4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
3JW4A 4Z4FA 2DLLA 4Z4HA 2IA1A 3WTWC 5ILUA 3MQ0A 4W5TA 3TB6A 1I1SA 3HRTA 2ELHA 3BJOA 3TO6A 1LNWA 3CUQB 3H1EA 2YX7A 4HF0A 3GFLA 4BAYA 1YG2A 4KVFA 3H5OA 4WUTA 2OZUA 2IT0A 2GBPA 1EH8A 4RB3C 2PQ8A 3NQOA 2LKPA 1R1UA 3GZ5A 4AVPA 3OLVA 4KN7X 4JP1A 4Q48A 3I54A 2H27A 2HQBA 2FE3A 4OG2A 1K78A 3M7GA 3TGNA 4O1IA 3OO1A 4OBBA 2IPQX 2H0AA 4QLCU 1TMYA 1ZN2A 1WETA 4RB2C 1EV7A 2FU4A 1OXKB 4ZYLA 2FW0A 3K1PA 3OLWA 1EH6A 2LSOA 4ETMA 1FT9A 2QV0A 3REOA 1BDJA 1E6MA 2A6EF 1P8AA 5BOXA 3ML6A 1AWCA 4LX8A 5D5XB 3LTEA 1EWTA 4N0PA 4YLEA 3TOAA 2NZVG 4G6QA 4A6DA 4Q6BA 4G97A 3GWGA 3W6KB 2QZJA 1CF7B 1QP4A 4A12A 5K5OA 4CHUA 1XWWA 3GFMA 4JB0A 1TLFA 2IA2A 2MYPA 1YW7A 3MZYA 3VOEA 1E2BA 3L7WA 1ZHFA 3I59A 2VBXA 4TV7A 4G0YA 3J80K 1USKA 3U1DA 1Z13A 4MR9A 2L3DA 3I0TA 3HV2A 2DFIA 2KJBA 3IPCA 3WODF 3QEMB 2DW4A 3LFTA 2TDXA 5TJJA 4HV5A 1JX6A 2JPBA 2DQRA 4ZYGA 3P7NA 4H3KB 2D1VA 4H3HB 4KV7A 2F5DA 1Z91A 3IC7A 1YK1A 2CWDA 3VEPA 2HJ9A 1V4RA 2WV0A 1CYEA 4OLAA 3V7SA 4I98B 4MRMB 5JFRA 1W7PA 5LGUA 4OU0A 3FDFA 4LLLA 1B9NA 2MYTA 2IJLA 4LDZA 1EWKA 1NXVA 5DDGA 2QVCA 3TO5A 2RGYA 2V0NA 1IN7A 4OMZA 5HQJA 3NNDA 4U0VA 1USSA 1R36A 1DPUA 4OLBA 1Y0UA 2FMFA 4MR8B 3F8FA 4YWHA 2LF8A 4HA8A 2H6CA 4MS4A 2YR2A 3O21A 1IXCA 4P5OA 3EYIA 3NRVA 3OLZA 2DO7A 4RS3A 2HKOA 5HS7A 4IHSA 1O3SA 4KT5C 1WKMA 4LB6B 1F51E 4RK7A 5J8CA 2Q5CA 1YQAA 5F6FA 5E8IA 1BC7C 3O2PE 3LUDA 3F6CA 4E7PA 3IPAA 2IA0A 2KKOA 3CZCA 1ON2A 4MQVA 3KYJB 1RI7A 4KUMA 4XFKA 1VPWA 4R1HA 3R6SA 2EA2A 2C6YA 2PUCA 1LJ9A 4MGRA 3GFJA 4PZJA 4ETSA 1LBIA 1OYYA 3C3WA 3EYYA 4HYEA 3GUDA 2GWRA 1O57A 3IHUA 4LJZF 1IN5A 2LNBA 5HLIA 1ZRCA 4HNSA 2XHKA 2PUAA 4MTEA 3BRSA 1ZLJA 4OIQF 3QLVC 5D4RA 3J81K 2NT4A 1LDDA 2PLNA 3E6CC 4BHCA 1W5TA 5E1ZB 2FSPA 5FLXZ 4MNUA 1NXPA 2E1NA 2WC2A 3BILA 1BC8C 2MLGA 4LG0A 1QPZA 3T8YA 1Z6TA 2O61A 1SRRA 3TOBA 4KIGA 3MAJA 3Q15C 2O03A 2CG4A 1LVAA 2ZMEA 1IUYA 2PMUA 4GYGA 3F8CA 1A0OA 1ZARA 5DV5A 5JNSA 4RGSA 2MH9A 3NEUA 1QQIA 1H9TA 2B0LA 2PUDA 4BNCA 4YRZA 1XSXA 2KRFA 5KC9A 3LQQA 3SFZA 1EHCA 1NXWA 1KQ8A 5TPZD 1K6OA 2R7DA 4N9HA 4Q47A 3EJWA 1K79A 2PEXA 3OV8A 5ED4A 1U5TB 3CG4A 1Z15A 2VOOA 2QVOA 4KICA 2CFXA 2GIVA 1HW1A 3SXYA 5B3JA 3C18A 4RXUA 4EYKA 1R23A 1I5ZA 3WG9A 2BBYA 1SFUA 2HPHA 4JOQA 4UVCA 4L9JA 3FM3A 2DRIA 4RY9A 5KQLA 4M9ZA 2H6BA 4XRFA 4Q7EA 4Z99A 2VOPA 4QYMA 1J5YA 2NS0A 1IXSB 1GXPA 2K02A 2CWEA 4XLNF 4ASNA 3C97A 4MR7B 5HS9A 3UKJA 3J80Z 3EDCA 4KFCA 5I4CA 5KVRA 2HZTA 1SXHA 5EEGA 1IN8A 2JVKA 3GX4X 5LRSA 1SD7A 4FB4A 3P9YA 3CUOA 2NRAC 5L3GA 3F6PA 1IRGA 4PYRA 2HQRA 2QVGA 2QZ8A 4WXDA 2EB7A 2AYXA 2MSLA 3LKVA 3KTOA 5DUIA 1J56A 1BDIA 1B4AA 1ZG1A 4CBVA 1PEYA 3HIFA 5EWJA 3MM4A 1HSTA 5KQGA 4HDVA 2PL9A 4EVSA 1VRVA 3DZDA 5FO5A 3WTVC 2RJNA 1ZH2A 1IN6A 5K1YA 1ZESA 1BDHA 4A5MA 1GCGA 4A6EA 1P92A 2VONA 1FLIA 3GO5A 2A5YB 2WMYA 1XCBA 4KMRA 3WTXC 3HOTA 4KPYA 3TO7A 1OXBB 3E5QA 3MIZA 1L5ZA 2L17A 4RKQA 3PQJA 2P4WA 3GYHX 3HM9A 4AD9A 4UHKA 1FBQA 5JVTA 2FMHA 4RY8A 2PBIA 4ZMSA 3SZPA 5KI6A 5FLXK 3KYIB 2QQBA 3CZ5A 1L3LA 4FT8A 1BN5A 3BJ6A 3JTHA 3J7AO 1PP7U 2QSJA 1FSPA 3DPLC 1DP4A 2N9UA 3F6OA 3U9GA 2CYYA 1ZGGA 2F8SA 2FVYA 1LEBA 3EUHA 5F1RA 1ZVVA 1NATA 3KJXA 3OQNA 2V1UA 2XKPA 2DU9A 1XGOA 4L0YB 3LOPA 2IW5A 2A07F 3V8LA 1Z9CA 1L5YA 2WJWA 5ABPA 1S6LA 3IP7A 3I53A 1ZY2A 4Z4GA 2OBPA 1MB0A 4I0BA 3VODA 1PNRA 1WI9A 2WY2D 1HSJA 1CEYA 1RUNA 4CYDA 1YTUA 3HDVA 2YHAA 5IEJA 3K0LA 1G3SA 1R58A 3HXMA 4P55A 4RGXA 3OO0A 1REPC 3F8BA 4P9UA 4WF2A 4IXAA 3IWFA 1LJLA 4EUKA 5IUJC 1FFWA 4P96A 1U8TA 3MA0A 2O8XA 1GHCA 2VK2A 4DNCA 2XROA 3ROFA 4LD5A 2FRHA 1YLFA 4EYOA 1OMIA 4A0YA 1HQCA 2BV6A 2OA4A 5LEJA 3JAMZ 4MS3B 3BPXA 5C5EA 2WB4A 1Z05A 3SY8A 1JL3A 5HM6A 5BS6A 2CO5A 3KE2A 2AYZA 4B09A 3G85A 1D5VA 5CVVA 1B1BA 1B9MA 4ZH4F 2EV6A 2ZCWA 5J6XA 1ZDMA 1U6GA 3LUJA 3O1HB 3KP7A 3FGZA 4YS6A 3ZP5A 1U2QA 1URPA 2GXGA 4DN6A 3CKMA 4RXMA 5E3JA 3I45A 3ZMUA 1TW3A 1K7AA 3QELB 3F7NA 4UVAA 4IILA 4RZSA 1FFGA 3H5WA 4ZPJA 3GV0A 5ICCA 5FWYB 3DGFC 3FXRA 3C3KA 1F5TA 3T5XA 4Z4EA 1D1QA 2YPRA 5LGTA 5KK1A 2YHBA 4G7HF 3OMWA 5T3YA 1D4ZA 3JTGA 3F22A 3A0RB 4I2OA 6CHYA 1BOAA 5BPIA 1Y1LA 3BJAA 2VUHB 1DCMA 4MEYF 2IRFG 3GZ6A 2WWYA 1XDUA 1ZRFA 2MC3A 1MDMA 2HGCA 1LB2A 1JFTA 3BZ6A 1ABEA 3H6HA 4Q6WA 5JNVA 1R22A 5ERIA 4BXUA 3WTUC 1FP2A 2Z3YA 4S04A 3IRQA 2EFNA 3HSFA 5HSGA 3E3VA 1G4DA 2CHEA 3O1JC 5ILSA 1UDRA 2NZUG 3I71A 1UCRA 1MB3A 2R25B 2XAQA 2F5FA 3DF8A 2HYFA 1P2FA 3KETA 4L0ZB 3Q7RA 3QEKA 3RKYA 3B73A 4G0XA 5HDGA 5L3BA 3RTRA 1TQMA 3RVPA 2P5KA 2ZFWA 2L54A 1PDNC 1E6LA 1MDMB 1ZHHA 4F8JA 5DD8A 2W85A 4M9XA 1OR7A 1Z26A 2M1ZA 2ISYA 3E6BA 2A9RA 2DI3A 4MEXF 4G6DA 3Q41A 2Y75A 1XN7A 1UHMA 3RYPA 4KMUX 1JDNA 2CGPA 3F6VA 1EFAA 5D4SA 4ENKA 1DC7A 2L19A 3OOPA 4PGHA 1W9HA 4R8HA 3NNSA 1XHFA 3L00A 4YR7A 5DGCA 2W42A 3R61A 2JBAA 2JCGA 2P6TA 5FD5A 1YMUA 3SAJA 2DBBA 1IW7F 2JPCA 3E97A 1XSVA 3JAMK 1G3WA 1YS7A 1D1PA 1JYEA 5CNMA 3FXQA 4FX0A 1FWZA 2ADUA 5LGNA 4L9TA 2BEOA 1MIHA 4PDKA 4LRQA 1FZPB 4WT7A 3CO7C 2L2QA 1XGMA 4M6YA 2FQ3A 4RKRA 3K9CA 1WQ2A 2X7XA 3GF2A 3FFWA 2V9VA 3QLUC 4Z2YA 3H5VA 3ZMZA 1CF7A 3KCCA 2M8EA 1BI3A 4O6JA 1R1TA 5JNRA 2A68F 1HKQA 2YU3A 3UK0A 1P4XA 2E7XA 5CVIA 1ZREA 3I64A 3BRQA 2PE5A 2EWNA 2M1BA 3QK7A 4PCQA 1R7JA 5ICEA 1BIAA 1TVMA 4TMYA 5BRJA 1S3JA 2A61A 1RZRD 4LDAA 1JLKA 1C4WA 1FYKA 2FQWA 3IWZA 4L85A 3J81Z 5CVJA 2QQAA 3I4PA 3DEUA 2UXNA 2ESNA 4MS1B 1FFSA 4E7OA 3BP8A 2CSOA 4CO8A 4KREA 1SMYF 2TMYA 3I09A 5JHUA 4F3TA 4MR8A 5CVRA 3FZVA 4HLXA 2E4UA 2P8TA 1JH9A 4YGXB 4BHPA 3KZYA 3VNAA 1GUDA 4AIHA 2FQXA 2HSGA 4EJUA 3SM9A 5IULC 1LQ1A 4YG2F 4I0AA 3FFTA 2DPDA 3GBPA 2H09A 4EV0A 2GA2A 2W24A 3W9SA 2FBHA 4I09A 3F8MA 2O3FA 5H6RA 2OQRA 1J0RA 1QO0A 4IRHA 4NCAA 3RH0A 5BMZA 3OLXA 1L0OC 1AOYA 1A2OA 3IRRA 1A04A 3LKBA 4G0ZA 2HEOA 2F5CA 1G3TA 2R47A 4G8XA 3KS9A 4MQEB 1DCFA 5FFXA 2M98A 1B00A 3I5UA 2UWMA 2FMKA 2HKXA 1DBPA 3KHTA 4PEVA 3DLBA 5CVUA 1ZG5A 4RGUA 4LG0B 3BREA 3BPVA 1H9CA 1M5TA 1YK0A 1YIOA 2JK1A 2OU2A 4KNYA 2LBPA 4DADA 2STTA 3JPYA 5LLQA 4L9NA 1W4MA 3F3XA 3IP6A 4NQRA 4CXFA 4HNQA 3QU6A 3RKWA 1CHNA 1T39A 2ID9A 2KIUA 2RGVA 1U0SY 5DCMB 1JGSA 3C3MA 3BOQA 1ISRA 3RVRA 1R8JA 3WU1B 3HHHA 1IN4A 3VNBA 1E6KA 3ABUA 2MD5A 5TQ2B 2Y48A 2DK5A 1O7LA 4MLCA 2E4XA 2RV8A 1QGPA 3Q9SA 2IP2A 3HTUA 1G3YA 3JVDA 4XASA 1M2FA 2K7LA 4N0QA 5TPWA 3K2ZA 2HFHA 5DKFA 3LUFA 2ZNYA 1LK0A 4BYYA 4H0EA 3FMQA 1APBA 4CGZA 1YW9A 4P98A 5FB2A 1JXSA 1D8KA 4IJAA 3ISPA 4EJOA 3Q7SA 4RS8A 2LPMA 5IUNC 2HQNA 4XAQA 4Y15A 3FX3A 2LP4Y 3M9XA 1T0FA 4JQFA 3ELKA 2E4ZA 2VBZA 4ETNA 5FGMA 4ZZDA 1I6XA 4F11A 2MYNA 1W7PD 2NUBA 1YFHA 8ABPA 4LK0F 2ZKZA 4MRMA 4KN4X 2FSWA 1D2AA 3OMXA 4LE2A 3TKYA 5A2QZ 1DUXC 1ZGAA 3QPHA 2OD5A 4OTZA 1K78B 3O74A 2RC4A 3RQIA 1USIA 1BIBA 1JHFA 3TD9A 2ID7A 5IC5A 3GEZA 4HF2A 3KSMA 5TE9A 4M74A 2E4VA 4FHTA 3LQRA 4RK6A 1BAPA 2FEKA 1K68A 3ZMVA 2FQYA 2VBYA 1SAXA 2KYRA 3DFGA 4G86A 4MQFA 2J5OA 4HQMA 3D8UA 1KYZA 2EFPA 4HX7A 4OMYA 4XBFA 4Q4ZF 1BBYA 3OLYA 4O5AA 2W84A 5FFZA 3WE3A 3GW2A 3H75A 3N0WA 4KZKA 3I42A 1RPJA 4M71A 3NBMA 3HRSA 3QLVA 2PUEA 5JNTA 1O3QA 1TLHB 2ZBKA 2JB9A 5FBKA 6ABPA 1QP0A 2CHFA 1SXIA 4IRXA 3A3KA 1F1ZA 4EM0B 2EFQA 5IT3A 4EVRA 3PFIA 5BQTA 1T34A 3SG0A 3N97A 3JTEA 4UHTA 4RGRA 5E1XA 3CNBA 1UFMA 3DQVC 5H20A 1J7KA 1FPQA 4M72A 4DQDA 1GLGA 2XAFA 1ZG3A 4N03A 4Z4IA 1Z25A 5LHHA 5EWLA 1W25A 2P4UA 1R5HA 5F64A 4W5QA 4ZYHA 4D6YA 4WK8F 3EGCA 4OIRF 3HZHA 1EH7A 1O7FA 3N0RA 4RSMA 1BJAA 2XIGA 1NXOA 1BA2A 1TQPA 4KRFA 3S2WA 2J48A 2M5WA 3JY6A 5GOTA 5EWMA 2WRZA 4YFKF 2R48A 2XGXA 2X0LA 2IOYA 5PNTA 4Y17A 2NAZA 4MAAA 3RVLA 2K4JA 3WGHA 1PUXA 2E4YA 2IKSA 2ESHA 1JFSA 5EWMB 3HHGA 3HSYA 4MGEA 2O20A 1IF1A 4ZMRA 1USTA 3BBLA 2RDPA 1SFEA 2MH2A 3T8RA 4RU1A 2Z33A 2KIMA 5KWSA 3BROA 4IVNA 2UXXA 4WXHA 1ON1A 2JVIA 2BGGA 1KRWA 5EWLB 3RI4A 4G9YA 1KGSA 3KP6A 5JI6A 1MVOA 5TPWB 2EA4A 4NICA 2WWVD 1MD0A 4LGWA 2RQPA 2YSRA 3ROUA 3SZTA 4HLYA 3RVMA 3CTPA 2PUFA 2XV4S 3T1BA 1HW5A 1Z17A 4P9FA 4TLLB 4WXMA 3LWFA 4HV6A 5TPZA 1FC3A 4HF1A 3H3ZA 1Z18A 2BE5F 2FMYA 5ICGA 3IP5A 1OPCA 3O2JA 4YP9A 1RZRA 3G3ZA 3D0SA 2D1HA 2Q0OA 2VBWA 3CS3A 1RXIA 3TDUC 3PQKA 2FN8A 4Y13A 2IVMA 5L3EA 1DPRA 3C7JA 1XDSA 2QBYA 4MPTA 4EVQA 4QWQA 3HK2A 2FNPA 1XGSA 2RJOA 1LDKB 3E5UA 1IIBA 1JE8A 4MYRA 3R4KA 2PL1A 4B8XA 3KKEA 3M8EA 4GNRA 4IRGA 4MQEA 2ETHA 1FP1D 3P9CA 1YYVA 4G7OF 5D5UB 3ZMDA 1VLZA 2DQLA 1P6QA 4LLNA 5J8FA 3JVIA 3KP5A 5IBQA 4RK4A 2E7WA 2ZO4A 4DQ2A 3FMSA 3T8TA 3CU5A 4MS3A 3O3KA 3VFZA 4ESJA 5HLHA 2ZMEB 2L02A 2HS5A 3Q9VA 4ENJA 3N4MA 1U2PA 5CNIA 3TO9A 4MQ9F 4HZFA 4UXNA 4XARA 2V1XA 3DKWA 4YO7A 1U78A 3H5TA 3BDDA 1P4AA 3CRNA 1DRJA 1VTNC 1HXDA 3W6JB 1FYMA 3NHMA 1KQ9A 2VYCA 3HDGA 3FF5A 1K66A 3CO6C 2VE8A 1TQIA 3QRFF 4MS4B 3EQLF 2VT2A 5IX8A 2HWVA 4ON0A 1KA8A 3F23A 2PKXA 2P9HA 2F5EA 4CZZA 3K1NA 5LHGA 3QLUA 5K5QA 5AIQA 2FBIA 1BI0A 1OKRA 1FOKA 5TQ2A 1T2KA 4N41A 2R3SA 2E1CA 1QKKA 4IPAA 4M88A 1YS6A 2M87A 3RVNA 3HRUA 3GLXA 5CNKA 3HJFA 2NNYA 1OYWA 4N76A 1W7PB 3UUGA 3HS3A 5DCLA 1FYLA 3DP7A 4O3MA 4IRIA 1DC8A 1BVHA 2G9WA 3ZMTA 3RVSA 4HOBA 1RXEA 4MR9B 1USGA 4YFNF 5L3CA 4NCBA 1J75A 2FLKA 1ONVA 4A2UA 5D8LB 2G7HA 1Z2EA 1P4WA 5TRDA 4O5VA 4L5IA 1ULYA 3QOPA 1SMTA 3A10A 3COAC 1FSEA 4OOIA 3LAJA 3KP2A 2H3HA 1XMKA 2AS5F 2I6FA 3GXOA 4A5NA 1QP7A 4RXTA 2DT5A 4AIJA 4WWHA 3K9TA 5H6QA 1XD7A 3QP5A 3HUGA 4RWEA 4N0BA 5DD4A 2GX6A 1YVUA 2XASA 3SHFA 4BH9A 3L09A 3IL2A 2O0YA 7ABPA 3GYBA 1D3YA 4MQFB 4RB0A 1M2EA 2Y0MA 1P6RA 5FWXB 3WTSC 4ML3A 4LLGF 5TQ0A 3Q5FA 2WJAA 5FBHA 4LE0A 4EM2A 2XVCA 3A0UA 5AIPA 3JS5A 2XAHA 5TQ0B 3GFIA 1U5TC 5FWXA 4YFXF 3DLHA 1JDPA 1Z1DA 1RUOA 1C0EA 2FXAA 4HBLA 1LEAA 1R5GA 1S8NA 2P7CB 4EY3A 1JF8A 2JRTA 1DG9A 2GKGA 2HR3A 1IZ1A 3VB2A 2F2EA 3M1EA 1YTYA 1QQAA 3ILHA 3P9KA 1QMPA 2M30A 1VKRA 2BYVE 2XAJA 2IPMA 4XLTA 1TJYA 4U88A 1I3CA 4HX4A 4JK1X 1TBXA 3F8NA 2H94A 3EODA 5KQPA 1ZAYA 4NB5A 3V7RA 1JYFA 1T38A 1FBUA 3QX8A 2FOKA 2ACJA 3IKTA 4XLPF 1RNLA 2O6GE 1I27A 1UHWA 1LJUA 2RNJA 1R1VA 3V8KA 1MKMA 1ZGZA 1S29A 4RAYA 1U5TA 2EV0A 3I5AA 2JSCA 4FE7A 3NNNA 5IEBA 5IUKC 1YW8A 4EGZA 3FXUA 2JRLA 9ABPA 4GXOA 2V6CA 4UHJA 1XGNA 2EV5A 1RIOH 4GCVA 5HLGA 2A3SA 3U2RA 4HDUA 5A2QK 1WRJA 3T38A 3QU3A 4CICA 2QWWA 4KK4A 1NHAA 3FM5A 3HOSA 2Q8KA 3P9IA 3LUAA 1SD4A 1QZYA 5L3DA 2QR3A 2IPNA 2QQ9A 2ZJ2A 3MYYA 4KYWA 4O1HA 1DBQA 4Y9TA 3CJNA 5FWYA 4GYIA 2X4HA 3T95A 2FKAA 2FN9A 1KYWA 2HQOA 3M9WA 1J59A 4UUVA 2MSWA 2P5VA 1D5WA 1QQBA 4G7ZF 3WGIA 1TM2A 3LA7A 3TMYA 3HVRA 4N47A 1E2XA 3ZN1A 1DZ3A 2EFWA 5D5VB 1JFVA 4I02A 1G6NA 2D2WA 3DGEC 2K86A 4HNRA 5D2CA 3URMA 1DJMA 3E61A 2PJPA 3Q7TA 2GQQA 3WTTC 1JHZA 3QX9A 3KLOA 1O3TA 3LUGA 3HO1A 2GXBA 4BHBA 1ZITA 5JS1A 4HQEA 2P5LC 4UV9A 2PLYA 4W5NA 3JSPA 3CG0A 3RPUA 5E17F 5ICFA 3D02A 4LE1A 4UV8A 2HYGD 5HDKA 4G0MA 5L3FA 4KMFA 4LMYA 5DLEA 3EDPA 1SXGA 4H60A 1J9IA 2UZKA 4EGYA 3CHYA 2VXZA 4S05A 1W5SA 2A6HF 4ESBA 2Z5UA 4MTDA 3K1MA 6PAXA 4G0OA 3LSTA 4PE5B 3LFKA 3H6GA 4EGSA 2PFBA 3EAFA 4G0QA 3CDHA 4RV5A 1WWXA 4KDPA 3OM1A 4F7ZA 3CTAA 3QP6A 3DPTA 5JR3A 3LUKA 4P1ZA 3LA3A 2ZNZA 1S7AA 4ZJPA 3DBIA 3OQMA 4NHJA 4BQAA 2XUBA 3H92A 4KK3A 1J2XA 2K4BA 2QM3A 2HDCA 4U7BA 4EJVA 2OAZA 2QYOA 3O2QB 3H3UA 1QPMA 5KC8A 2VODA 4GO1A 1Z16A 3LUHA 3R60A 3DXJF 4OIPF 3MF4A 3CFYA 2FBKA 4ENMA 2P7VB 1SD6A 3ZMSA 4M9SA 5D5WB 3DV8A 3QPTA 1SD5A 2MBFA 1R00A 3QEMA 4EM1A 5FD6A 2QLZA 5D6FA 5E1WA 1FSHA 3G1WA 4WX9A 1ZRDA 1MZBA 2DAOA 2WTEA 5EWJB 2XKOA 1KMIY 4JASB 2A9PA 5AONA 1TNSA 5DCMA 4WXCA 2FEWB 2JBAB 4KA4A 4I7HA 3T0YA 2G7UA 4KIFA 4A0ZA 4LZLA 3FMRA 3L9FA 1QNLA 3H5IA 5EEHA 3GA5A 1Z6RA 2VN2A 1U2WA 1PEAA 2MLKA 3K4HA 2MYUA 4RK1A 1FBSA 5JNWA 1DRKA 3HUUA 2EK5A 3NHZA 1HKSA 5K5RA 1C0WA 1PHRA 1QNTA 2ZAYA 2HTSA 4MR7A 3EQ2A 2L4AA 2RDMA 4RB1A 4RDCA 1HBXG 5BRAA 3ECHA 1MJBA 2FTKE 3N8IA 3EETA 4QICA 5HKOA 2A9OA 3RVKA 3E5XA 3WTYC 3MEXA 3CLKA 4EJWA 3FWEA 3S99A 1KU3A 2DK8A 2NNNA 3M6MD 2NT3A 1T98A 3BWGA 5DEQA 3KZZA 5DYMA 1U04A 1U3EM 2L01A 3V4GA 5CLSA 2HTJA 1JWLA 3I59B 3RIRA 4UNOA 3LUCA 2D45A 2RN7A 4RAZA 4F06A 3CUQA 2DTRA 4G94A 1DDNA 2CQKA 1JHHA 2E4WA 2B1JA 3GL9A 4M6XA 3N75A 2LIVA 2JZYA 3FMVA 2PUGA 2RKHA 5IT9Z 4MHGA 1F9NA 4Z4CA 4IHTA 2JTVA 4D6XA 3WE2A 4KQCA 4ZYDA 1EWVA 1ISSA 1LDJA 4EQQA 5B3JC 2IPLA 3RKXA 3H1FA 1ZAOA 2PG4A 4KQ9A 1FQWA 4CDGA 3RYRA 2RVCA 4ESFA 2GA1A 2KIFA 5LBQA 2A9QA 1IAWA 2GI4A 1KU9A 3HRMA 1KU7A 4M73A 1YO5C 5CNJA 3O1IC 5D6EA 4AIKA 4EVIA 3GBVA 4ENNA 4JA2A 2QU7A 1H9GA 3LMKA 4LFUA 4JAVC 2VC0A 3GVAA 3M8FA 3HTSB 5HOOA 2PN6A 4UVBA 3R0JA 4U7DA 3EULA 3TQNA 2ISZA 4NQWA 1PUEE 2V1DA 2OENG 2XRNA 2FEPA 1B59A 2COMA 1GXQA 3R0AA 5CJ9A 5E8GA 3ZN0A 4ZYEA 1SFXA 3HUTA 1Z12A 4OIOF 1STZA 1JBEA 5JS2A 3K69A 1ABFA 2IYNA 3G73A 3QLTA 4RK5A 2FMIA 2OZ6A 1DP7P 4JB2A 1GCAA 4Q5SF 3IDOA 4TN5A 1E17A 4LB5A 3GRCA 2YX4A 2QXYA 3HYIA 4L9VA 2JVJA 1I1GA 1F4KA 2QUFA 1BI2A 3WGGA 4HAMA 1NY5A 1AB5A 2L4MA 1U8RA 4FX4A 1IXRC 1FY7A 3N6VA 3CLOA 3E6DA 3B2NA 1QBJA 3C1DA 3KCNA 5DTEA 3GT7A 5C5CA 3RDIA 1T6SA 2FNAA 4EYQA 5GQSA 3IP9A 2FA5A 3L49A 1Z7UA 5BQ3A 2LDUA 3BY6A 3QAHA 2PUBA 4L18B 3O2SB 2HOEA 4YV7A 1ZYRF 2V79A 3WU0A 4HW0A 5LRRA 3MMNA 4JBAA 4KIBA 4NV3A 3RVQA 4IMJB 1NXXA 1MJ9A 1AB6A 4I01A 3F73A 3L2CA 3L6UA 4RY0A 2QENA 1HW2A 3QELA 5BPDA 1NXSA 3C6QA 3LAPA 4L4UA 2IDMA 4PZ0A 1PNTA 3KP3A 2Z99A 3SQNA 3KP4A 1WSUA 4EYGA 1NTRA 3MWMA 3ILYA 2K27A 1S7OA 1QO0D 1IRFA 3I58A 5DUKA 4U0WA 2VC1A 3MZHA 1TNTA 1MJAA 3N53A 5TQJA 1MAVA 4R79A 1B6AA 3RPQA 1QZZA 1OYIA 2VE9A 3O75A 3KEOA 2F8TA 1ZLKA 1BM9A 1XHEA 1Q1HA 2XDYA 4PGGA 2PAFA 3HEBA 3B02A 4EMSA 2FXIA 2JT1A 4YCSA 3KG2A 4XSXF 4W5RA 2W25A 3D5LA 3HSEA 3JPWA 2PI0A 1DBWA 2J5PA 3IKVA 4QPJC 5CYVA 4K2EA 1O3RA 5BR1A 2EFOA 2PJUA 3H5LA 3V7CA 2CW0F 3OQOA 3T6KA 4MS1A 2R4QA 4WXEA 5JNUA 4L5JA 3KFWX 4TLMB 3EQZA 1HKTA 5IT9K 3LA2A 1MGTA 2VT3A 2DPUA 2Z9OA 2FMLA 5DCFA 4IF4A 1P6UA 2GAUA 2XAGA 3V8JA 4A0XA 3RVOA 4EJTA 2MA3A 1ODDA 4D74A 2L18A 3CUQC 1CGPA 3M9AA 1LBHA 4IGAA 3KEQA 3FHZA 3HSRA 1YMVA 3ECOA 4QYWA 2STWA 3ERED 4PICA 4D0PA 4ETIA 3F72A 4Z9BA 1EAYA 3RVJA 1V3FA 1F4VA 4E70A 2LUOA 3TX6A 2PMHA 4HX8A 1XSDA 2FLWA 1KQ0A 2QW1A 2ZXJA 1XMAA 3E3MA 2KJCA 2FF4A 1KU2A 4OATA 4WCGA 1H0MA 5D8KB 1TTYA 2B4AA 1X3UA 5E18F 3SNKA 1NXTA 1Z2DA 3FFXA 1KRXA 2M45A 1FX7A 4RK0A 1M5UA 3MFKA 3WTZA 1ZH4A 2PMCA 3N0XA 4F12A 1DCKA 3MQ4A 2CD7A 2A69F 2Q2EA 2IPAB 2NYXA 2ZWMA 3JSOA 2GZWA 1D8JA 2VUIB 1UB9A 5HDNA 1ZH5A 3E6MA 2W57A 3ROTA 4MLDA 2EJRA 3O6BB 1PP8F 5KQMA 4IMIB 4U0YA 4G0PA 1TW2A 5LEKA 1RZ4A 4GPAA 5HVQC 1XCVA 3ZPLA 4OINF 3F21A 3H1GA 3KLNA 3ULQB 2MSKA 4YIIA 5T7BA 2OQGA 3HCWA 5ILVA 3MCZA 4WWCA 1XB4A 4AWXB 1FNNA 2R7FA 4Z0NA 2P6SA 5E20A 4Z9AA 5LHIA 4WZZA 1BI1A 4XXHA 1GVJA 3RJPA 3ABTA 2FEZA 4FE4A 1GUBA 5CHYA 4N9IA 3AAFA 1HEYA 3TDZC 4XSZF 2LF7A 3ZQ7A 4GGGA 2QBYB 3GWZA 1ZGJA 2BGCA 4W5OA 4YIFA 5HS8A 3OM0A 4ZZLA 2AXLA 4LK1F
chains in the Genus database with same CATH superfamily
1KI2A 3JW4A 4O2BF 1MIOB 1RHKA 3HB5X 2XDQA 1WO8A 4OMCA 4LZZA 4MW7A 4LHXA 4NZYA 3X2QH 1XPRA 5EINA 4QOEA 2XQKA 3I1IA 4QEKA 5K7SA 4RZUA 5E4YA 3TB6A 3AEZA 1XMOB 4ZDKA 3U3DA 2GARA 3UWOA 4BCDA 4I55B 1XAHA 3PX3A 4CCSA 4P86A 3ICEA 3BJOA 3NU1A 1ZU5A 1LNWA 2K85A 1NVWQ 3KYDB 3EXG2 3H1EA 1V37A 4QUBA 4WKOA 4ZOLF 3FH0A 2OV8A 3AHIA 3OWTA 4HF0A 1LFPA 3NO4A 3PC3A 4WJLA 3NOXA 4DV7B 2BR4A 2TS1A 4MJ7A 5H3LA 4C4ZA 4RVCA 1OA1A 4I0WB 3FNRA 3VR0A 2OK7A 5F77A 3HUFA 3KJZA 4UBMA 2ZVDA 1CRZA 3LGSA 5E9JA 4INPA 1EFRD 4DLUA 1Z2CA 3LZ6A 3H9UA 1EH8A 1RR7A 3S8PA 1MC1A 3KQTA 2CYAA 2EG5A 2LKPA 3FZGA 2CF5A 4MRRA 3UH1A 1PJBA 1MBZA 5TPZA 5I7VA 2WTBA 3AW9A 4HB0A 4I50B 4N8SA 2JCXA 3OHSX 1NZFA 2VL8A 2W22A 4NBTA 2PMEA 3RYFA 1AKUA 1YOBA 2R4GA 1JTYA 2E5LB 2PZAA 2H4FA 2HIGA 4DJ5X 1GGHA 3VOAA 4EUFA 3TGNA 3KHUA 3PNBA 4U2CA 1DADA 1ACJA 3EVFA 3FVRA 3RRZA 3RS3A 4BNUA 1K8QA 4J8PA 4U7TB 5B1BH 4C0QC 4NS4A 3GIWA 1VBKA 3I5MA 1VXOA 3R0QA 4Q1BA 1P9NA 3PF9A 4ZAZA 1PJCA 5F73A 3CLSC 2FU4A 3L7CA 4ALNA 5JH7F 4JVMA 3G89A 4H31A 4ZYLA 4K05A 2LH9A 1G8FA 3KFXA 3TL4X 1J8YF 1E1LA 2C58A 3V1UA 3JZIA 1VJ5A 3GEDA 5JZ9A 5FI0B 2CVFA 4UUSA 3A7DA 2NQ8A 3PQ5A 5EJ2A 3ZQFA 2IXEA 2P6NA 1TL8A 2CNWD 2EQBA 2RCNA 1DU0A 3HXPA 3PXEA 4WGFA 5BQPA 5LBUA 2F90A 3PUJA 1AM4D 5EXDA 2AX4A 4AUEA 5K6AA 2QV0A 4ZO4A 4DGQA 4EY6A 1E6MA 2OHXA 5BOXA 3OE5A 5JD3A 2EXXA 4MW1A 1EWTA 5ALDA 4E2YA 4CLRA 3AOEA 4CM3A 3BDVA 3ETDA 3WFZA 3NG1A 4F85A 3DF9A 1B15A 1JKPC 4G97A 4FFNA 3LHKA 1MJHA 1J9GA 4KI7A 2FEOA 3NHYA 5CX1B 1B43A 4GSKA 4FSXA 3GFMA 3HBMA 3AJ8A 5EKDA 5JD6A 3T99A 4DNPA 4CEIB 1YW7A 1NAHA 2WAFA 4XB1A 2MW8A 2R86A 1QVWA 2V4ZA 1UK7A 3FUXA 4CNQA 4DIKA 1CJKC 5GV8A 5JUWA 3N2GA 1H2AS 1U1EA 3I59A 3WLLA 3RFUA 4AUNA 1K97A 1FDUA 2R5YA 1VQ9I 4UBJA 4TKVA 2D54A 1Z13A 3WYEA 5L4LA 1J22A 3CBGA 4ZDLA 4BFSA 4C7XA 1EMDA 3I52A 3UWPA 3FTFA 2IE8A 1XZDA 1TPZA 3HV2A 3K4KA 2DFIA 1XYGA 1JSXA 2C5EA 3IPCA 4LSMA 4PLZA 4QBTA 4L4RA 1LDNA 1NI4B 2ANCA 4NCNA 3EZ2A 1MT0A 3B5EA 3G1MA 4HV5A 1GT0C 1SB9A 3MXTA 3PLNA 4QRIA 4C2AA 5JQGA 1Y6FA 2CXPA 1M0EA 2HO4A 5AKYA 4ZYGA 4NNPA 4Q7JB 1E20A 1E1CA 1AU7A 4H3KB 2X86A 4H3HB 1VQ1A 4NPAA 1K8RA 3O8RA 5FWDA 1E3WB 1M74A 2QL9A 4QJ5A 2ZTSA 3INRA 1AJEA 1UJMA 1XAIA 2R6GA 3GLHB 5KOHB 2VVTA 3AESB 1BR4A 2QX6A 3OUUA 4LDJA 4E03A 1CYEA 4OLAA 4FW9A 1XRPA 4BLQA 2AW3A 4J29A 1L5WA 3CINA 1BA5A 2Q0QA 1FFXA 4I98B 2AF3C 4GOOD 4MRMB 2ST1A 4RC9A 2I29A 4W5JA 4P3KA 2QROA 1W7PA 1FPMA 3REQB 3U56A 2B9VA 2QT1A 1J0XO 3PRHA 4OU0A 1TGYA 1U7TA 2VN8A 2VTDA 3GLIA 4LLLA 3ZD7A 2BFFA 2IJLA 2OBYA 2AXPA 3UMGA 1EWKA 4BMVA 2D5AA 4LZOA 5KWIA 2BKLA 3C74A 1EBBA 3AR7A 2WYHA 5DDGA 3MFYA 1NUUA 3JD0A 2AIRA 4CA0A 3RT1A 2V0NA 1X6VA 4MI9A 1RXVA 1FTQA 3MUFA 1AQ6A 3O8QB 4M38A 4PSUA 4DBVO 2D5VA 1VOTA 3NNDA 5I9BA 5TR9A 2Z57A 1PJ2A 1R36A 3HU1A 2H18A 3IA2A 2Q8PA 2X41A 1UF9A 2XVAA 4J0HA 4F93B 4I5GA 2AUNA 3U5ZB 1DWQA 5H68A 4MR8B 4HSRA 1TZMA 3NBAA 4A10A 4YCAA 5I7SA 5H1YA 1O9BA 1RKQA 1QGDA 4UMDA 1QB7A 3V8EA 1YZNA 4MSUA 5L45A 1ZK1A 1ODLA 2DOKA 5JSUA 3O21A 2ZYGA 4XTRA 2BBTA 1FP6A 2YJZA 3EC7A 3EYIA 1WCWA 1SEVA 5EG0B 3AVOA 3FFAA 3TRFA 5KJCA 3JR7A 4M3FA 4FUTA 4OY3A 4OBXA 1EZZA 4TVBA 5AK4A 5HS7A 1RHQA 3PGKA 5EE5B 5G02A 2O5EA 2PKCA 1O3SA 2ZW9A 1FEZA 5AIAA 5J8CA 3I04A 3GP8A 1V5GA 3M0EA 3CYFA 1QG6A 3W8NA 5EZ5A 1RPNA 1VJTA 4O4IA 4WL0A 4BZZA 1A36A 5DEOA 4IKFA 3D4NA 1ZYUA 1O95C 4RE5A 3H97A 4JENA 2JJ2D 1X86B 2X9DA 2HVSA 1NW4A 3F6CA 3GCXA 3PFNA 5D8DA 2IA0A 4LIVA 4QDXA 2KKOA 3G8CA 3UK7A 3BWDD 1ZOPA 2BDUA 4I1YA 3AEUA 1K06A 3GJ4A 1IMOA 4MQVA 2NTNA 4FR5A 4MCHA 4X91A 4HGRA 1W9MA 5EDNA 3F74A 4QDTA 3KEYA 4XFKA 1S3SA 1MMDA 3DVQX 1Q0TA 3EIXA 3FXOA 1SCUA 3QOXA 4M8NE 1K6JA 4PRKA 3F3KA 4EITA 3A6PC 1G4UR 3A02A 4MGRA 5L4NA 4G84A 2M9HA 4PZJA 1WXEA 2OCLA 4ARCA 5JQGB 4BV8A 3W8EA 2HU8A 1BX3A 2V4MA 2KMUA 1F8GA 3GEPA 3N28A 1BCRA 3A0BC 2XHEA 3N2NA 1GZVA 1O57A 1DX9A 4IQFA 5CLLA 4BX8A 5LD2C 4OXQA 1JHVA 4ENUA 3QBJA 1V3TA 2DT7B 1U2TA 3IUNA 3SM3A 2XHKA 2X1EA 1N3IA 3OJFA 2ZATA 3OOJA 4CUZA 1KY5A 4EB8A 3D7LA 3PPVA 3UEOA 5JLWA 4Q3BA 1ZLJA 4OIQF 2VXOA 4F60A 3GCDA 3QLVC 3WJ2A 1YJNI 2QKYA 3LQFA 5IKOA 1UPCA 2O05A 3C87A 2NT4A 1DAEA 1OBFO 3P2JA 3R9IA 2JFQA 1GA1A 4QBGB 2IEGA 4PC1A 4QJBA 4YT8A 5TGTA 4UE6A 4BHCA 2FUG2 1FJHA 1Q50A 3CPSA 3JQ7A 3QXSA 4M7WA 1NRWA 4Q16A 3GF4A 3ONFA 4UAUA 3X2EA 4ZTUB 1WS6A 3L46A 4X3CA 3I32A 4DE5A 4MI3A 1EWYA 1Z0KA 1IUFA 2GEKA 3BILA 2ZVQX 3KRTA 3JSXA 2P0WA 2M32A 1L7RA 4WPGA 2CLKB 3D2BA 4JMLA 3T8YA 4ERNA 1SRRA 3QF7A 1AQNA 1BH2A 1X4OA 3GH1A 4EW1A 4KIGA 4FGJA 2NYVA 1OFTA 4LRXA 3MAJA 1OSNA 1LFBA 3Q15C 4R84A 5C1IA 3NRBA 3H1AA 1KPHA 3TLKA 4DM7A 4G63A 1B8UA 1W1UA 1B0PA 2W93A 5FO0A 1JNYA 3RS7A 4TWZA 1PCXA 4C5CA 3AOGA 1IUYA 1CQWA 1IBSA 2H9YA 3GC6A 3O4RA 3PB3A 3AG3H 2AR0A 2VDOB 1JVBA 2ECFA 2PGNA 3G2IA 1HDGO 1A0OA 1T36B 1BHSA 3KHKA 5C0OE 3RIYA 3DFUA 1KXZA 2J3LA 3UFXB 1UJ2A 2JCVA 4IV8A 3W2WA 2BFNA 5G1PA 4DCMA 2MH9A 3NEUA 1JLRA 1WUIS 4TYNA 1WUHS 2WJ3A 3CUSA 4E5UA 5LOVA 3I72A 4OHUA 1RD4A 2CLHB 4PIVA 4YRZA 2KRFA 2HRQA 2WSSA 4L27A 4NZZA 5WRFA 1VYVA 3SFZA 2EFJA 1N2ZA 2ESRA 2F1IA 4JELA 4RNDB 4ZRMA 4I1PA 3S7TA 4EO9A 1K79A 2B35A 1WRBA 1ESMA 3LNQA 2HIMA 1JB9A 3HFJA 3JD1A 3KQVA 3PDWA 3RUCA 4AKEA 5AW1A 5K3EA 2IHVA 2HREA 4JBGA 3G2HA 1PFVA 4RNCA 1O6FA 3FCAA 3R5XA 4KICA 5D01A 3X1MA 1TMGE 2B2NA 1YRHA 2BMEA 2PL5A 3BWCA 5AVOA 2CDBA 1XX6A 4EYKA 3USZA 3DDCA 4TYQA 4G5YA 1DUSA 4WASA 3UT6A 4FKMA 2CJYA 1E92A 3VDXA 1PFQA 3ZV7A 1VQKI 1NG7A 1DFHA 4M9ZA 4RY9A 5KQLA 3K1AA 3KJNA 4Q7EA 4NYJR 5C8VA 4G0UA 3EPHA 4BP8A 3ZCTA 3FBNB 4LHYA 1A82A 4M3BA 2OWDA 3HI4A 1JPVA 2VLAA 7REQB 1H1LB 2OLEA 3TFWA 2L7MP 1J21A 2YZNA 3HPHA 3VR4A 4W1QA 3EVZA 5ARCA 3ZGOA 4BKQA 3O3OB 1RPAA 3PHJA 3U9TA 4U8GA 2OTCA 2GK7A 4F71A 3M07A 5HS9A 1AMNA 1EE1A 1Z74A 4J9VA 1HRKA 3MB8A 2HZTA 4AF6A 1VKJA 4CV0A 5EEGA 1U8UA 4LHZA 4MX8A 3X43A 4C01A 3HBJA 2CDAA 1BO6A 1VRWA 1U8XX 2QTMA 4F46A 4FB4A 4HS9A 3H05A 3IAAA 3PUFA 8OHMA 5KYXB 3ELUA 1MX5A 5IY5H 1NWCA 3CIOA 4REOA 3EPLA 1IRGA 4PYRA 5CX4A 3MN2A 5AESA 3KB2A 3NARA 4RF3A 2QVGA 4AJJA 3NTUA 2MSLA 4OJQA 4DY6A 2L7ZA 1KYVA 3C5WP 3V3TA 3ZE7A 2PUJA 3LKVA 2UZAA 4IDQA 3FCOA 3YASA 1FTSA 3DV0B 1O87A 1X8XA 4N48A 3B48A 3OCUA 4MIOA 2ZBPA 2IXTA 1OHHA 4JBLA 3CNEA 4UHBA 4CZ2A 2QGZA 3LAWA 5F3WB 1ZKGA 2CN1A 2FR1A 3Q4GA 3HIFA 3M3PA 1YGPA 2XGOA 3SZRA 3STWA 3N7AA 5KQGA 2B1IA 3BQ9A 2XITA 4IY1A 4ASUD 2JEOA 2X3YA 1AGYA 1Q7RA 2ZXFA 5AYVA 4FTWA 1GU0A 2A5LA 3DZDA 2CHQA 2J7KA 2IDJA 1T2AA 4ZARA 2ZRBA 1GPYA 5G0WA 4BO9A 3ND5A 2RJNA 1ZH2A 4IOCF 3IUEA 1G98A 1MUUA 1MF7A 3IHLA 4JLJA 2O8NA 1UBSB 2J09A 3P9ZA 3FCYA 1I2MA 4ZVUA 3D1JA 3FB1A 1KQPA 1BVYF 1E62A 2JFYA 3HABA 4N3AA 5CPFA 3C5VA 3A7EA 4FN5A 4BNJA 4D44A 3QBEA 2QS9A 3MVEA 1P92A 2VONA 1FLIA 2L42A 2Q2OA 1R49A 1SFRA 3L6CA 1WXFA 3B1YA 1QF6A 3THRA 3T5BA 4L5AA 1UFRA 2A5YB 2YHSA 4LYHA 2PEZA 5ALYA 2DODA 3UCFA 2O7RA 1P7JA 5K7ZA 3J80A 1V5IA 2ZTVA 1U0GA 1WPGA 1OXBB 2JHPA 2VHVA 2X9LA 3PGVA 2OUIA 1FFDA 2C2ZA 3MIZA 2CFCA 4M3NA 2PFSA 1E69A 4AKTA 5LZ2A 3PQJA 4YK7A 2YMPA 3HGQA 3WLRA 3GR6A 4R81A 4XLFA 1OR7C 1N2BA 2OZPA 4ZEMA 1KI6A 4UHKA 4YMIA 2JWTA 2DQ4A 3SC2B 3KTFA 4BBRJ 4BV3A 4YIKA 2F5VA 5F23A 3MBKA 1W2GA 1N7GA 6ADHA 1OT5A 2FMHA 2QTCA 4RY8A 2X8LA 1G2HA 3FMFA 3PXGA 4LOIA 1SY7A 4MW6A 5KI6A 4L78A 4B3BA 3K4LA 4MW5A 1XG1A 3IUOA 1MVLA 1CUDA 3D2AA 3RU7A 4AN4A 4LF7B 3HM2A 4YBZA 2ZIAA 2OE2A 3MGKA 5CXSA 3ITNA 1E7QA 4PZ9A 2BM8A 5EZYF 3SFTA 3STXA 3ZDRA 2YJGA 3DCYA 4JBYA 4WBSA 2A0YA 3V2IA 1PP7U 1SZDA 1YAJA 2BZSA 2D1SA 3DKYA 3P1JA 5BR4A 2G1AA 1FU8A 4YIRX 1DP4A 1PP4A 3AO0B 4I4IA 5CK5A 3F6OA 3DAOA 4C1BA 1P29A 1QO9A 2CYYA 4YDHB 2DA1A 1DPGA 2FX2A 3TZQA 3PC7A 2O7QA 4LCBA 3GAFA 4BNGA 4U8HA 4ZHQB 1X58A 3RC8A 2I6TA 3IBTA 2Q49A 1H4TA 1NR1A 4RAFA 3OFVA 3QFCA 4ZJYA 1CZOA 1MKYA 3OQNA 2V1UA 2ZU0C 2XKPA 2DU9A 4HFNA 4ZCQA 4Q3NA 3T3DA 5E9WA 2BY0A 2GJSA 1IFXA 3QWFA 3C3JA 2WM2A 2CUFA 4B3JA 4DNFA 4OXKA 1K8ZB 4E5KA 5B58T 2Q9UA 1X2NA 4AJPA 4BTLA 3DV9A 3HB1A 1JHQA 3FXKA 1O89A 2ARKA 5KYVA 2CNKA 1A5JA 1P81A 3W8RA 1YTLA 5M3FJ 4IIHA 2OCBA 4Z4GA 2OBPA 1HOMA 2OV3A 2OYSA 1YL6A 1AQIA 3A9WA 3W3CA 1JJAA 1PNRA 2M4KA 1UZUA 3DKKA 5J1YA 3GJRA 3HBAA 2WY2D 3KM0A 1XZPA 5FBWB 1HSJA 1X8JA 4IDAA 2JFNA 2CLEB 3MTBA 1E58A 1OXSC 3JYOA 1WW3A 3NQ41 4JGBA 4XEUA 3R5SA 2YS6A 5DISB 5E6UA 2FEAA 4A3EJ 3AETA 4CYDA 4Y2HA 3RARA 3HDVA 4F9TA 1HYHA 4OJNA 2ORIA 1DWOA 2EBUA 4IKOA 4OMDA 1R58A 4KXVA 1L4MA 2VDJA 3L8HA 1E5VA 4IIXA 1SVIA 3OO0A 3WYBA 2AN3A 1WSDA 2DC1A 1J1UA 2A6TA 3VR1A 1PT5A 3Q5EA 1AF4A 1UOQA 4WF2A 2WAQA 3CJQB 3AL3A 2JD2A 1E2FA 1WUYA 3GLVA 5JROA 3G79A 3U09A 3DTIA 1FFWA 2YIVX 5FTKA 3SEQA 4NATA 5L3QA 1U8TA 3LQYA 3LWZA 4KO4S 4QTUB 5C31A 3VVCA 4A8TA 2HJVA 2G1KA 4G1UC 2O8XA 5GAHJ 3SC3A 4OI4A 5M5YJ 3OWOA 3GB9A 4HXFB 4PWZA 4U2GA 3DKXA 2YYSA 3A9VA 1WCV1 4LD5A 3I1JA 1KK0A 3VR3A 4KXYA 1P5JA 4XPIA 2QQGA 2WNIA 1QRSA 1QV6A 1XG5A 1YQDA 3JAMZ 4TMVA 3BPXA 3DH0A 4B83A 4KE8A 1XNJA 2UYYA 3TI7A 2GM3A 1E7YA 2ILVA 1G5QA 1HKHA 1IK4A 2HNAA 2ILTA 4GQBA 5JZMA 5C3UA 4AF8A 1KZ6A 5K01A 3ZHVA 3CO5A 4Y2YA 2BEUB 4JJEA 5FADA 2QVLA 1GO2A 3OS1A 1C3OA 4F2DA 2B8EA 4FSDA 1S7EA 5F2NA 3E8SA 2YXBA 2R6AA 1RYHA 2P6MA 1B9MA 1CY8A 1YQ9A 4GRDA 2ZCWA 1ZDMA 4R1TA 4BB9A 4ER3A 2D13A 3O1HB 1JKOC 2PJRB 1N2CB 3VO9A 1T35A 2Q5IA 4G1MB 4JJ7A 3FGZA 1M2OB 3ZP5A 4GR4A 4LYYA 4PV7A 1XGKA 4YS6A 4CYMA 2GXGA 1ZMBA 2H2HA 1CQZA 1KARA 4RXMA 1U8YA 3OD1A 5E3JA 2DFDA 2WJPA 3I45A 3ZMUA 3VYVA 3QELB 4D1YA 2FD5A 4UVAA 1BW5A 2VWPA 2ZVJA 5EQTA 3ZQLA 4Q1EA 3UHOA 3EXFB 2PN1A 5AUOB 3A6JA 5ICCA 1SBCA 1BS9A 2XTMA 4J7CA 3CWZA 1S7GA 4FHEA 5HE9A 3W6OA 4MICA 1TZLA 5BQFA 3KKKA 1WNTA 3EBLA 3B6IA 2QMEA 3M4ZA 3PZBA 4BKPA 4UQOA 2XZDA 1OZHA 2H1OA 1D1QA 2YPRA 5LGTA 5KK1A 2RGNA 2PG3A 3BQMB 5U1PA 4AIIA 3OMWA 2JI4A 4A3BJ 3DDZX 1DV1A 4RVDA 3FUTA 1D4ZA 4GR5A 4YCBA 5JD5A 4YB8A 3JTGA 3JALB 5HBGA 4HAVA 3JATA 4I2OA 1OJ7A 5MF6A 2ZXUA 1BOAA 1MQ9A 1ETQA 1VKZA 3A4MA 4OX9B 3JYLA 2YFKA 5C32A 4CIVA 3PQ7A 1C1DA 3ZCOA 3BK2A 4RY2A 1A4IA 1LFDB 1JLLB 2CB0A 5DX0A 1KEEB 3IH2A 1CY7A 3Q0TA 4DJDC 4EG7A 2GZSA 5D86A 4H4KC 4GP9A 2ZBQA 1Q1VA 3DLPX 1GAQA 3H0KA 4JLPA 2YWBA 4CETA 3B2EA 1UBUS 4FEEA 1MJGA 4JYCA 4ZT5A 1FS6A 1YOVB 2G06A 1JPJA 3OM8A 4FNMA 1AA7A 3B9QA 2YXDA 5TIIA 2HGCA 2POCA 5CR9A 4URVR 3FXMA 1F0PA 1NKVA 4N4OB 2A5GA 2I03A 2PX5A 3D7SA 3GMIA 3MRSA 4HYTA 3OOHA 4OKNA 3RO7A 4P0TA 3R7NA 2WDPA 3AUTA 2BMWA 3S2SA 3L7KA 4JLDA 1G60A 4U00A 4ARUA 5YASA 3OYCA 2CK3D 3TG2A 1UUFA 1PI3A 4KIWA 4F8EA 2G4VA 3KR1A 4BXUA 2IU3A 3IYLW 2HA7A 4TQ9A 4S04A 2Z3YA 1SUAA 2ZFUA 4BO4A 1E3HA 4ARVA 3KOWA 1W0CA 5A1TA 5AXAA 1C9MA 1R9TJ 2VXYA 3EIHA 3KUDA 4MUMA 5HSGA 1VQLI 3OSUA 4W9NC 2FX5A 1GWNA 3O1JC 1XRNA 5T5QA 2H00A 4CQLB 3VUFA 4UCQA 1XWIA 3T7SA 1E79D 3RTDA 2PL3A 1AK9A 4FYVA 3KAQA 2YWHA 3SU8A 2CKDA 2A0KA 2R25B 3NP9A 4R68A 1X15A 4Q9LA 2QUAA 4CW7A 4S24A 2GPTA 1A76A 1P2FA 3KETA 3WGNA 1F48A 2YZMA 5HK8A 1VMEA 3NVDA 2FZ5A 4FZVA 4L0ZB 4E22A 1PAUA 3EJ6A 2PQ0A 2H9AA 3RKYA 1J8FA 1PEDA 2LE0A 4LYAA 4FMCB 2BHSA 1HR0B 4G0XA 3E0JB 1L1EA 1W5EA 3WMXA 1LK7A 2M3AA 4KMSA 4X5OA 8LDHA 1T6NA 4D0NA 2RK4A 2P5KA 2HRBA 4FMBB 3G2KA 4MVJA 2L54A 2JFVA 4BKRA 4EUSA 7YASA 1PDNC 4NNOA 4NU0A 4OOFA 4UREA 2I1WA 4D3FA 4QNRA 5HILA 4JJ8A 4UZEA 2QUBA 4JEMA 3OLQA 4MLPA 5SZKB 5DWVA 1P5FA 5BT9A 2P5YA 3TOSA 3FWZA 3LDAA 3TIFA 1CLEA 3E6BA 1WMSA 2EZHA 1NY6A 3MMYB 3G1OA 1DU4A 2A9RA 2F64A 2H1FA 4G6DA 2MMGA 1W8DA 2YHIA 3PSHA 2P2CA 1SUEA 3PV0A 3Q41A 1XN7A 3ROGA 4MKGA 2XYHA 1JDNA 3MINB 2CGPA 1QTIA 1EFAA 3ABIA 2E21A 1Y8RA 4ENKA 2L19A 5IBCA 4DDWA 1DE0A 4ZGGA 2VHEA 3AIKA 3OOPA 4PGHA 4GF5A 4MARA 2B7LA 3WX0A 2M1XA 1AKTA 3VZCA 3AVVA 1SFOJ 2Z1MA 1T29A 3GLHA 2H85A 4GHWA 4IFEA 4UVGA 4W99A 5DGCA 3R3XA 3HL2A 4Y2XA 5DLDA 5JMOA 1XMJA 1MD9A 4KXWA 4RMGA 3C3XA 1UT5A 2P6TA 4DC1A 2B99A 4BXFA 3GEBA 1IW7F 1Y5RA 4GVLA 2DKFA 3E97A 2KX7A 1ZN8A 3JAMK 1G3WA 2HU7A 4Y30A 4U9UA 3UOGA 4N39A 2CXUA 3A1UA 5JJ5A 3FXQA 1EB9A 1TU3A 1UPBA 4B80A 2LCIA 3IMGA 1QTRA 3AF1A 1HTBA 4L6CA 1FDOA 1PK8A 2AEJA 4RVNA 1MIHA 1I3NA 3DOJA 4AG3A 5AK0A 1QK3A 2EILH 3I2FA 4ZT3A 4TPKA 2GHIA 3X0DA 3K0CA 4MDFA 4BE7B 5A5FA 3N2YA 1PE0A 1S89A 3B6KA 4KVGA 1KAOA 1XU4A 3G0DA 4PPFA 2DTXA 5LQAA 2XBMA 3ZV3A 3AEYA 3UMJA 3WC4A 3FFWA 2R7XA 1D2EA 3MGGA 4KWIA 4R51A 1OY1A 4Z2YA 3B12A 1CF7A 2ZYVX 3H5VA 4BS9A 2JNWA 4YONB 5K0JA 1YBVA 4IUBS 4DC0A 2Y69H 4AXXA 1Y6GA 2VHZA 1WA5A 3KFVA 2A68F 4OO3A 1NM5C 1EA5A 1V1MB 1HKQA 4EMTA 2YU3A 4WLEA 3UK0A 1Y9DA 5JCOC 4C7OA 1ZI8A 3D8TA 3BRQA 3E7PA 2PE5A 2BW3A 4X65B 2EWNA 1RHJA 1VPVA 1YRLA 3EDYA 4IJ5A 3NAGA 5EAIA 3JQ9A 2AOWA 1R7JA 1XPXA 3L5KA 3UPTA 4DA4A 2QMZA 1BIAA 5ISMA 2WTXA 2ZRGA 1TVMA 3M1CA 5IKXA 2A61A 4MGYR 1Y63A 3Q9NA 4UNQA 3IWZA 1LTKA 3J81Z 1HM5A 1UBKS 3O8OA 3ROKA 1G3QA 5IAOA 3VHRA 4JX9A 3I9NA 3DEUA 3JD3A 5J47A 3ONDA 5AK6A 5TS2A 2C7VA 1N9ZA 2HL6A 2Y0CA 2UXNA 3QENA 4HSGA 4PZAA 2EAUA 2ATVA 1Y9ZA 2ESNA 2I6UA 2ENUA 3TQTA 1R5ID 3JWGA 1FFSA 1YI1A 1ZL0A 1Y9AA 3BWXA 3JVEA 2DUJA 3D2LA 4QYIA 3ADBA 3ZZNA 3CDIA 1SMYF 2R6CA 3BCAA 5K3FA 4F3TA 4LDRA 3KR2A 3HDJA 4OSOA 3RTEA 3ZHYA 4HI0E 4IGIA 3OCYA 1UCFA 1R27A 2E4UA 3KZXA 4O4JA 4W8GA 4AUMA 1FU4A 5IJWA 3C2QA 2WA2A 5DGTA 4BHPA 2W90A 3ZWYA 4ZI3A 2HSGA 2K3PA 1RJEA 1L1RA 2ZRAA 1FFEA 3DL7A 1VIDA 3LBNA 1LQ1A 1KOFA 4P22A 3WWYA 3HG9A 4YG2F 5DOVA 1FW6A 2V97A 2E49A 1TEZA 1U1FA 3GBPA 4HX5A 4K03A 4EV0A 2YUSA 2D2EA 1VI6A 2FZKA 4CIAA 4FYHA 2CXTA 2FBHA 2W6QA 1F9EA 3AKYA 3ZXIA 5H6RA 5CP8A 1Q0RA 3VKHA 3DLIA 4FMCF 1ZVQA 4UXIA 1OQYA 4JOSA 5H3HA 3WB1A 4OLHA 3EF0A 4A6PA 1OFGA 2ZITA 4IHJF 3BMXA 1D9XA 3OLXA 3GUYA 4ZZ2A 2BSXA 1H2YA 2Q5FA 2J9RA 3IAEA 5JPDA 1AOYA 1HE1C 3DMYA 1G8YA 4J90A 5KVVA 2H6EA 3KPUA 1NRIA 1QDEA 2UVQA 2F5CA 4QYSA 3WLNA 1L5HA 1M2GA 5ERYA 1SCDA 2DFLA 3KS9A 4MQEB 3T5MA 5BVGB 1NH3A 5BSUA 2UWMA 1HE5A 2DR3A 4NECA 2HKXA 5DM0A 5FLYA 3TZBA 5JISA 5GONA 5LVAA 2PRYA 4C7OB 4KN9S 3W06A 1VE3A 4LG0B 2X6WA 1YQQA 3QYJA 1XTZA 1SVOA 3BPVA 3LSRA 4TT3A 4AAYA 1OB2A 5LBIA 1H9CA 1YK0A 1YIOA 4JFRA 1ENHA 1LLDA 2JK1A 4J1TA 3WSWA 4NCKA 2OU2A 5HPYB 5HNKA 1OWOA 3EUFA 1ZR4A 4KNYA 1DJOA 1FVXA 1H05A 4DUGD 4ZANA 4X63A 1VL1A 2ECQA 3F3XA 3FKQA 4BXXJ 1QHHD 4NQRA 2NU8B 1E2PA 1Y34E 4INJA 3P9NA 1E2GA 3QU6A 3RKWA 1CHNA 1Y0BA 2HQ1A 4L0CA 4QBKA 2RGVA 4QUIA 3I12A 4WY2A 4ZCRA 2NP7A 5DCMB 1NMSA 2JAUA 1BX0A 1TM3E 3QWAA 3ER9A 3C3MA 2VPRA 1PGPA 4R8MA 2I3ZA 1NW3A 1SHTX 3EW9A 4LOLA 4MWZA 4WXRA 5HS6A 1QOQB 4J49A 4C6TB 2H31A 2HA6A 3ACCA 3BVPA 1DIOB 4FNOA 1KI8A 1OXTA 3EG9A 1Y81A 2YFQA 3HHHA 5MN5A 1KZ4A 4CMHA 4Q4DA 3ABUA 1F38A 2FSIA 4NBWA 1WJAA 2JD1A 2Y48A 3KC2A 3E9NA 1YR1A 3VVMA 3GLFB 3BR3A 4XYEA 5BURA 2F6RA 2XE6A 2D2VA 4R9UC 1I1HA 4G5QA 1NVDA 5ALOA 2FZ4A 1PL6A 3KDPA 4KPUA 3V8QA 3U7HB 4DMCA 1VF9A 2WE7A 1X1AA 2VT7A 5BWMA 2E4XA 7GPBA 1A98A 2MSYA 2VAWA 4Q82A 2XKKA 3D6HA 3GMDA 4JMPA 1PW5A 1CS0A 3Q9SA 1Z5VA 2Z2ZA 3NEAA 4GYYA 2IP2A 1UBNA 1Z37A 3F7MA 4FXOA 5IZCC 1XJWA 3EZ7A 4M21A 1NE7A 1D2CA 3ESYA 3JVDA 4XASA 4WVFA 3IP8A 2HCJB 2P3QA 4UUPA 3VBEA 2XGSA 4G85A 3K2ZA 1JQKA 3DQQA 5DKFA 2P9BA 2C5AA 1R5JA 2BHTA 3LKZA 3W0LB 4LJ4A 3OCXA 2FPWA 1JHOA 2DBQA 2O2XA 2X22A 1ZKMA 1SZJG 2V55B 1UKVY 1CETA 2XAAA 1G4AE 3KUKA 3SZOA 4A0FA 4H6XA 5CJPA 4F5DA 1YZLA 2I2CA 2VPXA 1YZUA 3DV0A 2D5IA 4K1XA 4Z51A 4HWGA 3ZWMA 4YAOA 1T56A 4E31A 5HQTA 4AMBA 1W2HA 2I80A 5K4HA 1NR7A 2JSPA 2VQCA 4DMGA 1H23A 5EF6A 4HLUA 1GFZA 1YCHA 2BBWA 3NH9A 3PXXA 4JVLA 4M0PA 1JBQA 2WWTA 2H0RA 1YIAA 3R6WA 4XAQA 3TKAA 5HR5A 1PJLA 1PJZA 2WV7A 1E5TA 3PJGA 4PLCA 2A84A 3L40A 3KWFA 3S5UA 1UKBA 2E4ZA 2FFHA 5BRNA 1K4KA 1I3LA 2GCPA 5ES3A 5AXBA 4DWWA 3WIUA 1UEIA 3QMWA 3VMMA 4ZAFA 1J42A 3QVGA 4AIDA 4AG6A 1UG0A 5FGMA 3RRYA 1RR6A 2AHRA 1EI9A 2FH5B 3IOEA 8MHTA 2I4IA 4EUEA 3RTBA 1B1AA 4CG1A 1NJGA 4WZ6A 5EMJA 2QLTA 3R2JA 1TQ2A 3AESA 4I5EA 3AM4A 3ABZA 2OCPA 4K26A 1M2JA 4EHNA 8ABPA 1B76A 1N8SA 3CH6A 2GLUA 3HYTA 3K9WA 4NAHA 4INZA 5EZQA 1E4VA 1P7IA 2VQLA 4PBRA 4Z3KA 3E27A 4J4BA 3E3NA 3GZJA 1JDTA 1OTYA 4YREA 5ERGB 2P75A 2OD5A 4OP1A 1VSTA 4FHGA 4OJMX 3TW7A 2K6GA 4FX5A 2V54A 2X14A 4QOGA 5JS7A 1Y5IA 1E4EB 4J03A 3M9LA 5CB4B 1USIA 3JZDA 1UPTA 2C29D 5HKAA 1J49A 4G0NA 4RHCA 2ID7A 1Q57A 1F8FA 3A1WA 3TD9A 1T2CA 4TVSA 4NMXB 2RGXA 1TA9A 2ZK7A 1QGYA 1ADCA 3TSZA 3D3KA 1P62B 4PLPA 3M81A 3D3EA 1IBMB 2FEKA 2FQYA 2VBYA 1T5SA 1VFNA 1E1QD 1C4OA 3C1TA 1WTAA 3K2IA 2QF7A 3S16J 4G86A 1ZISA 2JFHA 4BY7J 2DLNA 1XCGB 3PENA 3IEMA 4EHFA 4HQMA 4D9JA 4MMZB 3PHGA 1Z0IA 2GBYA 2AJTA 3CF2A 2M4GA 1CIVA 3CQ9A 2I4MA 5TT0A 4FILA 4MYDA 4RH3A 3VZDA 4XBFA 4Q4ZF 4O5AA 3I6BA 4H7FA 1OTHA 3WGJA 5L9AA 4TLEA 4IH9A 1FU7A 1Z6QA 3GW2A 3TTTA 4OFZA 3WO1A 3ZJYA 3IO5A 5B5SA 5BSKA 1A6QA 3GTPJ 2AI3A 3EY4A 3IQFA 5IBPA 3NHSA 4WDQA 4YMWA 2Y2UA 3I42A 5J1TB 3RE1A 5K8JB 1RPJA 3PVSA 2FJUA 3NBMA 3S7ZA 1N77A 4KOEC 3SS8A 5B4TA 5CA1F 2PUEA 2C00A 2Q2VA 3C5CA 3G5AA 4IPTA 4R2JA 5KKCA 3G1UA 2OXFA 1B4DA 5HP4A 4AYBN 2ZBKA 4LC1A 1NVKA 5KSYA 4MB0A 2JN6A 1W1WE 4FD3A 4D0RA 1JA9A 1BHQ1 3IQZA 1DAOA 3K9NA 2CHFA 2W6ZA 3QXGA 2RBKA 3WY9A 3L1IA 2H5EA 5T3UA 1GPWB 3WYDA 1RRMA 4NL4H 4KGZA 3I6QA 2EEZA 2NAFA 3HZRA 1NV9A 1LSUA 3PNTA 2JKVA 1X7YA 3C24A 1T34A 3JQFA 3SG0A 1ZM9A 3EMDA 1P2SA 3JTEA 4NJMA 1BDMA 3NAMA 4E30A 5AW3A 3F3MA 4RGRA 3VNSA 3WQRA 2O8FA 5E1XA 4HR7A 5DIFA 4CIBA 1UFMA 3BE5A 1E1CB 1NE2A 1L5VA 4Y0NA 3A32A 2E2IJ 5CTJA 4E5YA 2BAGA 2OHFA 2WMNB 3LT4A 2RMKA 2ZB7A 1IMJA 3CEPB 1LVUA 4MWBA 4RHXA 1GA4A 3U17A 2P40A 4L5CA 5KSWB 3TXXA 1J5PA 3ZKWB 2J3IA 2XWSA 1G8XA 1H2XA 1W25A 2PM8A 4TRMA 5EWLA 1N8NA 3DA8A 4LNHA 3SHTA 4BQRA 1IIRA 2D1RA 4EG0A 1PV2A 1R5HA 3HJCA 5F64A 4OLFA 2IHJA 2PRZA 3TVDA 3UICA 4I5FA 3BWEA 3E58A 1TD1A 3UJAA 1ZN9A 2BEVA 1N2JA 3OSFA 1M9NA 1OILA 4P54A 2PV0A 3Q8WA 3VJMA 5LXTA 3N0RA 2OILA 2WYVA 3BJIC 4RSMA 2XIGA 4XQ0A 1NXOA 3S2WA 2FOWA 2PXXA 3L4BC 3UAOA 4QU8A 1YFLA 5EWMA 2XCIA 4CE6A 4DMUB 2XGXA 2OUKA 1GRCA 2CQXA 2ZBEA 3W5DA 3GJ7A 5B36A 3ZNNA 1K63A 3WL5A 4J2HA 3QHPA 2R7TA 3L1VA 2E4YA 1R1DA 2XNCA 4DMHA 5HZKA 4MV6A 2ESHA 2QY9A 4LA4A 1KHHA 3AZOA 1UQRA 4O4IB 3E8MA 2XRLA 2C99A 3SJUA 3E9EA 3HSYA 3I30X 3P4YA 4J0QA 4MGEA 3AVUA 2Z4SA 1C9YA 3SDBA 3GVIA 1VIMA 3KE9A 3LUPA 1IF1A 5C1BA 3UT0A 4XVCA 3A03A 1SFEA 1T95A 1F9AA 1RLOA 2G9NA 1JKQC 3IPLA 3DEHA 3WBBA 4BY9E 1UMCB 1R8QA 3F7OA 4DZPA 1XBTA 3HJGA 3P4UA 4LC9A 4R1PA 4X8OA 5FF9A 5A4AA 3BS4A 1DKUA 4CODB 2W2KB 4DA9A 3RC9A 3R9WA 1FSFA 5IPFA 1KRWA 2ZAMA 1CQPA 1N8KA 3FNBA 1B0ZA 1XZCA 2IU4A 2WM8A 1LF5A 3R7AA 4G9YA 1KGSA 1VL8A 2W8BA 2IQIA 1QVUA 3CN9A 4HDSB 3JWHA 3GYGA 3KZMA 4R16A 3RUIA 3K1AB 5J4HA 4XX0A 4DV2B 1VQNI 3VV3A 2FOXA 2QDKA 3KT3A 1OGJA 2EA4A 1SHJA 1BN6A 2Z2XA 1Y42X 5IOZA 3SN6A 4NICA 4TQUS 2WWVD 2BT4A 3DWIA 4X1KA 4BQSA 4MYTA 3LD9A 4YPOA 1UQTA 1KMMA 2IF0A 3ROMA 4OX9Y 4J1SA 5KYYB 2ZJ8A 5B3AA 4DXDA 2GEJA 3KO8A 3ZQCA 1DEHA 1Z8FA 2NLOA 1RC1A 1Y5NA 2PRKA 2HDHA 1TF7A 4RPHA 3DPIA 3N05A 3HKEB 5C3EJ 3PUWA 3ZTTA 1EM8B 4L5BA 1NX9A 4OU4A 4EHHA 2DA4A 1Z3XA 1B2RA 1TC2A 4I36A 4QGBA 4YPVA 3BG3A 1Z17A 1HLVA 1NNUA 4P9FA 2IYQA 2JDID 3MMXA 3MWEB 2CMDA 2D3TA 3WB9A 2RHDA 3ZGLA 4KQ1A 2WKRA 2AZXA 3TRHA 4NH4A 1T0FC 3WB0A 1UANA 4N5MA 1FC3A 3CUWA 3ZDFA 3V6LA 2EDCA 3H3ZA 3OJCA 3C39A 1V3QE 4YJ3A 2BE5F 1GNSA 3GZTB 4JJKA 1IB0A 5HCIA 3UFXA 3ZGXA 1N36B 1XL0A 3VU9B 1ULBA 1OPCA 4YP9A 1RC8A 1PUFB 1F4LA 1G7CA 3EWIA 2PSJA 2A58A 3DHEA 2PWAA 3P32A 1EK1A 4IDOA 4V0ME 5G41A 4UFPA 4A15A 1RZRA 4GL2A 1W44A 4IUCS 4B3GA 2VSXA 3FZYA 3LYAA 3LHFA 1AF7A 2XQJA 4K6MA 4QXQA 4UBKA 3G6EI 4BJ5A 2IHNA 5J2TF 4JLVA 2XCRB 4M8SA 2CE7A 2QTGA 2WHYA 4M6WA 1CRLA 1WB6A 3NBQA 4FGKA 4L8FA 3UPDA 4AICA 3FHOA 2HU9A 1CZLA 2DWQA 2GN0A 3HUEA 5JDCC 3RAPR 1JFTA 4ZU3A 1DPRA 1Y4UA 3IAS6 3L92A 1CUYA 1VIAA 4WJZA 4IZOA 4MPTA 2B1GA 2YFHA 1I0IA 4P92A 4QWQA 3BTCA 3HK2A 3HA5A 3OPVA 4M87A 1XGSA 5FXMA 3UJ3X 1SU4A 1D09A 3E5UA 3T3EA 4B33A 5HJEA 4X7MA 2PL1A 1LU9A 1TIBA 4ARZB 4B8XA 2Q3CA 4QQNA 4V03A 5B57C 4I9UA 4UEKA 1PJRA 3SD7A 3GFSA 1Q0UA 3KQNA 2BOVA 3E3AA 1YYVA 2AOXA 4BO1A 5D5UB 2EFEB 2P65A 5AVXA 5I7FA 4RLFA 1N5JA 3LM8A 5DTIA 3SZLA 4HDMA 4LLNA 1C9JA 4FNGA 4UOZA 4DXHA 3AF4A 1ZLXA 1G1MA 3E3LA 3ZBUA 1TYCA 3TW6A 2ZQZA 2C98A 3CVJA 3L82B 1JKJA 3RDPA 1WKBA 1MGPA 1GFIA 5FWNA 1JXOA 3PR2B 4DQ2A 2CXSA 3DMRA 3K3PA 4YJ2A 4MS3A 2A78A 1ONBA 3VFZA 4ESJA 2Y77A 3CH4B 3DAGA 4DQXA 1JU4A 4JLNA 4M9RA 4E4HA 3BCHA 1M75A 2L02A 2ICWG 3LFUA 1TWFJ 3BXEA 2BONA 2LVBA 3LNCA 4ENJA 3D3WB 4E1VA 1UM9B 3GLLA 4NDLA 3OF3A 2EINH 4HZFA 4DBQA 1ZZEA 3FOBA 3HO6A 3LPMA 4H59A 3HI6A 4Z0PA 3PM1A 1DJPA 3U0VA 2V1XA 1RYFA 3D81A 4FJ0A 4YO7A 2CFIA 1D4OA 3KP1A 1N9KA 3GO4A 1P72A 1H93A 4E2ZA 1AK1A 1EBFA 2FRXA 2JQ7A 3FNEA 3OQHA 3CRNA 5TRTA 3HKDB 3JWJA 2FUNB 2WAEA 1ZCZA 1ERDA 3U1KA 3TDNA 1AE1A 2QTNA 1FJGB 4UM9B 4Q15A 3D1LA 3TR5A 1AU9A 1HXDA 2BHYA 2P4EA 4EKNB 1QHHA 1J20A 2VYCA 4IBOA 3F96A 4TZ0A 3RBZA 3BH7A 4DLVA 2FQ4A 1P91A 3E81A 2ZG6A 2H1WA 1R6TA 2GEDA 1TQIA 3QRFF 5G0UA 1JKIA 4XM2A 1V6CA 2X1CA 3V9PA 2J5RA 3MWGA 1FUEA 3I4LA 4ON0A 1VCHA 2PKXA 3MTDA 4BP9A 5K0FA 2O3RA 2XSZD 3FDZA 1RRGA 3UMSA 3ZW7A 4CZZA 3K1NA 5LHGA 5K5QA 3K6RA 4CKCB 1CZUA 2ZYDA 4S1NA 1XKQA 1HE4A 2NO1A 4F2WA 2WT9A 3WGVA 2A67A 3EGEA 3FGPA 2H7YA 4LWOA 2H54A 5TQ2A 3A36A 3T7TA 3V5NA 4OSEA 3MWEA 2VWHA 2R3SA 4B48A 1JEJA 2KHMA 3V42A 3O8NA 3KKPA 4HGOA 5AKXA 2PZLA 1PWHA 1YS6A 2KZGA 1VHJA 1QRDA 2FZGA 3L8EA 4NENB 2LKCA 3BGVA 2BFFB 4DLWA 3M7IA 1WY7A 4URFA 5GZ1A 5M5XJ 4XDHA 3QSYA 1HLDA 1W7PB 4AJ4A 5KOIA 3HJNA 2H2DA 3HS3A 1P4JA 4QXOA 1PSZA 1Q77A 4UPDA 1DC8A 3A28A 3MOSA 2G9WA 2JAQA 2O5VA 3TUIC 4RTNA 1RXEA 1JR4A 2JRCA 5KOHA 5AW7A 1WXDA 1USGA 5L3CA 4Q4JA 5J59A 3QVJA 1J75A 3ZQHA 1MAUA 4RSRA 2GXSA 4WK2B 4A2UA 4J00A 5D8LB 1ANKA 3AKDA 4PCUA 3Q3EA 4HDNB 4E6KG 4UMVA 2H7CA 3QU4A 3ZKAA 3HXLA 4L5IA 2F4VB 2KSQA 1T9BA 3LV8A 3DOHA 5AK3A 1ULYA 1QV7A 4G9BA 2HF7A 2R1ZA 2PYIA 4OU5A 2P0EA 2GD0A 2OWEA 4V2GA 2VKVA 1OVMA 4JYMA 4GEKA 5HODA 4LXYA 1DG3A 2D4HA 4G6TB 3LAJA 4AM3A 1YKSA 4M0CA 2QZPA 2XUAA 2RHCA 3G49A 1NFQA 1H65A 4YRDA 5TGDA 3V7FA 1L7AA 4R2HA 5EE3A 4HQ6A 3GGSA 1ETVA 1DC4A 2RK6A 2O19A 5AW6A 3RPUD 3TIXB 1RM3A 3WL6A 1M0TA 1X7ZA 2VPQA 3ZZ0A 1C8BA 3IESA 3HN7A 1LTQA 2Q1ZB 1KKUA 3NX4A 3AEKB 3GQVA 3WIEA 3JWEA 4CWAA 4RXTA 1W93A 2DT5A 3CW2A 4AIJA 4WOBA 2FMXA 4HFRA 5H6QA 1YITI 4YFYA 5EVJA 1XD7A 2QRVA 2OXTA 3EUWA 2CV2A 2XUIA 3HUGA 5GY7A 3FF4A 4RVUA 2QL7A 4N0BA 2LY1A 5C8YF 2E36A 1OYOA 3MN1A 5IP6A 5IK2A 3KJFA 3U80A 3ZQKA 3GFTA 2GX6A 3SHFA 3NB0A 1IC8A 1ZIXA 1TAQA 1T8RA 2LKSA 1XA4A 2WPNA 3AW8A 4IUYA 4YVFA 4E5DA 2NYRA 3KPYA 2OY0A 3DLTA 3CCVI 2Y9ZA 3K2AA 1IBRA 2J3MA 1FQKA 2BY3A 3GLFA 2O2EA 4MVJH 7ABPA 3JWIA 3UUEA 1U6JA 4G81A 3KYCB 1A9OA 2GCGA 4XMYA 4CXMA 2XUDA 5LZ9A 5FWXB 1G64A 1QLHA 3VOSA 4W9NA 1G8JA 4AECA 4LLGF 3O8CA 2Y4OA 3Q5FA 2JG3A 5EQDA 2VSYA 1DZIA 4R1SA 1W5BA 1PLLA 4ND5A 1H4QA 3JS5A 4GLJA 1MC5A 1E9VA 4NSNA 3RAJA 4LMRA 3U81A 5CM8B 1UWVA 2EFHB 2J3QA 3BSSA 4GYWA 1C0EA 4QUJA 2P2YA 2C57A 5FOQA 1LEAA 4CCAA 2DPLA 2ZRDA 1GZ4A 3SS9X 3T7JA 1U7ZA 4Q3DA 4DMRA 3AL0C 1CDZA 1G1AA 4NG4A 4EG1A 3BZBA 1DG9A 4BIMA 4I66A 5K2OA 2HR3A 2V3VA 3E1GA 4M0EA 4QVGA 3THSA 1IZ1A 1KI3A 5IKEA 3NPAA 4BB0A 3FVWA 1YNSA 5AXCA 2VK8A 2F2EA 2ECKA 2FP4A 4YA6A 3TGWA 2J08A 1ML3A 3QVUA 3P2KA 1ZJYA 4NC8A 2A7QA 2YQ5A 3GUUA 1HTWA 1S4MA 3NV7A 3OIUA 5J1RA 3KKMA 3IVAA 3CMEI 3WZLA 5JHFA 4RACA 4RENA 1S96A 1QMPA 3GGCA 2M30A 5DM1A 5ALZA 2Q62A 2OJED 3GIDA 2NOAA 1E1MA 3WNZA 1HG0A 3BTSA 5KNCH 1E8DA 3JAKA 1TJYA 1I3CA 3RWOA 3FPKA 3PNOA 1XN4A 1HPLA 2MJLA 2EBHX 4M98A 3M6UA 2BHZA 3NZEA 5LJIA 3K32A 1OC2A 1TBXA 1NGSA 5EZGA 3BHJA 3S68A 1ZAYA 1Y9EA 4NB5A 2E2WA 3JV7A 2IYFA 5CD1A 1VP3A 3OI7A 3OT4A 1H2WA 4PFPA 4PJMA 2NUPB 3NDPA 1T38A 2IYLD 1TQ6A 1YDHA 1RRJA 1JHDA 2O7SA 2ORWA 4P4SA 1RIFA 4A8JC 3SQXA 1XRJA 3DHYA 2KHZA 1I27A 4IV5A 3UKOA 1ODKA 3RYCB 2DFFA 1LJUA 2YIJA 4Y2UA 2A3NA 1RXWA 4B2PA 3V8KA 1U63A 4DV3B 5KJ6A 1QGUA 2OCXA 1AA9A 4EBBA 3ZNOA 3ILSA 3TM5A 1E6WA 4RAYA 1KP2A 2VTBA 1C14A 1JGTA 3DTVD 3I5AA 5DYWA 3MPUA 5KTRA 3TS1A 2IEZA 4O4HF 4JLMA 5IEBA 4KWEA 4CM4B 4GYJA 4W1PA 2FW7A 5HIMA 4CMBA 4WCFA 1XX5A 3DOIA 4WFJA 1DRUA 1VLQA 4EY4A 5DPMA 1HDXA 4FDTA 4A16A 2NUAB 4MWSA 5JSYA 3WYNA 2V6CA 4RA9A 5LB2A 5DNWA 1DC6A 4U6SA 4AJLA 3R9KA 5B1YA 3IQGX 3LXRA 3ZWQA 1RIOH 1MOZA 5L4SA 3PNQA 2BY1A 3EARA 1R3UA 3GROA 1EDDA 4QGGA 5DP2A 2OYRA 1P19A 2GFQA 3U2RA 1GR1A 1Q2XA 4FX2A 5DW3A 4C0JA 2RB5A 3HKBA 4A3DJ 5I5GA 4HDUA 1N32B 1M5RA 3CT4A 3KXPA 4BEWA 1X42A 1BRMA 3FM5A 5A62A 3IBGA 3N87A 2HMWA 2BTQA 3ZE8A 1AVTA 3IKMB 1YFJA 1Z6AA 2KT0A 2AH5A 2GUGA 1SD4A 4II3A 2UZ0A 1O5TA 3QKWA 4KE6A 3O6VA 4P32A 4R2LA 5L3DA 1XYVA 4WNAA 2XCTB 3DFMA 3UV6A 2R7WA 3TM4A 2QQ9A 3FNFA 5HZMA 4L8LA 3MYYA 4BY1J 3F2VA 4TKMA 2FUEA 2GN4A 4B6SA 4QJIA 4O3FA 3TOXA 5LQDA 3CJNA 1DTEA 1LS1A 3C3BA 3IP3A 4ZQCB 5J2UB 4GYIA 3BAZA 1ENYA 4EHIA 3UV3A 3VWBA 1YNOA 5ALIA 1EFKA 1PG0A 2OXCA 3CONA 2WIGA 4I5IA 5B3LA 2BGWA 4MKRA 1VG0B 2CC2A 4CG2A 1WCYA 1SK9A 3I83A 3CP8A 2RIPA 2LREA 3M9WA 1M73E 2OC6A 4P5PA 4EY8A 1UAAA 1A2QA 4FR2A 2EATA 5DULA 2HRZA 2QTTA 2VJQA 1ZNZA 5K0SA 2NVOA 2VYNA 4HDNA 4XKJA 4FFOA 1QQBA 4D80A 1M2VB 3WGIA 3OE4A 1Q20A 4U7JA 3WK6A 3LA7A 3TMYA 2HRCA 1Y82A 4FIDA 5CJ2A 2VXCA 3ZN1A 2D2IA 4HPWA 2PJZA 4N47A 3ZE9A 4F21A 5JBQA 5JH7B 1PUIA 4G3XA 1S5LC 1EVZA 2PZKA 1G6NA 3P8ZA 1GGKA 2PPLA 4BNHA 3L4KA 4RJLA 3HRKA 2FYTA 5B6JA 4PJJA 1G9TA 4AZ3B 1JG1A 3OX1A 4HNRA 2OZVA 2P2NA 2CH0A 3ESDA 4H1VA 4YALA 3URMA 2H51A 1DJMA 1V39A 4IO0A 4CV2A 3PYMA 5CXXA 3IAM1 3DUWA 2C4HA 1I9GA 1TA0A 5IHXA 4KRXA 4NBUA 4AJOA 3I3SR 1K2VN 2Q50A 4KNVA 4A2WA 4OV6B 4AYXA 1GSAA 2V26A 2QY6A 4BHBA 3KT0A 1ZITA 4U2KA 5KVAA 4OI0A 4TXHA 5JS1A 3OU6A 1ZL2A 2X5JO 2YXLA 1A9ZA 4BO7A 4KU4A 2CL0X 2YHIB 3L7NA 4ZREA 3FPSA 4HUQA 5JALA 2Q8QA 3FTQA 1XSEA 2NVWA 1YMQA 4HADA 4X85A 5EIBD 1RQNA 3AUXA 1B16A 2AR9A 3D02A 3PTLA 3UMFA 3UWMA 4GG1A 1C3LA 3V4FA 4BX0A 4BWFB 4EKDA 5BN3A 2EKZA 3K4JA 5F52A 1XMIA 1EJBA 3DFFA 4KMFA 2CLDX 5F1YA 1E3PA 4LMYA 1S2NA 4P8RA 3EDPA 1QZTA 2OGSA 2Q3HA 1UXHA 3G5LA 3PXCX 3LO5A 4EPRA 4GGPA 4MIMA