5AW3A 2C57A 3OFSA 2C0PA 2VJMB 4DGSA 1F8YA 2AG6A 2ZBUA 3DEYX 3GEEA 3VMFA 3VKGA 1EESA 5IXYA 2G09A 3VYUB 1UANA 2BBOA 1P74A 3K6JA 3OEHD 3RSCA 3VU9B 2Q29A 1CFZA 2FHPA 2RGAA 3ZXXA 2B1IA 4EO4A 4NG4A 2DBRA 2X3YA 5FI5A 3U6KA 3OETA 2FN8A 5JECA 2NOAA 1E1NA 3EOZA 1HM5A 2IH2A 1NX9A 4HNVA 4LBWA 5AW1A 4C05A 2WSMA 3CRW1 4BNIA 4EEKA 2R1VB 3BTOA 3GZJA 4FSDA 3RU9A 5ABPA 5FQNA 1S3FA 4PR3A 2PPVA 2GWRA 1P19A 5AICA 1FZQA 3GPBA 4K8OA 3DAGA 2D1RA 4RADA 4U7DA 2PANA 4DABA 3HCRA 4DPMA 4UUAA 1CRWG 3E1GA 1A4XA 2Q41A 3D8BA 4JJ8A 1KERA 3ZGXA 2WWYA 3AR7A 1G8MA 2Z43A 4AAYA 3HDYA 2D0DA 3UT5A 5GIOE 2NMVA 1L7DA 1G3UA 3AU8A 4JC5A 1MA0A 1JPVA 3ND9A 3TD9A 5DWDA 5A0VA 1CRZA 4AZ3B 2ASEA 1FNBA 4N03A 2FCAA 1G63A 4RGBA 1N5OX 1RM4A 2MJLA 2VWQA 5CT5A 1FJGB 1UQUA 5LDGA 1OF1A 1HEUA 2I1WA 4NKRA 1Q3HA 2P7HA 3KJQA 2OZLA 2FPMA 3JVVA 4E2XA 5LYJF 5DI3A 2GRAA 3VNRA 5CCXA 4WNYA 3PWTA 3UT0A 1YMVA 2EJVA 1DP4A 2YS7A 4OJQA 4OQQA 3FAZA 5K3FB 4H4DA 3EAGA 4FE7A 3EZ6A 5JZVA 1PL6A 1XTUA 4MS4A 5CLQA 2NUAB 4MJ3A 5L3RA 4IDQA 1EFRD 1N77A 1WETA 1R6UA 2PRIA 2W6JD 3E7WA 1MO3A 2W2KB 3ILHA 1GAJA 3U1BA 2JIQA 2R00C 4N5MA 5LL6P 4WBNF 2DMRA 3QXJA 1F5NA 1LQTA 5TQ0B 3GJQA 3I8XA 4NEQA 1HLGA 1W7AA 3V32A 1DTWA 2QQEA 1NVTA 5BSGA 3PUKA 3W34A 2OXIA 2V9PA 3K30A 1WRBA 2JCVA 3VKVA 3TJMA 1FYDA 4QPPA 1P17A 1VA4A 4KREA 4MGHA 5JT1A 4DB4A 2FDRA 4ZCIA 5CT8A 3H9UA 1S3SA 2N1BA 2FKNA 2VG8A 3PUJA 4IUBS 4MIYA 1F2VA 5K0NA 2AC2A 4BDTA 5GZ3A 4UU0A 2WHYA 3UBMA 3BWDD 2Y05A 3JPYA 3KTAB 4XZ3A 2CSUA 3A04A 1STOA 4A15A 1CUDA 1KYYA 3A3PA 2YVAA 4FEAA 2KS6A 3RVKA 4BX8A 5CGZA 4EBFA 4YRGA 3KZ1E 2ZYWX 4NI5A 3IUBA 3DWGA 1LPBB 1OKKD 5SZIA 2JAOA 2W2LA 3OD1A 1IZ8A 5F9MA 4M0LA 3OCZA 5F64A 2VHWA 2BN4A 2DFPA 3S4YA 3LBIA 4Z7NB 2PKQP 5A4KA 2YHUA 1E3EA 4PC2A 3JZFA 1WXHA 2YXNA 4WNIA 5BW8A 4OY3A 4OU4A 3FNQA 3DPIA 2QTCA 1FRFS 4FLFA 4Z4CA 3L1IA 3RABA 3WGIA 1P8AA 1QCZA 5DTIA 1EM6A 4YN3A 3VPAA 2UU9B 3QY9A 5F76A 2RI6A 2G25A 3T9DA 1M2VA 2VDVE 2O5VA 2RJ3A 2NO0A 2ISCA 3CX8A 4JA0A 2FWAA 5IK2A 3F73A 3RC7A 1R0BA 1K7FB 2ZVPX 3EMBA 5KNDD 4UREA 3N1UA 2Q0SA 1BW9B 4M0UA 3AZOA 3OSZA 3VZBA 3NW9A 5HKAA 2AXQA 3HU1A 5EJIA 4K9NA 1JL3A 3OKFA 1TM4E 4WOPA 1RIFA 3DEZA 4LOHA 3B70A 3W1VA 3ZK9A 2PQ2A 4C6TA 3T9EA 4R1TA 4XUCA 1NUHA 2NUPB 3BMCA 4GQIA 4XQ9A 3Q5DA 4R2KA 2ZIGA 3FOAA 1U3WA 1FTGA 5TJHA 5JQWA 3P19A 2JG3A 3R5FA 1LRLA 3PUXA 5IJ0A 5KTSA 4CGZA 1HLDA 3I05A 2DPMA 4HDCA 3Q9LA 4Q7MB 1USGA 5KMGB 1TJNA 3IR7A 2CXTA 2OSBA 1WD7A 3KEOA 3PE3A 5ESDA 3U2QA 1OXVA 1RC0A 3K9GA 1NBHA 3RIHA 1KAQA 3AB7A 3PPWA 2VP4A 4B34A 4U63A 2PJRA 3TNDA 1QUFA 2XZTA 1PQWA 2H9AA 2DFVA 4Q34A 5GJVC 5A05A 5TJ9A 3G9UA 3WHIA 3ZCPA 4R1UA 3GRKA 3IOCA 3PRKE 1JMVA 3OPMA 2DUNA 1DTEA 3EGXB 2O05A 4JJGA 1RD4A 5CVCA 2AQIA 4HN9A 4F11A 4HCJA 1X1EA 2X3UA 3HK2A 3NETA 5AKKA 3A70A 4CDRA 1EGAA 1M7GA 1XHFA 5FBLB 1GLGA 2GXUA 3G0BA 3V1LA 1YIDA 3VR5D 2GASA 3QEKA 1MZVA 1NJ6A 2D62A 2E48A 2QT1A 4GE0A 4BVFA 1BEEA 4TQGA 1UL1X 3GA0A 1V41E 4TPKA 2ZT8A 2R1ZA 1EDEA 2JRLA 1NDUA 3H05A 1GDTA 1GAQA 1Q74A 5LWQA 3HVKA 4AROA 2ANCA 3KWJA 4KYUA 3KSMA 2IYPA 1YVPA 3VBEA 3IIMA 1KDYA 1YV9A 1DKMA 4HK4A 1WQ4A 4N7JA 2EC5A 3PNPA 4EITA 1E5XA 2D5AA 3MPOA 2YY5A 2G04A 3D6NB 3OOJA 2ZUVA 2OFWA 5EWMA 2C9CA 2YH2A 3SHWA 4AMBA 4HNAA 4WTOA 5HW0A 4UMDA 1ATIA 3FD8A 3NDBB 3JW8A 2R96A 4KO1S 3OPVA 1JDBB 4MUIA 5J58A 3SQWA 1II9A 2OORC 4AU1A 3FUTA 3ML1A 3WGTA 1K88A 2E1PA 5AJZA 1GTG1 4N7RA 2QMEA 1OBFO 5EE1A 3S7ZA 3BWCA 3L7IA 3WLRA 2PUGA 3S81A 1WMEA 1BA2A 2BGTA 4K5QA 2GFIA 3GCGA 3H8WA 4MTLA 4YAEA 2C9YA 3DHWC 5H82A 1B74A 1XPJA 2IYLD 4UAJA 3NBYC 1W5TA 2A3RA 2I4NA 2J08A 4BVEA 1FX0A 2I7CA 1ZIDA 5I9TA 1A97A 1FK8A 2BBSA 4HWPA 3RYFA 4AFNA 1PSDA 2JHFA 3INRA 3TSZA 4UNSA 2WU0A 4C4AA 2HOQA 2XDQA 4M9CA 3KAQA 2GD2A 2WBLC 3H18A 1FBNA 3HUTA 3PHIA 2XMCA 1QH1B 1VL0A 5ER9A 3BWVA 4PG6A 2XRFA 2ZFUA 4A1OA 4EX7A 1VKOA 1LA2A 1DIGA 2H31A 2EG5A 4RVSA 3ZV5A 3EIUA 4AJPA 5CA0B 1VYTA 4R31A 1V6AA 3ZK8A 1AQNA 1X2BA 4R5MA 4P83A 4FFNA 5F5XA 1L8OA 4GW3A 4HQ0A 3UYLA 1VBFA 3L5KA 3AC0A 4D25A 2P1ZA 5FL3A 1LPPA 2GBLA 4MA5A 2R2GA 3ENZA 4XTRA 3IR5A 2CJPA 1P0IA 5LQJA 1WEKA 1H6CA 1OBVA 2QE7A 4ZRDA 5HYVA 1NVWQ 5EVCA 2BEJA 5L51A 4DF3A 2HR1A 3A3NA 1W1UA 4EW3A 3G6WA 1RIIA 5F1OA 1J1IA 1RWQA 2B4KA 4X1IA 4KQEA 3RU7A 3NO4A 4K3VA 4DADA 3GROA 2Y8EA 3MGBA 1K6IA 3WZLA 5ICSA 2PQ6A 4DLLA 2PNJA 3KDPA 3DNFA 1KEVA 3I5MA 4S35A 3VU1A 5KVCA 4TLLB 4O8ZA 4QBHA 1K89A 4TV8B 3AJ9A 3LW8A 1JXAA 3LA6A 4MVYA 1IJKA 2DBVO 1AB5A 1DJQA 2JHGA 3MUEA 3QVTA 4KGXA 1O95C 4MV8A 4NPHA 4DVJA 3HACA 6LDHA 3U9SA 1QPBA 3CW9A 1CKEA 5CU7A 1RLOA 2YKGA 2V4ZA 4MHTA 1NASA 2IOQA 2IYUA 3I72A 4FHEA 1CLEA 1A9PA 5H83A 5TR9A 1RWWA 3HH8A 4Y2GA 3M1IA 3VV3A 2IXAA 3QPBA 5BP7A 1FDWA 3K15A 5FV7A 1X7WB 1QG0A 1I1OA 4TSFD 3QKUA 3VZDA 2B25A 4BEJA 4D7AA 1GM5A 4ZI3A 4GLBA 1MVNA 4OD0A 2B83A 4GVPA 2FPXA 5HKKA 2ESRA 4WOBA 2ZRKA 2H11A 3BZBA 2PNFA 4AS2A 3O8RA 2JLYA 1PRYA 5KOIA 3I6ZA 4NOJA 4ZTZB 2PM8A 3O2QB 1GYPA 3DC7A 3C5EA 1PDVA 1A4RA 4MI9A 2VOEA 3USES 6PFKA 4IIEA 3HWSA 3N2KB 2AI3A 4RUKA 5M04A 1VMIA 5LYJB 1YUNA 2H0QA 3LKDA 4UEKA 1SUEA 4MCHA 4RGQA 4GI2A 5LD2B 1VHJA 2FP3A 1ORHA 3K1JA 3OQHA 5KOYA 3L8MA 2OHVA 1OLSA 2IBMA 1ZW1A 2IPLA 4XQCA 4O4IB 2QZSA 1H2XA 1O77A 1J70A 2NPOA 2WU4A 4HAOA 3MCUA 3UCXA 1IB0A 4P86A 2AKYA 2FN3A 2J0VA 1PEKE 2C7QA 1XMXA 3NC1C 3D7LA 4G65A 3K6KA 2HK6A 4WAUA 1VLZA 4AL4A 3OLZA 1X7DA 4CKBB 3V7NA 1PNOA 4QRIA 3WK7A 2PXHA 3ODPA 1L5OA 4KN8A 2VQ3A 2EKDA 2NSHA 2X2OA 2WE8A 2FWBA 5H16A 3VI3B 3MJSA 1ODKA 4D96A 1JYEA 4HGOA 4WKBA 2C9MA 5TEWA 4YMSA 4JSRA 3PE6A 4KW7A 2E3JA 3PDJA 1JDPA 3SFTA 4R71A 2XT6A 4YNBA 3HXMA 3L4BC 4CL8A 5CFNA 5BQFA 1Q0LA 3PUIA 4MUGA 2J32A 3D8NA 4CMHA 4F46A 4C03A 1QZ3A 1YB1A 4CL2A 3M1YA 2EEZA 3DMPA 4DYDA 3WC4A 3GA7A 3C4VA 1ONBA 2C1XA 1T35A 4V0SA 5FPKA 3AHGA 3AK4A 1PDWA 1L5FA 2IS4A 2UXBB 1MX3A 5AM5A 4DEXA 2YJNA 3A0RB 1DX4A 3MTQA 3OLXA 4JU8A 3VC2A 1ZLYA 2CLDX 3BSYA 2C96A 3LX6A 3W5IA 3IS3A 3DDUA 3KJNA 4X20A 5JXWA 1DRWA 3CMMA 1RI1A 1AF4A 2ID8A 4I8XA 1YZVA 4OMFG 4YJHB 1TK3A 4TYYA 2RCNA 2ZI5A 4L8WB 2QDKA 5DHPA 3E1KA 5DOVA 3S70A 1L4YA 1NU6A 1V45E 2JJ2D 4MW6A 4OQXA 3ED5A 4M3NA 2TMYA 4IFBA 4E5MA 2HHHB 2OV8A 1FS4A 1MV5A 1D2MA 2EJTA 3BA1A 1UT6A 3AOEA 3UQYS 3W7AA 3AJEA 4ID3A 4QXPA 1W36D 3QUBA 2ZWAA 2HN9A 2VJKA 3G02A 2EWMA 2L0XA 1BE6A 3MWGA 2HA3A 4HAUA 1X39A 3OLVA 1U5CA 2GO7A 2ZWIA 1PHRA 5E7JA 3TXYA 3KQLA 3V8PA 4HYTA 3QBEA 1AXEA 4KTTE 2FQXA 3L0SA 3QITA 4GDFA 2IFTA 1VGQA 5AVYA 4Q3LA 4K40A 4YRJA 3MHTA 3M4XA 3KL4A 4W6ZA 2OY0A 4N47A 3T94A 1O6BA 1OGJA 3UWPA 4PTYA 1W8IA 2W6PA 1TCVA 3OMXA 1TO6A 4IVQA 3AZQA 4NSNA 3PLAE 3IAAA 3SAJA 1L1RA 4WVLA 5LQUA 4NENB 3INGA 1W19A 1Y3BE 2V9ZA 4YRCA 4GPBA 2VHUA 4IG9A 2IL1A 1FP2A 1L4BA 5IYZB 2WJ4A 3JQFC 2IXTA 1NFQA 1Y0BA 4R98A 3CRRA 1DCMA 1RWNA 4L51A 3IAS1 4P32A 1UDBA 1Q7TA 3SM3A 2X0DA 4YV7A 5K01A 4Y0NA 2NG1A 1YUBA 1T1IA 2GOYA 2JRCA 1A5BB 1E2FA 1GCOA 2MSDB 2BGRA 2ZROA 4IF4A 5KOHA 5TS3A 1R37A 5K6TA 4LX0A 4MMXB 1UXHA 3RRXA 3LKZA 3WLLA 1ORRA 1QYVA 2DLNA 4IDOA 1NI3A 1S4QA 1JKFA 1XZ8A 3M83A 4R9UC 1PWHA 1YXMA 2OKCA 3T0FA 3ZXUB 4S05A 1NG1A 1TAQA 2C2GA 4E2YA 2IHYA 4G37A 5KHAA 2CUKA 4Y6LA 1THMA 4EZEA 3E84A 2EGUA 1JLLB 4HUQB 4UBLA 3PUHA 4V0NA 1YCDA 3VPDA 3CX3A 3ZLUA 2BHRA 3O1IC 4DNPA 4QJ3A 3L7JA 2AFIB 1NW8A 2IUUA 4RHYA 3ZU6A 3VO2A 4RKYA 1N2HA 1ACMA 3MS7A 1EVYA 5F35A 1VKNA 1B8UA 1R8SA 1J7KA 1U2ZA 3K9WA 5EWLA 2C5EA 2XDWA 3H9CA 1X13A 3ZVMA 1ID1A 2OHGA 5JLAA 4RAQA 4YVFA 2M1XA 1LI7A 3NT2A 4C5BA 2IE0A 4C01A 5H9WA 5KSYA 1GPBA 2PS9A 3DL4A 3G2QA 3ZKWB 4C78A 3DXZA 1E69A 3LKVA 3OSUA 5D5PA 4P98A 2OYSA 1Z39A 2Y2UA 1ZIPA 5FHQA 1X0VA 2ZSAA 3L18A 5BRAA 2FR8A 2H17A 4IIGA 1OBOA 2ZWVA 2GAIA 4ZQEA 4TRJA 3H4IA 1XAJA 4H0CA 1A4IA 3TGLA 4LRTB 2IGBA 5E1MA 3VA7A 3GPLA 3JSAA 3QXGA 1OB2A 5I7EA 5I4IA 3B2QA 1QTNA 4HX9A 1BMFA 4BFLA 3ILVA 4KMMA 3U7QA 3P9IA 1TK9A 3GOHA 1AS2A 1XVUA 3DB2A 2C54A 4RD2A 4MROA 2W93A 1H23A 2E55A 4FW9A 1NDQA 1VXRA 5FUQA 3DLIA 1E7QA 3ZWVA 1JZSA 3E8SA 1E2PA 1I9CA 1ZMBA 3LTEA 4PQEA 4F3KA 5C5EA 2QW1A 2G1KA 4M22A 1MH9A 3B3AA 5JD6A 4KWHA 1IOVA 3P2JA 2GEBA 4FMDF 4ARZA 2ET6A 2VLBA 3ESRA 3U56A 3E5MA 5EKUA 3RREA 1YQQA 3YASA 1PAUA 4MPPA 2OPHA 5LP6F 1G20B 4HNRA 2V5UA 1G21E 3AR4A 5JYCA 1YI1A 3ZV7A 3C15C 2XIJA 1FTWA 2PA0A 5JYDA 4XD7D 3RYHB 4BLRA 4DBVO 4BFWA 1WIWA 2IOFK 4QRHA 3L6BA 3C85A 4PN3A 5DULA 2GEVA 4U7PB 3C1OA 1Y1LA 1SOWA 3MTGA 3QQ5A 4U2GA 5AM3A 5K8VA 5JS8A 3VH3A 1J2JA 2CLCX 4DCCA 8AT1A 2Z2ZA 3O73A 3VDMA 1P18A 2AF3C 1JFLA 1ND6A 3PFBA 5FTJA 3ZZMA 4EY5A 1SXIA 2NV6A 2OEPA 3LNTA 1E3SA 1NUUA 4GC5A 1SUFA 3G88A 4G01B 3V8MA 4ASUD 2RHGB 2FG5A 1XK6A 3DE0X 1VGVA 2ENUA 3UMJA 4HNGA 1L8XA 1QAOA 2WZBA 2R751 3EE6A 3L05A 3O8DA 4RESA 4X97A 4KR6A 1SPXA 4FGUA 5AOBA 1SCDA 1O0SA 3FBWA 1GR0A 3ZHBA 4E33A 4HUJA 3VXKA 221PA 3M34A 4KGVA 1PQYA 4U9IS 3FJ1A 2QN2A 3FYUC 3OIFA 3WLJA 3KZXA 3UMSA 2IVZA 3C8DA 5LKRA 3NKFA 5HM8A 3WS7A 3CURA 3R9IA 5IT4A 3EFOB 1WZNA 1L7PA 1ZIOA 3GFPA 1FC0A 1MHPA 3E7DA 3U4HA 3WE7A 4IYRA 2V55B 2XQIA 3CEMA 2I2CA 5CTAA 4O4LF 1Z0ZA 5ALZA 2W42A 2V03A 3AETA 1XMOB 1R10A 3NTOA 4LOLA 4EX6A 4U4AA 3QKIA 1RP7A 1OH8A 3V1KA 5ADUS 1CD5A 1G16A 3EH2A 3GLVA 4IQ8A 4O0MA 4ZKEA 4BO9A 4D6YA 1R66A 4TMTA 4BZWA 1M1ZA 4X66B 3TDNA 3CLVA 1FPMA 1TUIA 3CCFA 3KOMA 5KYGA 2QE7D 4K28A 1Y5MA 3N28A 2VDWA 3TX2A 4YCLA 3PC2A 2Q4EA 2R68A 4EMSA 3H5OA 4EMBA 3FFXA 3LUDA 2VEDA 1AQYA 4RDXA 1QQ7A 2CXOA 1PEAA 3RJTA 1NBMA 4JJIA 4XJTA 3VRHA 4UUOA 2ZI9A 1VSTA 2O1XA 3DOOA 5BMVF 2ST1A 1D2CA 1NOIA 2PV7A 3ETNA 5HX7A 1AC5A 3VC7A 1XTVA 4KQGA 1C4OA 1PL8A 4RZHA 2W8ZA 2LUOA 1Z4PX 3EASA 3LUFA 3QUSA 3G2PA 4ZQFA 5GONF 1ZMRA 3UG6A 4ZT4A 4Q4AB 5T64A 2ZJ8A 1ENYA 4HDNA 3N05A 2QPAA 4A2PA 5GAJA 1E2NA 5KAMA 4NFSA 2KW5A 3FAKA 3GY0A 2PMKA 1U11A 4AECA 3WL7A 4JGBA 2PE5A 1Z83A 1SULA 1YS9A 4BMPB 4KPYA 2IY8A 1PVOA 2XGMA 4AJ4A 121PA 3HUFA 1X8XA 4RU1A 3EODA 5DSXA 4XWYA 3WIUA 4DQKA 2AX4A 2WOOA 3Q5GA 4ZDIA 4W5WA 2ISSD 4WOKA 1MHTA 3K0HA 2WW8A 4B80A 1UJ5A 1Z9BA 3KT0A 4RTJA 1XTKA 3ZTYA 1EK2A 2BHNA 2ZYUX 3O82A 4HDRB 4QSHA 3JR3A 2IE8A 4JBWA 4KQJA 3HNOA 4DPLA 4IDCA 3C3AA 4RY2A 4MVCA 2O0JA 2QRJA 4ZI5A 2PSHA 2OHFA 4JEMA 3Q72A 3KKQA 1BQ3A 4EEXA 3LY8A 1TAHA 2YMPA 5IXSA 5IM4F 2JKZA 4PAMA 1U8UA 2WV9A 5LR6A 4ICIA 2PZBA 4U9UA 3T35A 2OHJA 4XCVA 4H59A 1M6VA 2J5RA 1A5TA 1PD1A 3CZAA 4MKFA 1UZUA 3K72B 1HDRA 4BO4A 5BURA 1SVMA 4B3CA 3VR0A 2JI8A 2XCRB 1XQXA 4I5FA 3U7IA 1PG2A 2W2VA 1FSFA 4IH4A 4IXMA 2I65A 1NQVA 3MINA 4BIIA 3IVMA 3R7FA 3TINA 1RHUA 3DTYA 1OTXA 3WMRA 1IY9A 1R18A 2V3CC 3HJHA 5B1HA 4M99A 1HDOA 2GPTA 4IJKA 4PBRA 3VR5A 2JGKA 4FVTA 3TLYA 3LWBA 3QV2A 3ZCXA 1J2UA 2PGXA 5DRTA 3V7FA 2P69A 1NXTA 3K0FA 3D81A 3ZY3A 1D2AA 2UYQA 4GF5A 4J9VA 4MQBA 4MULA 2IV2X 1XD2A 2Z5FA 3SIXA 1TKCA 3K1AB 2OCDA 1U1GA 2P2GA 2PAAA 1W76A 4C4YA 4RGYA 3DGEC 4QD3A 4EJSB 4RJ2A 3PEWA 3QEBZ 3CNOA 4HZIA 4KN6A 1SUWA 3SPXA 4U2FA 2AZTA 1WHTB 1RPNA 3UEOA 3ST7A 2IIQA 2JARA 4NIMA 4PO8A 3ZBPA 1QH8A 4AXBA 4OLBA 3FCXA 1E3WA 3C7AA 1ULTA 5HM6A 1W5BA 1J4AA 3O83A 1HK7A 1JEOA 2BWJA 1C80A 2POCA 4LRWA 4RKRA 4PRYA 3TGWA 1WXXA 3M6MD 3KHTA 4CG1A 3IB6A 1EG2A 3I04A 2OOSA 2QG4A 5CLJA 1ZK1A 1FW6A 3QLEA 3F7OA 2FMHA 3WIBA 3BHNA 4O33A 5LZ9A 2CXPA 2LV8A 2UAGA 3MB5A 4L5JA 5DBHX 4QECA 3BAZA 5G4LA 4DM3A 4EJSC 1FU7A 3T5BA 2VUUA 3GEGA 3DBLA 1NIJA 1OH7A 4B0PA 2FW1A 2OGWA 2Q50A 2VN8A 4KAFA 5DIFA 1FIUA 5G0TA 1LNQA 4K9OA 3R74A 4CIVA 4GI3A 3K3PA 4J7AA 4MKIA 4WVFA 3P2OA 2GVNA 2OTCA 4F9EA 4E5UA 4GP9A 3F5SA 3EMVA 4ER0A 2GKSA 3T5PA 1K7SN 3VPHA 4A73A 2QMOA 3VPSA 2Z3VA 2X8JB 4ARCA 1P39A 1XJCA 4WZAA 4BQRA 2GYYA 3HPRA 3RVPA 5JZ9A 3MERA 1PQPA 2EG9A 1W29A 4XGQA 3MC1A 4MNTA 4C07A 3TLBA 3IEVA 4OTZA 5DJ5A 1YRWA 4F60A 1U9ZA 2V9CA 1XMQB 5F1YA 4DA0A 1B16A 1YZYA 4TXNA 4A36A 4HFJA 5HNKA 4N5IX 1M66A 2WT9A 2WD8A 5HMLA 1VE5A 4FGWA 4PTZA 4QATA 4YRBA 4LXYA 5KYUB 1HSZA 2JEZA 3DOCA 3TZHA 1ZH8A 4BO1A 1TDJA 1XEFA 3A9VA 3AIIA 3QXHA 3G5MA 5DLYA 4MR8B 1RHJA 2ZRNA 3ZXIA 4OKSA 5KJFA 2IYEA 4IX9A 1NNEA 1ZJ5A 4Q3NA 2Z58A 3H0KA 3V4ZA 5B3JC 4XOIA 2F59A 4FZJA 3EIXA 3K70B 3MB8A 3AEQB 2I03A 1NNUA 3S2EA 4IDFA 3H13A 4XYLA 3AILA 4OOFA 3DDZX 1RYBA 3GRFA 2J41A 2J09A 2WJVA 1BYIA 1Y1PA 3FNRA 3KYCA 4ISBA 4ZO8A 2KQUA 3PYMA 4EPXA 2UDPA 4NZZA 1P4RA 2GJ8A 3ER9A 1LW6E 1JDNA 1M1YB 1QO0D 2NSDA 1DBWA 3JD2A 5TX7A 3PUVA 4UE6A 4RE6A 1SXHA 4JI8B 1L4GA 1RXYA 3C7KA 1R8JA 4UM9B 3KV3O 4G63A 3T5TA 3VISA 1QS0A 3D64A 2HNAA 3TO5A 3TTWA 2DE0X 1S3IA 3OM9A 1S6YA