4RZUA

Crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
206
structure length
205
Chain Sequence
GVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate kinase
publication title Crystal structure of ADP bound dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 67
structure length 205
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rzuA00
1E9RA 3OIYA 1QVRA 3QXSA 3FOZA 2OBNA 2ZEJA 5EE9A 4QJ5A 2DB3A 1XZQA 1GKIA 1FQJA 1M7GA 3IPXA 1D6JA 4ERNA 2IF0A 1EFRD 3LW7A 4LJYA 5FPKA 3UWKA 2WPDD 4BEJA 1OH6A 1UEIA 3AB3A 1EK0A 3UXMA 5E7JA 4BLQA 2H16A 3B82A 3QKSA 1DVRA 1QHHA 1U90A 4KXFB 3T5DA 2HYIC 3LAWA 1OB5A 1AKYA 3OE7A 821PA 2BV3A 3BE4A 4M0LA 4PSVA 1EWQA 2JLUA 3D8BA 1DG3A 4QOSA 1N0WA 2RGAA 3TGPA 1LTQA 2FH5B 5K8UA 1IXRC 3VR5A 4GL2A 4BFYA 2IYQA 2ZI3A 1K5DA 2HJVA 2ZJ2A 1AZTA 2GAAA 5EXPA 3OZXA 3B78A 3SE0A 4JVLA 2H57A 1ZD9A 3Q5EA 5FI1B 1Y3AA 4MRSA 3R9IA 1GM5A 1R6BX 1E3MA 1N0VC 4HI0E 3ZH9B 2W0MA 4TQUS 4KVAA 5L3SA 3FKQA 2JATA 1Z0DA 2B92A 2P6NA 1U8YA 4Q1DA 2EVWX 1TQ6A 4NYMR 1FMLA 5FBLB 5BWMA 2N1BA 4PAOA 3EC2A 2ZE5A 4IOJA 1HURA 2X2EA 4KFRA 4LBYA 3RS4A 4ARZB 1Q1BA 3Q3JB 5CITA 1RKBA 4IDNA 2F9MA 2BC9A 1CR1A 3I61A 5G41A 4EPVA 1Q57A 4Q00A 5J4HA 3FMOB 3CX6A 4D82A 4ABYA 4LHXA 2PH1A 4GOJA 1E9EA 1E2NA 2WZQA 3RABA 4BGDA 4URXR 5JWHA 1SKYB 2BBWA 3FGNA 4O3MA 3PIRA 3O47A 5EUQB 2DFLA 2X8AA 3T5GA 1LF5A 1H8HA 1JAIA 1RRGA 2FV8A 3FYHA 2GCPA 4U5XA 3N70A 3PEUA 1E2JA 1SXJE 1ZRHA 2WSSD 1E2MA 4WVFA 4C0QC 5HZKA 3MSXA 1G7CA 3RNLA 1J7KA 1G3UA 2UKDA 5EP1A 5IK2A 3UG6A 2V54A 2AD5A 1Z3IX 2IYWA 1Z29A 2G88A 2BVNA 4B3CA 3FWYA 4URWR 3QJYA 3MGCA 1P60A 4OQFA 2IS4A 5E3HA 4DLSA 2PX3A 1ANKA 2REBA 2OAP1 2O0JA 4V0LA 2ASEA 2Q3MA 2R2AA 2AKYA 2NQ2C 2HT1A 2FE4A 4US2R 1ZU4A 2RH5A 4HB3A 1II8A 1QF9A 1DO0A 4QJ4A 4YLGA 4DUGD 4Q1FA 6Q21A 2ERYA 1D9XA 2WOJA 2XSZA 2ZRNA 4CZ2A 1GL9B 3EIQA 4GMXA 3U4QA 2GJ9A 2VF7A 4H1VA 2WIBA 3FE2A 1HYQA 4TZ6A 4RD1A 1Z0KA 1DAEA 3C15C 2XB4A 4URYR 2HEIA 2NO1A 4PHGA 4LJAA 3BGWA 3TKLA 1G8YA 1UDXA 4NBSA 1S2MA 4G5OA 1E2QA 5KDLA 1DAFA 2O8CB 1EFUA 3VQTA 3IIKA 3X1WA 3LD9A 1TUEA 4M1YA 3VR2A 4JL5A 1OFUX 4JLNA 2CK3A 2VF8A 1E1RA 1S8FA 1IN8A 5L3RA 3K0CC 2CVHA 2VP5A 1XPRA 1F48A 1NF3A 1YRAA 3CPEA 3ASZA 4HDCA 3HR7A 4UKDA 2V8OA 1OIVA 5L8VA 3QXCA 4O2LA 1N6KA 2CHVA 2IUTA 3IBYA 4NDZA 5KTYA 1G4UR 3TSWA 5KSYA 2R6DA 2YYZA 3L43A 2ZRBA 2CJWB 5E7MA 3VHXA 4ILEA 1QHIA 3DVLA 1XCGB 1P75A 1PUIA 4CEHA 4D25A 3R7WB 4EUNA 1RPZA 5JJKA 5J5CA 4L5BA 1TL7C 3F0TA 1B0UA 2AFHE 2JLRA 3AKCA 2FSGA 3QKTA 1OYWA 3QPVA 2OXRA 3CX7A 2ZRHA 5KSZA 2XTNA 2FMXA 2R6AA 3GD7A 3CF2A 3WP0A 3WHKA 1SXJA 5BN4A 1R8SA 4HZUA 2RCNA 4A4DA 4HUTA 1E2IA 3HP1A 5CIQA 1G1MA 2LCFA 2NMVA 4XVRA 1RIFA 3UWOA 3NH6A 4PHTA 1FX0B 1Z22A 4XJXA 5EE1A 1G6OA 3M6AA 4WXPA 2ANCA 3OEEA 3K0FB 2DWOA 4CVNA 4XTRA 2ZE6A 1IY2A 3PXGA 4QNRA 4NYIQ 4UXHA 5BN5A 2F43B 1UBCA 1W4AA 3AVYA 1H65A 4AC9A 3QKRB 1LV7A 4TT3A 2OAQ1 4JSYA 5AUOB 3DOEA 3K8YA 4JBXA 3CZQA 2IXFA 1MO5A 2QTFA 1DS6A 1Q3HA 4KI0A 4A0HA 3SN6A 3PG5A 1JR3D 4B2IA 1VCOA 3CNNA 1TQ4A 4OI2A 1P73A 5C4MA 2HT6A 3MRSA 1Q44A 1YR7A 5GVSA 1SVLA 1WA5A 2IEZA 2QROA 3IHWA 3LW8A 4B32A 3B1YA 1RVDA 4G01B 3LX8A 4M9XA 4PZYA 1NBME 2OLJA 4LBZA 2D06A 4V0MA 1GL6A 2OFWA 1JPJA 1U98A 2QM7A 2RGNA 1X86B 2XXAB 3IILA 5C1BA 1QHHB 3CIOA 4LGMA 4OHXA 1OT3A 1K6MA 3AQ4A 4Q4JA 4P32A 2JDIA 2RHDA 2QMHA 3GLHE 4XWOA 1LFDB 3V9PA 4BASA 5KU1A 4TYYA 3SOPA 1MRNA 1GP2A 1NI3A 1MT0A 2BMJA 2Q9AA 3B13B 1Y63A 3B9PA 3HJNA 4PC7A 4WZBE 3GLIA 3Q8XB 4XWAA 1C1YA 3TLXA 2W6ID 5FI0B 3AUYA 4XIGS 3LBHA 1KO8A 1L4UA 2QAJA 1S9DA 1KZ7B 4KHZA 3NBFA 1JQJC 1R0WA 2AHOA 3ETLA 2QGNA 2W6JD 1VHLA 2F3RA 3VX3A 3I8SA 4I1OA 3SQXA 4JLDA 5LB4A 3K9HA 2GEUA 2IC5A 2G9NA 2XJ9A 4JLMA 1OXUA 1VMAA 2CLSA 1YE8A 1XMJA 4LJ5A 3TNFA 4LDJA 4F38A 1JXOA 1CF4A 2GTPA 4UJ5A 1XRJA 4C7OA 2ZYTX 4LZZA 4Q01A 1VYTA 2JAQA 4Q4AA 4O0MA 1G8HA 1U0HC 4TN1A 2GXQA 4WAUA 3I32A 4C9BA 2GDJA 3TUJC 4KLZA 2RGGA 5B57C 1VIAA 1TMKA 2CLCX 2ANBA 3K9NA 4MRRA 4CEIB 3LDAA 3OE7D 4XH9B 2WJGA 3QVUA 2L0XA 2NO9A 1GSIA 1P2UA 3VTKA 4M9ZA 1G5PA 4HSEA 3LV8A 1FNMA 3B5JA 3THWA 1OXXK 1NG1A 2PBRA 2ZS9A 1G9XA 5L3VA 1EFTA 2ODNA 3TE6A 4QHYA 1EFHA 2YVUA 1N5IA 2ZSDA 1XFAA 5JJLA 1F3OA 2C77A 3GEHA 3L0PA 3MG9A 2ZR0A 4TSFA 4RZ2A 2J9RA 3KJGA 5BQ5A 2OZEA 1NBMA 2Q9BA 1XMVA 3L8ZA 1II0A 4IOKA 2JJ1A 5DHAA 2NZJA 2KJQA 4MITA 4RD3A 2O0HA 1HV8A 4B44A 4B73A 3GLFE 4Q9JA 1II8B 2XZPA 1G3QA 1N5JA 1E0KA 1G20E 1KHTA 5KSPA 5TV2A 2GK6A 4URVR 3SJCA 3GMTA 2BOVA 5IDVA 4OHZA 2FEMA 4DKXA 1JECA 4WIAA 5CB8A 3GLHA 3HDTA 3VU9A 3I1FA 3NC1C 4TMTA 3UIEA 1AA9A 3ZGXA 2LKCA 4JVMA 4TWZA 2JJ2A 3AF4A 1UM8A 5FTNA 3F5FA 1TU3A 3X1DA 2ZI5A 2HF9A 4E09A 1H8HD 4MDEA 2ZYWX 4BFSA 3LXRA 5GJWC 4U00A 2I1QA 4UJ3A 4BFTA 1QHYA 1AS3A 2RHMA 4GZLA 4Q48A 1TNDA 1XU4A 5IK2D 4JS0A 1FTSA 4QL3A 1Z8FA 4P3YA 1S3SA 1PUJA 2ZE8A 3A4MA 2R62A 1Q1ZA 4PXAA 1G7SA 4QGAA 2NG1A 4DHEA 5FTKA 1BIFA 1SQ5A 1ZNWA 2AX4A 3QXXA 2ZRGA 4X8LA 4E03A 4RFSB 3TW4A 5ELXA 3CRMA 3HPRA 1X1SA 1GRQA 4JLPA 2H92A 2HF8A 1WB9A 3THYA 1QDEA 1PVOA 4QHTA 2RAPA 2O8DA 1ZIPA 5JWRA 5JSZA 1SVMA 1Z83A 5JS7A 3R20A 1D8TA 1E1QA 2XSZD 3MWYW 4FCTA 4CYMA 1ZJ6A 1N6LA 4RKFA 1S9HA 1SKQA 3H0KA 1ZBDA 1IM2A 3SFVA 2WAYA 1SXJB 621PA 1CJUC 2D2FA 3C41J 3RC3A 4HZUB 3TH5A 2GJAA 1W4BA 2OFOA 2ZM5A 1DADA 4LC0A 1UKZA 1R7RA 3AVOA 3VR6A 1KY2A 3FFAA 4OK6A 3W90A 3W9YA 3PJRA 2R6CA 1DELA 1FUKA 1GAJA 1M7BA 3VMFA 1Q20A 5KSOA 3IKJA 1RJ9B 1MR3F 3SHFA 1R5BA 3GFPA 5HE8A 1U9IA 2GZDA 4YMWA 1T9HA 1TQ2A 4LI0A 3I73A 4GBMA 2G0TA 421PA 1YZUA 3GLFA 1W49A 3T06B 1PLJA 3T1TA 1KIMA 2WWIA 1EGAA 3PQCA 2WBLC 1AK2A 1Z06A 4JLBA 3Q7PA 4PC3A 4TZ0A 4BRUA 1Q21A 2C99A 3C5HA 1WMSA 1I2MA 1UKYA 3AP1A 2RGXA 3U2QA 4G5RA 4Q9LA 4LPSA 5DYGA 2P5SA 1ZNXA 4BQSA 5AR1A 5H70A 3V4RA 2QPTA 1D2MA 1KK2A 2UZIR 3UMRA 2QENA 2XAUA 3D6TB 2V4ZA 2GEDA 4P4TA 4S2EA 4JKIA 1SXJD 4MKFA 4Q4HB 3LFUA 3U61B 3UANA 5A0FA 5DYIA 2QT0A 2VA8A 4IDOA 1XMIA 1TF5A 3T1VA 2BCGY 4IXMA 1NL3A 3OEED 3B1XA 2V7QA 4HAYA 4IRUB 4A8JA 1V5WA 4MGYR 1MO3A 1E2LA 4Q4JB 5DI9A 1VYVA 2PLRA 3I4LA 3GJ6A 2Z5FA 3BFKA 3MMPA 1AN0A 3G82C 1W47A 3EXAA 4XSGA 4DLUA 2A5DA 1IN6A 3QNUA 4II7A 4M22A 4TT3D 1N5LA 2ODWA 4LHWA 4A82A 1SGWA 4US1R 5FTJA 3SI7A 4I1VA 3F8TA 3FHCB 2CL7X 3ONWA 4BECA 2ZVPX 4OJQA 4MRNA 4QRHA 1HTWA 4D0NA 3CRVA 4JZKA 4L16A 4JVSB 2WSMA 2OILA 3X2SA 1W0KA 2QRZA 3KXKA 4C0HA 1N6PA 3NC0C 2WJYA 2NO0A 2LKDA 4PZLA 2HUPA 1Z6GA 5JCZA 4KSCA 1ZUIA 5KNBA 5DH9A 4C0JA 5JLJA 2ZUDA 4NHOA 2Z4SA 2XOKD 4C7OB 1E2KA 2QT1A 4DSNA 3FTQA 3CRW1 4Q4AB 5FOVA 4PO1A 1KKMA 2C96A 1NMZA 4RCZA 1HE1C 3AF2A 4L9WA 2RMKA 1GKUB 3U3OA 1TF7A 2IYLD 3IIMA 2P3SA 4URZR 4EPWA 1SXJC 3QF4A 3TW8B 1E0SA 1KI4A 3SDZA 3GLGE 3CR7A 3Q7QA 2JDID 2WM9B 1CJVC 1E9SA 3DKVA 2ORWA 4GZMA 3FVQA 3MLEA 2BEKA 2IW3A 4XWKA 3C16C 5AJZA 2A3RA 3LX5A 4AYWA 2B6HA 5FH9A 2V1UA 1DAMA 1T4GA 2ZRPA 3AVUA 3THWB 4Q7JB 1JJVA 2FFBA 3NG1A 2YNMA 3HPQA 3E2IA 3BBPA 2HJGA 5EQTA 3ZS8A 2ZSAA 2D3WA 1FZQA 2C8VA 4MYUA 2PMKA 1ZC4A 3NDPA 4DB4A 4EAQA 3BORA 3TVTA 1VCNA 2E87A 2GBLA 5J40A 1G8PA 4TMXA 1MO6A 1KI9A 4F92B 4YMUA 4B3XA 2ZUCA 4F7WA 3CR8A 3VKGA 3RVBA 1R0XA 2EU8A 5LB2A 2J7PA 4XSHA 1XWIA 4QXAA 3V00A 1OB2A 2B7CA 2QGZA 2ZAMA 3S1AA 1I2DA 3EIHA 4LX0A 1N6IA 121PA 4W5WA 1VG1A 1Z2AA 3GLHB 4YDHB 3VU9B 4PQFA 5GJVC 1U0LA 2AR7A 3I3SR 1U99A 2ZI4A 2C95A 1HQCA 2ZU6A 4NPHA 1Z07A 2QAGB 5EXXA 2QBYA 3U6BA 4AURA 3VKHA 3BOSA 2I4IA 1XZPA 2ATXA 1T5LA 2FG5A 1NY6A 1E9FA 2RGNC 3NKVA 5G53C 3HR8A 4AKIA 3THXA 2IK8A 5CK5A 2VP9A 4ZI3A 3ZD6A 2VHJA 3H86A 3KKNA 4QBFA 1U8AA 2CCGA 3B2EA 1FPMA 1ZD1A 2ZUBA 2IF2A 4A0FA 3SJZA 4YMSA 2WMOB 1UDWA 2EFCB 2W83A 3EZ9A 3H4MA 4URUR 1JB1A 4FCVA 1HA3A 1YR6A 2H7VA 1GITA 2C04A 4JL6A 3T34A 4Q9HA 4TLAA 4TSFD 1EX6A 2FEOA 4NCHA 1ZM7A 3GP8A 2GJSA 1NBMD 1W46A 2ZU0C 2JJ1D 3AVWA 2FFQA 2EWVA 2C9OA 2VPPA 5AUQA 2J87A 1CP2A 3Q5DA 3K70C 2JCSA 2YOGA 1X8LA 2G6BA 2V3CC 4FW9A 2N46A 521PA 2ZIAA 5JSZB 5FBRB 3GLGA 1OIWA 2BKEA 1T3LA 1EG7A 2F3TA 4FMCB 1R5NA 3SYLA 4PO8A 4Z8YA 2B8WA 2HXYA 1I4LD 2JJ2D 3REGA 1IONA 2F6RA 3ND8A 1E32A 2G1KA 3DDCA 2GJKA 4AKHA 4DCUA 2ZJAA 4B2PA 5FPHA 1SVKA 4Z1MD 2CHGA 1EXMA 3C7KA 3W34A 1LF0A 2UVQA 2QA5A 4BFXA 1BH2A 1F2TA 1PV4A 2R8RA 5EJEA 2C9CA 4RY2A 1KI1A 3EPHA 2O8FB 4JL8A 2A5JA 4DDVA 1V43A 3Q9LA 2BM0A 4FD2A 4BEBA 3SHWA 1ZIOA 1ZUNB 4RSGA 4DSOA 3UATA 4ZDJA 2QTHA 4BFWA 3EX7C 2FFHA 2QU8A 1SVOA 2JLVA 2MSEB 2OT3B 3GLFB 1FW6A 5DO9A 3KJIA 5G3ZA 2ODEA 1GNRA 3L0IB 2ZTSA 2GXAA 4JLAA 4KITB 1LNZA 3GJXC 1W36C 3IEVA 4LHVA 3ZVLA 2AK2A 4A9AA 2FSHA 1TPZA 2FZLA 1N6HA 1PLLA 4UQOA 3ZVMA 1E1QD 5TY0A 4PFSA 2GESA 2MMGA 3RS7A 1AJEA 4ON9A 2R65A 3C14C 1ZUHA 4R7ZA 1PLKA 3PUZA 4HAVA 4RVCA 2A9KA 2CVFA 3DO6A 4CRWB 3JZAA 2XTMA 1T3HA 1XEWY 4Z8XA 2CL6X 4QBGB 4CT5A 4RZ3A 4TTPA 4V0NA 3K0SA 3I62A 1XB2A 3QIAA 4L4UA 3WXMA 3AF1A 4D4LA 2FWRA 4D80A 5JCPA 3WMEA 2FSIA 4NP6A 1UBFA 4A2WA 3BH7A 2QAGC 3KDSE 4IHQA 3CBQA 1TU4A 3CZPA 1AZSC 4HLCA 2JLWA 5F9HA 3ICQB 1S0UA 1OW3B 2GKSA 4XD7A 5CIWA 5CB6A 1T8TA 1FTNA 2EFHB 4MGIR 3J81k 1Z6TA 1NLFA 2CBZA 2ZJYA 3TRFA 3HU3A 2YV5A 1VIYA 2J1LA 4BFZA 1OH7A 4U02A 4HB0A 1XCMA 3K09A 1BS1A 1ZCAA 1W7AA 1P61B 4I4LA 2QEQA 4ZIRA 2VHUA 4DBLC 2IWHA 1NY5A 5GVRA 3AVPA 5FTMA 1IN7A 4NH0A 4PSAA 2H18A 1N6OA 2PZGA 4D6PA 3W3AA 1S4QA 1SZPA 4K46A 1KK0A 2GNOA 2QQEA 3EG5A 1O87A 1S96A 3FMPB 4LHYA 3VFDA 1WCV1 1ZCBA 3WRYC 4LBVA 2ZRIA 4PANA 2ZRFA 1CR4A 2EWWA 2FF7A 3QVVA 4M1KA 2IYZA 4LJ9A 2V7QD 1P9NA 1UJ2A 4NZYA 3C5CA 3QF4B 2EYQA 4M1WA 1G3IA 1TEXA 3NH9A 3QKUA 1LB1B 2HCBA 1IN4A 3K0AB 2VTKA 2NO7A 1KK1A 3QUSA 4OJKA 4V03A 5H68A 4AYXA 4PQRA 2GCNA 2QSZA 4MGKR 4TLBA 2C5LA 4AD8A 3BJIC 3IO5A 2Y8EA 4FI3C 4V0ME 4AKEA 1DAIA 2YWFA 2Z43A 1OYYA 1KMHA 4JYBA 1IAQA 5B30A 4ASUA 5AUPB 1GZSA 4KYIB 5IRCD 3GCGA 1F60A 2CE2X 3U3RA 3U7GA 2QE7A 1E98A 1NVVR 3OAAA 1JI0A 4UNNA 3RAPR 5F2EA 4B43A 4BFUA 4BUJA 4XVUA 1W0KD 3GLIE 2WIAA 1M74A 2GA8A 2EYUA 4Z51A 5DI3A 2JLZA 4Q1CA 2VYFA 4HLUC 4DLTA 1XCPA 2OUKA 2TMKA 4HAWA 1XTKA 3D31A 1KAGA 3EAQA 2ZSFA 4IVRA 4A0RA 3GJ5A 2C98A 2GF9A 3REFA 3GFTA 3WMFA 4ZV4A 2KI5A 4BLRA 1NN5A 2NO6A 1RFLA 2E9SA 3GJ4A 1CBUA 2FFAA 3MAAC 5JI3E 2Z0MA 1L8QA 5FPYA 2BBSA 2CL0X 4JBWA 3GPLA 2QBYB 2KBEA 2JASA 4PQYA 1XD2A 4EPTA 1NVUQ 1RRFA 5JMTA 4QKQA 1MOZA 1ZC3A 1QG4A 2AN9A 2ONKA 3K9GA 3RS3A 4BZQA 3PCRB 3PEVA 3P27A 2HV8A 3ZZUA 4AWXA 3SQWA 3V4FA 1GG2A 3THXB 3QEJA 4HB4A 2ZYUX 3GJ3A 5KOYA 3PUYA 4GPTA 3VAAA 3NWJA 2P65A 4OHYA 1L4YA 3SYKA 3WRXC 4Z54A 2VHCA 5HZHA 1S3GA 5FBWB 4HAXA 1COWA 2YZ2A 4P31A 4B71A 2FN4A 1P4SA 2QI9C 2VBCA 2QPAA 3B1ZA 1T0JB 4DDUA 5JEDA 1KI6A 2J7PD 3OIVA 5EXTA 4QM6A 2K5UA 1JPNA 3MD0A 4LHZA 3ZQ6A 3TMKA 3TR0A 1NLZA 1UPTA 4R71A 2ZE7A 3GLGB 2ZJ8A 4WZ6A 4X8HA 3RS2A 3QEOA 4UNPA 3CPHA 2BDTA 2RGBA 2XOKA 4BZXA 3A6PC 1F2UA 4M9QA 3U7EB 2VHQA 4PC1A 3GJ7A 2A30A 3BB4A 3LXXA 4Q02A 1AIPA 5FL3A 3QKSB 4M1MA 1E9BA 4TMVA 3AVQA 2R6GA 5J47A 1MABA 3ZYCA 1JEEA 2ZPTX 3A37A 3MJHA 4B3DA 1SHKA 1F2TB 2JLQA 1YZGA 4BE7B 4Q9KA 4DJTA 4RCYA 5C4GB 2OV2A 4DDWA 3BFXA 3ADCA 1Z6AA 2AK3A 4MRVA 4MYTA 5FPSA 2QTVB 3EZ2A 3SJAA 1EWRA 2IT1A 2J7KA 3ZJYA 3QY0A 1KNXA 1YKSA 5E4FA 5KUTA 3LLUA 1QHXA 1KDPA 1W48A 1ONBA 1Q12A 3EPLA 1OXVA 3RWOA 3HYTA 1JEDA 5C46F 4PAMA 1QG2A 5B58C 2GBLC 3P26A 4FMCF 4Q7KA 1NJFA 5L3SB 5A4JA 1VECA 1ZNZA 3W8RA 3IDQA 4US0R 1CR2A 5EE3A 4B35A 4PHFA 2OBMA 4JLJA 3ADDA 1NVWQ 3LBIA 4IOLA 2IWRA 1NKSA 4F4JA 1YQTA 3ZVNA 4M1TA 4D4MA 1E96A 1XEXA 1KSFX 4GP6A 1HE8B 2F1RA 4KFSA 2BEJA 1XTJA 3NVAA 3X1YA 4F93B 1G7TA 2IUUA 2W2XA 1NP6A 4KBFA 1A7JA 3C8UA 3H2YA 4P4SA 5SZIA 3QF7A 1ZM2A 4KVGA 3QENA 4UXIA 2J41A 4JT2A 2A7QA 2LWIA 3WY9A 1Z63A 4QJ3A 3VX4A 1Z0AA 2PEZA 2PMDA 2VP6A 2O8BA 3PV0A 3SEAA 1HY3A 3CNLA 4H1UA 4LK2A 2ZS8A 5TMPA 4TYWA 3AVTA 1E2PA 3WNCA 2QL6A 5BN3A 2JJ8A 2FPKA 4HATA 1D9ZA 4B48A 2WMNB 4DWJA 1OF1A 3OFNA 5DGXA 3CH4B 3VR1A 1Q3TA 2GXUA 1W44A 4ZCIA 4ESVA 2FZ4A 1OKKA 3KXIA 3MJRA 4LC1A 4ZIRB 3LRPA 2J0UA 4B6EA 2FOLA 3KXLA 5EP2A 4A0GA 3HU2A 5DE3A 1KY3A 1DG1G 2D7DA 1JXMA 5D3MA 2MSDB 4EFNA 5TARA 1FMJA 4EKDA 1GOTA 4DCSA 3U4QB 5KPJA 1KDRA 4LUCA 2W0SA 2YHSA 2GRJA 2W00A 4TLEA 2IYUA 2XZOA 2WWGA 3NTUA 1DPFA 1R10A 4OHWA 5CDFA 1G17A 1KDOA 1FQKA 4ZPXA 4Z1MA 4LCBA 4M4SA 5JS8A 1DO2A 4XVQA 5HKKA 3U7FB 2OSBA 4F91B 3RSOA 4BRWA 4CIDA 5L3QA 1G64A 3IIJA 4JLVA 1XDBA 4B33A 1J90A 4XD7D 3MWJA 3T15A 4MH0R 1AQYA 3B1VA 2QM8A 5DN6D 1KMHB 1E2EA 3LWNA 2EW1A 4AKGA 3LNCA 5FUYA 3RHFA 1Q0UA 3KX2A 5HCIA 4CEHB 2Z6VA 3NBZC 2VL7A 3FHOA 4LYJA 1J8MF 3QG1A 2RGDA 5DI3B 4DLWA 3MCAA 2IXGA 4N0EA 4NYIR 2ERXA 4TQAA 4DT1A 2OCAA 3LY5A 4LOAA 1UBEA 3A36A 4NKRA 3CH5A 5F3WB 1DOAA 4NE2A 1I4DD 5KO2A 4CF7A 3FB4A 3RYTC 4KFTA 3RSLA 4DZZA 1TTTA 4EQ6A 4JYCA 1XTRA 3A1TA 4C0LA 2O5VA 3TAHA 1G5RA 1G41A 1GRNA 4CGZA 4ZKDA 1CJMA 1E2HA 4M53A 1XD2B 1RW4A 3W5IA 1S1MA 1KI3A 1UKVY 2YINC 2ZREA 3CM0A 3CONA 3M1IA 4V02A 3KQHA 3B9QA 2WVJA 4C0KA 2Q21A 3OF5A 1FUUA 3LQQA 2QMUA 4M8NE 2A5FA 4L8GA 2VP2A 1PZNA 4OK3A 5KNCA 5AJYA 5EXSA 4ASUD 3WNBA 1P9WA 4LYFA 1ZAKA 2CCKA 1XTSA 4YMVA 2QE7D 3OAAD 4UNQA 4WBSA 4E5UA 1LS6A 1E0AA 4JLKA 4IVQA 1EFCA 5G3YA 5J4LA 5JFGA 3BERA 2FDCA 3F3YA 2CCJA 3C4JA 2QUZA 3IPYA 2ZI6A 1E99A 1J8YF 4KYUA 3K0CA 3PR1A 2XNSA 4Y0AA 4EPXA 4OKSA 1LVGA 1KO7A 5P21A 2GHIA 1KI6B 2NZ8A 2QNRA 2CLDX 3HYRA 1KZGB 5DLQC 2KSQA 3CUEF 4IDQA 1XNJA 1R8QA 2OO7A 2VRWA 1XP8A 4EIWA 1KGDA 5CLLA 5FUVA 3LQRA 2AWOA 3DKPA 3CPJB 3IHLA 4YXWA 5CLQA 1F2UB 1D5CA 1YZKA 2ATVA 2ONJA 4Y0VA 3FKSA 4QG7A 1TEVA 5LPNA 1OLOA 1NVXQ 4QFMA 1IBRA 4DVGA 221PA 3AKYA 3CNOA 2NPIA 2ORVA 1GNPA 2V6JA 4OQMA 1MABB 2ZRLA 3W6PA 3X1XA 3CLVA 5EE5B 2WJVA 4QNMA 2ZSEA 1ZMXA 1CIPA 3CW2A 2KB0A 1A82A 4M1SA 5LDDC 3GLIB 4PAQA 5SZHB 3I5XA 3I5YA 1P2VA 2ZRJA 1X3SA 1YR8A 3E5HA 3KTAA 1GTVA 2BJVA 2IYVA 4HUQA 1XJ0A 4DCNA 4KODA 4DLRA 5DNYB 3P4XA 1COWD 4NCNA 4WA7A 4A1FA 3KKOA 2GETA 5DHFA 4JVNA 3ZIAA 3DZDA 2IHYA 1G8GA 3GEEA 2GAOA 2ZSBA 3IBGA 4OQXA 4E22A 4DB2A 4HZIA 1BOFA 1VKJA 1GWNA 2OM2A 1ZM9A 3AF3A 4NYMQ 5C18A 3NDBB 2XB2A 1XTQA 4YONB 3TSZA 4UNRA 2WWYA 4D26A 2AKAB 1Z6YA 5FL7D 2VP0A 3NHBA 4S35A 5BW8A 1DAKA 1GDDA 3DM9B 2PX0A 3Q72A 2ZANA 4TTQA 3CX8A 2QN6A 3AH8A 3FMFA 3T1QA 3HU1A 4GMDA 1E2FA 2I3BA 4QGFA 4V0KA 4BLPA 1XEXB 4LWZA 2G3YA 4Q5IA 3WYFA 3A1WA 1NN1A 3TUIC 1BMFA 3BK7A 2VSFA 3QG5A 1A2KC 1VG9B 3B60A 2PCLA 4Q47A 1Z0FA 1HQYE 4CDGA 1NMYA 1OHHA 4D2IA 3MWKA 5FOXA 2JLYA 1Z0JA 4RD0A 2CXXA 1G6HA 4N1AA 5AUNB 3KQLA 2O8BB 1W1WA 2EFDB 3ZZ0A 1DEKA 1GVNB 2FNAA 2Q3HA 4NCIA 4LSGA 4Q4LA 1OXTA 2P67A 2CHQA 2H8KA 2YC2C 3N5CA 5CM9C 2BBTA 4B76A 1NIJA 4IOMA 2O8CA 2VEDA 2J3EA 4Q03A 4PPGA 4JBYA 5CYPA 1TF2A 1X8JA 3OEHA 2ZXUA 2B8TA 2J0UB 3IUYA 4OQNA 2XTZA 1E0JA 5FR2A 4LJ7A 1NSFA 2OCBA 4Q7MB 4IDHA 3T12A 5JRJA 3U6KA 3R9WA 2DHRA 4J0QA 1ESNA 4JJKA 4NCKA 5D3MB 4WZAE 3BB3A 5F9FA 4DIEA 5AJWA 3BS4A 3Q85A 3CO5A 1J2JA 3ICEA 1F6BA 4W5HA 5E7IA 2CJWA 1OSNA 4F4IA 2DYKA 2IS1A 3R7WA 1C4OA 1KI2A 3JZMA 3OESA 1Q1EA 2F1IA 2JLSA 4LJ6A 4NCJA 1ZM3A 5EZ5A 2PJRA 1N25A 4MQBA 1R4AA 2D74A 5CYOA 1IJFA 3A8TA 3G0HA 2VHTA 3CWQA 1NN3A 4LV8B 2AD1A 3BAFA 4CT4B 1WBBA 4B3GA 3OFND 4ACBA 2W58A 5J4YA 2QORA 3TBKA 3M4YA 5FR1A 3RANA 4M2LA 1MV5A 5TDHA 1GNQA 4IKEA 3RWMB 2V9PA 1M7HA 1OKKD 2ZS7A 2OCPA 1KJWA 721PA 2IYTA 2CMKA 1UBGA 2WTUA 1KJZA 3ZQJA 2VH5R 4Q9IA 3THYB 2GCOA 1ZYUA 3CRRA 2DWQA 3RRNA 2O8DB 1RRPA 1Z2CA 1X1RA 3QKRA 1OFIA 2WV9A 5FOSA 2J46A 3A1VA 3EC1A 4LBWA 3EA0A 2W2TA 1YZQA 3I92A 3IO3A 4Q1AA 3FMIA 4ZDKA 1E79A 1HUQA 4ACAA 2ZR7A 4PSKA 4ZO4A 2NIPA 2WWWA 2ZYVX 3WBKA 4LPKA 3R9XA 4OQLA 1XF9A 1TADA 3PUVA 1U94A 5HKKD 2A78A 4Q21A 2J0VA 5KHOC 1GRRA 2VP4A 5KDOA 5DISB 1N0UA 2QP4A 1JNYA 3IQXA 3BFVA 3EPJA 2V1XA 4JMPA 1ZD8A 3PFIA 3DEFA 4KFUA 3KFXA 5KYKA 1Z6XA 1AS2A 4HDOB 1YZTA 2ZITA 2FA9A 4RJLA 2XXAA 1K5GA 1I4TD 4JJZA 4IW3B 2PZEA 1CRPA 5IHPA 1NLYA 2BCJQ 4R98A 2DWPA 2X1VA 1IXSB 2NOAA 4LV5B 4B2LA 1A4RA 2C9YA 2ZJBA 1R5OA 1CJTC 1B23P 1X8KA 4QGGA 1EX7A 3KKMA 2IEYA 1AGRA 1FL9A 4PZZA 3SS8A 2ECKA 1QBKC 1KAOA 4ESHA 2XEXA 5D3QA 1G21E 4I99A 1XXHE 1SVWA 3SC3A 3JVUA 1ZW6A 2OESA 3AP2A 3D3QA 3EIEA 3SU8A 1KOFA 4C2TA 1H8EA 1N5KA 3QBTA 5JBQA 4LV6A 5TVKA 1YR9A 1G19A 1TAGA 4UXJA 4A8JB 1G8FA 5SZJA 1E2GA 2E1RA 2DFNA 1W2HA 4QBHA 1JBKA 1TUIA 4A36A 3U3KA 5EP4A 1FP6A 4JLOA 2NTYC 2YOHA 5KPDA 3CF6R 2AXPA 3RS0A 4D4KA 1E9CA 1LW7A 3DHWC 1HEIA 2H1LA 3KTAB 3DZ8A 1E69A 1XEFA 3GQBA 5DN6A 5CJPA 4BZPA 4CEIA 1Z28A 4HUQB 4HLQB 5FOUA 5J4VA 2X19A 1A1VA 3LLMA 4V0OA 2IYXA 1DARA 2VQSA 4DLYA 4GRAA 2D4HA 1ESMA 5EP3A 1P7CA 3UKDA 3OIWA 2AWNA 3R8FA 1SULA 4TYPA 1IJEA 4QC2A 1KJYA 1VCIA 2A5YB 1G4AE 2N42A 2BIFA 3CWZA 3K0EA 4NU0A 3WYGA 2IYRA 4ZCMA 1SVSA 2OEPA 1U8ZA 4RKEA 4EFMA 4YXWD 3O8CA 2HDNB 3QXJA 5ANRB 5TB5A 3FKSD 4FINA 4W9MC 5A5GA 3GJ0A 2WAXA 4MDFA 1KDTA 1W0JA 3DMNA 1XX6A 4DDTA 2H5EA 2ORIA 4MYCA 3SJBA 4AK9A 1T6NA 1XPOA 1JALA 1G291 1YU9A 2GWHA 5GJBA 1E9DA 2XNDA 3K1JA 5CK4A 3SR0A 1AS0A 1P9RA 1T8UA 2BWJA 4P0TA 1ZU5A 4CW7A 2FGJA 1US8A 2OHFA 4JIMA 4PX9A 3TQFA 2BJWA 4O2RA 4DXAA 2REXB 5FBQB 2DFKB 2OCYC 4FMBB 3QSYA 5JRZA 1U9IC 1KO4A 2KE5A 1RE0A 1CS4C 1RYFA 2ZJ5A 5FPTA 2F9LA 2IA5A 1KTVA 1QHGA 4KV9A 4BLTA 4C0BA 3KFVA 3QOFA 4MRPA 3K53A 1KO1A 3WBJA 4KCGA 1U2RA 2OXCA 1XXHA 3ZIAD 1NNEA 2FGKA 1OXSC 4YMTA 4A2PA 4A2QA 3RC8A 2G1JA 2QPOA 1DAGA 3KKQA 5JEEA 5AJVB 5KNDA 2O52A 1II9A 2VO1A 4EJSA 2YC4C 2ZR9A 1AQUA 2WKQA 3ASYA 3CKLA 3AEZA 4EDHA 2BKUA 2QG6A 1BKDR 1OFTA 4B75A 5FTLA 1DE0A 2O0KA 4DRZA 2BMDA 3S1AB 2Z83A 4MYHA 5IT5A 4GDFA 2WOOA 2Q0HA 3LBNA 1OH5A 2JIZA 4MUAA 3U44A 3OIUA 4RFSA 2XJ4A 4AYTA 1BMFD 1KSHA 2HLDA 1OH8A 2XITA 1OIXA 4FXPA 4DLZA 3EZ7A 1ELOA 4D4JA 4RZXA 3ADBA 3RRYA 1OHHD 3KQKA 4OI1A 3QPUA 3NIBA 4DLVA 4A8JC 3W5JA 2OFXA 1PJRA 4PHHA 3WMGA 2J0QA 3KJEA 4HEJA 3U7HB 2IS6A 1JR6A 1WDTA 5CJ2A 2B21A 4KU4A 3FDIA 1LS1A 2GVZC 1SHZA 4NYJQ 5H1YA 4C0AC 4NMMA 2PLFA 2Z4RA 4C0SA 2MMCA 5FBVB 5HR5A 1RJ9A 3OEHD 1E2DA 3TK1A 3IQWA 3QQ5A 1CKEA 4YC7A 4NL4H 2WHXA 2GCOB 1K8RA 2B7BA 4FMDB 2DFTA 4MKIA 3T35A 1G7RA 5FL7A 4JKYA 2ZVQX 1IHUA 3N2EA 1IXZA 3U3MA 4YDSA 2AL7A 2YKGA 4RD2A 2YWEA 1G16A 1C9KA 3RRMA 4HDQB 2XZLA 4L15A 4GOXA 2XX3A 1XMSA 1VG0B 3T61A 5H8WA 2CEAA 2V6IA 4C30A 4Q18A 5EE0A 5FUWA 5B64A 2DR3A 4R9UC 2H17A 3G5UA 5FFMA 3SFZA 8OHMA 4WXRA 4OHVA 3P1JA 4FWTA 2ZI7A 3A1UA 5AK0A 3W6OA 5KDDA 1NKTA 2BMFA 1OJLA 2PZFA 3B8HA 1IN5A 4B74A 4DSTA 2IUSA 3CRQA 4EPRA 4Q4HA 3LO5A 5CDFE 4DCTA 4X8MA 1L7VC 4XTCS 1RRCA 3ADKA 5M04A 1IY0A 4DIDA 2QSYA 4K8OA 3BH0A 4EPYA 1GIAA 4ZI2A 3WHLA 3B85A 4KO8A 5JECA 1E6CA 4R2IA 1P72A 3T1OA 4GFDA 5HTKA 4A6PA 2ZJZA 3QPWA 2IYSA 1VDZA 5JJIA 4GSYA 1M34E 4CEJA 4F4CA 1P6XA 2YJTD 2ODBA 1P62B 1L2TA 3O8RA 1HT2E 1A2BA 2A5GA 2I1VB 4LYHA 4A6XA 5TXGA 3PVSA 4U7DA 1AKEA 2EQBA 1ZNYA 3AGQA 1E79D 1YJ5A 4GI7A 2YOFA 1P2TA 4IXNA 5GADl 3I72A 2G0NA 4TYNA 1RYHA 3CF0A 2R44A 4ITRC 1CTQA 4ZCLA 3AP3A 1MH1A 3FFBA 2ZI9A 2Q9CA 1QHNA 3E70C 3B1WA 2J5XA 2JA1A 3KB1A 1WF3A 3LA6A 5E95A 3L2OB 3SBEA 2FX3A 4W5JA 1FOEB 3AGPA 3RLFA 1G3RA 4EFLA 1Z5ZA 2CNWA 1GL7A 3LH5A 4Q1BA 3TIFA 2ZQ5A 4D0LB 2FJUA 2JGNA 4P4UA 2DBYA 4PC6A 1QHSA 4PC2A 3NEYA 4HAZA 1N2CE 3DOFA 1QVAA 4PPNA 4M21A 2RB4A 2BMEA 3VHLB 3W3ZB 3A58B 2QRNA 4IDPA 1IQPA 5JHHB 1E94E 5AWFC 4FIDA 3VNUA 1CU1A 1FP7A 1M1YE 2QP9X 4AG5A 1IY1A 3WNDA 1TX4B 3CB4A 4TL6A 1W2GA 4IEEA 1QZXA 2Q3FA 3W8NA 3AV0B 1WBDA 3DMDA 4G5SA 2X2FA 4RD4A 2O8EA 1GFIA 1JAHA 3KUDA 1Z47A 1ZVQA 3AF0A 5BYJA 4PR0A 3ZD7A 2WWFA 1H8ED 3BD9A 3P20A 2XGJA 1XEWX 3LVQE 3ZS9A 1F5NA 2HYDA 2SHKA 1KI8A 3A4NA 1TQDA 4NONA 1KSJA 1Q1QA 2R6FA 1CXZA 2ZJOA 4OYHA 2ZETA 4DEXA 2OLKA 4I81A 3VR4A 2RGCA 3AVXA 1VTKA 1P3JA 4I1SA 1J99A 3K9LA 1XJQA 3O8BA 4A92A 1US8B 1VPLA 2RKOA 3QE0A 5J4KA 3ECCA 1M6NA 1BYUA 4B3BA 1LY1A 4N0DA 1EFRA 1R2QA 1GUAA 1YHNA 2PT5A 3H1TA 4H9GA 2WPDA 4LJ4A 3FPAA 3I8XA 4N3NA 3WYAA 4AI6A 1G3MA 1DBSA 1G5TA 3P4YA 2QAGA 4RZUA 1N6NA 3PITA 2FPMA 4G5QA 3AVVA 1SVIA 2ZRMA 1D2EA 3EWSA 3EASA 1ZP6A 1XXHB 5UKDA 3N2IA 3E1SA 2YWHA 4MUBA 5C2JB 4GT1A 5DSZA 5LD2B 2BBOA 2REOA 3KB2A 2CE7A 4NTZA 4TL9A 2C2HA 1N6RA 3B7GA 1SKYE 3UG7A 5K8LA 2VIIA 2GF0A 4W7SA 4EJSB 5JI2E 1T0HB 2OE2A 4D81A 1WXQA 1WE2A 4JSTA 4MKHA 1W0JD 2P2LA 1VYUA 3GFOA 4LYAA 3NBYC 3U44B 2GEVA 1UKEA 2IS2A 1E4YA 2ZAOA 4NYJR 4BLOA 3BC1A 3TSOA 4TTRA 3MFYA 4C2UA 4IJMA 4BWYA 2XNDD 3AUXA 3UK6A 4A15A 3DPUA 2BM1A 1W5TA 4I1UA 2R9VA 1DAHA 1NN0A 3EZFA 3TVDA 2PJZA 5G40A 4ZDWA 2J59A 1Q22A 1NMXA 4DCVA 5BXQC 2QZ4A 2ZROA 5EUMA 3KZ1E 2C78A 3A4LA 1W5SA 3UMFA 1UFQA 4HLDA 4XOIA 4MGZR 5JHGB 1W4RA 4M1OA 5BYKA 2V55B 1IOZA 2G83A 1HT1E 2FPLA 2WICA 3EPKA 3EARA 4B3FX 1N3BA 3PUWA 4FWIB 4IFBA 4PPFA 1FNNA 1CJKC 2WJIA 3QI2A 2KBFA 4D0GA 3R8CA 1E4VA 2UZ3A 2O8FA 2C03A 1JQLB 4Q19A 1YZLA 1Z0IA 2F55A 2CK3D 3FHTA 5LBIA 1OFHA 3K09C 2WSSA 3THOA 1FFHA 3ZVRA 1E1RD 4Q1EA 5HE9A 4HB2A 2WJHA 3UPUA 1KYIA 3L82B 2JIZD 3L0SA 2VSOA 1ODFA 2QMEA 4MA4A 2EFGA 2F1JA 4M9SA 3O8DA 1MRSA 4OI0A 3BB1A 4HLUA 3BH6A 2ZRCA 3X1ZA 4Q66C 4TMKA 1NIPA 3M0EA 2HLDD 2CDNA 1OV4A 2P5TB 3PUXA 4KJZA 4TL8A 1NG9A 1KNQA 4KBGA 3GEIA 1QRAA 3DL0A 1ZM4A 3LVRE 4G3XA 4G1UC 3IGFA 4WOPA 3BWDD 2DPXA 4X8OA 4OK5A 3RRZA 3JVVA 4ARZA 4DUGA 2BHRA 4FN5A 3ZDQA 3RDPA 3P32A 3PENA 4TMWA 1R0YA 2WKPA 1JR3E 2AXNA 1YRBA 3TQCA 3PEYA 4OBEA 4C4PA 1G18A 3MUFA 3EZ6A 1UF9A 2YWGA 1T91A 2WKRA 1U81A 2ZRDA 2FSFA 3B6EA 3KJHA 3KKPA 4FCWA 2D7CA 4LY6A 4DC9A 2J0SA 2QQ0A 2G77B 4FMDF 1T5IA 2GXSA 4UNSA 2IXEA 3PEWA 1M8PA 2P6UA 3TAUA 5LD2C 2D62A 2HXSA 4BPBA 1GKYA 1YVDA 3TUZC 1WRBA 4CEJB 1KKLA 4DSUA 1JJ7A 3L8YA 1A5TA 3AKEA 3AKDA 3OHMA 5K8TA 5CM8B 4EJSC 4RD6A 1M2OB 4QHSA 4LRWA 3D7MA 4MKGA 1XTIA 3ND9A 3BRWD 2F7SA 4BFVA 1XD8A 3U60B 2A2ZA 5HCNA 5SZKB 4GP7A 2OG2A 3SBDA 3GJ8A 3KL4A 3SNHA 3K70B 1NRJB 4BLSA 4HAUA 2GILA 4IEIA 4R2HA 1AGPA 2GVDC 2VSXA 4IVPA 1EESA 1KO5A 5HPYB 4P4SB 2W2VA 4AG6A 2OBLA 2PEYA 2QY9A 4B6FA 1CEEA 1XBTA 1OPXA 4K81B 3EA5A 4OI4A 4DEYA 2DY1A 2IL1A 2X77A 3BXZA 4Q7LA 3SYNA 1OE0A 4TMZA 4P33A 5AJXA 4KLNA 4OL0A 3TJZA 1ETUA 3NHAA 1ZINA 3VKWA 1WP9A 2VLIA 5K8IA 1CR0A 1R0ZA 4WW0A 5DIFA 1X6VA 4LJ8A 4PPQA 1KSGA 1HH4A 4G5GA 1XPUA 4E07A 3KUCA 3K0AA 4PO9A 3L0OA 4HYYA 5FUXA 3ZZTA 4POAA 1VG8A 4JT4A 1MO4A 1MKYA 1NJGA 1D2NA 1Z08A 1RC8A 2JEOA 1BYIA 1YZNA 2F1HA 1KMQA 1J70A 4PTLA 2DCUA 1UEJA 4IFEA 1XD9A 3WP1B 2O8EB 5EZ6B 2IBMA 3EW9A 4C3ZA 4B34A 4ZDIA 5JZVA 3IEUA 1W36B 3K70D 1BO6A 1KI7A 4TL7A 3UMSA 4YQFA 1WQ1R 2ZRAA 4ZKEA 5IF9A 1VHTA 2QMOA 1DTSA 1JR3A 3VNVA 2WWXA 3RS5A 2J45A 4GOKA 2CNWD 2JLXA 2ZRKA 1RZ3A 3BIFA 4G0NA 1CLUA 4QBIA 4TYQA 1AM4D 2WJJA 3DM5A 2PT7A 1E9AA 2IHBA 1GILA 1P5ZB 5B2ZA 5JWOA 1T3SA 5L3QB 5FOWA 5GJCA 2QP3A 2PL3A 3KQUA 1KK3A 4KSBA 3EWAA 4DLXA 2EFEB 2IX3A 3QXHA 3MWLA 3SZRA 1S1CA 3U5ZB 3TR5A 5FOTA 3VR3A 1NVVQ 2HCJB 4KAXA 4O25A 2WWHA 1FX0A 2GZHA 3NEJA 4L9SA 2P0EA 4TLDA 3ZLJA 1W4CA 2NGRA 1CRQA 3K0FA 1UAAA 3AM1A 4AY2A 2D2EA 4B47A 4TQ9A 2RGEA 2GJ8A 2F43A 3NBXX 4TLCA 3W6NA 1UADA 2Q6TA 3NXSA 1NSTA 2NPFA 5F98A 3QBVA 1XJCA 1U0JA 4GNKA 1CULC 2MSCB 1VCMA 4DT1B 2W6IA 1W36D 1P2SA 2IYYA 3U3JA 2PCJA 4AIIA 2AFIE 1O3YA 2KWIA 3A1SA 4QM7A 4RFVA 3HWSA 2FU5C 2GK7A 2P6RA 3H84A 3KQNA 2W6JA 4QGHA 2GZAA 4EQ6B
chains in the Genus database with same CATH superfamily
3UFBA 1E9RA 3MJEA 3PFBA 3NWBA 2L18A 4I8DA 1N2CB 4W5TA 1J5XA 3FOZA 4P81A 5ABPA 2OBNA 3AOEA 3E9DA 3K1AA 4E2WA 5EE9A 1RJFA 1HETA 3KYJB 3NUQA 2YXPX 4MPPA 2QTLA 2G4VA 3IPXA 5IVPA 3LDUA 2PUHA 4RMNA 5FPKA 3BVPA 3SSOA 5LP6F 4BEJA 3HKDA 1UEIA 4QQFA 2J5RA 1AK9A 3HR4A 2XYHA 1LBHA 1I0ZA 3E7WA 4UHFA 4BWFB 3HVJA 3RM3A 2H16A 1T4CA 2FK7A 4IICA 4BLQA 5CFPA 5LU8A 2XV1A 1U90A 1NDUA 4RNCA 4XXHA 5B58T 2B1RA 3T5DA 3KFLA 4GKJB 3PHIA 4C7BA 2LD4A 1AKYA 3G02A 3IB3A 3PNLA 5JBIA 2BKXA 2EJCA 2AJBA 1GEGA 4IJVA 821PA 1S2IA 3WLEA 5JH7F 2XOEA 3H2ZA 1EWQA 1ZHFA 3JQQA 1QVZA 1YRQA 4IIFA 1P91A 3UT6A 3TW6A 1N0WA 4FDAA 3NASA 4X95A 2FH5B 5K8UA 1IXRC 4DR7B 4JWKA 1EUCA 2OL4A 4PZEA 1K5DA 1SU7A 3L5KA 1WNTA 1NX9A 2C0PA 1P0IA 1HO3A 2GAAA 1ZVJA 3M4ZA 4RE5A 5EXPA 5A3QA 3F67A 5JQWA 1PJQA 3B78A 3KELA 3SE0A 2GEFA 1G8SA 2QMZA 3SSNA 3ZDAA 3IKMB 3V1YA 1ZD9A 3Q5EA 3LL7A 3PNYA 1O7JA 5JATA 2A9RA 3KBBA 3STVA 4A23A 2G76A 3R9IA 4UAGA 1U1IA 4KX5A 5TSDA 1V9LA 3TS1A 3ZWQA 3M8KA 2P9JA 5AM1A 2VAVA 3FKQA 2RHWA 3HFSA 5EJ2A 1Z0DA 1NXWA 5FRDA 2P9BA 2H4HA 3LCRA 2VBIA 3S3TA 2JZOA 4NOMA 3V1LA 3OZUA 1KJ8A 4R05A 4BMVA 4K05A 1QKJA 2N1BA 3N2ZB 3LC0A 2DC1A 2O1SA 2IV2X 2ZE5A 3OOJA 4IOJA 4KFRA 4ARZB 5CA0F 5IUJC 5LQJA 2A67A 4FGZA 4L8FA 5CITA 3DEAA 2P1RA 3ORYA 4CE6A 1Y8RB 4I55F 3I61A 3DVSX 3QHPA 5JV5A 1QAQA 5J4HA 1WP4A 3FMOB 3JSXA 5B5SA 4LHXA 2PH1A 4GOJA 1PZHA 2A4KA 3C6KA 5JWHA 1KA9H 5THXA 4DWOA 1YFZA 3PIRA 4PZ9A 3RSCA 2BFDA 4HEA6 1JYFA 2AI3A 2AFIA 1T25A 3F73A 3PQ4A 4ZC1A 6CHYA 1RRGA 3GR6A 2ID7A 4F11A 1C3EA 4U5XA 3QA9A 3IERA 1M6HA 1A8UA 1UUFA 5CJJA 1JU3A 3WL6A 1SXJE 1KJNA 1ZRHA 2VLBA 2WSSD 3A3KA 1EK1A 1XZFA 2AR0A 4FUTA 4FUQA 4MB0A 2GH1A 3LYLA 5C81A 4UUMA 1W59A 2I29A 3BGDA 3MSXA 4YYZA 4ZJUA 2PD6A 2AD5A 1E18A 1V6CA 1WB5A 3GAAA 4HDSB 1USKA 3ZY2A 5KYKA 2BVNA 1U7HA 3PX3A 4OHRA 3CLUD 1AKRA 5ISMA 3B9BA 4URWR 3QJYA 5KKCA 1EVEA 5DP1A 4OQFA 5F4ZA 2WAAA 3PF8A 2GRUA 3C1AA 2IS4A 2OTCA 4RA6A 1ANKA 1NDHA 2OAP1 4AQYB 4V0LA 3N7AA 4V3CA 1M8FA 4NECA 3DZGA 1LPAB 3TQQA 1W36D 3LPMA 2DP4E 3AUJB 5EY5B 4AZ0B 4OHPA 1C1XA 1DO0A 1WX1A 4DUGD 4RVNA 4Q1FA 4AUNA 4ALKA 4YJ2A 1NW4A 4LY3A 6Q21A 2ERYA 1ORWA 4MCHA 3URMA 1T2FA 4RKWA 4F71A 3M5WA 4OM7A 4Q9AA 3AUUA 4QDUA 2GJ9A 3HYCA 3II6X 4H4EA 3QY9A 4IBOA 4L5AA 5G4KB 1GZUA 2IP1A 4ZTZB 2XWJI 4FS3A 3C15C 4URYR 3HCAA 4PHGA 1EFKA 2W11A 4OPMA 1G8YA 1UDXA 4EL0A 5EA2A 3EEYA 2CW5A 1S2MA 2GN6A 3KPWA 2DVMA 4G5OA 4JJIA 4PG7A 1YBFA 3C98A 4RDCA 1EFUA 1XA0A 1EGVB 1F8FA 1R0RE 2CFTA 2P4HX 3F6SA 4GHWA 3B3JA 1HEUA 1UK9A 2QU7A 3OUUA 1MZPA 1B73A 3D1VA 1YVUA 4JL5A 4JLNA 2CK3A 3DPSA 3AG6A 1NUSA 4DSAA 1J8VA 5EIBC 1GG8A 4KUEA 1SOMA 4DADA 1OAOA 4EMTA 2J6BA 1BHJA 3ZWAA 1INLA 4PS0A 3C6YA 3NTOA 1DC4A 1L6IA 1F48A 4MJ3A 5CT5A 2Z57A 4RXTA 2ZYRA 3ESQA 1CF2O 1QCYA 3HR7A 2B4AA 4FBMA 5E9JA 4BNLA 4BN5A 4D3YA 4AP6A 4LXQA 1N6KA 1M6VA 3R3HA 2C1ZA 1RQPA 2IUTA 1OCEA 2NX2A 5KTYA 1G4UR 2JGEA 1ZAYA 1NYQA 2BI7A 1K89A 3L43A 4TZKA 2VJDA 2L69A 4QXQA 2YWDA 5E7MA 4KPUA 1QHIA 3M2TA 3VHXA 1WZUA 1XCGB 4ARVA 2MSWA 5IVHA 2F2TA 5KNBD 3EGDA 4D25A 2I7CA 2D3TA 5DWQA 4DA0A 2O2DA 4XUEA 1UC9A 3VGJA 1H0SA 5C1OA 3DGEC 3QKTA 1JFSA 2FSGA 2NZVG 1LV8A 3UCEA 1OROA 3QPVA 1D4FA 1GNLA 2VJLA 3FY4A 3OPYI 3PHCA 5JJCA 2ZRHA 3LQYA 1VE6A 1YB1A 1SXJA 3AF5A 4PVCA 3FXAA 3GT4A 1QCDA 4XX0B 5BSUA 1JIXA 4OQYA 3RU2A 3S7TA 5CDGA 1H1DA 4RU1A 5B3JC 3SD7A 3ENKA 3ONDA 2NU7A 4I1IA 1XZNA 4RF3A 3UWOA 2LR0A 2A9FA 3BSYA 1FX0B 2HGSA 3LWBA 5CB4F 1AQJA 1G6OA 4XQEA 3HG7A 3OEEA 3KYCB 3P5SA 4JOQA 5I4IA 1K5PA 2F3UA 2DWOA 5EFOA 1SD1A 1TAHA 4XTRA 3VI4B 4XQ0A 4QNRA 4RK6A 3UJBA 1R9GA 2VDVE 1Y6ZA 3ZU6A 1WOYA 3K35A 1H65A 3O8QB 1JA1A 2YZMA 3U37A 3GCWA 4JBXA 1CCWA 1IIRA 1YS2X 3CZQA 1RYMA 2IXFA 2NSLA 5U4QA 1MO5A 1VJDA 2X0RA 4HEA1 5JISA 2FHPA 5AXAA 3I12A 3SLRA 5IULC 4KI0A 3TMAA 3WMXA 4FZ3A 4IM7A 5AHKA 4CM7A 4MRAA 1JEYA 3BRWA 3SN6A 1EVJA 3CEHA 3P5BA 2VXBA 1PW7A 5DRYA 1PZXA 3GRVA 3STUA 4KQGA 4AU1A 5K8VA 3OLXA 1P73A 2QLJA 1FC0A 2ZIUB 1SU4A 5PGMA 4GEGA 2V59A 5JVDA 3N6RA 3I04M 1JEQA 1CEYA 3JQAB 5TPZA 4AY5A 1RHJA 1LVUA 1R12A 2ZUWA 1ZR2A 4UTXA 1CY8A 3OQIA 1VKRA 4GPIB 2IEZA 3IHWA 5C5CA 1HMYA 2A5LA 5DCUA 5F5LA 3I9KA 4HOYA 5K3DA 3BXOA 4JOCA 3ZHXA 3E22B 3KPJA 4KNWA 1NBME 2OLJA 1YCHA 3LNTA 1UBLS 4BU1A 3DBOB 1UMCB 4LBZA 2YV1A 2D06A 1V9SA 1GL6A 2I4TA 1JPJA 4V0MA 4A2CA 2XXAB 2QM7A 2VHEA 2VZEA 1SPBS 3IILA 5DNVA 2WP0A 2FF5A 4BO9A 2ZVJA 4U8HA 1WL8A 2WIFA 4DNFA 2FR0A 2Z9CA 3AQ4A 1GZVA 1DJQA 4OG2A 4Q4JA 4MUKA 4S2UA 2QD2A 3BPSA 2VHWA 1BCRB 3AYZB 1MRNA 3TQRA 2BMJA 5EWLB 2Q9AA 3HJNA 3HVUA 3VMMA 3L4EA 3Q8XB 3ZXYA 1BXKA 3J7TA 4ZO7A 5YASA 1C7EA 5FI0B 1XLTA 1L4UA 4DPLA 1GPDG 2VT2A 4UHCA 4DBZA 1KZ7B 1YBHA 3L9WA 4D9GA 2XKJE 1EM8A 1T3GA 1EVIA 2XQGA 2D00A 1R0WA 3ESRA 3O8OA 4EGSA 1RXYA 4FHZA 1Q17A 4R8RA 4GIBA 2W42A 2H2HA 2OFPA 5T4EA 3K9HA 3IOCA 1ZD3A 4NENB 1M1NA 1MW8X 2YXNA 3GRAA 2P11A 3SBXA 5CLJA 1KTIA 4CQMB 3F5QA 4IIJA 1BU8A 2F1KA 3FMVA 3GY0A 1BTOA 2Q8QA 3EVNA 4L6IA 4LZAA 4E31A 1YO6A 4RBNA 4F38A 4NBKA 3CN9A 3ZE1B 4B79A 4Q01A 1K6EA 1TFUA 2D1RA 4MDHA 4EABA 4BQRA 1MT3A 2J33A 3V7FA 1G8HA 4TN1A 3U9TA 1BFKA 4LX8A 1CUYA 3GFGA 3QA3E 3TUJC 3RIHA 2K4MA 4HPWA 3FHLA 3SE7A 4YJFA 5B57C 2CLCX 3K9NA 4KO2S 1OWMA 1ZPDA 4L51A 2I7XA 2GD0A 3LDAA 3PC3A 4DQDA 3PJGA 1T2EA 2NO9A 3P9QA 1GSIA 1P2UA 2IGTA 4KXXA 3TLAA 4M9ZA 3S1LA 3RVMA 4D8YA 3LK6A 1FNMA 1QPBA 3H11B 3MYRA 4X7BA 4XZ3A 4EO4A 1LDBA 3B5JA 3CW9A 3M6IA 1OXXK 5I51A 3QU7A 1K3TA 2ES4A 2AC2A 2UUAB 4IHJF 2OQVA 3A2LA 3TE6A 1SEPA 3M6MD 4LDZA 5AXBA 3V2HA 1EFHA 2G0AA 1TYEB 2HO4A 2ZSDA 2X0IA 3K96A 2IITA 4PNPA 2EQ5A 3MG9A 4MA0A 4UASA 3F6RA 2YUIA 4PCVA 1ZBQA 1NBMA 2OORA 1DKMA 3A3PA 4KVFA 1U9YA 5IMBA 3ABOB 1H3EA 3D3NA 3GLFE 4Q9JA 1II8B 5FWXA 1RMYA 5HOEA 2ZULA 1N5JA 3L49A 3CZ5A 5KSPA 3AOEC 2BLLA 5TV2A 3SJCA 5IDVA 3FPCA 2CUZA 1JECA 1XDWA 3ACBA 4TKMA 4WIAA 3VU9A 1B42A 1BU5A 5F73A 1U6JA 3UIEA 4LDAA 2I66A 2LKCA 1V5EA 4KKVA 3OP4A 4ZVQA 4MVXA 5K3SA 2HNAA 5FTNA 4CL0A 2XY4A 2I4LA 1MFPA 1TRKA 3B12A 4YGYA 2BZ1A 3TZEA 3BD8A 4WXYB 1VQ1A 1ZUWA 2J5QA 1Y9AA 3L1UA 4E09A 2VNHA 2RONA 2IEGA 3JQ8A 5DSXA 4MDEA 1TKBA 3TRDA 4BFSA 1RDFA 2XH8A 4U00A 2NYVA 1F8XA 4AJEA 4D8WA 2I6TA 4FYIA 5H9VA 5BQXA 2PT9A 1XU4A 4LW8A 4KRYA 3A9RA 4CMIB 1QYWA 1CK4A 3EDCA 3ABRB 3G8YA 1VMKA 4QL3A 4DAEA 2HQOA 4CKWB 1MJNA 2P4EA 3PJEA 2GOYA 2YJGA 3A4MA 1AV7A 3BFPA 4QGAA 1XUOA 5FADA 4FJ2A 5TMDA 3TLKA 4DHEA 2Y2VA 5FTKA 1BIFA 1I3MA 3HJAA 2VRCD 3COZA 1A9YA 3QXXA 4IO0A 4FYPA 4Y1EA 1T2VA 4E03A 4Y9RA 3TW4A 2WA1A 3HPRA 4GOMD 2HF8A 1JH9A 4DC0A 4QHTA 4ZQBA 4D9JA 5IZ4A 2WHRA 3FGPA 1NQWA 4X45A 2PMCA 3A1FA 5HFNA 3RT1A 2J6HA 4KQFA 1J4AA 1SVMA 3HZZA 3WB0A 5JS7A 4UFOA 1YONA 3R5TA 3GA5A 1T4MA 2H4ZA 4HGZA 4FCTA 4G5YA 1N6LA 4WSOA 1XFDA 2E4VA 2YIVX 3C97A 3OE4A 4X7PA 1ZBDA 3DTVA 4GLFA 4ZJZA 2WAYA 3V8QA 5J2TA 2D2FA 3QEBZ 4MVJM 5ENZA 5BN4B 5FIUA 1W6RA 4DBVO 1QQ7A 1P1JA 1W4BA 2GJAA 3DFUA 1DADA 2GN1A 1LEHA 1UKZA 3JYOA 4LC0A 2ONCA 2WSLA 4F97A 1K3FA 1KY2A 3FFAA 3QNMA 3RSSA 4CTJA 1SXQA 2QZSA 1DELA 1CRLA 2R6CA 3BDVA 4M87A 3VMFA 5ECYA 1PR9A 3EQ9A 1Z39A 3IKJA 1KDYA 3BX1A 3SCZA 1MR3F 4EW3A 3SHFA 3AFNA 3VO1A 4YMWA 3U9LA 1JG6A 1ZD2P 5TPWB 5TS3A 4C1NA 3SZ3A 3PDUA 4YJGA 1IC6A 4GBMA 5BP7A 1X42A 4EYSA 5IEJA 3LS2A 1W49A 3GLFA 2BFBB 4JV5B 1HDXA 5CGZA 2NYUA 1JFFB 1AK2A 2WE8A 4G1VA 3Q7PA 4G67A 4WOKA 3OOHA 4O2AF 8AT1A 4TZ0A 2C99A 2GLTA 4UATA 3C5HA 2D7JA 5EJ7A 3GVCA 1C8LA 1H0HA 3PLAE 1ILWA 2VK4A 1OBFO 1WMAA 2N9UA 4MS3B 5DYGA 3T0FA 4DA6A 1ZNXA 4PXYA 4BQSA 2ZJ7A 1MQAA 1ST2A 3NMUF 1NJ8A 2AXEA 3CN7A 2QENA 3BK1A 1DCFA 5FD8A 2UV8A 4I3HA 2V4ZA 2VRBA 2GEDA 4P4TA 4S2EA 4IH4A 1H4TA 2ESRA 2P75A 4I5GA 5G0UA 1CZHA 3ZE0B 1XAGA 3NQ41 4PYJA 3U61B 5JIBA 5DLDA 2VA8A 1QH8B 1YI8A 3ANNA 3CPSA 1XMIA 2FPSA 4DMLA 2I1LA 1R4MB 3Q41A 1KVTA 5AVZA 5K1ZA 1RJEA 4IXMA 2YIJA 5ALOA 1ADJA 3GVIA 4HAYA 2YYYA 4WNAB 2PG3A 5JBNA 4UAJA 7MDHA 1K4KA 5EHXA 1K97A 4EHKA 1RQNA 1C7QA 2PLRA 4FYWA 2WY2D 5IDQA 2Z8XA 1DC6A 2WJZB 2Z5FA 4CWAA 3MTJA 1PJ8A 2HMVA 2NZXA 3EXAA 4FNGA 4PZDA 4XSGA 4DLUA 5EJAA 4EUHA 1L8AA 4II7A 1C30A 2Q2VA 2V7WA 3FWNA 4L3WA 4L8VA 1SMKA 2GSWA 2B4RO 4EATA 2GCIA 4HNAA 5CT6A 4LVCA 3H19A 3NP7A 1I1OA 4QRHA 1OX5A 4K9DA 2NTNA 4YDQA 4FKZA 2AFHB 1HTWA 4OQQA 3CRVA 4L16A 2D2VA 3F96A 4N01A 4D0NA 3QELA 4LE2A 3Q2OA 4LOIA 1X87A 3RUDA 3A6EA 2O14A 2X1LA 3G1UA 4CHTA 2AZTA 2NO0A 4RA9A 2XCLA 1ST3A 2HUPA 3URKA 4I2VA 4F5ZA 5JCZA 4JENA 1ZK3A 4FQ7A 5KNBA 5DH9A 1OV6A 2Q0QA 4C0JA 2Z2JA 3ENQA 2GFHA 4X93A 1NAHA 1EWKA 2O5CA 2G4LA 2BT4A 2Z4SA 3WL5A 5I7UA 5KHLB 1E2KA 1Q7BA 1U5CA 1DLIA 5BWOA 5CEEA 3RSHA 3SVTA 4XX1A 4AMYA 1EB9A 2C96A 4G37A 1ENPA 2OD7A 2XE7A 3ONEA 1J0DA 5BNWA 4RCZA 1DMRA 1WPRA 3IQIX 1TF7A 4EKYA 4EPWA 1SXJC 4JQYA 3PT5A 3TCXB 4ER0A 1KI4A 1UWVA 3TTVA 4Y98A 2V6FA 1R66A 3G8AA 2HGZA 3OQHA 1ZLXA 2V7BA 4LN1A 4RFLA 5IJ9A 3ZTTA 2A0FA 3EXG2 4XWKA 2CV2A 1VSQA 4ZAYA 3GEPA 4O4HA 4ZOCA 2IGBA 3HHEA 5AJZA 4ZJPA 1F2DA 4PRZA 4YCBA 4EVSA 2B6HA 5FH9A 5IANA 1BEEA 2CUNA 3AB7A 3AY7A 3JQGB 1G5FA 1VIMA 3P9IA 1Z4MA 4PZ0A 3THWB 4KN8A 3HPQA 3FYDA 3BBPA 1C3LA 4ZTBA 1GUZA 5A9SA 5I45A 5DM70 2GQ0A 2RK6A 5EQTA 4S1OA 3IX7A 4J7UA 5TQ0A 1FZQA 1QDLB 1N8SA 2PMKA 1ZC4A 4I4IA 1G2IA 1PFYA 3BORA 3QYJA 1G8PA 4NMLA 2VRNA 1N2GA 2CFRA 1ID8A 1KI9A 1J2TA 4I4TB 4YMUA 4XRRA 1UJBA 1XZAA 4GXNA 3O83A 5B1YA 3ZE7A 5HX7A 3HEAA 5KWIA 4YT5A 1CUSA 4HRYA 4M89A 1R0XA 2HC9A 4YPFA 1OTHA 3VKGA 2IYAA 2J7PA 1M9NA 4QUAA 3V00A 5F51A 1OB2A 1T1IA 3IAUA 2HJHA 1FFDA 3AIKA 2JG3A 1JTVA 2ZIVB 1B6SA 1I2DA 1VC2A 3EIHA 4ISBA 4LX0A 5T5QA 2REQB 4XPZA 1EDDA 3GLHB 2PUVA 2X5KO 4UMFA 2P35A 3OZDA 4XYBA 3MW8A 2JGKA 3HXKA 5GJVC 3V55A 1U99A 3G9QA 4ZU3A 3ZNPA 3UJ9A 2W2PA 1EHIA 1HQCA 5K3BA 4WZBB 1JIUA 4HDNA 3OQOA 4R9RA 3RROA 2QBYA 5EXXA 1WZIA 1TO1E 3UAZA 3C6XA 2I4IA 4RVOA 4A0QA 2ATXA 4REQB 4NIMA 1NY6A 3CH6A 4KXLA 2CHEA 5EPOA 1UT8A 4WY8A 4NBLA 2IK8A 2PZ8A 2H8GA 2VHJA 1U8AA 2CCGA 3AO0B 1FPMA 1D04A 1TGYA 1Y82A 1OX4B 3E84A 1MAAA 1XPJA 2VYNA 3ZDXB 1J0XO 4A0FA 1EUYA 3H4MA 1QRSA 1WZEA 4NATA 1RI1A 2W2QA 3N7UA 1YR6A 1GITA 1N57A 3HH8A 3IXMA 3N39C 1E8NA 4TLAA 4TSFD 3UT5B 5KU7A 2WM3A 1S2DA 1XLTC 2QZPA 4P54A 3I0NA 4PG4A 4BC1A 1SC4A 1ULTA 4FR5A 2AEMA 4RGQA 2JJ1D 3I2IA 5BVHA 4E30A 1ABBA 1MOPA 3AVWA 2V7GA 4AULA 2C9OA 3TN7A 2AXQA 3BL5A 2VJMA 4MDYA 3GZNB 4E2XA 4BAGA 2JGJA 2QXYA 5JSZB 4O2BF 4RV4A 1HDRA 2YQ4A 3AU8A 2IU0A 4AICA 4RJTA 1DOHA 1EG7A 1T3LA 1AGXA 3C8HA 1R5NA 3EODA 3EVZA 3FDZB 3G0BA 2B8WA 3A04A 3HP4A 2HXYA 1XYGA 3JQ7B 3LY9A 5LYJA 1BWRA 4KC0A 3QWFA 5IF3A 1WCXA 3MLBA 3NLLA 3ND8A 1YL6A 3WLPA 4DWVA 2G1KA 3DDCA 2DPMA 3O0DA 2GJKA 3OMXA 3TW0A 2B99A 3BMCB 4RPLA 3OBBA 4Q9NA 1BWSA 1HFJA 2ZJAA 1RRMA 1SVKA 3GV0A 2CHGA 4FTWA 2V98A 1EXMA 1M6WA 4B4VA 4DR3B 1C0PA 2UVQA 1BH2A 1W73A 2CEKA 5DASA 3HJBA 4G86A 3RB8A 4BP8A 3L8EA 2VXCA 2PLWA 3UA4A 3DEYX 3UWSA 2O5RA 2JI4A 3NHJA 4A16A 1TC2A 2BM0A 1QHFA 1V16A 1RRKA 1U5AA 1YS1X 3AESA 2D1QA 1ZIOA 3GB9A 4IS3A 5GONF 3SHWA 3ZV4A 5A5VA 3COPA 4L5IA 4P3KA 3UATA 1F4PA 1PJLA 1Y1QA 1ZEJA 5ALZA 1P80A 3RRFA 2FFHA 4JJ6A 5DZSA 4BFWA 5HKOA 1O1YA 2JLAA 1A1SA 3R3VA 2WF7A 4DPMA 2JLVA 3KJIA 4YTEA 2Z56A 3AXTA 3MZ0A 3A6GA 3N2LA 2ODEA 4TM7A 4AJ1A 1G20B 2AZDA 2ZTSA 5DYYA 3SDBA 4C89A 2G5CA 2PQ0A 4V0QA 5BT9A 1ULAA 4ZAGA 1U02A 1GFWA 4WZAA 4UQLA 4B7ZA 4PONA 1M33A 2FSHA 1TPZA 4KAJA 1JHZA 5JAPA 1N6HA 3FNBA 4UQOA 3KR0A 1E1QD 4M7OA 1MXHA 3I34X 2GESA 4XYEA 1UBKS 2J9YB 2OORC 1AJEA 4U7WA 2ETXA 1PNVA 3SF8B 1FF9A 3UENA 1ZUHA 4IP0A 3UHOA 2XAAA 3HY6A 2BFFB 3MOGA 5GM2A 2CVFA 5EGNA 4R51A 3GO4A 4A7PA 4P8RA 5BV8A 1ZGGA 1ZH0A 2X4LA 3Q6IA 4MVJF 2CL6X 1KU0A 4QBGB 4X41A 4YAOA 5D7BA 4MIEA 3D59A 1MG5A 3JPWA 4PNHA 4TTPA 4U2BA 1RS0A 4L4UA 3WXMA 3AF1A 4D4LA 2FWRA 2AS0A 1UBFA 1R8XA 2E49A 1IIBA 2BSAA 4GPZA 1U3VA 1GNTA 2B78A 3KV1A 1E6KA 1I3NA 5K0EA 3N86A 2H08A 2CMFA 3LCJA 3IHTA 3JAWA 2JLWA 5F9HA 3ICQB 1W85B 1M1XB 3FCEA 1OW3B 5CIWA 3D4IA 2EFHB 4N5IX 1TYAE 2QRGA 1QX4A 4AB1A 2A86A 2AMLA 1NLFA 1V7PC 2ZJYA 2HB6A 1RI3A 2EBFX 1JDJA 3LMKA 3HL4A 1A88A 3UMBA 2F1OA 4WLVA 8ABPA 1XC7A 1WXWA 5KTTA 1LDYA 3UPTA 1ADBA 4BFZA 5JNUA 3BXGA 1JHQA 2X1HA 3HYLA 3K8OE 1MFZA 4RGVA 5LM3A 1XCMA 1BS1A 1S8NA 1W7AA 4I4LA 3EDQA 3UJDA 5LKAA 2VHUA 3W7BA 1V1JA 2IWHA 3KOXA 1I10A 3H17A 3K0KA 2F90A 1CY2A 3VGPA 2HPZA 1IN7A 4HXFB 4CODB 1C8VB 2H18A 3W3AA 1UK7A 3GZ4A 1S4QA 2QUAA 1XGKA 1PIWA 5TGZA 2FZ5A 2KS6A 4KMSA 2JD2A 1O5TA 4DY4A 1S96A 2G28A 3FMPB 1FE8A 3VFDA 2CHUA 1A77A 4I19A 5AXCA 3W4JA 2IEIA 4LBVA 1GFSA 2DQYA 3LM8A 2ZRFA 4M1KA 1T3TA 3QBDA 1RYNA 1R88A 2HK9A 4AXXA 1Z37A 3W05A 3PP8A 2B5OA 1J0CA 4MYRA 2V7QD 1UJ2A 2VDRB 2PRIA 3QVMA 1DG9A 4YJHB 3WWYA 3STXA 1NUQA 3TX2A 2JBAA 1RAFA 2VXYA 3HRHA 2GCNA 2P4UA 4MGKR 4CLXA 3CUKA 4MWZA 2C5LA 3ZZMA 2GEBA 1GGHA 2Y8EA 3IT1A 4F5DA 5ED4A 5IU6A 1SR8A 4PTYA 3D6NB 3EQ8A 1MC4A 3ZWPA 1D1QA 1OYYA 2XYPA 3E27A 3NVKI 1YAHA 2Q6IA 2I2BA 5B30A 4IUDS 3O7MA 3UJNA 1FDUA 2RH8A 5AUPB 2NTVA 4D3FA 5IRCD 1M0SA 3VPFA 3FI0A 2QE7A 3OAAA 4CEHA 1JWBB 1JU9A 2CC2A 3NOXA 4BFUA 3VVBA 4RTPA 2ZKLA 3F98A 3C7TA 4FC7A 2I80A 4P4GA 1T8SA 4Q1CA 1FUYB 4DLTA 5IM5A 2C5HA 3AM5A 4EA8A 2R85A 2TMKA 4TS9A 1XTKA 2E3JA 1C9EA 2HSJA 3D31A 5G0TA 3ILHA 2ZSFA 1GPAA 4IVRA 5HGXA 1L5VA 3ULKA 2P9FA 4CL2A 3REFA 3OZGA 1BA3A 2WG0A 1MGOA 3MAAC 4QOEA 1L8QA 5FPYA 3GMDA 1NWCA 2BEUB 2CL0X 5BR4A 5FUMA 2QRVB 3H8WA 1JAYA 2DBRA 4J1NA 4JBWA 3VKVA 4EL5A 1HI9A 2BGJA 2QTRA 3EIXA 4FOPA 3CLKA 3V1NA 5HP4A 2JASA 4Y2HA 5EIEA 4PQYA 5KYWA 1EFPA 1XD2A 1QG6A 1K8ZB 2WT4A 3MELA 3KQOA 5JMTA 2EWMA 8MHTA 3MBIA 2P9GA 1A5BB 2NSDA 3RS3A 4RJ2A 3KD2A 3WISA 3ZZUA 5B2FA 5LA6A 2Y6VA 3THXB 2SKCA 1V8ZA 1VXRA 2AG5A 3OU6A 1QGUA 1FNCA 3OOYA 3PUYA 1LKZA 3OECA 4I36A 2EARA 2E6UX 5ECWA 1QFXA 1L4YA 1O97C 2BGTA 3SYKA 2VHCA 4DV3B 4LZWA 2E0IA 2BZ0A 4UC0A 5FBWB 4C7VA 4KO1S 4MO2A 1U0RA 4MVWA 3SXJA 4AO6A 2VDUE 3OZEA 4P31A 4H4CA 2FN4A 4JROA 2QLMA 4QU9A 2ISQA 4AJ9A 3AHHA 3RS9A 2QI9C 3G5TA 2FSUA 1T0JB 1A50B 4DIOA 3L18A 3H65A 5JEDA 1MA3A 3NHUA 5EXTA 5DX1A 3Q4GA 1JPNA 5C8VA 4LHZA 4CFSA 2O7SA 1QRDA 4UCFA 1FMTA 3TR0A 2D1YA 4TKLA 4E11A 4WJLA 4LQLA 1UPTA 2ENUA 2ZE7A 2NUBA 2O59A 4PG6A 4X8HA 1Y4AE 3QEOA 4IJQA 4UNPA 4YO7A 3RS2A 2RGBA 4M1QA 2NACA 3UQZA 3W2TA 1Q0TA 3A6PC 4M9QA 2VHQA 4RVSA 3D6MA 1MB9A 4PC1A 1N3IA 3LXXA 4Q02A 3U3XA 1AIPA 4D92A 2ODAA 1OXKB 4HH4A 4Q93A 5FL3A 5REQB 4HL6A 5IHXA 2XVXA 1XRNA 1E92A 1E9BA 4TMVA 1KEZA 3HLKA 4E88A 2GYUA 3CZAA 5AKGA 1IOWA 2FWMX 3PICA 1JR4A 1UBHS 1YCDA 3LZDA 3FZGA 2VUUA 4BNTA 1SHKA 5AW9A 3BJRA 1E3QA 2RH4A 1YZGA 5IN5A 4Q9KA 1O96A 4EJ2A 5JD3A 3FOEC 1BXGB 1S02A 3BFXA 4NABA 1Q14A 4AKTA 4LWQA 2Q6KA 4MYTA 4ZJYA 1RXWA 2C2ZA 2QTVB 1NF2A 5A3VA 3MT9A 1EWRA 2ZBUA 1L3BA 2V6GA 4OXYA 2YVKA 2MDTA 2WD7A 5EWJB 2C20A 2V0GA 4ZVUA 4LF5B 4G0ZA 4WCVA 3EPLA 1JJAA 2VJBA 3VI3B 3G2NA 4L73A 5C46F 1IWPB 4Q3BA 1VIDA 3L7JA 4Q7KA 3QTBA 1TZKA 4U6QA 5L3SB 5J3JA 1VECA 3J7AC 5EL0A 4D6YA 1E58A 3AHJA 2RCYA 1PDOA 4IZOA 4KQ9A 3RSFA 4QG3A 3W8RA 1ZN2A 1LBEA 1JL3A 3G2JA 4G0OA 5DGDA 3TFOA 5FBKA 1OWLA 5EG5A 1NW3A 4JP5A 3SM9A 5KCZA 2IWRA 4Q05A 2DFPA 4F4JA 1C2TA 1JN0A 2JFUA 1V1RB 3NETA 1KP2A 2Q1SA 5T8KA 2FZEA 1XEXA 2VAWA 2Y27A 4JYAB 4KFSA 1D8AA 4WQMA 2J4FA 1IUOA 4DHWA 1H6CA 1WY5A 2W2XA 3CT6A 5SZIA 1J56A 3Q1KA 3BQNB 1QKKA 4UCQA 1CV2A 3IQFA 4AT1A 4QJ3A 1NP7A 3AF6A 4HLNA 5IC6A 3UB3A 5JMWA 1T36A 3R8XA 2HQBA 1JDTA 3UTCA 4MX8A 3BD6A 4H1UA 4XM1A 2Y3IA 2G82A 1DWUA 1W5AA 1VHWA 2V3WA 2ZS8A 1E2PA 6LDHA 4TYWA 3LXMA 5IK2D 5LLTA 1D9ZA 1DJPA 4XB2A 4YUXA 3CH4B 4G4SO 4F3NA 1W44A 2PSEA 1IZ9A 1NV9A 1RXIA 2HMWA 3P19A 4D7AA 1QBGA 1U28A 1J07A 2FZGA 4BNWA 4FLMA 2ZIGA 1M2EA 4OB8A 2Z1DA 2VS1A 3O4HA 3F49S 1MC5A 2IPOA 1N9KA 3WDLA 4F86A 3CVJA 3KXLA 4A0GA 4LE1A 4IO1A 1YHZA 5DE3A 3RADC 4DCJA 1KY3A 4OHFA 1B00A 4ZXPA 4Y1RA 2PH5A 5DCLA 2H4WA 1JXMA 5D3MA 5DHUA 1G60A 3BGSA 5HDQA 1KC3A 3N2KB 4R1TA 4Z0HO 3FPSA 4DCSA 1KMIY 3OQJA 3OO1A 3WL4A 1NBOA 2C2XA 1K7YA 2PWPA 2W0SA 1SIUA 2YHSA 3KZNA 4AZTA 1LBIA 4XFJA 3EIUA 1RMTA 4Y7CA 3H97A 2VVTA 4TS3A 3NTUA 4XFKA 1I1HA 5CDFA 4F56A 1Z9BA 4ZPXA 3IV6A 4HNTA 3M34A 3A6FA 2XADA 1DO2A 2Z30A 4XVQA 3HQ4O 2OSBA 4F91B 4A91A 1MTZA 2WWVD 3OLQA 2V03A 1G64A 3IIJA 3OETA 2BFEA 4B33A 1XK6A 1J90A 4NFHA 3PL5A 5JAQA 3T15A 2JEZA 1T6BY 1MLDA 3ANTA 1GUFA 3L9XA 5A3JA 4Z53A 1AKUA 5DN6D 1M67A 2ZWAA 2BGRA 1BHQ1 4XDYA 5DNDA 1GA1A 5J2UA 4I4NA 2VKTA 1UBOS 5FO1A 2OHOA 3ZW9A 5FXMA 2G1UA 5BPHA 3DCJA 5JD5A 4S05A 4BJ5A 2TMYA 3NBZC 3BCHA 3FHOA 3H2IA 2JCGA 3KZCA 3C1OA 3CIFA 1OPRA 1NKVA 1J8MF 1LDNA 1RLMA 2QG9A 4LYGA 3WL8A 5JOQA 4D56A 3JATB 3P2MA 4YPVA 2IXGA 1DJOA 2XT0A 3GBVA 4WBNB 2NSHA 4UBOA 2QJTA 1ESCA 4G07A 2G04A 4MEJA 5AK6A 4TOIA 5AVWA 5JY6A 2PRYA 3LY5A 5KQMA 1Z5GA 2FKAA 4MVJP 2C4HA 1A7AA 1EWVA 2Z9DA 3E82A 4JAVC 1Q74A 3CH5A 2EKBA 2JIRA 4NKRA 4DDMA 4YRCA 3JASB 4AMVA 4MA5A 3RYTC 3KYDB 5HFJA 2G8LA 3FNGA 2E4WA 4PYOA 1H93A 2NVUB 2DR2A 3KVRA 4ZQFA 4FZVA 1OVGA 1ABFA 4E4RA 3LL4A 1N2CA 2ARKA 1G5RA 4FNMA 1GRNA 1VKOA 2BJHA 1CLEA 3INTA 4CGZA 2GPTA 3V4LA 1CJMA 1J33A 1RHRA 3G9ZA 2D13A 2O7NA 3W5IA 1Q1GA 1UKVY 2AVNA 4QTYA 2BSXA 3GPDG 4A03A 3IMCA 2R00C 4K40A 4R8LA 5L95A 4C0KA 4ZU6X 4DCGA 1FUUA 1P3DA 3GAMA 4BX9A 3HKEB 2A5FA 4MQMA 3P0HA 5A6SA 1LCIA 3JTMA 5EXSA 3ZWYA 2FQWA 3T3GA 3CE6A 3WNBA 1M8JA 1N5DA 2I6GA 2DHQA 2ZJ6A 3OZAA 4L07A 4B5LA 5LP1A 1TJ5A 1EUQA 1ZAKA 2CCKA 3JQCA 4OCZA 3PRKE 5U1PA 4KTVE 4I55B 2OVBA 4RSMA 1ZOPA 4JQSA 1E7RA 3UYKA 3RC7A 3ABSB 3G6WA 4L27A 4DLBA 4IIHA 4U0KA 2FDCA 3F3YA 4P6VF 4D3ZA 1RQRA 3A9UA 2SKDA 1NW9B 1Z33A 3F97A 4KYUA 1M2VA 2VQ6A 1JKXA 1MX5A 2X9QA 2Y1CA 3PR1A 4EF5A 4DR1B 1BC5A 1KO7A 1U2SA 1KI6B 2B94A 2FUG6 3H18A 1SCJA 4OBBA 2CLDX 5G2OA 1A9RA 1NZJA 3GBPA 2KSQA 3HXTA 1XLUA 1QTIA 5FFFA 1XNJA 1R8QA 1XA3A 1IZYA 1DFIA 2OO7A 4J8PA 4C2BA 2ZIXA 3U7RA 1UZMA 2UXBB 1JDBB 4Z4HA 4K9PA 3DKPA 4JMLA 3WGTA 4DYHA 2XBLA 2NAFA 1F1JA 2PLAA 4Y0VA 1D7AA 3T1NA 2PAFA 4OUDB 4QG7A 3IQEA 3WK8A 4YK7A 4LWOA 1DBPA 1NSYA 3QEKA 3UB4A 1LW6E 1CY0A 2YX1A 4G5XA 2ORVA 1GNPA 1KMMA 1V5IA 1MABB 1Z5UA 2RIPA 1T9KA 2ZRLA 3OUZA 3W6PA 1P9OA 4JN6B 3EVTA 3PTAA 3ESBA 3B3AA 1U8EA 4RW0A 1ADCA 2X42A</