4RZXA

Crystal structure (type-3) of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
207
Chain Sequence
KGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure (type-3) of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords Probable thymidylate kinase
total genus 85
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rzxA00
3SQXA 2KB0A 4PSKA 1BMFA 2XEXA 3G0HA 1Y63A 4G5OA 1N6KA 2H16A 4Z8XA 3MSXA 2ZE5A 4EPRA 5IF9A 1JNYA 4KSCA 2B8WA 2H17A 5JEDA 2FPKA 1FW6A 5C18A 1G7CA 3L0OA 3PUVA 3U61B 3THWA 3AVQA 3WYAA 4CEHA 5EE1A 1XTSA 3BGWA 121PA 1J90A 3HDTA 4R2IA 3UG6A 2ZAOA 1OH7A 1LS6A 2WWHA 4F4IA 1XNJA 2VTKA 2AFHE 1E2PA 2J45A 3RLFA 3K0SA 4DLWA 4AC9A 3I61A 3GJ4A 5FR1A 3X1XA 2IXFA 4GP6A 4B74A 2RKOA 4BFTA 1XCPA 2FOLA 1NN3A 3OZXA 1JJ7A 5FOTA 3TMKA 3AP1A 1DAKA 5FI0B 3EZ2A 1G8GA 4R7ZA 3VKHA 2WJIA 1IN5A 5E4FA 1SVKA 1Z47A 4C7OA 1FL9A 4RZXA 1T3HA 4URYR 3AM1A 4ASUD 1E9RA 4LBWA 3AGPA 4QJ4A 1ZUNB 2BOVA 3VR2A 2QP4A 3VAAA 1Z06A 3RS4A 1S0UA 3TLXA 4KI0A 1XMSA 4PAMA 1KHTA 3ZH9B 1TQDA 1E98A 2HYIC 1M74A 4UJ5A 1RYHA 3C7KA 3WP1B 4LSGA 2ZJBA 5GVRA 2PMKA 1KK0A 5EQTA 3SHWA 4RZ2A 5CITA 4DIDA 4Q1BA 4BFWA 2GXSA 2ZI7A 1HV8A 2ZAMA 2ZIAA 2V6JA 4P4SA 1KMHB 4C0QC 2IF2A 3BK7A 2XTNA 1UM8A 4JL5A 4IOKA 4ESVA 1Q12A 3ADKA 1IY0A 2G3YA 2FE4A 5LBIA 1ZM4A 4BLRA 3QKRA 5FPKA 5KSOA 4DT1A 4EPYA 2B7BA 5JS8A 4KU4A 3RS2A 3SBDA 1DELA 4EPVA 2BEKA 4BRUA 5F3WB 2V7QD 2D7DA 1KK3A 2ZPTX 1BS1A 2TMKA 2KI5A 5B58C 3A4NA 1R8QA 2HDNB 4EPWA 3WNBA 3CH4B 4Q4AA 2FH5B 3B5JA 1DE0A 1ANKA 5CDFE 4DLYA 3NWJA 3PENA 4L9SA 4A9AA 4D0NA 1W36C 1KO4A 5F9FA 4HAXA 4Q7KA 1ZU4A 2W83A 1VCNA 4O0MA 4M1MA 4WZ6A 3B7GA 3GLHE 4LPKA 3FKQA 4TQUS 2XTMA 3VR6A 1XPUA 2ODWA 4LY6A 3K09C 3VQTA 1KI1A 3DM5A 1DAGA 3LD9A 2C9OA 3E1SA 3VU9B 4TLEA 3AGQA 3C5HA 4FW9A 5CIQA 3HWSA 4ABYA 3K9LA 4MH0R 3QXSA 4F7WA 4B43A 1KSFX 4HB3A 1TF7A 3IKJA 3THWB 4PO1A 1IN4A 2FSIA 1W0KD 4N1AA 2VPPA 3PUYA 2OILA 3C16C 4JT2A 2BCJQ 4M9SA 1RPZA 2J0QA 2R8RA 1CR0A 3DZDA 1VCOA 3W3AA 4ERNA 4LHWA 1DVRA 3GLGA 1PJRA 2IYWA 4JJZA 1WXQA 3EA5A 1OKKA 1W44A 1XJQA 1GL9B 1QG2A 3FKSA 3QG1A 1ZCBA 3LQRA 1DS6A 2ZU0C 3AV0B 5J5CA 3C15C 4R9UC 4X8OA 3QBTA 3BBPA 4TL7A 2A7QA 3NH6A 1BYIA 2OHFA 4FINA 4LV8B 3DO6A 4PXAA 2ZM5A 2FFBA 1HA3A 2ZANA 1ETUA 2ZSEA 2ECKA 1P75A 2Z6VA 2ZI9A 3KZ1E 4M8NE 5FTMA 5G41A 2X8AA 1GP2A 4GMXA 4DLZA 3K70D 5AJZA 1OXXK 2FG5A 2VP4A 2AXNA 2MSEB 3AVXA 3PEWA 5DHFA 4FWTA 1Z6AA 2V9PA 2GAAA 2FX3A 1NVVQ 4OQMA 2G88A 4PC2A 1R5NA 3AP3A 2YWFA 4JLJA 2BKUA 1YRBA 4DCVA 1IOZA 3LBNA 4CDGA 4P4SB 1OFHA 3KXLA 1IM2A 1DOAA 1RE0A 3EIEA 5H1YA 1LB1B 5TDHA 2J0UB 3ONWA 1AN0A 1G21E 1D2MA 4LHYA 3FHOA 1KMQA 2HUPA 4LI0A 3HYRA 4MRPA 4UNQA 4DSNA 4EUNA 3KKNA 1X6VA 3NDPA 3THYA 3W90A 1KY2A 1P2UA 2H5EA 1TF5A 4JSYA 4Q18A 4U00A 1W48A 3CZPA 1HEIA 3H1TA 5FOWA 4AKHA 4PO9A 4QHYA 3M1IA 2J59A 3K70B 4Q4AB 2FSFA 3LW8A 2NO0A 1GKYA 4CEIA 2OXRA 3SQWA 5B30A 3K53A 4DLSA 1MV5A 4HLUA 2ZSFA 3CPJB 4FMDF 3KJIA 3GEHA 1EX7A 5FBRB 4MKHA 4NYJQ 3CRQA 4NP6A 4NYMQ 4BZXA 2RMKA 1E79D 3I73A 1J7KA 1CXZA 1QHHB 2FPLA 2Q9AA 3GMTA 4KV9A 2VHJA 1N6RA 2GCOB 2ZI5A 4MITA 2O8EA 2ANBA 3CWZA 421PA 3CH5A 3TIFA 4YMVA 2ZXUA 1R8SA 1AQYA 3N2IA 3TQFA 4GZLA 4HUQB 4I1VA 3FDIA 4HAZA 4OHWA 5C4MA 1DARA 3CBQA 4LC0A 1Z2CA 3R7WB 4Q1DA 4YLGA 5SZKB 1HY3A 2J0VA 4IXMA 4MYUA 1G4AE 4EAQA 4GDFA 2Z4SA 1V43A 1SKQA 3L0IB 4LK2A 2WSSD 4Q7MB 4P33A 5GJWC 2IS4A 4L4UA 3KXKA 1XTRA 1SQ5A 2X2FA 5AUPB 1XDBA 1E9EA 4Z1MD 2Q9BA 3ADCA 2QMOA 4G5SA 4UQOA 2WBLC 1EFRD 2ERYA 5CK5A 2D2EA 3QPWA 3Q9LA 3KJHA 1TEVA 1IBRA 1JAIA 4IVPA 2YZ2A 1D9ZA 1KNXA 1IJFA 2VYFA 2QM7A 4NYIR 2I1QA 4B47A 3O8RA 4C0SA 4PC6A 5BN5A 2VH5R 2IS2A 4QOSA 4GL2A 3IIJA 1CJVC 1J8MF 4A8JC 1WBDA 1Y3AA 2WSMA 2ZRNA 5DI3B 3A1VA 2WIBA 4QBHA 1A4RA 2G6BA 5KTYA 4V0NA 3K70C 2EYUA 4DUGD 2NGRA 3Q3JB 4A0GA 1T0JB 2EFEB 3D7MA 2NTYC 2QT0A 2PCLA 4JL6A 4MUAA 4YC7A 1R2QA 4IVRA 2A9KA 3AH8A 5AWFC 3QNUA 3AF0A 4Q1FA 4DCSA 2F43A 2OE2A 2JLYA 1Z08A 3B60A 4PR0A 4OI1A 4TT3A 4CRWB 5C2JB 3LWNA 3SJCA 4HATA 2OCBA 2O52A 3ASYA 4JZKA 2CHQA 4Q00A 3I32A 4I99A 1EX6A 4PTLA 3GP8A 3KX2A 1SVOA 2F1HA 2GA8A 3QXJA 2P6UA 4MKFA 1G5RA 3LBIA 1YZQA 4HDCA 1N0WA 1HYQA 3RABA 4XD7D 4TQ9A 3NDBB 2R65A 1ZYUA 1NJFA 1W0JA 2W6IA 2WWFA 4BFVA 4Q4HB 1CP2A 2OEPA 1JJVA 3A58B 2C03A 2A78A 3TRFA 2BMEA 4AK9A 2VL7A 1F6BA 1XMVA 3DDCA 4LJYA 1XJCA 1S3GA 1L2TA 3GJ0A 4TZ0A 4F91B 4E5UA 1EFRA 4EJSB 1UBGA 2RCNA 5JWOA 3RHFA 2OSBA 3CLVA 2GWHA 1Z3IX 4JVSB 3EZFA 2ATVA 3K8YA 1U8ZA 2WSSA 5EXSA 3FPAA 3ZQJA 3QY0A 5JLJA 1R0WA 5CLQA 1Z0IA 2QUZA 3A36A 3BB3A 2P67A 1GILA 1PLJA 2PBRA 1OH8A 4A6PA 1E2KA 4LX0A 1OIWA 2GEDA 2X77A 4WOPA 1E2HA 1I4TD 2KBEA 1CLUA 4AIIA 3DOFA 3U3MA 4AD8A 1EFTA 4GMDA 4B75A 2JLRA 4MKGA 3P4YA 1OT3A 3PVSA 4W5HA 1BH2A 3FB4A 1RJ9A 5JJKA 1GL7A 2F7SA 2MSCB 3OESA 4X8HA 4DCNA 1S3SA 2QPAA 1FOEB 2A5JA 2YVUA 4PHFA 4EJSC 1R0YA 4DKXA 1VDZA 3IEUA 3L82B 3FOZA 3ZVLA 4UNRA 5JCPA 2Z83A 1KI9A 5FOXA 5SZIA 4C4PA 4BLPA 1F48A 4QXAA 3F3YA 1R7RA 2IEZA 3C14C 4BFXA 2CK3D 2EYQA 4Q48A 2A2ZA 3WYFA 5KSZA 4IDPA 3SEAA 4ZDIA 4LJ7A 1EESA 4HSEA 2AR7A 3C4JA 3P4XA 1QHYA 4RCZA 2W0MA 4HAWA 4D0LB 5B2ZA 1XPRA 1D5CA 2ZRLA 4WW0A 4NBSA 2ZS7A 5FBVB 1X8KA 1SXJA 1RRGA 4PAOA 2OUKA 4FIDA 3CF6R 2BKEA 4ZDJA 2VP0A 2LCFA 4JBWA 4JLMA 3R9XA 4HLQB 4QBFA 2R44A 2L0XA 1T8UA 3EAQA 1KDTA 3EIHA 1XTQA 2G83A 3O8BA 2CL0X 4OK3A 4LC1A 3TAHA 2OAQ1 2GZDA 1F2UA 3FMPB 5HE8A 4D4MA 1XEXB 4V03A 5E7JA 1QRAA 3OEHA 4DT1B 2GESA 2ZRKA 3OIUA 4MGKR 4OQXA 3MLEA 3MGCA 4JJKA 4UXIA 2XB2A 2C9YA 3CRW1 2OG2A 5ELXA 1KTVA 1L8QA 4BRWA 4D26A 2WPDD 5CIWA 3VNVA 1XXHE 3W6OA 2ZRDA 1VMAA 3PEVA 1ELOA 1ZC4A 4MDEA 1E9CA 2JLUA 3MJHA 4X8LA 4V0LA 4Q02A 2DFLA 1Z28A 2DY1A 4Z1MA 3W6PA 5IRCD 1IY2A 3V4RA 3GPLA 4PZZA 5TXGA 1XX6A 4BGDA 4IRUB 3EASA 2CMKA 3B78A 3GLIE 3VMFA 5LB2A 2CDNA 1X3SA 3WNDA 2C04A 1M7HA 4OI0A 2EU8A 3LQQA 5L3RA 3U44A 2FNAA 4BLOA 4MYTA 4PC1A 4A15A 3FMOB 3MFYA 1MT0A 2FFQA 2IF0A 1TQ4A 3KL4A 1U94A 5DHAA 4KFTA 4O2RA 2AD5A 1J70A 5K8IA 4DLUA 2DB3A 1KSGA 3J81k 3THXA 4FMCF 3I8SA 4TQAA 3OEEA 2CK3A 1NSFA 1KDOA 1PUJA 2IUTA 5IK2D 1YZUA 3VX3A 3LRPA 4H1UA 1X1RA 1UKVY 2IYTA 4QJ3A 1P5ZB 1WB9A 4XIGS 1ZNWA 3RSLA 1AZTA 1FUKA 3ETLA 1SVIA 4RD3A 4LJ8A 3K9NA 4IDOA 4YMTA 1CJTC 3F5FA 1DO0A 4HLDA 8OHMA 2Z5FA 3MWKA 1IXRC 2OXCA 1TQ6A 2F6RA 5FPTA 3VR3A 3LNCA 1O3YA 2RGXA 4RKFA 3T1VA 2QE7A 1GRNA 4BWYA 3VR4A 1JQJC 4A2PA 2IC5A 2XZPA 2GBLC 3GQBA 3QXCA 4L16A 1E69A 1UF9A 3QG5A 4EQ6B 4BECA 1YKSA 3RVBA 2QSYA 3PCRB 5JJIA 1E99A 2QMHA 3ZLJA 4ZV4A 3OFND 4RZ3A 5TB5A 3QKUA 4P32A 4NZYA 2GBLA 4M4SA 2ZUCA 1UEIA 3HU2A 4FCWA 1YR7A 4WZBE 1G5TA 2DWPA 5CDFA 1QHGA 3N5CA 3GEIA 1VECA 5DYGA 1RFLA 2HJGA 4KLZA 4YDSA 3AKCA 4RSGA 2IYVA 1E1QD 2XB4A 3ZJYA 2AX4A 2QZ4A 1A2KC 5DIFA 3GLFB 2O8CB 1DADA 5HKKA 5JRZA 1M2OB 2AWNA 2G77B 3L0PA 5AJVB 2QAJA 3U3RA 1UBFA 4IJMA 3LX8A 4IEIA 4LJAA 2IWHA 4MGZR 2QM8A 3VU9A 3IEVA 2FJUA 3EPKA 1JECA 2Q3MA 2B92A 1KIMA 3EIQA 1G20E 3IBYA 4MYHA 2ZE8A 3RRNA 1E2EA 2Q9CA 2QL6A 4M1SA 3MUFA 1VIYA 4BZQA 4CEIB 1TUEA 2FZLA 1GSIA 1IY1A 3MG9A 4OBEA 4YONB 1A5TA 3DKVA 1OLOA 1M8PA 3SI7A 2ZUDA 3VX4A 5IK2A 1ZRHA 2NZJA 2CL7X 5AJWA 3VKWA 2QNRA 3D3QA 1JR3E 1JXMA 1Z6XA 2GETA 4ARZB 4P0TA 2BM1A 3AVWA 1Z2AA 1T91A 2ZU6A 4ZI3A 2QMUA 4IDQA 1IXSB 1OIVA 5G40A 4TT3D 1U81A 4C0HA 5ANRB 2KSQA 4O2LA 4ZO4A 1FNMA 3U7EB 2Z43A 4GBMA 3B82A 4TL8A 1XZQA 1UKZA 4PQFA 2RAPA 4PQYA 2QAGA 4Z8YA 2G9NA 2CCKA 1F60A 5H70A 3NKVA 1B23P 4M1WA 3UK6A 1CEEA 1OH5A 4NYJR 2ZRCA 3MJRA 4L5BA 2IEYA 4EKDA 5JSZB 3T61A 4XJXA 4TTRA 2PMDA 3UIEA 3CB4A 3M6AA 3H2YA 1G8YA 4LHVA 2MMGA 1QVRA 5EXXA 3K0AA 3DKPA 1DBSA 4ACBA 1LVGA 1SULA 3LFUA 4BFZA 2VF7A 4DDTA 2F3RA 3WMFA 3LVRE 2V7QA 3N2EA 4AKEA 4XWKA 1KO8A 5AUQA 4S35A 3FVQA 2YC2C 4EFLA 2IS6A 1N5JA 4A0FA 3L8ZA 5FTLA 1VHLA 2IUSA 2PZEA 3PUXA 4OQLA 3X2SA 4QNRA 4QGGA 4GT1A 3EX7C 4RFSA 3I5XA 1GUAA 3SNHA 2OBMA 4ZDKA 3IIMA 1K8RA 2Z4RA 4V0OA 4KHZA 1X8JA 4D82A 1W2HA 2JASA 5FBLB 3KQKA 2HLDA 1DAIA 1T4GA 2O8CA 3ND8A 2VLIA 1AA9A 5FTJA 2IHBA 3T1OA 2YKGA 1P3JA 3LLUA 1Z22A 2C8VA 2GILA 2VP9A 2WIAA 3Q5EA 4Q21A 2F43B 2JIZD 3OIWA 4CYMA 2REOA 2H8KA 4M21A 3IIKA 1MH1A 2YNMA 4XVQA 2SHKA 3I4LA 4G3XA 4LV5B 4MYCA 3GJ8A 3SE0A 1OHHA 4NYIQ 3KQNA 2O5VA 4A6XA 1OV4A 4LBYA 3BXZA 2VA8A 4M1YA 2IXEA 3KFVA 4MRVA 2O8BB 1VTKA 4D81A 1WRBA 2IW3A 1F5NA 3QSYA 4PPNA 2RGGA 4L15A 1M7BA 1WA5A 2W00A 2HT1A 4P4TA 1H8EA 3O8DA 4TMVA 4R2HA 1YZGA 4HI0E 1M34E 1P9WA 1W49A 4DCTA 5HR5A 4A82A 4LJ4A 1ZUIA 4ZCLA 4LHZA 1DG3A 5AR1A 3LXXA 4H1VA 4Q4HA 1OIXA 5EJEA 2GJAA 2YHSA 2CVFA 4KYIB 5M04A 4KFRA 4PFSA 3U3JA 2HXYA 4N0DA 3UXMA 1FTNA 5TVKA 2OBLA 2OLJA 1AGRA 1G4UR 2A30A 2HV8A 2XITA 4B3FX 3NBYC 4D4LA 2W6JA 4UNSA 2XGJA 3HPQA 1M1YE 4Q7JB 3BWDD 2ATXA 1EXMA 3K0CC 4GZMA 4XVUA 1OFIA 5FUYA 3EWAA 1EK0A 1UDXA 2JLZA 2RGCA 1ZU5A 1OB2A 1T5IA 2Y8EA 3Q7QA 4B71A 4G01B 3LXRA 3ZIAA 5AUNB 2BMDA 4L8GA 1AK2A 4M0LA 2FU5C 5JI2E 4KLNA 1AKYA 4Q9JA 1WBBA 1KI8A 4LOAA 1G6HA 3WY9A 3UMSA 4PAQA 1EWRA 3BFVA 1FFHA 3BB4A 1DAEA 1LV7A 4QBGB 2OM2A 2QROA 4A8JB 5FL7D 2W6ID 2MMCA 3KJEA 2FSGA 4GSYA 2V8OA 1RJ9B 2JAQA 2W2XA 4WVFA 5FL3A 4II7A 4XTCS 1TEXA 3WRYC 1XD2A 4V02A 4C0JA 5HZHA 1VG8A 4Y0VA 3THOA 1KAOA 1E2NA 2DCUA 2HJVA 2WKQA 1M7GA 3ECCA 4KYUA 2A5GA 1Z8FA 4NONA 3DM9B 3NC0C 3BAFA 4AI6A 2J41A 2MSDB 5IDVA 1E3MA 2BCGY 1H8ED 3P27A 4RD2A 4WZAE 1L7VC 5KNDA 1CR4A 2FGKA 4QM6A 4TMWA 4E22A 3DL0A 4TSFA 1KSJA 4XSHA 4AG6A 1CJMA 3H4MA 2GCNA 3GJ3A 3ZVRA 521PA 1NVWQ 1W4CA 4LYFA 2ORVA 1JQLB 1SXJB 2J7PA 2XZOA 5K8LA 1RYFA 3LLMA 2A5DA 2OESA 2JLSA 1ZBDA 2ZRGA 3F8TA 4TL6A 3QXHA 2K5UA 4OI4A 5BN3A 3I3SR 2E1RA 1T9HA 2GXAA 4LZZA 2LKDA 2PJRA 1KJZA 4DSUA 3R9IA 4NHOA 4R71A 4DDUA 4URVR 3KTAA 1G7TA 1EWQA 1HURA 4LBZA 1Q22A 4YXWA 2QGNA 3VTKA 3MMPA 4RZUA 3REFA 3X1YA 3VR1A 1Z83A 3I92A 1U0LA 1H8HA 3TE6A 5KNCA 5EXTA 1VCIA 1G3RA 2XAUA 3A4MA 3HYTA 1AIPA 2H1LA 2CHVA 4QL3A 3RWOA 1JBKA 1N2CE 3UKDA 1E2LA 2VP5A 2VHCA 2GF9A 3HP1A 2N42A 4QJ5A 3TKLA 3AB3A 4QGHA 4BLTA 2IYXA 3I1FA 1E96A 2NPIA 2FFAA 2CXXA 1TF2A 3LO5A 2G1JA 1G291 3CX7A 1TU4A 2R9VA 1UAAA 5C4GB 1ZW6A 1SXJD 4GI7A 1OF1A 5J4LA 2ZS9A 1P2VA 4BEBA 1ESNA 4BZPA 1AGPA 3QI2A 4HEJA 1R0XA 4KBFA 2WPDA 3BFKA 3QENA 1IN7A 1CULC 1MRNA 4DC9A 1Z0FA 1KI3A 5GJVC 1NI3A 1G3MA 4XSGA 5P21A 2HYDA 2WV9A 1IHUA 3CNNA 4Q1CA 2FSHA 5J4VA 4Q19A 1GKIA 1YHNA 2AD1A 3AF1A 3T1TA 1OB5A 3FGNA 5EE9A 4OQFA 3T5DA 3BS4A 4DCUA 4NDZA 1IJEA 3Q8XB 2EFHB 3CPEA 3CM0A 2FMXA 2UKDA 2J7PD 3EWSA 4MGYR 4CW7A 4ZKDA 3THXB 1D2NA 2QGZA 1SVSA 2BBTA 1NBMD 3U2QA 5KSPA 2CLDX 1QHIA 3RRZA 3BERA 4K81B 2AKYA 1OFTA 1XD2B 4JBXA 1IONA 3M0EA 4IFBA 1YU9A 1HE8B 2JJ2D 2DR3A 3SJAA 4B3GA 1N3BA 2GTPA 2P0EA 4B76A 3TVDA 2G1KA 3SS8A 1C9KA 4OL0A 4BLQA 1SKYE 3MCAA 1DG1G 2ZS8A 2WJGA 4XH9B 4HB0A 1NY6A 4LDJA 2ZRBA 2PX3A 1KO7A 2VSFA 4DSTA 1E9AA 4DZZA 4UKDA 3ICQB 1II8B 1RVDA 4FN5A 3ZZTA 3ZZ0A 2RGEA 4LJ6A 1YR6A 2IA5A 3BOSA 4RJLA 1BIFA 3BH6A 2OFOA 2WMNB 5FL7A 3HJNA 3EPJA 1MO3A 2O8DA 4B35A 3WMGA 821PA 2RHDA 4NYMR 1XMJA 5FOUA 3G82C 3I8XA 5KPJA 5KU1A 1W5SA 3JVUA 1GNRA 5EP3A 1D2EA 1CS4C 4D4KA 3KTAB 4NU0A 3WNCA 4S2EA 5AK0A 5L3VA 4HAYA 3I5YA 1IXZA 4HDOB 3QKSB 1XWIA 3QVVA 2OCPA 3U44B 2GVDC 3BORA 2ZREA 2LWIA 3K0FB 4P4UA 3RS3A 3ASZA 4B48A 2ERXA 3MWJA 5B57C 1D6JA 1NLYA 1ZD8A 4AYWA 1MO5A 3U5ZB 4QG7A 3SN6A 2F9MA 4U5XA 2W6JD 3A1WA 3RSOA 4AYTA 5KDDA 4G5QA 4X8MA 1Z5ZA 1B0UA 3FFBA 4Q4JB 5UKDA 3LH5A 4KO8A 4Q1AA 4HZUB 3UMFA 1NN5A 2DWOA 3A6PC 3DPUA 1LW7A 3PV0A 4TZ6A 5AUOB 3L43A 5TMPA 1R6BX 2C99A 1N25A 4GOJA 1ZVQA 4IEEA 1AS2A 1NMXA 2O0HA 1FNNA 5HTKA 5JZVA 4OHYA 1CIPA 4YXWD 3PJRA 1GKUB 3AKYA 1I4DD 1P62B 5FUXA 2F55A 3KXIA 3M4YA 4ZKEA 5FOVA 2RGNC 3FYHA 2PT7A 4MGIR 2AN9A 1SHZA 1R5BA 1ZIPA 1J2JA 2AK2A 1QZXA 4OK5A 2V4ZA 5DYIA 5CJPA 2BMFA 1LFDB 3IHLA 4JVLA 2FZ4A 2IYRA 1OHHD 2IX3A 1HT2E 4US2R 3W5IA 1ZUHA 1II0A 1XJ0A 4QGFA 1ONBA 3KB2A 1Q3TA 3OEED 4EPTA 3QEJA 4DEYA 4TSFD 5JWHA 3PFIA 1S9HA 2D06A 4QHTA 3KB1A 1KGDA 4Q7LA 2RGAA 5JEEA 3U6BA 4DLVA 4DSOA 1KJYA 2QEQA 4NTZA 4TMTA 3X1ZA 4DRZA 1VIAA 3CW2A 5BYJA 3GLFA 3JVVA 2DYKA 1NIJA 3K0AB 1R4AA 1F3OA 3IGFA 4HZIA 5A5GA 2CNWA 2O0JA 1Z0DA 1X1SA 3P26A 3PIRA 5J4KA 2LKCA 5KYKA 3B8HA 4PPQA 3W8RA 3U3OA 2VO1A 3P32A 1S4QA 1KZGB 1RRFA 4DUGA 2ANCA 2GRJA 1E2IA 4OHVA 1YZTA 2G0NA 4QM7A 3NH9A 2GJ9A 2D2FA 1K5GA 1KKMA 3Q85A 5GADl 2QTFA 4FXPA 3IQWA 5HPYB 4U02A 3LA6A 4RCYA 4B44A 3V4FA 2HEIA 2QRZA 3A1SA 1GG2A 3QOFA 2W2VA 1X8LA 4TL9A 2XSZA 3OHMA 1E0AA 4ASUA 2XJ9A 2JDIA 5KPDA 3QUSA 4JLDA 4KFUA 3VFDA 2HCJB 2JLWA 3FTQA 2ZR9A 3RWMB 4B2IA 1SVWA 4C9BA 1UEJA 5JRJA 4UXJA 1L4YA 4I81A 5BW8A 3AF4A 2R6GA 1J8YF 2PX0A 2NG1A 4RD4A 2BDTA 4WIAA 3T12A 5C46F 1Q1EA 1CJKC 1G16A 2EFCB 2ZE6A 2ASEA 4RKEA 3TUIC 3AVVA 3UWOA 1GWNA 1I2DA 2BEJA 2FA9A 1KNQA 2OFXA 2QPTA 2X1VA 1O87A 1N5IA 2YOGA 2PT5A 4FMBB 4DIEA 3CZQA 5JSZA 2NO1A 1NIPA 2ZJYA 4KODA 1ZINA 3GLGB 1ZD9A 4AYXA 3B13B 3LY5A 3Q7PA 3I62A 4Q5IA 2F1IA 4URZR 3F0TA 4A4DA 1MKYA 1ZC3A 4N0EA 3AF2A 3CR8A 3I72A 1KJWA 3NBFA 5FUVA 3EPLA 2EW1A 2XXAA 5F98A 4KITB 1C4OA 4Y0AA 5J47A 1ZM7A 2ZJAA 4C2TA 4M2LA 4LCBA 4E07A 4CT4B 2WWIA 3AF3A 2EWWA 2WAXA 2YV5A 4LYAA 1DPFA 2GVZC 3IQXA 4O3MA 1OW3B 4PHGA 1G8FA 1Z6TA 6Q21A 3TR5A 3HU1A 5DLQC 1XB2A 4G5GA 2PJZA 1TU3A 3CR7A 5DISB 4EIWA 4Q9IA 2QMEA 2IXGA 2FWRA 4A0RA 1XEFA 3ADBA 1P9NA 4DBLC 4K46A 3NXSA 2GJ8A 2RGDA 1NKSA 3QKTA 4QRHA 3U3KA 4EFMA 2ZYVX 4KAXA 3GD7A 3U7HB 1SVMA 2C95A 2D3WA 1RIFA 2J0UA 3NEJA 4WXPA 3BH7A 3U7GA 3FE2A 1FP6A 2HLDD 3CPHA 2WJVA 1HUQA 1QHSA 2WKPA 1EFHA 2ZJOA 1W7AA 4LUCA 1G6OA 3JZMA 3ZQ6A 4AURA 3FKSD 2C98A 1L4UA 1BYUA 1KDRA 4RY2A 5DNYB 2RB4A 1KZ7B 4KJZA 4YQFA 4JLOA 2ZVPX 1KY3A 2O8FB 3R9WA 1G8HA 3S1AB 2FEMA 1BOFA 2NO6A 3K0CA 1MR3F 2GK7A 4BEJA 3AP2A 4I1OA 3KKMA 1K6MA 3B85A 1T6NA 4XWAA 4JSTA 1Q44A 5D3QA 4US0R 3OEHD 4PX9A 2BV3A 4WXRA 3RYTC 1YE8A 1GVNB 1IN6A 2AXPA 2ZI4A 5FPSA 1CTQA 2VP2A 5B64A 5L8VA 3TW4A 5J4HA 3QXXA 2O8EB 4E09A 3CNLA 1E2DA 2QTVB 3D6TB 4W7SA 1GAJA 2AK3A 3B1ZA 2H92A 1FMJA 2GKSA 3GEEA 4GFDA 4G1UC 4HUQA 1OYYA 3C41J 1D9XA 2QORA 3K9GA 4URXR 1S9DA 2DWQA 3TAUA 3KJGA 3QEOA 2ZTSA 4BPBA 5EE0A 3A8TA 1UBCA 4TN1A 2AHOA 4MRNA 1FX0A 5K8TA 4A92A 2WWYA 1E9SA 4DDVA 3PR1A 3EZ9A 2XTZA 3FWYA 4IW3B 1YR8A 4BFSA 1KO5A 1N6OA 5IHPA 2J3EA 1RW4A 1G3UA 2IYUA 2WVJA 3L2OB 1ZNXA 2PLRA 1P4SA 5FTNA 1Q1BA 1YZLA 2P5SA 2VHQA 3IDQA 1KYIA 4Q03A 2F9LA 4NKRA 4TYWA 4D80A 4B3BA 2CVHA 3QE0A 5DSZA 4US1R 3GJ5A 3L0SA 1E94E 3SOPA 1US8A 2CE7A 2YWEA 1TL7C 1V5WA 1RRPA 3TBKA 4PHTA 4QBIA 4TTQA 1OYWA 1JALA 1H65A 1P9RA 1ZNZA 3KKQA 4A2QA 4Z54A 5FPYA 4KVAA 4LPSA 3B1XA 4KXFB 1N6PA 3T35A 1HQYE 4DEXA 3P20A 4B33A 3Q5DA 2XOKA 4XOIA 2I1VB 1N0VC 3EG5A 5HKKD 1GL6A 2YOFA 1Q57A 1E0SA 1QHHA 1N5LA 1E1RD 2G0TA 2RGNA 1UPTA 1S1MA 4TMKA 2WZQA 1Q21A 2ZJ8A 5LD2B 1LF0A 3HR8A 2J9RA 4PSVA 5BQ5A 2IS1A 1XP8A 5KO2A 2GEVA 1YR9A 1E2JA 3EZ7A 1S96A 3RDPA 3FHTA 2C9CA 4DJTA 1JR6A 4UNNA 3X1WA 4LRWA 4ZDWA 4HB2A 3E70C 2RGBA 3TNFA 4TMXA 1XTIA 1Q20A 3UG7A 2VF8A 1FQKA 2EFGA 3S1AA 1WQ1R 2GXQA 1OH6A 2Q0HA 1QHXA 2GDJA 4QHSA 4TWZA 1PLLA 3NHAA 4DB4A 1E32A 1GOTA 1UJ2A 5EE5B 1GZSA 3FMIA 2WWGA 3PEYA 4B3CA 4L9WA 1KSHA 4JKIA 4JLNA 5DGXA 1S8FA 5F2EA 721PA 2J0SA 3V00A 4FD2A 3KQHA 3ADDA 1J99A 4ITRC 1BMFD 1ZAKA 4AG5A 2QAGC 4XD7A 1ZCAA 4LJ9A 4YDHB 4JYBA 4LJ5A 4M1OA 3UMRA 3TGPA 2C5LA 3AEZA 3P1JA 4PQRA 4A0HA 4CEJA 3OAAA 1VHTA 5BYKA 1QVAA 2QPOA 2JLVA 3A37A 5LPNA 5GJCA 2VHUA 2GCPA 4B73A 4D25A 5DI3A 2VSXA 1RC8A 4Z51A 4AKIA 4MA4A 1JPJA 1NLFA 3RS0A 1COWA 2UVQA 4GOKA 3O47A 1E1QA 1QDEA 2H7VA 4RD6A 1PLKA 3QF4A 4M9ZA 4JL8A 2F3TA 4W5WA 4XTRA 4W9MC 2WOOA 1NL3A 4JS0A 5CM8B 3RS7A 2CJWB 2ORIA 5BXQC 1EG7A 2D7CA 1N6HA 1JXOA 1NLZA 4O25A 1N0UA 2WWWA 3K0FA 1R10A 1D8TA 5KOYA 3H86A 1KDPA 2KWIA 4OJQA 2QP9X 3PUWA 5FTKA 1AS3A 2QG6A 1I4LD 4IKEA 4NCNA 3WBKA 1VG0B 2BWJA 1PUIA 2D4HA 1VG1A 2RH5A 3PG5A 1G5PA 2ZJZA 2REXB 4IDNA 1P7CA 3EC2A 4HZUA 4B3XA 1MABA 3RANA 1TAGA 1XFAA 2XSZD 2PZFA 2YJTD 3SFZA 1TX4B 1ODFA 3PUZA 3SJBA 3HR7A 1Q3HA 1T0HB 4PO8A 5KHOC 4IDHA 1NVVR 2JGNA 4JLAA 2ZRHA 1XMIA 4M1TA 5JS7A 1A1VA 2AWOA 1G7RA 2YWGA 2ZRAA 2XNDD 4PZYA 621PA 4XVRA 3U7FB 1WCV1 1E6CA 4OK6A 3EZ6A 3DEFA 5JFGA 3GLHB 1FZQA 4I1UA 4UXHA 3LVQE 4EFNA 1KI2A 5HCNA 1VKJA 3CUEF 1P6XA 3RS5A 4BFYA 1ZJ6A 1NN0A 1U0JA 3VNUA 3QQ5A 4JKYA 2H57A 2NZ8A 4NL4H 1XEWY 3EW9A 5F9HA 3GCGA 1WP9A 1Z6GA 3CRVA 3L8YA 3SC3A 2UZIR 1ZM9A 3MD0A 4LWZA 3VHLB 2GZHA 1U9IA 1W0KA 3JZAA 4G5RA 3KKPA 4IHQA 4JLPA 1G17A 4POAA 3ZS9A 3TW8B 5JJLA 4EDHA 4BUJA 3FMFA 4ZCIA 1ZD1A 2ZRMA 3CF2A 5EUMA 3TUJC 4HAVA 1II9A 3BD9A 3B2EA 1E4YA 1W4RA 2GJKA 2GNOA 4YMUA 2REBA 4TTPA 2RHMA 2EVWX 1F2UB 2ZSAA 1E9BA 1XEXA 2R6DA 3MWYW 3QKSA 2FN4A 1U8AA 1P2TA 1ZNYA 2ONKA 1YVDA 2PCJA 4KVGA 4GNKA 1Z6YA 3AUXA 4Q4LA 1UBEA 3T1QA 3AVOA 3W8NA 1I2MA 1XF9A 1U0HC 1Z0AA 2DHRA 1T5LA 2V6IA 3KDSE 2HCBA 1OJLA 4LYHA 2FPMA 1GDDA 1WF3A 1XBTA 3AVUA 3CX8A 1W47A 5JWRA 5FFMA 4F93B 3K0EA 3LBHA 4Q4JA 3QPVA 1GITA 3SDZA 4HUTA 3EXAA 2ZVQX 4LYJA 2ZYTX 5CB6A 1XEWX 1OXUA 2VIIA 1XZPA 4CT5A 5L3SA 4IOJA 4B32A 1TMKA 2IYSA 4Q1EA 5JCZA 2H18A 3PEUA 1NG1A 3TH5A 3ZS8A 3ZD7A 2IYQA 1G1MA 4M53A 2J1LA 2WHXA 2CLSA 4V0MA 2CJWA 1TNDA 2VBCA 4FI3C 1YJ5A 1EGAA 3TK1A 3WP0A 3NC1C 2VP6A 4D0GA 2KJQA 4TYPA 4H9GA 2BM0A 3QF7A 1VYVA 4CVNA 3OFNA 5CYPA 3UPUA 3U4QB 1U8YA 2OO7A 2VHTA 4HLUC 1COWD 4Q9LA 1BO6A 1Q1ZA 2ORWA 4F4JA 5GJBA 1ZM2A 1QHNA 3CX6A 3NIBA 3OIVA 2N1BA 3RC8A 1KK2A 2IUUA 1GTVA 3CKLA 4AY2A 4Q47A 2CHGA 4YMSA 3MAAC 3UANA 1A7JA 1W36B 2QA5A 5HE9A 2B6HA 3GFTA 2QQEA 1T3SA 4DLRA 3KKOA 3ZYCA 5E95A 3RRMA 2XXAB 3U6KA 1TUIA 1SHKA 1KI6B 5A0FA 1W46A 2P5TB 4B34A 5AJXA 2WAYA 1W5TA 1OKKD 3ND9A 1NF3A 4ILEA 1E9FA 1VPLA 4EQ6A 2GF0A 1XRJA 4UJ3A 5JHHB 1KKLA 1XCGB 4M9QA 3VR5A 3BJIC 4JBYA 4GP7A 4HAUA 3AVTA 2R62A 1A2BA 2JIZA 3TSZA 3ZGXA 3HU3A 2ZYWX 4MQBA 2DFNA 4ZPXA 1E2GA 1XU4A 2V55B 3GLIA 1FP7A 2JJ1A 5K8UA 1DO2A 1IAQA 1VCMA 1XD8A 5KDOA 2OT3B 3E2IA 5E7MA 4Q9KA 1C1YA 4F38A 2IBMA 1OE0A 4P31A 1GIAA 3B1VA 4TLBA 5EUQB 1CF4A 4C0KA 4JT4A 1E2MA 4R98A 2XZLA 2UZ3A 1OXTA 3SU8A 3IPYA 3SZRA 3ZZUA 4TYNA 1JR3D 1P72A 2ZITA 2CBZA 2JATA 2XNSA 2CLCX 5GVSA 1AQUA 3R20A 3DMNA 1NNEA 1RKBA 2IYZA 3IO5A 3X1DA 2O8FA 2WJJA 3CONA 1AZSC 3VKGA 1SZPA 2ZRJA 2GXUA 1T3LA 5EP1A 2CCGA 2OV2A 2DFKB 1S2MA 1NKTA 2ODEA 1AKEA 4N3NA 1HH4A 4LV6A 1JEEA 5CM9C 1SGWA 4ARZA 5FI1B 2O0KA 1NVUQ 2HT6A 3ZVMA 1RRCA 2ZE7A 2BBWA 1CU1A 3RNLA 2JCSA 2PH1A 3IUYA 5E7IA 4OHXA 3IPXA 4DWJA 2YWHA 3NEYA 4C7OB 4JIMA 1ZM3A 2XX3A 4DB2A 1U90A 1P60A 1SKYB 1QBKC 4V0ME 3BRWD 5DN6D 1AJEA 2HXSA 2NIPA 1JEDA 1Z29A 1XXHA 2JJ1D 4MRSA 4OYHA 5C1BA 1U2RA 5LB4A 2JA1A 3NBZC 3AQ4A 3WMEA 3H84A 2ZRIA 3RAPR 2BIFA 2R2AA 1KMHA 3LAWA 2NPFA 4PC3A 4ACAA 4AWXA 5JI3E 3A4LA 4ZI2A 3W5JA 3C5CA 2QBYA 4HDQB 1N6LA 2I4IA 1DAMA 4D6PA 1E79A 4CF7A 4HYYA 1HT1E 1N6NA 2J46A 4ESHA 4ZIRA 3OAAD 2ZROA 4TLCA 5EP2A 2AFIE 3OF5A 1E9DA 3T15A 4F92B 4A1FA 4W5JA 1GNPA 3KUDA 3U60B 4FMDB 1T8TA 2ZR7A 2Q21A 2R6AA 2A3RA 4JLBA 4JLVA 1LTQA 1X86B 4RFVA 4CEHB 1PVOA 3G5UA 4OJKA 3BIFA 2J87A 4TMZA 4P3YA 3ZD6A 2E87A 1JB1A 5JBQA 4HB4A 1NP6A 2CE2X 5DH9A 4ZCMA 1YZNA 3AKEA 2R6FA 2YINC 4IXNA 5A4JA 2QRNA 5KNBA 3R8FA 2OBNA 4FMCB 2B7CA 4D2IA 2PEZA 4NCJA 3DVLA 2GEUA 3FHCB 4B2LA 4DXAA 1CBUA 5G3ZA 1UADA 3DOEA 4YMWA 3CRRA 3TR0A 5CLLA 1EFCA 2CL6X 1K5DA 2ODBA 2W0SA 3WXMA 1A82A 2WM9B 2PZGA 4M1KA 2FV8A 1NRJB 2QY9A 1W4BA 1NMYA 2JDID 4KSBA 5FBWB 3TVTA 2Z0MA 1HTWA 4JYCA 2QAGB 3PITA 4K8OA 5JMTA 3SR0A 2QE7D 5IT5A 3TSOA 2C77A 1G7SA 2ONJA 3SBEA 2O8BA 3GLFE 1XTKA 1LY1A 1FX0B 4DVGA 2QTHA 1W0JD 2NQ2C 4ON9A 1FPMA 1QF9A 3BE4A 4TLDA 4TYYA 2CCJA 3K9HA 1G64A 5J4YA 1G3IA 3QKRB 2KE5A 3CRMA 1NMZA 2Q3FA 1TQ2A 1OSNA 2JLQA 5KDLA 5KUTA 3AUYA 4BE7B 3EPHA 4NCHA 3A1UA 4QC2A 3GJ6A 3VHXA 4NH0A 1W36D 1KI4A 4CEJB 2PLFA 3DHWC 3H0KA 1SXJC 5FPHA 1ZP6A 1NG9A 1US8B 2CNWD 3C8UA 4RFSB 5LD2C 5TV2A 4C0LA 4G0NA 1PV4A 3WHLA 3B9QA 1GNQA 1GRQA 1E0JA 4PPGA 4B3DA 1XCMA 3GJXC 2F1JA 2NOAA 3IO3A 4IOMA 3TJZA 2B8TA 4IVQA 3RRYA 1G41A 2VEDA 2AL7A 3B6EA 3QF4B 1U9IC 3QJYA 3ZDQA 2IL1A 5EP4A 2NMVA 1IN8A 1R5OA 4AKGA 4ZIRB 1MO6A 2BBOA 1E4VA 4Q01A 3ICEA 2NO7A 4MKIA 1TADA 4I1SA 1N6IA 5CJ2A 4DHEA 5CK4A 4A8JA 1UDWA 5SZHB 2FDCA 3EARA 2XNDA 3K1JA 2XOKD 4JVNA 1JPNA 4PC7A 3V9PA 3TUZC 1EFUA 1OPXA 2ZI3A 2C96A 1KO1A 1WDTA 4WAUA 2ZEJA 1G19A 2BJVA 2I3BA 3A1TA 4WBSA 3GJ7A 4BFUA 2P2LA 4FCVA 2ZQ5A 2WMOB 2VSOA 3BH0A 3NTUA 3T34A 3SYLA 3W34A 3B1WA 1KAGA 1FTSA 4IFEA 3CWQA 1CKEA 2JJ8A 2E9SA 4QFMA 4RVCA 3WRXC 4C2UA 4JVMA 2P65A 1CR1A 1QG4A 2OFWA 4UNPA 2ZRFA 2JEOA 3QPUA 1MOZA 2BMJA 4TLAA 1LS1A 2GCOA 3LW7A 4DLXA 5HZKA 4MDFA 4DDWA 4E03A 1N5KA 1FUUA 1KK1A 221PA 2OAP1 1IQPA 2V1XA 5HCIA 3TQCA 2HF9A 3D8BA 2ZJ2A 1Z63A 4PHHA 2OZEA 3FFAA 4URUR 5DE3A 5JECA 1NJGA 1OXSC 3R7WA 3B9PA 4A2WA 5D3MA 2QQ0A 3QBVA 3DMDA 1WMSA 5TARA 3AKDA 3TSWA 3EC1A 4RD0A 4C0AC 2ZUBA 2JLXA 5FR2A 2GZAA 1NSTA 2ODNA 4GPTA 2FF7A 2D62A 3BC1A 1MO4A 2VQSA 3SYNA 5CB8A 1P2SA 2B21A 3OIYA 1VG9B 3OE7D 2R6CA 2P3SA 1Z0JA 1LNZA 2FFHA 1GM5A 4NPHA 1R0ZA 3SJZA 3THYB 1F2TB 1P61B 1UFQA 1XTJA 4M9XA 4B6FA 3PQCA 2EFDB 4CGZA 3W6NA 2GJSA 5FUWA 5DI9A 1UKEA 5EZ6B 1VYUA 4MRRA 1WE2A 3BB1A 5DO9A 3SFVA 3D31A 4BQSA 1MABB 5L3QA 4KFSA 4IOLA 2V1UA 2WOJA 2QN6A 1RZ3A 2JJ2A 2BC9A 1YQTA 2F1RA 4OI2A 4MUBA 2QSZA 3UWKA 4CIDA 1UKYA 1P73A 3R8CA 2GAOA 1G18A 1NBME 4TYQA 2WICA 1ESMA 2C2HA 2IYYA 1Z07A 3EA0A 1NY5A 1S1CA 4Q9HA 5EE3A 5E3HA 1Q0UA 3PXGA 2WKRA 5KSYA 4QNMA 1NBMA 3GLHA 2A5YB 1U99A 1E1RA 2P6RA 2Q6TA 4HLCA 3U4QA 1DAFA 4WA7A 4I4LA 2CEAA 3KFXA 1G3QA 1LF5A 5EZ5A 2XJ4A 3SYKA 4PZLA 1VYTA 2BVNA 1M6NA 1Z0KA 1DAHA 2QU8A 3IHWA 3Q72A 2FEOA 3RC3A 2Q3HA 1CRPA 4CZ2A 3IBGA 4PANA 5SZJA 2OCAA 3NHBA 1YRAA 2PEYA 5J40A 1TTTA 4U7DA 2ZI6A 5BN4A 3NVAA 4GRAA 1AS0A 2YYZA 3O8CA 1GFIA 2DBYA 3CO5A 4F4CA 3LDAA 4EPXA 3BFXA 4GOXA 5CYOA 5H68A 4D4JA 4LGMA 3QVUA 5TY0A 2ZYUX 2W58A 4C3ZA 1G9XA 2AKAB 2DFTA 3CIOA 3HPRA 3B1YA 2QENA 1MRSA 2FGJA 2N46A 1H8HD 4C0BA 3AVYA 1E2FA 1SVLA 1DEKA 2YOHA 5D3MB 2WJYA 5AJYA 2IYLD 5EXPA 1E2QA 1CJUC 4XWOA 2IHYA 1XPOA 2ZSBA 5L3SB 3T06B 3SHFA 5H8WA 2PL3A 1Q1QA 3K09A 1E0KA 2C78A 4BLSA 1G8PA 1PZNA 2X19A 5BWMA 2J7KA 3WBJA 4RD1A 3OE7A 2DPXA 1TPZA 2YC4C 2A5FA 1JI0A 4PPFA 1W4AA 2OLKA 2HF8A 3KQLA 5FH9A 3GFOA 4FCTA 4OQNA 1F2TA 3REGA 3T5GA 4BASA 2GK6A 1KOFA 1YZKA 1SXJE 2J5XA 5G53C 1HE1C 4QGAA 3W3ZB 4M22A 3MRSA 3UATA 1NVXQ 2BBSA 2ZRPA 4QKQA 3ZVNA 3KUCA 4LBVA 4JLKA 3QIAA 4NE2A 5G3YA 2IK8A 5L3QB 4JMPA 4URWR 3KQUA 4A36A 4DLTA 4KBGA 1W1WA 4KCGA 5DN6A 4PSAA 3W9YA 2WWXA 4FWIB 4Q66C 2D74A 4NCIA 2NO9A 3E5HA 1CR2A 3WYGA 2QI9C 2KBFA 1FQJA 2GHIA 3CF0A 3NG1A 2BHRA 1ZMXA 1HQCA 1KI7A 2ZSDA 4V0KA 1NN1A 3WHKA 1JAHA 5LDDC 2P6NA 2WTUA 3LV8A 4OKSA 2EQBA 1XD9A 2V54A 2IWRA 3CNOA 2QT1A 2IT1A 1KI6A 2ZETA 4B2PA 1U98A 1II8A 1W2GA 2EWVA 4LHXA 4J0QA 3DZ8A 3N70A 1BKDR 2BJWA 4B6EA 4EJSA 4OHZA 5FBQB 1XXHB 1CRQA 2V3CC 2ZJ5A 1FMLA 2QP3A 2VRWA 3LX5A 2O8DB 3NBXX 1ZIOA 2OCYC 2WJHA 2W2TA 3AVPA 1JR3A 3ZIAD 1GRRA 3GLIB 3GFPA 3IILA 3MWLA 1OFUX 4NMMA 1AM4D 2ZR0A 1OXVA 2X2EA 5FOSA 4C30A 4NCKA 2QBYB 5JHGB 1DTSA 3GLGE
chains in the Genus database with same CATH superfamily
1XN4A 2P90A 5IP5A 3SQXA 1XP5A 5BSWA 4BGVA 2FOIA 1YF3A 3GD5A 4L3OA 4I3FA 3TRJA 1RAFA 2DE0X 2FZGA 1WU7A 3MSXA 4CLRA 4EPRA 5IF9A 5JAHA 4YHHB 1CB7A 2H17A 5JEDA 3KE9A 5C18A 1PN3A 2DQKA 2XE6A 2Q8PA 4XPIA 2IPXA 1I33A 3PUVA 2X14A 4LNUB 1UCFA 1XZDA 3G7NA 4MVXA 4QUEA 1SQ0A 2QG9A 4ZEXA 4CEHA 4P4NA 2CSXA 2H1HA 4KR2A 1XZHA 2JGEA 4P9NA 2GMWA 3ASUA 4R2IA 1KOGA 1Y34E 3ZHUA 5IAJA 4D8TA 2E2WA 2YZMA 2BMVA 2VTKA 2P41A 1EGQA 3BMOB 2HCTA 1EGVB 3G3EA 1N1MA 5CHYA 2J45A 3BREA 4MPTA 3UEOA 4DLWA 5MDHA 4HFJA 3ZW7A 1JU4A 2X7XA 2P4EA 1JE1A 4R8MA 4HF7A 4BFTA 4GDMA 2CV2A 3T9AA 1NN3A 2P62A 3DPIA 4WZZA 4ZVOA 5CB0A 1DAKA 1M54A 4LYEA 1PT7A 2JD0A 5FI0B 3HY6A 3TINA 3N74A 4QATA 2WJIA 5TGZA 1SVKA 3B1KA 1FL9A 1Q92A 1M2VB 3TQTA 4Y9UA 4C4OA 3AM1A 5EUCA 2GDZA 2I67A 3AGPA 2DHCA 1C7QA 1Z33A 2BFPA 4W82A 1Z06A 2WVGA 2QV0A 2ZIUB 1L3IA 2EL9A 4KI0A 4O4JB 3T99A 3ZH9B 4MVJF 3RRFA 5B1EA 3MGGA 2HA5A 1FU4A 2HYIC 3CSDA 3WQSB 3H8WA 4BTEA 2BGRA 3SQOA 2O6HA 4YQZA 5BR4A 1EFDN 5LL6P 3AWDA 2KHZA 4Q1BA 1FP1D 4BFWA 1H2XA 2IXDA 2XH8A 4X1KB 4EP1A 2ZIAA 2Z2IA 4YALA 3S1LA 3IC5A 1MZPA 1ZESA 5K3SA 2AW3A 1UOOA 1X9GA 5DHSA 1Q12A 3ADKA 5JR3A 1IY0A 2I80A 2FPGB 2G3YA 2FE4A 3R3YA 4KQMA 1UZNA 4TWBA 2RI6A 1J0EA 3MMZA 4QE3A 4X0EA 2OD9A 1OWPA 4XPZA 2HHAA 4DT1A 5KSOA 1JL3A 5JS8A 3LF2A 4PTYA 4KTVE 4RK6A 3SBDA 1K0FA 3K96A 4LK3A 3HN2A 4MUEA 3K4PA 3LC0A 5DTMA 4CIXA 4H1TA 5LA6A 1CNMA 5T57A 5A06A 1EVIA 3MT0A 4LOJA 3HCEA 2KI5A 2GEJA 1G2IA 3P0RA 1DE0A 4B0PA 1VLVA 3H42B 3OEYA 3DKRA 2W2LA 3WK8A 4B9EA 4HS9A 1UBLS 3WLIA 1SXGA 4A9AA 5L4SA 1KO4A 1VLMA 1GNSA 5IN5A 2QX8A 3QVXA 2ZUWA 1CUBA 4JBNA 1H2AS 4WFQA 3B7GA 4LPKA 1JPVA 4TQUS 5JPIA 1EZ1A 1QFSA 1QC5A 2V96A 4D4GA 1M0EA 1OAKA 3ABRB 4M86A 3ZBUA 1KI1A 1ZSYA 5DNWA 4J6EA 3HP4A 5LP6A 1DAGA 4IMIB 1N2BA 3G5TA 5CX1B 3E1SA 4O4HF 2IDKA 3RNOA 1FMFA 1PFQA 5C81A 1M1ZA 4MK4A 1I2AA 4TLEA 2BUCA 3C5HA 3ICVA 5CIQA 4ABYA 3FOZA 4MH0R 1E63A 3QXSA 4JH0A 1JDBC 1H2RS 1KSFX 3EFOA 4KO3S 4X95A 4EG6A 4EYGA 1XZIA 3NWEA 5KBYA 3THWB 3K9QO 3WMRA 1IN4A 4ZZ3A 4PE5B 2FPRA 3L3BA 2VPPA 3PNBA 4N1AA 5LDHA 1LDMA 2BCJQ 2X5XA 2X6QA 3BRWA 2AE1A 3DEHA 4IILA 1A8PA 3KNZA 1RP7A 2ZCUA 2QE6A 2ZWVA 1MT3A 3PNVA 3P9RA 2HU8A 3NC4A 1DVRA 5HF9A 2EIXA 2PGLA 1WXQA 3OC6A 4NQRA 3VZQA 1VE6A 1QG2A 4MR9B 1ZCBA 2R1UA 3VSBA 2VDJA 2YUTA 3JR7A 5J5CA 1SCUA 2C2OA 3NM6B 3QBTA 3SXJA 2BDUA 3CA8A 3ROFA 4HEQA 2AFVA 3NH6A 4PXAA 3L84A 1Q5PA 1CSEE 2QHXA 2QK4A 2FFBA 4GQBA 4BNUA 1DRUA 3D6HA 1P75A 2ZI9A 5AKIA 3P9NA 5FTMA 4HAOA 1YE5A 1GPUA 4BJ3A 1G59A 4RGQA 1K89A 5A1TA 4AWBA 2VP4A 2V59A 2HDHA 2MSEB 4IX1A 2IE0A 4KV7A 3PEWA 5DHFA 4FWTA 3G8CA 1Z6AA 1XYYA 2V9PA 3L93A 2FX3A 2DECA 3ROMA 4OQMA 4WRRA 3F98A 3SDSA 1E1NA 1R5NA 1V2GA 2J6CA 3LK7A 1YBFA 4IS2A 5DN9A 5GONF 1GPYA 1IOZA 2B37A 1LZKA 2VCHA 3LBNA 4CDGA 2XYPA 5EIBC 2QTLA 3D6AA 1ACLA 2OSVA 3VSDA 1U6JA 4I2NA 1KMIY 4Y7CA 1GZVA 4YP1A 5KTKA 5H1YA 2EW8A 3EIEA 2B7LA 1MXHA 3FZYA 3TQQA 1QDLB 2J0UB 2Z2XA 3IA2A 3O9ZA 4EK9A 1DCKA 4F72A 1AN0A 4JP1A 2H4HA 4OXNA 4EUNA 1KMQA 5KNBD 3UQZA 3KRTA 2HO4A 3IYLW 1EGHA 1X6VA 3T41A 2ZIXB 1O77A 4CG0A 1KPIA 1P2UA 4JSYA 5REQA 4FSXA 3C6BA 4KPUB 1HEIA 1RYZA 3RPEA 2EP8A 4C4XA 5DPMA 3K70B 3LW8A 3UENA 3LQYA 1S3FA 5C0OE 2VKTA 4ZGWA 2IPLA 4KGZA 5IF3A 5AXAA 4K26A 1UFVA 1QLWA 2A1TS 2ZSFA 1QGDA 3IMKA 3ZCRA 2C5BA 2B2CA 3PFKA 1LBIA 3IP5A 4N5NA 2BYTA 2MR5A 5FBRB 3NHKA 1L1FA 5FA6A 1BE0A 4Q6BA 3FSEA 3LIIA 5B53A 3DWGA 1SPBS 1F51E 4ETWA 4BZXA 1L8XA 5DK6A 1UM9A 2XUPA 1U0EA 3I73A 3M1LA 3MJTA 4P2GA 4E4YA 4G1BA 4EM6A 4QDJA 3GEPA 3MUEA 4U5QA 3ZDRA 3GMTA 3QLJA 3ZDAA 1SBQA 4G1EB 3UMCA 1SUDA 3PUIA 4UEQA 3P52A 5ARCA 2ZI5A 4CR8A 1NW4A 3PYMA 1IMOA 1HFJA 2ANBA 2FEXA 3BF8A 2ZDQA 5ETJA 3TIFA 4QRDA 1X2EA 4BNVA 4RK1A 2QX9A 4HUQB 2FHSA 5C4MA 3FFTA 1GTSA 3Q1LA 1DARA 3CBQA 4IIDA 2JLBA 4YQEA 3F9CA 1OXKB 4H0NA 1O95C 2E37A 4Q1DA 5ABPA 4KG7A 2DH5A 1YL6A 4OHBA 3O3MB 4I50A 1OGIA 2XR1A 2J0VA 2XEDA 4IXMA 5AW7A 1V5FA 2JCGA 4ZVNA 1GSAA 3WNQA 2RH8A 3PDJA 4EAQA 1BHJA 4EJ0A 3WJ2A 1RZVA 3VSAA 3LWBA 4Q7MB 4P33A 2M2IA 2X2FA 1CQIA 1QO9A 3FJOA 1MX5A 2O0MA 1E9EA 1BXRA 1UPBA 2FWBA 3I64A 3ZJUA 1OI4A 2O14A 3NEPX 5J3JA 1QIHA 3ILVA 2VI5A 1Y1RA 5CK5A 2ERYA 5AXDA 3QPWA 3Q9LA 2HKIA 3ITKA 1IBRA 1JAIA 3LIPA 4UBNA 2YZ2A 5E9QA 5KZMB 3K16A 3E1GA 4UFOA 2XBLA 3VVLA 1E3WA 5CGQB 4LYGA 1ECGA 2QOEA 1CNEA 2ZYRA 3L7LA 5LYJB 4RHCA 1Y48E 2OAEA 1CJVC 2G04A 2ID7A 3IIJA 3DR3A 1C0PA 3HG7A 1YBMA 1CJCA 4TTIA 5FI3A 3ZJTA 2QV7A 1LPPA 1U11A 5H81A 5DI3B 1KA9H 2WHYA 4GLOA 2ATIA 4FOTA 3U39A 1GO2A 1OI2A 3BXFA 4JODA 2BFDA 2H1VA 2HRQA 2POCA 3JYNA 4DUGD 3CLTD 2EOAA 3OCZA 4X6LA 2VKQA 4ZI7B 4JJ4A 2NTYC 2OMKA 2Q29A 2WF6A 1V47A 2FLVA 3DZHA 4HQRA 4RORA 2HRCA 2GZ1A 4UU0A 3V7NA 4JL6A 2PCLA 3PZRA 2YFQA 1PJSA 4LXXA 2B94A 4L07A 4MUAA 4YC7A 4FEGA 1VJGA 4L9RA 3RS9A 3TLAA 5A5FA 2YQ4A 3N7AA 3UV3A 4COKA 3OUUA 2EATA 1MJHA 1I94B 1E7RA 3FIJA 4YMIA 4ENWA 1FS5A 1ZOIA 4MWGA 2GPWA 3EAFA 4OI1A 4CRWB 3DCIA 5C2JB 2ZIZA 3ZGNA 1Z88A 2LIPA 2A0YA 4HKTA 3CS3A 3IQEA 4QFCA 1EBFA 3R0JA 4U2EA 4NFHA 3ZZMA 2Y1FA 3AI1A 1XGKA 2B1GA 2CHQA 3JYHA 1K9SA 1OVGA 1SO8A 1EX6A 1PL8A 1XDDA 3W8FA 2I2WA 4PTLA 1CHNA 2O2JA 1FW8A 1DG9A 3UO8B 3KX2A 2B69A 2F1HA 4BB0A 1PX0A 3QXJA 4MS3A 5B3JC 3ZDZB 1VJDA 2LTAA 3OT1A 3PYLA 4MKFA 4ER3A 3UK7A 4WKCA 2VPTA 5DBIA 2J3HA 1KBOA 3A26A 3TZLA 1HYQA 2AN1A 4Y6SA 2D54A 3QVMA 4JQCA 1HL3A 1HG0A 1ZG3A 2NZXA 1XCLA 2PGAA 2R65A 2WWFA 2VSQA 2Y1KA 4RH0A 2G7MC 4RGBA 2NTEA 4Q4HB 3KHTA 4BFVA 4YCSA 3MS7A 1JJVA 4IWYA 4MJ3A 4CMJA 1XO1A 3ED5A 1JX6A 3TRFA 3UK1A 1WV0A 2VL7A 4O5AA 3WMWA 2H6EA 2VUSA 1BCRB 1IUOA 1NONA 1UXHA 5DCLA 3C98A 1L2TA 3BWXA 3H83A 3FNQA 7GPBA 3ZN2A 1N8SA 4J7AA 1HSZA 3KKZA 4L3WA 1P9LA 5FIUA 3V2UA 4EY5A 5I7EA 1BX1A 1DRKA 3MWGA 3AU9A 1GTL1 2ATVA 3CUKA 2A9RA 2R7MA 4XLLA 3HRKA 3QY0A 4JNKA 3ZQJA 4G0UA 4QX6A 1QS0A 4RPHA 4UD6A 1L5GB 3BILA 3L7CA 1GILA 3CN7A 2G4CA 2PBRA 1OH8A 4RBNA 4A6PA 5A9SA 5CA0B 2HHLA 4I9UA 3ZEIA 5L40A 4OFWA 2VHZA 2X77A 4EYOA 4ZEVA 5EHZA 1FUYB 1E2HA 1I4TD 1QFJA 2W6ZA 2X41A 3G85A 3IUEA 4MWEA 4Y6LA 2QN7A 1EH5A 3DOFA 3SE7A 3ZHYA 4AD8A 4BOYA 2JLRA 1FB5A 1RXIA 2H4FA 2PA3A 5E7QA 4I55B 2A4MA 3TECE 3P4YA 4DRXB 1NA5A 1UBRS 1BH2A 1BNCA 2G28A 2WDZA 3PNYA 1RJ9A 2OCLA 4YT2A 4GS5A 2VWGA 1H2EA 3HU5A 4TXNA 4C5AA 5HKAA 4KDCA 3JWEA 5ISMA 2CLOB 2ZTVA 2YVUA 1G6KA 2ZXEA 4E2FA 4R6XA 4UNRA 4XM2A 5AP9A 2IOHA 2IEBA 3BULA 2ZAIA 2JVIA 5DX8A 1AHPA 1PW5A 4HJXA 1TE2A 4BL5A 4TRRA 3ZV3A 1NHWA 2GS9A 1R7RA 4BFXA 1R6AA 2O2EA 2CK3D 4Q48A 4DLLA 5A3SA 1AT1A 3WYFA 1P31A 5CDGA 4UW9A 2FPSA 3MJCA 4XCQA 2IZ0A 4PCLA 3U4MA 3OF3A 1EESA 3AIMA 4BWVA 2GARA 3I0NA 1QHYA 4RCZA 1FU8A 1VP3A 4H3VA 2XGSA 4MA5A 4MB6A 4LGVA 3QX3A 3OMXA 1KY5A 4FS3A 3ZY5A 1UK9A 1SH7A 5GGYA 1T2UA 1WUYA 4MRMB 4KE6A 1D5CA 1FDVA 4RW0A 4WW0A 3WSVA 5FWYB 5B3KA 3UOGA 5AJHA 1ENOA 1K1EA 2YBEA 5FF9A 2P5UA 4WJKB 4PAOA 2OUKA 4FIDA 1MBZA 3U1VA 4KX3A 1FSSA 2Y0BA 1E77A 1OWLA 2NYAA 1TLLA 4Y6PA 4IV8A 2GBGA 4HLQB 1TD9A 4LJLA 3L6CA 5JV5A 3R8XA 2L0XA 4NBVA 2FZWA 3QU4A 1FVFA 5I8WA 1KDTA 3EIHA 4IBOA 1M8GA 1NT2A 2CL0X 5KNLA 4IZOA 4LC1A 3S40A 4EYQA 2OAQ1 2FMHA 1TO2E 2XY4A 4D4MA 3KKKA 4BE9A 1NE7A 1C8LA 3RGGA 1QRAA 2H51A 3MINA 1G4HA 3ON5A 3IVXA 3QJGA 2GT1A 4OQXA 4UXIA 3MGCA 1ZRSA 2H4WA 5H9VA 3CRW1 4D46A 1C3LA 3W05A 2QS9A 3IQDB 4Y0NA 3UAWA 3STYA 1BRTA 4BRWA 2JLXA 2ZRDA 3PEVA 4CTMA 3KOYA 2Z04A 4MDEA 2WFLA 5AW8A 3BJEA 1IEVA 2DFLA 2DY1A 1NU6A 2WIKA 3KOWA 1IY2A 4NESA 5DGCA 4MQUA 5FTWA 1U04A 1LWNA 3P4UA 1YFLA 3OG9A 4C08A 1MU0A 3GI1A 1W2WB 4FWBA 4AS2A 2PQMA 1FQWA 3DR5A 3EXFA 3P2IA 4CM9A 4ZT3A 4MP8A 3PC6A 4D45A 2CMKA 1O5IA 4IQFA 2IH4A 2CDNA 2BI7A 2WYIA 1YS2X 3HWWA 4NULA 5JCZA 3L8DA 3U4IA 4HFMA 5AW0A 3TIVA 1ISMA 2FVXA 2MHCA 4GAEA 4M3NA 3CVUA 1EA7A 2A59A 1EXWA 3FMOB 2X8JB 3EK2A 5EMNA 3T52A 3G2OA 4O2RA 3NDJA 3PC7A 1ZUNA 1UC4B 2MWMA 2OGZA 1GZHB 3THXA 2FMUA 4FMCF 3UKOA 3HUFA 4C76A 5FLEX 5EJ5A 1W52X 2CK3A 1P8JA 1NNI1 2GPTA 1KDOA 2IUTA 2Y2UA 3AOGA 3DDOA 4WKNA 2C2ZA 4X44A 4BCBA 2IYTA 2AH5A 1JSXA 4QJ3A 1Y9ZA 1WB9A 3OCCA 4I1PA 4HTFB 3AR4A 1AZTA 1FUKA 4P98A 1D2HA 4LNHA 3WK5A 2G72A 4IDOA 4C14A 5GV7A 4YAIA 3Q2OA 2W48A 3UT5B 1CJTC 1M73E 2ZBVA 3EVGA 3QXGA 5BW5A 3F5FA 3URMA 4IIEA 3T7KA 3ZY3A 1Y7TA 2E18A 3SS9X 2BGUA 2IU4A 5DW3A 5A2QA 1TQ6A 4L3VA 3O2JA 1O3YA 2NQ8A 2Y93A 3AONB 3D02A 4PHCA 2LVBA 3OPMA 4RF5A 4A2PA 4EB6B 1GFZA 2GBLC 5E1DA 3W8DA 4I9GA 2B83A 5TMDA 4EQ6B 4MUMA 2HLNA 2PUGA 1YKSA 5JG7A 1YOVB 3L7MA 4O08A 1ODSA 4PZDA 3RYFA 5JJIA 5C5DA 3IDZA 3ZLJA 3K6KA 3OFND 3IVAA 3UMMA 3A27A 3RSZA 3SEZA 2P9QA 5TB5A 3R1IA 2WUWE 4CKBA 1QR6A 3DE7X 4ZOAA 2ZUCA 5DRTA 3IE1A 1UJCA 4WZBE 2FW6A 5ALJA 3JYLA 4TMFA 5ERGB 4QULA 1VBMA 4KOEC 5JE8A 1JLKA 2W93A 4YDSA 3AKCA 1FMCA 4RSGA 4GMFA 3J7TA 1NBHA 2XB4A 3ZJYA 4GWGA 1TYZA 2BRUA 2QZ4A 5DIFA 3GLFB 4LE0A 2IVFA 3KYIB 3CUUA 1ZUWA 1P3DA 3OIGA 2C61A 4S1PA 1L1RA 2G77B 5HKKA 3V32A 5KYYB 4ECEA 3G1WA 1PNVA 4NV1A 3M4ZA 4ZCPA 2DCMA 3LX8A 1N92A 4LJAA 4MGZR 2QM8A 1LI5A 3UAYA 2A9FA 4Q93A 3VU9A 4C7KA 3AFIA 2FJUA 3KLMX 2H9AA 4QDOA 1E62A 1GD1O 2O05A 2PQ6A 4MIKA 1KIMA 2ZE8A 1U0BB 2FUG6 2QL6A 4O2AB 3DBIA 4DR3B 1VIYA 1VPDA 4BZQA 4CEIB 4FB5A 2M32A 1NQAO 5DTIA 1TUEA 2IZ5A 2IDJA 1LPBB 3JQGB 3EZGA 2ZUFA 4ZAZA 2GPNA 5IJWA 5FKJA 3RSHA 5F5NA 4PIVA 4OKIA 1K98A 1M8PA 2QSJA 1XNGA 3FWHA 3H8JA 3HUEA 3LX6A 5IK2A 2PXHA 1L5HA 3VKWA 3VPAA 3W5UA 1V35A 3OE1A 3D3QA 1JXMA 4BKQA 1CF2O 1YD7A 2WIFA 3M4NA 1LRJA 1MJ5A 4F6LA 1T91A 2D1FA 1EKXA 1JKFA 3V4SA 2A0XA 2QVCA 2QMUA 3RT1A 3CNEA 1OIVA 1FQOA 2K6GA 4TT3D 4F3CA 4D3YA 4ZYZA 2G70A 2KSQA 5KKAA 4XWWA 1HLDA 1RXEA 1D2RA 3IV6A 2IIBA 1NATA 4H7KA 3ZJ4A 2RGRA 2Z43A 4BQPA 4H1WA 2GKOA 3VUFA 4LA4A 4PQFA 3SF8A 1HNNA 1J49A 4E0BA 3J80A 5CXQA 5AVUA 5JSKA 1B6TA 1ONPA 2ZDHA 4Z8YA 2CCKA 1U6IA 2GUGA 4RVDA 3NKVA 3TBHA 1I30A 3NBQA 1B23P 1HZZA 5DP1A 2GFHA 4NYJR 3UKJA 3MJRA 5E0OA 13PKA 2IEYA 2X40A 3AFHA 4L8FA 4RMJA 3SC4A 4EKDA 3T61A 4EJFA 4G36A 1SURA 3I9LA 4MKRA 2LZ0A 3UIEA 4AZWA 3EEBA 3WGUA 3K8ZA 1Y6QA 2OORC 1ISIA 4AROA 2J9ZB 2AJDA 3H2YA 3HVKA 4OREX 1TRKA 3EVNA 1O4VA 2FVYA 3JD1A 3OWOA 1NM5A 3NFRA 4WLNA 5EXXA 4CG1A 3DUWA 3TWOA 5TS3A 4F9EA 1DBSA 4XEHA 2Z3WA 4ACBA 3LY8A 3LFUA 3NCTA 2VF7A 2BFCB 4MVJG 3SDBA 3HEAA 2F3RA 3M3DA 3Q7RA 1F5SA 1QUFA 1YCFA 2V7QA 3ESRA 4TKUB 4ZAWA 1TLFA 3DBLB 2Q6VA 3OQJA 3VHXB 3FH0A 4AKEA 4XUEA 1KO8A 3AB7A 1NFQA 4D8YA 3FVQA 2YC2C 2OVFA 1TUBA 1VBKA 4A0FA 1VHLA 2IUSA 2UUOA 4WZBA 4PG7A 2IYEA 3FA2A 4GT1A 3TMYA 1H4TA 3Q3EA 3I5XA 1PG0A 3IOEA 4YUZA 3WB1A 3A04A 3SNHA 1ZVVA 2OBMA 5KYTA 3BL6A 3DGEC 1VL0A 1Y81A 4XGNA 2P30A 2I91A 4RAOA 5JUWA 2FQWA 2AKEA 5LIRA 4B3RB 3HGTA 1AZWA 4LXIA 4CQNA 1L7BA 3PE4A 4FZ5A 4Z4QA 1XR3A 1V8OA 5SICE 4XW2A 5GOTA 3DMGA 1T4GA 3DKKA 3AW8A 2DJIA 3ND8A 4F1JA 1RWXA 4D9JA 3HBFA 1CUEA 3MIZA 3OH8A 1GUYA 5LIPA 3LLUA 4XDZA 2GILA 1AQLA 1ZJWA 5CDSA 2VDWB 2JIZD 1Z5NA 5DWVA 4EGQA 2NVBA 1C3EA 2XQVA 4AZVA 4LFBB 2SHKA 4YLEA 4G3XA 4LV5B 2K7FA 4CFZA 4OUKX 3SE0A 3EHEA 3EGDA 1AKUA 3NONA 5IPFA 4NYIQ 1XNQB 4EKYA 4U4AA 3KQNA 1PQYA 1PKEA 1JB9A 1UODA 3H3FA 4LBYA 3NO4A 5KNBH 4BO2A 3FWNA 1A5ZA 1A3CA 2AUTA 3IAUA 2Q6OA 4J07A 4D99A 2BMWA 2JI4A 3K5PA 1XJWA 3STVA 4D81A 1WRBA 5AVRA 2DR2A 1V7ZA 1HMPA 4LVNA 3ZX4A 1LPAB 3ZNOA 1X74A 4LF6B 2W70A 1M7BA 2Z6UA 2W00A 5TEVA 1D6SA 4NENA 1CF9A 4P4TA 2FXIA 4RHFA 4TMVA 1E92A 3FYCA 2GPJA 3OOSA 1M34E 4HI0E 4G0ZA 4U2KA 2FZEA 4I1RA 4QWMA 5AR1A 4ZCLA 1RI2A 3M82A 6LDHA 5EJEA 1Z12A 3T3EA 2CVFA 2CMFA 1NW5A 1Q1NA 2XE7A 3MMNA 4G1CA 1J5EB 3WNVA 4N5MA 5M04A 4IIXA 2I0FA 4PFSA 3U3JA 2HXYA 2OWDA 1FTNA 4RIFA 5TVKA 2OBLA 2D5LA 1QQTA 2OLJA 2BCEA 2I3AA 1AGRA 3GH3A 4IHJB 5KQRA 4WVLA 4RNDB 3AFGA 4M8SA 4F1WA 2W6JA 2I8LA 2C7RA 3J7AC 3DEYX 4TRNA 3UOAB 4GM0A 3G6KA 5SY6A 3RKRA 4GZMA 3BIWA 1C41A 4X3PA 1OFIA 5FUYA 1UJMA 1XZJA 2EQAA 4NEHB 1UDXA 2QRPA 4HDKB 2UZ1A 4CMEC 5IANA 4Y2VA 3JQAD 3TFOA 4JI2B 1E7YA 3Q7QA 2Y8EA 3ZIAA 3LXRA 1E89A 1S8NA 2CGEA 5H5JA 5E1OA 3QX7A 1AK2A 2VK8A 5JDIA 4KQ2A 5JI2E 4IXDA 1TECE 3VZRA 2GTHA 5JAZA 3EIFA 2P7IA 4YUYA 1DIHA 4YP7A 1P17A 4RVSA 2B36A 2QTCA 5C34B 4PYQA 4QDUA 4NJOA 3YASA 1EWRA 5I48A 3BB4A 3H9CA 3BWCA 2OM2A 3FMGA 3OLVA 4FYKA 3D5TA 1CJBA 2W6ID 2MMCA 2QJTA 3KJEA 3KR9A 4ZC8A 4I4TB 4WPGA 3L7BA 2ICAA 1RJ9B 2W2XA 5I7FA 2XCQA 3K9WA 3PA8A 3E15A 4G2NA 3TLBA 3ANSA 3VVBA 4DA4A 4FOSA 3UH0A 1C80A 1MQ8B 5A62A 3S44A 5LBTA 3WRYC 2FHPA 1R66A 1VG8A 4Y0VA 1N5DA 1QX4A 2TYSB 4XIJA 3DOJA 1KAOA 4LSZA 2WKQA 4NIMA 4ZREA 4FN4A 4P7KA 4JZYA 2GB4A 3OD5A 1R74A 3LFHA 4E5SA 1QB7A 3DM9B 4CU2A 1TI7A 5CXUA 2M1ZA 3LUFA 1SC9A 4WV3A 1SD1A 4C05A 3LQFA 1EDOA 5E2AA 4WGFA 3Q15C 5EGNA 3SSNA 1ZJYA 3P27A 1L7VC 4YJ2F 3RK0A 3NOXA 1P1CA 4TMWA 1DOHA 3QU5A 4I6EA 1U80A 2P68A 4XX0A 2YW2A 3AR5A 4ZWNA 2ODPA 3IJRA 3DL0A 3DHYA 3H5LA 9ATCA 4XSHA 4AG6A 3GJ3A 2Y1WA 3GC6A 521PA 4BB6A 1W4CA 4LYFA 2J4FA 2ORVA 1GJRA 1FP4B 3D5EA 5DM4A 5KYWA 2E0IA 2QLTA 1O2DA 1R8YA 3PQ6A 5A9RA 1Z4OA 2V03A 1G20A 2H85A 1INLA 1O5TA 1WQ3A 4WI1A 3RVJA 2ZR8A 2OXIA 4OI4A 4A0QA 5BN3A 4D42A 2WUDA 4UBLA 5C7YA 3I61A 4GR4A 5IYZB 3UT6A 2VAXA 2LKDA 2R8OA 4XJSA 4DDUA 3REQB 3RGWS 1DP4A 4EB8A 1RXCA 1Q7GA 2DQZA 3OCYA 3OJCA 4YXWA 3FN4A 3GFGA 3VU1A 2QGNA 4RZUA 3KTFA 3REFA 2WQ7A 1Z83A 3ULKA 3TE6A 5KNCA 3KHSA 3HYTA 1XTUA 3INGA 3AZPA 2H1OA 1ZR4A 1Y98A 4M37A 2Y92A 1VXOA 1JBKA 1M0TA 1H4VB 3D0KA 1W96A 3D6NB 4GC5A 1EVKA 3HJAA 1UXKA 4YDRA 4U2FA 4TKVA 2OQIA 3TKLA 3AB3A 3F96A 4A8PA 2IITA 1QYDA 3HKBA 2FFAA 4BCCA 4MQMA 3EGVA 1PQPA 3LO5A 1G291 3CX7A 1YTUA 2HK6A 4GYKA 5KTRA 5LJIA 1DPGA 3NDIA 4OQEA 1CQJB 4X65B 1SXJD 3DHNA 4L57A 1NASA 1SOAA 4J1TC 3BGSA 5FNVA 3W2EA 4KXNA 5BP7A 5ALKA 4DMKA 2WPDA 3KC2A 4IGFA 1CQWA 3KJZA 1IN7A 2Y0EA 1MRNA 1KI3A 5GJVC 1NI3A 4F8EA 4XSGA 4HPWA 1ZA2A 2WV9A 3CNNA 3DQPA 3KQWA 3V8PA 2FSHA 1ZY2A 2X6RA 1DAOA 5ARBA 3T1TA 1EGMB 4II2A 5EE9A 1ITZA 2X4GA 2WU1A 2XYRA 1BFUA 3BS4A 2X8JA 3ZWYA 1P74A 2EFHB 4CWAA 3STTA 3M4JA 3CM0A 2FMXA 4BX8A 3S55A 1J09A 1WETA 1JYSA 1IEQA 1NQTA 1N1DA 1SVSA 2QGZA 4IP0A 1AXGA 2BBTA 3ETHA 1NBMD 2YMLA 3R23A 3Q7IA 3GGGA 2QKYA 3DVSX 4Y2JA 5HOEA 1XD2B 4IIFA 4I5IA 4AS3A 3TD2A 3WIVA 1IONA 5HCUA 2EKDA 1QH1A 3HB9A 3UA3A 1MGOA 4PLCA 1HE8B 2R751 4N0QA 1JG6A 1H9BA 3SCZA 2DR3A 4B3GA 5DNAA 3HO8A 1JQKA 1ZH6A 2W6NA 3KVNA 2G1KA 3VOTA 4ENTA 2HXGA 3I01M 3ILSA 2EWMA 4OL0A 1M83A 3T38A 1MCZA 1NDUA 4EZBA 1IC6A 2ZS8A 4YX9A 3D5QA 1QO0D 1CYDA 4YASA 3FDZB 2H2IA 3PP8A 2ZRBA 2PL9A 1NX9A 2PX3A 1KO7A 2VSFA 2AOVA 1IMJA 4MI9A 3Q40A 4CQJA 1II8B 4EB6A 4F56A 3R7AA 2V45A 2X3YA 3PHJA 3Q7EA 1KDZA 5K0JA 1XA3A 3H5AA 3UJDA 1A97A 4NAUA 1LSUA 3KYDB 1YR6A 4EJ6A 3TRHA 3JAKB 4C5BA 5E6RB 3IV7A 4FZJA 4RJLA 4CTJA 4P3PA 4F04A 5K0FA 4EHAA 4RAQA 1H94A 3HJNA 1TO1E 1MO3A 3EQ2A 4DY4A 4EGJA 3WMGA 3V1TC 3PT9A 1PE0A 1XQ1A 2RHJA 3TLEA 5DYYA 3SC2B 5A5DA 5FV4A 3IPCA 3RYIA 3TOZA 1BWSA 5KPJA 1EIWA 1ECPA 1M76A 4M7OA 4K0KB 1KQPA 3BCHA 2H2HA 4D4KA 4X1OA 2VAVA 2JGAA 4YRQA 1ST2A 4S2EA 5AK0A 5L3VA 4HAYA 1HI9A 3I5YA 1IXZA 2LBPA 4U2CA 4I5FA 4NZZA 2DLDA 3KR2A 4X20B 1QAOA 2OCPA 1LTHR 4MWTA 3U9LA 5L51A 2ZREA 4GOOD 1KEZA 5T5QA 2Z3ZA 1YMVA 1GQOA 4QYIB 2PL1A 5AXCA 3BAZA 1CY8A 4P4UA 4GX2A 3HMKA 6AT1A 5J5VA 3PHIA 2IRWA 1NLYA 1RI1A 1DT5A 1MO5A 3C8DA 5ADVA 2F9MA 1P5JA 3A1WA 4GICA 4U5XA 1PWHA 3HSYA 5EWLB 1IPEA 3RSOA 4AYTA 4MVJP 5CB4F 2EL7A 1LBSA 3UMFA 4Q4JB 5HNKA 4JU9A 2OZPA 4REOA 3CUSA 2QW8A 4MS4B 2WUVA 3ROPA 3PV0A 3QX8A 1TW2A 2E4YA 4FCCA 4RTLA 3L43A 4X3OA 1LPMA 2C8JA 2JRLA 2VHYA 2VP3A 4IEEA 1FVOA 4K3VA 1ETHA 3C3JA 2LCQA 5LXTA 5I9SA 2X0KA 1AS2A 2O0HA 4I36A 4U7WA 1FNNA 5HTKA 3UC9A 1XU7A 3C8HA 3UM9A 4BX9A 5JZVA 1QU3A 1BX3A 4RWZA 1GLVA 4YXWD 2UZ4A 3O4GA 4M36A 4K1XA 3AKYA 1I4DD 4Z86A 2EKLA 4M1EA 1KMNA 1YB7A 2EKQA 2HFKA 3M4YA 4L5AA 3TDNA 1MJGM 3V5NA 3ZHRA 1SHTX 5EGSA 4K03A 7AT1A 1ILEA 3A1NA 1SHZA 1J2JA 1JRLA 1AUPA 1ZX1A 2AK2A 2VDKB 2XRMA 5T4HA 1FF9A 3UXYA 2OGSA 2H2DA 1QB8A 3QKIA 3AHFA 3OLWA 2Q5LA 3TNDA 2FZ4A 5BRJA 4YHBA 2IX3A 1YMQA 3PDWA 1UBHS 5BSKA 3W5IA 5EJ2A 1II0A 1XJ0A 4WCFB 1Q3TA 3OEED 1CY1A 4P4LA 1EFAA 1WB5A 3PFIA 1S9HA 4G9GA 2YCBA 1JJIA 4N65A 4WN9B 1D4ZA 1R6TA 3QELA 3BX1A 1KGDA 1TZCA 1TU0A 3BHMA 4FX5A 2VJKA 1QU2A 1MB2A 3RBVA 3VDRA 4EFDA 2IYOA 3R0VA 4YGYA 3WO0A 5KNDD 4P84A 1JAXA 2QEQA 4TMTA 1RKUA 4JD5A 1VIAA 4QFBA 4WEQA 1DMSA 2QVGA 3G0OA 3JVVA 3U4GA 1UT5A 3WLTA 2C2BA 4HZIA 3JRWA 3WNZA 1EVLA 2O0JA 1RM3A 2I4OA 2FPPB 1YDEA 1ZK4A 4H7IA 1M2NA 3BTVA 3OFVA 2IPAB 3AIOA 3UJCA 3P26A 1RE1A 3TZ6A 5CBKA 1RJDA 2LKCA 3W04A 3B8HA 3OBBA 4IIYA 3W8RA 4E5DA 1ODIA 5JNUA 2R5WA 1S4QA 3O1HB 4V39A 3SQNA 1KZGB 1RRFA 4DUGA 4HP8A 4OHFA 3RQSA 1OBVA 2VPIA 1YZTA 5I7UA 4BB9A 3NH9A 3ZV4A 2CNLA 4BNXA 2D2FA 3C4VA 1EUZA 4KR3A 1KKMA 3BFJA 1WX1A 3Q85A 3T7CA 1MB3A 2EJTA 1SZCA 5L95A 1IU9A 1JFLA 2EIHA 4ZARA 1MQSA 4GKVA 4YAWA 3V4FA 2AW5A 2QRVA 4EZIA 3KQPA 3A1SA 3LXUX 3PQ5A 4HS4A 1QC5B 2W6CX 1X8LA 3O9VA 1E0AA 2R1VA 1P5RA 1AK1A 2GI4A 2J3LA 2R1TB 4DA8A 4E15A 1JG4A 2ZCVA 1XZ8A 1Y4ZA 5E3IA 4G5FA 1YK1A 4ASUA 4LNAA 3PI7A 5CX1A 2FRXA 3QUSA 2H4ZA 3KZOA 5TF4A 1C50A 2GAJA 1BKYA 4B2IA 3RWMB 2VDWA 5CT5A 3D81A 2Q7XA 1UEJA 5CNJA 3LOQA 1L4YA 1YQWA 4I81A 3AF4A 3TD6A 3VJMA 2PX0A 1BHO1 1QIGA 2NG1A 3F6BX 2BDTA 4KH0A 2QTMA 3EGDB 4NV0A 4WIAA 1TCUA 3KPVA 3T12A 4CDRA 3SHTA 3N8HA 1ZN8A 3HYLA 1NZFA 3N05A 4IGIA 1U2QA 4BXOB 3AVVA 1I1QB 1JHMA 2VATA 2OFXA 2IZZA 1TRHA 3LWDA 3CZQA 1JHXA 2Y0PA 2NO1A 1ZINA 3VPDA 3M7IA 3GLGB 2XUJA 3RJTA 2KLBA 2ALJA 1CEQA 3B13B 3H5WA 4N49A 4EITA 4NX2A 5A3QA 4P92A 1DWPA 2H52A 3WLOA 5KU7A 1G2QA 5LP1A 4A4DA 3P19A 1PW7A 1XG5A 1A2QA 1MKYA 2CVOA 2HQOA 4Z7OB 3WSTA 4L51A 5CDTA 1ZC3A 4N0EA 4FYWA 4QPCA 1OPRA 3B2NA 1V8ZA 1OZAA 2Q1SA 1KJWA 3NBFA 2HWKA 5DTQA 1WNFA 3EPLA 1PEKE 4DCOA 4MA0A 1ZM7A 2ZJAA 4LCBA 4LOLA 2IBTA 1CUYA 4F86A 5KOJA 3BWBA 2WAXA 3UPTA 4PYJA 1M2JA 1ADCA 2QZSA 3X2EA 2VOJA 2CVPA 3FCSB 3WO1A 3GT4A 4NBWA 1Z6TA 5DF1A 3TR5A 5GM2A 3BUSA 1I3OA 2PJZA 2Z8YA 2H1SA 1KEVA 3MTIA 4OOEA 1Y5NA 4PGAA 2FWRA 2IIPA 1XEFA 1GY8A 1W94A 3KQQA 4DBLC 4EWLA 2OHGA 3L7YA 4FFLA 3R3HA 1UQRA 3WKCA 2Y66A 3PKZA 4EVQA 3Q10A 3FYUA 1CC1S 2VRCA 1C8KA 1B73A 3LP5A 4MQLA 5B1HA 3RTDA 3KZCA