4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional regulator BasR
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
3HSEA 1JHFA 4RZSA 1XSXA 2FE3A 3ELKA 2FSPA 1FSEA 3H5VA 4D6YA 4LDZA 1V4RA 3RKYA 2RV8A 1QO0A 2FEWB 4KIGA 3F72A 3RJPA 2PFBA 3DF8A 3D5LA 3LWFA 4F8JA 1P6QA 4ZMSA 4WWCA 4KK4A 3REOA 1CYEA 1BBYA 1I3CA 3H1EA 2V6CA 4OLAA 4RY9A 4E7OA 4P98A 4L9TA 4BYYA 2B4AA 4MAAA 2PMHA 1XGOA 1LQ1A 1BDJA 1KRXA 3EDPA 4N03A 3HDVA 4M71A 2E7XA 1Z15A 3WE2A 1DDNA 3O75A 2AS5F 3OV8A 5JNWA 1P4AA 4MR8A 5BQ3A 5A2QZ 4G0QA 3KG2A 1FYLA 4U7BA 1XSDA 2QYOA 1KQ0A 4EGZA 5HDGA 2QLZA 2Q8KA 1USIA 3ZP5A 4L4UA 4JQFA 4MQ9F 4KVFA 4LLLA 1ABFA 2A9PA 2F5FA 3K9CA 4BQAA 3W9SA 4RXUA 4GO1A 4N0QA 5CHYA 1ZRCA 2O6GE 1IN6A 3HUUA 3Q41A 3LOPA 4Q4ZF 4RB1A 3E97A 4EJTA 5DD8A 1K66A 2JVIA 3O2JA 2A69F 3ILHA 3ABUA 3J80K 5HDKA 5L3EA 3I54A 5E3JA 1G3YA 2BGCA 3O6BB 3SQNA 4RK0A 2M45A 2R3SA 5H6RA 2L4MA 5HS8A 1DZ3A 1TQPA 1PUEE 1IIBA 1NATA 2PUFA 4YV7A 3IL2A 3T8TA 7ABPA 2FN8A 5B3JA 4RXTA 3SHFA 1FP2A 1UB9A 1R5GA 4L0ZB 2CHEA 4O1HA 1VPWA 5HS9A 2EA4A 2RQPA 3ZMSA 2TDXA 4UVCA 1ISSA 4MR7B 3HSRA 3FWEA 4LB5A 3G1WA 5CVJA 3JW4A 3SNKA 5DUKA 2K7LA 1QPZA 1RI7A 2NT3A 2DAOA 1IN7A 4LG0A 2L54A 3EUHA 5LRRA 2GAUA 4G0MA 5AIPA 1PEYA 4OIRF 3HV2A 4LLGF 3L09A 3F7NA 2ACJA 2YHAA 1Z1DA 3KZYA 1XGMA 1EWVA 1ZARA 1JXSA 1FC3A 1ZVVA 3OM1A 4GYGA 2FTKE 2QUFA 1S8NA 3KLNA 3TOBA 4ZYEA 3JPYA 5DCMA 1V3FA 2RDPA 3Q9VA 2VC1A 3I4PA 5DCFA 1LB2A 1ZLKA 4IRXA 2H6CA 2LF8A 5CNJA 3EODA 1K68A 3ROUA 1ONVA 1KGSA 5LEJA 3EJWA 4MQEB 2NNNA 5CVRA 2IA2A 4ESBA 3QLVC 2BV6A 4RK6A 2A61A 3GZ5A 1XHFA 2STWA 3BY6A 4EVSA 3CU5A 3O74A 5BMZA 3RH0A 4MHGA 1FY7A 5DUIA 3HUGA 4D6XA 5F1RA 2XDYA 2H94A 5CNIA 1USSA 3R6SA 2F5DA 1QBJA 4Z4CA 3HUTA 4WX9A 4L18B 4HX7A 3O3KA 3W6JB 3C3WA 3V8KA 2BYVE 4GPAA 3Q7RA 3O2PE 1VLZA 3LUCA 2LDUA 2W84A 1PEAA 2JT1A 4I0BA 3IP9A 3SY8A 5IUJC 4QYMA 4GXOA 1TBXA 3BJAA 1P92A 5E1ZB 5EWLB 1SD5A 4JAVC 1U6GA 5C5EA 4RGXA 1SFXA 4Z2YA 3C1DA 5JNVA 1A0OA 2IOYA 1KQ9A 4IF4A 1T34A 4UVAA 3CTPA 4GNRA 1BDIA 1U5TC 4RS3A 3SM9A 1HKSA 3MZYA 2XUBA 5DTEA 1W9HA 2EK5A 4LMYA 3BP8A 2VN2A 2FEKA 1ZLJA 2CYYA 5FWXA 1U3EM 1H9GA 1FP1D 3M1EA 3WTUC 4RKQA 4UNOA 2ETHA 1QZZA 4E70A 1IZ1A 2IPAB 3T8YA 1DC7A 2E4UA 2MYTA 4EGSA 3SG0A 3HIFA 1YFHA 2PMUA 4G9YA 1GCAA 3NNSA 4DQ2A 4HQEA 1KRWA 1YQAA 1HSTA 2LBPA 1ZDMA 3ZQ7A 3VNBA 4W5TA 4KIBA 3T0YA 2HYGD 4G0OA 4L0YB 3FM3A 2XAHA 4H0EA 3J7AO 1P4XA 3EQLF 3CRNA 1BN5A 1JYEA 1QP7A 2MSWA 1TW2A 2KJCA 1DG9A 1E17A 2EV0A 1BVHA 1OXBB 3DBIA 3JPWA 3V8JA 1E2BA 3DPLC 2EFPA 4YG2F 1E6LA 4R1HA 4IVNA 1SAXA 4XLPF 4ZPJA 1UFMA 1FQWA 4M88A 1APBA 4UUVA 1TLFA 2IYNA 2HDCA 4S04A 5T7BA 5HS7A 4R8HA 4KMRA 3TOAA 3BBLA 1UHMA 1USTA 5L3BA 2IVMA 1D5VA 4A0ZA 3JTHA 4HX8A 3IRRA 3GFMA 3BRSA 4M9SA 2DTRA 3I0TA 1EH6A 2OD5A 1JL3A 3V4GA 1D3YA 1W25A 1XDSA 1DBPA 4BXUA 4I7HA 4KA4A 1ODDA 3HVRA 1QPMA 3LAPA 4O1IA 2H3HA 3R0AA 3KZZA 3P9KA 3H3ZA 5FD5A 3OO0A 4TN5A 4ZZDA 3LFTA 3MZHA 3RQIA 2DFIA 4F12A 3QU3A 1USGA 4HLXA 2NRAC 2LNBA 4NICA 3FDFA 2K27A 1IRFA 4XXHA 2TMYA 2VUHB 2VYCA 1FFGA 2Z5UA 5EWJB 1PUXA 1FLIA 2WRZA 3DLBA 2ZWMA 4P9UA 1RUOA 3TGNA 1C4WA 1EHCA 6ABPA 1F9NA 5FWYA 2PUDA 2CHFA 3G3ZA 3RDIA 3IRQA 3O1IC 3I5UA 5TE9A 3WTWC 2XAQA 3SFZA 4G7HF 2P6TA 2PQ8A 3RVOA 3R4KA 3F6CA 2RJOA 3QP5A 2ZKZA 1LJUA 3GEZA 1S6LA 2FMFA 3QELB 4WXEA 2QM3A 3CTAA 2GIVA 4O3MA 1I6XA 1OMIA 2HEOA 3HM9A 4EVIA 4Z9AA 2XROA 3RVJA 2AYZA 5J8FA 1HSJA 4JOQA 4M9ZA 3GBPA 3F8MA 2R47A 4D74A 3ZN1A 1IAWA 8ABPA 4S05A 3V7SA 4RGRA 3C18A 4Y13A 2HZTA 4EQQA 3RVRA 3EDCA 1DRJA 3KETA 3JSOA 1EFAA 3ZN0A 2FW0A 3DLHA 5FB2A 5BRJA 4EV0A 1JHHA 2XASA 2VBWA 3HJFA 1Z13A 2KIFA 2DU9A 1CF7B 5KQPA 5D5XB 3OQMA 1JE8A 4IPAA 3WE3A 3PFIA 2HQOA 3A10A 2LKPA 5E8GA 1ZRDA 1NXOA 2KKOA 4K2EA 4HDVA 3GX4X 3T6KA 1Q1HA 3GLXA 2EFNA 2MSKA 1UHWA 1Y1LA 2R48A 3DFGA 2IA0A 2QVOA 3MWMA 3FFWA 4WWHA 1JDNA 2Q0OA 1DRKA 3M7GA 3CS3A 5D2CA 4ENMA 4UHTA 4MQFA 3LA7A 1Z05A 2COMA 2Y48A 1QNTA 4KRFA 4WXMA 2QWWA 3T8RA 4KK3A 3U1DA 5KI6A 1QQAA 2EV5A 3RYRA 3EAFA 3CG0A 2P6SA 1JHZA 1RXEA 1JYFA 4RY0A 1SD7A 1R36A 3WTTC 2HYFA 5D5WB 2L01A 4Z4IA 1J0RA 5ILSA 1ZHFA 3F8FA 3ERED 5EWMB 2HTSA 3FXRA 5L3GA 3WGIA 2PL9A 1MIHA 1EH8A 5TQJA 3TKYA 2FXIA 3WTZA 3OLYA 2M5WA 3NNNA 4A2UA 4HQMA 5D6EA 4QICA 3H1GA 4Z4GA 1J59A 1YLFA 4HA8A 3C3KA 4Z4HA 5JR3A 2PUEA 4HV5A 3HYIA 3ZMUA 1P8AA 1YO5C 1MAVA 3CLOA 3TO5A 2MYPA 4W5RA 4LE0A 1ZGAA 4LFUA 4L9JA 3MM4A 1C0WA 1Z2EA 2YU3A 2PL1A 1P2FA 2DW4A 3CUQA 4CDGA 4O5VA 1U04A 5H6QA 1EV7A 3TDUC 2AXLA 4ZYLA 2PE5A 2PUAA 4AD9A 3BJ6A 3QEMB 3L6UA 3MEXA 1KU2A 3K2ZA 2KIMA 4I01A 4OOIA 3KYJB 4MR7A 3HXMA 2XHKA 4EVRA 1TW3A 5LEKA 5BPIA 4M6XA 4KPYA 5JVTA 1U5TB 2WJAA 4E7PA 4OG2A 1JBEA 2DT5A 1MKMA 4U0WA 3H5OA 4EGYA 4FB4A 2D45A 2E4VA 2EJRA 2GXGA 3M6MD 2HFHA 1BJAA 2ZBKA 4BHCA 3F6OA 5LLQA 1L5ZA 4MTEA 5EEHA 5C5CA 5D5UB 2RVCA 5FGMA 2HTJA 3GXOA 1J2XA 3BOQA 5D8KB 4JBAA 4MEYF 1UCRA 1MB3A 1QP0A 3P7NA 4MQEA 2GKGA 3S2WA 3I42A 3I71A 4PCQA 5F6FA 1SMTA 1S29A 3GUDA 1ZG5A 3N97A 4ZYHA 2W57A 4O5AA 4CGZA 5LGUA 4Q48A 3URMA 1UDRA 2E1CA 3VB2A 2H0AA 1AB6A 2GQQA 2HWVA 1YVUA 3TQNA 4KFCA 3DGFC 4P96A 5IT9Z 2XAJA 2G7UA 3CO6C 3E61A 2VOOA 3CJNA 3N8IA 2OQGA 2R7FA 2DI3A 3COAC 2CD7A 3GRCA 3N6VA 2O0YA 4PZ0A 4IRIA 3PQKA 4CZZA 4ENKA 3LTEA 5TQ0B 2YHBA 1MJBA 4HYEA 5HKOA 3OO1A 4W5QA 4OIPF 2G9WA 2Z33A 3IP6A 2E4XA 5DLEA 1TTYA 5D6FA 1BI2A 4PYRA 1ZGJA 2M87A 4LK1F 1LJ9A 1FWZA 2VODA 1NTRA 2FBIA 4RK4A 5EEGA 3C97A 3HOTA 2MD5A 4BH9A 4OTZA 5EWLA 2IPMA 3O1JC 2LF7A 3BPVA 1DBWA 3H6GA 1ZGZA 3EYIA 2HQBA 2FQYA 2Q2EA 1DC8A 4YCSA 2XKOA 1LNWA 1QQIA 3IHUA 1RZRA 1GXPA 1XN7A 2FBKA 3A0UA 2N9UA 3LUHA 3HSFA 3RVKA 3FZVA 1R1UA 5D4SA 4U0VA 3IC7A 9ABPA 4UVBA 4Y9TA 5ICEA 4EUKA 2P8TA 3HO1A 1QMPA 3FX3A 3TO9A 2QQBA 1U8RA 4L5IA 4EVQA 3I53A 1JX6A 1IW7F 4WUTA 4G0PA 2PUBA 2E1NA 1QO0D 3E6MA 3DPTA 1QQBA 3DV8A 3WGGA 4M6YA 4EYKA 2QVCA 4YRZA 3HRTA 3F6PA 1O3QA 3ROTA 1D8JA 5FLXK 4WXHA 1R8JA 4IHTA 4G94A 4RGSA 3GA5A 2J48A 3KJXA 1D4ZA 1QKKA 2CGPA 2VUIB 2MA3A 4FX4A 3GFJA 4LJZF 2P4WA 1LJLA 2QBYA 1L5YA 3NQOA 4EMSA 4U7DA 4I0AA 2WJWA 2ZJ2A 4GGGA 4O6JA 3WTYC 1JWLA 3TB6A 4OBBA 5FFXA 4L9VA 2P5VA 5E1WA 1NHAA 2R25B 4ZMRA 5L3DA 4N9HA 3ROFA 1HKTA 1VRVA 1CHNA 1MJAA 3BRQA 4Z4EA 4TV7A 2NUBA 4Y15A 3OQOA 5TQ2B 2NAZA 2QENA 2DO7A 1CEYA 2M1BA 1E6MA 3WTXC 1ZAOA 5ICGA 4KZKA 4TMYA 3T5XA 5KC9A 4KT5C 2NNYA 4D0PA 4BHPA 4L5JA 3DEUA 4JA2A 3FF5A 4QYWA 2HS5A 1F51E 2ZMEA 4LX8A 2OQRA 2FMKA 2RDMA 4YFXF 2O61A 3MMNA 3M9WA 2EA2A 2MH2A 3E5XA 3IWZA 1MZBA 2CWDA 3J81K 3QX9A 2P5KA 1DPRA 2FQXA 4FX0A 2QU7A 4RKRA 3OMWA 3T95A 4HF2A 5EWJA 3GV0A 3K0LA 1G3TA 2Z9OA 1GUBA 4PDKA 3GT7A 5TPWA 2E4WA 3QOPA 1CGPA 3LA3A 1LDKB 2E7WA 5K5QA 1IRGA 2IKSA 3BILA 4G7OF 3GO5A 3HHHA 2DK8A 3B73A 4U0YA 3B2NA 1K78B 4RS8A 4MEXF 4CXFA 4M9XA 5J6XA 1L3LA 1FSPA 1YMUA 4EYQA 2PJPA 3UK0A 3QX8A 2E4YA 3GFLA 3HHGA 1DP4A 4HBLA 1S3JA 1O3RA 3TO7A 1LBHA 5HOOA 1GXQA 4YWHA 2QXYA 1RNLA 2WMYA 1JFTA 3HTUA 5DGCA 1MDMB 2VONA 3V7CA 4ZH4F 3LUJA 3O21A 2A5YB 4Z4FA 4F3TA 1OYIA 1R58A 3FMRA 3MA0A 1BDHA 3M9AA 1JFVA 2FSWA 2Y75A 2Z99A 1O7FA 2FEPA 3QK7A 4RGUA 4CBVA 4OATA 1TVMA 1S7AA 2A68F 5JS2A 3CDHA 2DQRA 1JLKA 4N0BA 4DADA 5HQJA 3KS9A 2JTVA 3VODA 1CF7A 4HNSA 2X4HA 2PLYA 3IKVA 2CFXA 2QV0A 3JAMZ 4Q6BA 5LBQA 3B02A 1B00A 4A5MA 1F4VA 2FA5A 2UZKA 1O3TA 2STTA 4AIHA 1I1GA 3K4HA 3RVPA 2FNAA 3O2QB 1U78A 1R22A 3LUDA 1KMIY 5IT9K 2GA2A 2HR3A 4KQ9A 4H3HB 4LDAA 3F8NA 5KVRA 3OLZA 2X0LA 4TLMB 5LHGA 4F7ZA 3WGHA 2E4ZA 3LUFA 4G0YA 1Z12A 4HNQA 1XB4A 4FHTA 2M8EA 3QP6A 1YS7A 3HRUA 2FKAA 2L2QA 5HDNA 4RV5A 1IXSB 4HOBA 1REPC 2BE5F 4CYDA 4G6DA 1YK0A 1ZYRF 2BBYA 4A0YA 3L7WA 5JNSA 3QLVA 1TQIA 4A5NA 4YIIA 4XSXF 3H6HA 1F4KA 2QVGA 4ZYDA 5ILUA 3G85A 5EWMA 4QPJC 1SMYF 2FQWA 3C6QA 3RI4A 1FOKA 2J5OA 3CO7C 4Y17A 1BI1A 1O57A 3UKJA 1FBQA 4W5OA 3LSTA 1I5ZA 1X3UA 4MYRA 4EJOA 3ZMDA 4G86A 4KDPA 3U2RA 5IX8A 3DP7A 1JF8A 1LEBA 3KSMA 4OINF 1YTYA 4JK1X 2NYXA 1M2EA 2FMIA 1TQMA 3WTSC 3QEKA 4M72A 2ISZA 1YS6A 4FT8A 1IUYA 1YW8A 3F8BA 3U9GA 3F21A 2AYXA 2IPQX 5DD4A 4YFNF 3GL9A 4B8XA 3HZHA 5ICCA 3BPXA 5CNMA 2JBAB 4RB3C 4N9IA 4G97A 5IUKC 1ON1A 1QZYA 3QEMA 2FMLA 3QAHA 1HW5A 3HEBA 4KYWA 2CG4A 1E6KA 5E18F 1EH7A 4MRMB 1W5TA 4IMIB 2OZ6A 2IRFG 4OIOF 1STZA 4DNCA 1EAYA 1KU9A 3CUOA 1SRRA 1GLGA 1ZH2A 1U5TA 3F22A 3NBMA 3QLUC 2PG4A 5TPZA 3KTOA 1BOAA 3CFYA 3T1BA 1U0SY 3WU1B 2LSOA 1FFSA 3EETA 1R7JA 4LK0F 2QR3A 2QQAA 3ULQB 4OLBA 2FXAA 3LQQA 2VC0A 4AWXB 3L9FA 1J7KA 4XBFA 5T3YA 2VXZA 3NHMA 2IW5A 2L3DA 3E6DA 3RKWA 5LHIA 1NXPA 5K5OA 1ULYA 3KE2A 3BROA 1G3SA 4LB6B 1G4DA 2M30A 2KIUA 5D5VB 5KC8A 3I58A 3WODF 3OQNA 2JPCA 3RIRA 3GYBA 4RK7A 5LGNA 3F73A 2V1DA 5FLXZ 2FN9A 5K1YA 2FF4A 2XAGA 5BOXA 2G7HA 2EFQA 3N0WA 1JFSA 5JFRA 3F23A 5KQLA 3Q5FA 2FNPA 2PMCA 2IA1A 1YW7A 3VOEA 3N4MA 1FYMA 1YMVA 3OM0A 3CG4A 1Z9CA 4XFKA 3GW2A 2PI0A 1ZY2A 3OMXA 4MNUA 4CICA 1HXDA 3DXJF 3M9XA 2QSJA 1W4MA 1WWXA 4RDCA 3LA2A 3KKEA 3KLOA 2W24A 2JRTA 3GYHX 3E6CC 4PZJA 3E5UA 4MTDA 1R00A 3H1FA 2CSOA 5HVQC 4LZLA 4OIQF 2LP4Y 4PICA 5IEBA 1NXWA 4MQVA 2NS0A 4EM2A 5E20A 3KP7A 4JB2A 4Z9BA 1JGSA 3CHYA 5KQGA 3ZPLA 4PGHA 3S99A 2HQRA 1HW1A 1IN4A 3KFWX 4QWQA 5D8LB 2R4QA 1XGSA 2KJBA 3ECHA 2A9RA 2YX4A 3WTVC 3J81Z 4GCVA 4KREA 3Q9SA 3LUAA 1B4AA 4G0XA 3M8FA 4QLCU 5IT3A 3FMSA 3EQZA 1YTUA 5TJJA 2UXNA 4UV9A 4WT7A 5CVUA 4H60A 2UXXA 3FXUA 4M74A 1D2AA 5JHUA 5J8CA 3D02A 5L3CA 3IPCA 4WXDA 2P5LC 3IKTA 1ZITA 3TDZC 4G0ZA 1ZESA 2FMHA 2Y0MA 4IXAA 4HAMA 4DQDA 2O3FA 1DPUA 1PNRA 3I64A 2WWYA 2RJNA 3JAMK 1KU7A 2YPRA 4IHSA 1NXVA 2ID7A 4KUMA 4YFKF 5BRAA 1D1PA 5BR1A 3K1NA 1S7OA 1EWTA 4N0PA 1I1SA 3KEOA 5FBKA 2ZAYA 1FSHA 5BPDA 5FWYB 1BC7C 4EM0B 3LQRA 4RXMA 1YG2A 1WQ2A 1XMAA 2CWEA 4NQRA 1Z16A 3IP5A 1O7LA 3G73A 2MYUA 2RN7A 5B3JC 4HF0A 1XD7A 5KQMA 1P6RA 2D1HA 3R61A 1LK0A 2XIGA 4LLNA 3I59B 2MBFA 1ZHHA 1W5SA 3NEUA 5JI6A 1E2XA 1WI9A 2FU4A 4YO7A 2PUGA 3SAJA 1IXRC 4WXCA 3L49A 3O1HB 2CO5A 2OU2A 4MS3B 2P9HA 4MS4B 3E3MA 1RPJA 4EJVA 2JVKA 1J9IA 1DJMA 2IPLA 2DLLA 4P1ZA 1Z6TA 1BIBA 2RNJA 3A0RB 3OLWA 4B09A 1FNNA 1D5WA 4FE4A 3I09A 3K69A 5E8IA 1M5TA 3WU0A 1D1QA 1Z25A 4P5OA 5LRSA 1SFUA 2FBHA 2L19A 4GYIA 4NQWA 3HCWA 4EJUA 3BJOA 2DQLA 1K78A 2VBZA 3JVDA 3VNAA 1W7PD 3FM5A 1I27A 4U88A 2LIVA 1ZGGA 2OZUA 1G6NA 4G7ZF 4YLEA 1ZH4A 3MQ4A 3EULA 4YP9A 3JY6A 4MQFB 2UWMA 1Z2DA 4MS1B 2PEXA 2V0NA 3HRSA 1H0MA 1MDMA 2JK1A 4ZYGA 1BI3A 4PE5B 1NY5A 1AOYA 3BWGA 4Q5SF 4XARA 3UUGA 4MR9B 1B1BA 4KQCA 1IXCA 3EGCA 3IWFA 5IULC 1FBSA 3K9TA 4MGRA 4YS6A 2EB7A 2MLGA 2P7CB 2ADUA 2HSGA 1T0FA 2NZVG 2XKPA 4Z99A 3RPQA 2DPUA 1YIOA 5KK1A 1P4WA 1DBQA 1MVOA 1A04A 4ON0A 3N53A 2VT3A 4ENJA 4OMZA 1KA8A 3RVSA 1URPA 3HDGA 4RB0A 1TNSA 2FEZA 2WV0A 5FBHA 5H20A 3RPUA 3TX6A 3F8CA 1KQ8A 1O3SA 4Q6WA 2MC3A 4UHKA 3CUQB 1YK1A 5DDGA 3R0JA 4RAZA 1F5TA 1T2KA 4HF1A 5ILVA 3JVIA 2GXBA 1F1ZA 1K6OA 1TM2A 4NHJA 4PEVA 4NCBA 4RB2C 2FVYA 1RZRD 5HLGA 2PKXA 5HLIA 3QPHA 2V1UA 1W7PB 2L4AA 2DK5A 4RY8A 1Y0UA 4NV3A 3P9YA 2RGVA 1ZG3A 3QU6A 1Z18A 3BDDA 4ESFA 2Z3YA 4A0XA 2ELHA 2I6FA 3H92A 4HV6A 3W6KB 1LVAA 5D4RA 3K1MA 4L9NA 1B59A 4RK1A 3HOSA 4HNRA 5E17F 1VKRA 1EWKA 4G8XA 4P9FA 2EWNA 1FT9A 1LBIA 1B9MA 3H5TA 5CVIA 4TLLB 2ZFWA 1U2PA 4IMJB 2D1VA 2JBAA 1HQCA 1GUDA 4N41A 4IJAA 3GWZA 1SXHA 1PDNC 4ASNA 5JNUA 4MRMA 1XHEA 3HS3A 5DKFA 3C7JA 2QZJA 4ZJPA 3ZMTA 2MLKA 4L85A 4YGXB 4JB0A 2O20A 4HLYA 4CHUA 3QELA 1M2FA 2HGCA 1R5HA 4G6QA 4I98B 1FX7A 2WWVD 3RYPA 2H27A 3ILYA 2F5CA 3DKWA 5JNTA 1Z91A 4MR8B 3EQ2A 4HX4A 3FXQA 6PAXA 4I09A 1J5YA 3C3MA 2K86A 3HSYA 3Q15C 5JS1A 3KHTA 2VOPA 1IN5A 3GF2A 1MB0A 2K02A 2JPBA 2FMYA 3N0RA 5IBQA 1OKRA 3FMVA 1Z17A 2HKXA 2A6HF 1U2QA 3N0XA 2V1XA 4XLTA 2HQNA 2DRIA 2ZXJA 5DYMA 3E3VA 3GBVA 4OMYA 4XAQA 3DQVC 4A6DA 4BHBA 1HW2A 2ID9A 1TNTA 2KRFA 1JH9A 3KEQA 3ML6A 2EV6A 2JSCA 3CNBA 2O8XA 3NNDA 1XDUA 3TD9A 3A3KA 3RVNA 2CW0F 1ZRFA 4KV7A 3DGEC 2XV4S 1PHRA 2XAFA 2JCGA 3HTSB 4WCGA 3LUKA 1XGNA 4ETSA 3HRMA 5LGTA 4I2OA 1FPQA 5CLSA 4A12A 2BEOA 3H5LA 2GWRA 2D2WA 3TO6A 2X7XA 1ZN2A 3RTRA 2BGGA 4LRQA 1T6SA 4KIFA 1T38A 4JP1A 1JDPA 4ENNA 4WF2A 5K5RA 1OYWA 1RXIA 2VT2A 4UHJA 3OLVA 2XVCA 1FBUA 1J75A 4IGAA 1P6UA 2PAFA 3JTEA 3R60A 4ESJA 2VE8A 3SZTA 6CHYA 3FFTA 4LE2A 1MGTA 4M73A 3KCNA 1GCGA 3CLKA 1Z26A 5KWSA 3F3XA 2GBPA 4ETIA 5JNRA 4NB5A 2QBYB 4IILA 2RGYA 2PLNA 1Z6RA 2JZYA 4PGGA 4LG0B 2A3SA 2VK2A 3FFXA 3KP5A 4UV8A 3LFKA 2R7DA 1H9CA 1NXTA 4I02A 1ISRA 2FLWA 2IP2A 3ZMZA 2DPDA 2K4JA 1BAPA 1DP7P 3H5IA 3IP7A 2OA4A 4KN7X 1R1TA 1HKQA 2L02A 3MF4A 4R79A 3RKXA 5A2QK 4F11A 2F5EA 2OENG 5DCMB 2A6EF 2F8TA 1USKA 4Q7EA 1NXXA 1U2WA 3ECOA 2ISYA 1FFWA 2ESHA 4OU0A 5F64A 1GHCA 4W5NA 2ESNA 3MIZA 3O2SB 3OLXA 4IRHA 1ON2A 2EFOA 1DCMA 4KMUX 2W25A 2H09A 2GA1A 5GOTA 4KNYA 4N76A 1BI0A 1FYKA 2YSRA 2ZMEB 4EJWA 2WTEA 4AVPA 3LMKA 2IT0A 1ZH5A 2PN6A 4F06A 2OBPA 1SXGA 2M98A 3VFZA 2W42A 2W85A 3F6VA 4MLDA 3SXYA 3VEPA 3MCZA 4NCAA 2WY2D 3GZ6A 3D0SA 3KCCA 4XRFA 3E5QA 1GVJA 5DV5A 3FMQA 1H9TA 2A07F 2H6BA 5TPWB 4AIJA 2PJUA 1T39A 3P9CA 5DCLA 1WRJA 3WG9A 3EYYA 3KP6A 2WB4A 1HBXG 2QW1A 3MQ0A 1WSUA 1QGPA 1YW9A 2FQ3A 1K7AA 5IC5A 3CUQC 3QLTA 4KN4X 1M5UA 1NXSA 4LD5A 3I5AA 4MGEA 1OPCA 2P7VB 3I59A 2QQ9A 5AIQA 4RK5A 3LKVA 3LKBA 2J5PA 2XGXA 2HPHA 4RSMA 3H3UA 5TRDA 1B9NA 4RWEA 3Q7SA 1XMKA 4P55A 2EFWA 2GZWA 3J80Z 1AWCA 1L0OC 2WC2A 1BM9A 1IF1A 3FHZA 1SD4A 3E6BA 4MS3A 1DCFA 4MS4A 1XCBA 4RAYA 3Q7TA 2JVJA 2LPMA 2JRLA 5PNTA 3JSPA 5FWXB 2ZNZA 2MSLA 1YYVA 5IUNC 2DBBA 3KYIB 5TQ0A 3DZDA 5E1XA 4DN6A 4LGWA 4H3KB 4ZZLA 3CZ5A 1LDDA 1C0EA 4BNCA 3H5WA 4HZFA 5HLHA 3HK2A 3M8EA 2HJ9A 1KYWA 3V8LA 2IJLA 2NZUG 3MYYA 3ISPA 5ABPA 2CQKA 2K4BA 5TPZD 3KP4A 3KP3A 1SD6A 2MH9A 5L3FA 2MYNA 3QRFF 1K79A 3GFIA 3D8UA 1LEAA 1MD0A 1T98A 2YR2A 2IPNA 5CVVA 1AB5A 4MLCA 1VTNC 3GWGA 4XASA 3RVMA 2Q5CA 4EYOA 1B6AA 3MAJA 3P9IA 4MS1A 2FLKA 3JTGA 5HSGA 4YR7A 5ICFA 1OR7A 3KP2A 4BAYA 1TMYA 5FO5A 4Q47A 1R23A 5CYVA 3GVAA 4ETMA 2A9OA 5AONA 4A6EA 3T38A 2VBXA 4MR9A 5CNKA 3ABTA 3ZMVA 3TMYA 1D8KA 1BC8C 4CO8A 3RVQA 1TLHB 3QPTA 5ERIA 1DCKA 1R1VA 3L00A 2ZNYA 2VBYA 1SXIA 2C6YA 2FRHA 4XLNF 2QZ8A 2NT4A 5BS6A 4WZZA 5CJ9A 2PUCA 3K1PA 3SZPA 3BZ6A 2ZCWA 3OOPA 3IDOA 2HOEA 1ZAYA 3IPAA 3QLUA 1BIAA 4Z0NA 2M1ZA 2GX6A 2VE9A 1PP7U 4FE7A 5BQTA 2F8SA 1MJ9A 5ED4A 3CZCA 4JASB 1WETA 4ML3A 1FZPB 4KICA 1G3WA 4UXNA 1Z7UA 5LHHA 2IDMA 2L17A 1QP4A 4RU1A 1ZG1A 4XSZF 4EY3A 1PP8F 3MFKA 1HEYA 1RZ4A 4YIFA 3NRVA 3LUGA 2XRNA 1KYZA 5HM6A 1U8TA 2GI4A 1SFEA 3JS5A 5I4CA 2V9VA 1KU3A 2RKHA 3BREA 5IEJA 2A9QA 3N75A 4KMFA 3FGZA 5TQ2A 1LDJA 3H75A 3PQJA 1XCVA 1RUNA 4MPTA 3V7RA 2F2EA 2HKOA 1BA2A 5FD6A 1A2OA 2FOKA 1W7PA 2PBIA 5FFZA 1XWWA 2P4UA 1J56A 2LUOA 2RC4A 5GQSA 3RVLA 1WKMA 1XSVA 1OXKB 2JB9A 4N47A 1OYYA 2OAZA 2V79A 4EM1A 2KYRA 4EYGA 3CKMA 4ETNA 3AAFA 4HDUA 2YX7A 2B1JA 1IN8A 1RIOH 3NHZA 3I45A 4IRGA 2L18A 3LAJA 1QNLA 3L2CA 4AIKA 2B0LA 2ZO4A 1PNTA 4HW0A 4LE1A 1DUXC 5DEQA 1TJYA 1ABEA 1ZREA 4WK8F 2O03A
chains in the Genus database with same CATH superfamily
4XYGA 2FK7A 2HC9A 3CNOA 2ID8A 3IAXA 2XRYA 3H1EA 3WIEA 2PYZA 3IYLW 3ZNQA 3HB4X 1WVIA 4UTNA 4JR1A 4ALIA 3BH0A 5KOHB 2JA1A 5K3DA 3P2EA 4B7ZA 4I1YA 4AMGA 1GL6A 3VDXA 1MX5A 2JI9A 3AI1A 3R2JA 1XSDA 4P5EA 2CLHB 4RD0A 1N2XA 5TX7A 2QLZA 4ER7A 4HS9A 3OAAA 3DTVA 1WRBA 4L4UA 4QSHA 5GVSA 1ABFA 5JHHB 1LNZA 4L95C 2D1TA 1ZRCA 3LA6A 3FPHA 4XB2A 5DXAA 4V2FA 1DARA 4LSMA 4XGNA 3F7MA 3PQCA 3ILHA 4EEKA 5HDKA 1G3YA 1GPDG 1YDGA 4RCVA 3WP1B 4PAOA 1I3KA 1IC8A 4LX0A 3T8TA 4FCCA 4MJ7A 3H86A 1CNMA 3S8YA 4X1IA 1Y1QA 4A2QA 4DDTA 3ETLA 1JHYA 3N2IA 2QRMA 1RC8A 1VPWA 5CA0B 3PD1A 2TDXA 3ZJYA 1JHMA 3V8QA 3SBXA 1QPZA 3JQ9C 2VH1A 1WV1A 5AIPA 2CXXA 1M0TA 4KLCA 5KQSA 2TCTA 1JXSA 2UYYA 4KG7A 1U7UA 4K5QA 2WYVA 4R2IA 2G9RA 1VL1A 3IAFA 3W2VA 4PIMA 1E1YA 3NBUA 4AC0A 1T8TA 5ALLA 1KQGA 3T0IA 4NZ9A 3TN7A 4L5YA 3IVMA 2STWA 3MZ0A 3CU5A 2C2HA 1WPRA 4KDRA 2P27A 2PYIA 2EAUA 4OM8A 5CNIA 4QUKA 2BR3A 3T5DA 1F5NA 3UWPA 2BTOA 3NB0A 1ZUNA 2J3EA 1P1RA 3PWTA 4B84A 2NU7B 4PSKA 3I2JA 1IQRA 3OIWA 5ECDA 4URXR 3HY4A 5I8ZA 1RLUA 2A4MA 3KZOA 5CX1B 1O95A 1K7CA 4EUFA 1RHJA 1DO8A 4M9RA 4KLNA 4WLUA 3ZYZA 4L7VA 1WXIA 4RS3A 3IX7A 3GFFA 5HQ3A 3T35A 2WY8Q 2FEKA 1YQGA 2JHPA 1QH8A 4H6VA 1RCTE 1HEIA 4OF4A 2EF0A 2OV4A 1NIJA 3K71B 3IUPA 4KQIA 4Q01A 5MGNA 5IM4F 2XMSA 1XGKA 4PO1A 3Q6IA 3IIKA 1S7CA 4HQEA 5K2OA 2AW3A 1C7EA 4O4LA 5A03A 4NYJQ 2XAHA 2W0SA 2FDCA 1RM3A 4E5VA 4I9NA 5E1BA 3BXXA 4RH0A 1P4SA 5ISMA 2YRXA 5EZ5A 3JYOA 1BVRA 3E7PA 1VG8A 1KY5A 4BVGA 1JI8A 5AVVA 2R4UA 4DEVA 1UFMA 2V58A 2GARA 4CN9A 1U8EA 3EMKA 3IDZA 2EKQA 3BBLA 1YZTA 3GTLJ 1D04A 3A05A 1Y8QB 4RVDA 3BGIA 2C2KA 3GFMA 3QE3A 2WC1A 2XF7A 1IBMB 1BE0A 3AG5A 2R6CA 2VUMJ 3Q11A 2GJAA 4NICA 5DZSA 3FDFA 3I6ZA 1Q22A 1FFGA 1S9DA 3UJCA 2PX9A 1DUIA 4OUDB 3PX2A 4R5HA 4AZ0B 1E1QA 1AHHA 5TVKA 5B57C 4CCWA 3NEYA 3QX3A 4TV8A 1YX5A 3RDIA 5TE9A 1SIBE 3ZX5A 2KP6A 4KO1S 2APJA 5BVHB 4OYYA 1ZRHA 5FPKA 5FP0A 2ABWA 4CMEA 3UK2A 4INZA 1XPJA 1FQOA 4C0XA 4J16A 4LY0A 4FZ3A 1V6SA 2XROA 3H4MA 3VR4A 5J8FA 4WDQA 3T7IA 1IAWA 2W43A 3IBFA 3QBJA 3RVRA 1ADBA 4XSHA 4ZC3A 3HJFA 3VH4A 2RGNA 2P90A 2ZIWB 3GLIB 2V7XA 3IRUA 2KKOA 4J43A 4ZCLA 3O4FA 4J7UA 2WYIA 4CU5A 1Y7HA 3KUXA 4RSGA 1Y1TA 4N65A 3U4AA 2XA2A 4OSPA 3L5KA 3U7JA 5AVWA 2LR8A 1GGKA 2QVYX 5AVQA 4BLWA 3S3NA 2FCAA 2GKOA 4XR9A 2HYFA 4YO8A 1WPKA 3WLJA 3S3OA 5FRMA 4YQZA 1J0RA 1TUBB 4GZ3A 1QUFA 5EWMB 2PL9A 3QUTA 4DJTA 1JLLB 3N2EA 3NNNA 4QICA 1J59A 2F1HA 4Z4HA 1V1RB 3QY9A 2JI6A 3A3PA 3PIIA 1EDOA 1J2RA 5CVTA 2UDPA 5KHOC 4QUJA 4EDFA 4FGWA 1SCQA 3SKXA 1R6RA 4F5YA 2AXLA 1XTKA 3IO5A 3MEXA 1MNDA 2OWEA 1Q0UA 5CVCA 1PZEA 1L9XA 5AHKA 5ALYA 2PMEA 3OCVA 5JVTA 2XHEA 3BA6A 1N1EA 2WIGA 3NOXA 2K3FA 1QVWA 3BFKA 1L5ZA 3KUCA 4QARA 4PLYA 3VU8A 4I3GA 4QKQA 4TZKA 3QHQA 3BOQA 1RKXA 3KEMA 1V1MA 1ZK1A 3IAAA 2E2JJ 4TWIA 5F6FA 4G5QA 3COYA 1DXOA 1W52X 1UDRA 4NBWA 3FTFA 3NASA 4LGMA 4ITUA 4D9CA 2D00A 4Y2TA 2G7UA 4DVGA 3FR7A 4QFDA 3CJNA 2R7FA 3KAKA 2I3ZA 3M1CA 2J6CA 3FBTA 2VXDA 3TR0A 1E2LA 3IUQA 4ESHA 1ITZA 2DM6A 3FWHA 3U4HA 5IAKA 3RK0A 1ATIA 3Q3GE 3B7PA 3F1LA 4ZIRA 2R60A 7MDHA 1RZRA 1GXPA 4D4GA 2H52A 3VA7A 2N9UA 3QTTA 4JS0A 4BKQA 2XPCA 3AKZA 2IWRA 3HY6A 2EKBA 4Q39A 3ZH9B 4GIBA 2H1KA 1TLLA 1PJRA 3OCWA 5LWHA 4C4OA 3OPYB 4R9SA 1U8RA 1K5DA 2V97A 1ZKGA 1IW7F 2HQ1A 4PC6A 1Q44A 3LC7O 1AGYA 2QXUA 5D87A 3FSGD 1RS0A 1TD9A 1WZUA 4A27A 1UZMA 3TZLA 5FLXK 3GA5A 4DKXA 2VTBA 2X1HA 4W7HA 4U63A 4P53A 4U7DA 1FLVA 8MHTA 1NQAO 1Q7TA 4K9DA 2R25B 3P0IA 4PAGA 2VQLA 1FBTA 5EHNA 4HEQA 1DUSA 1QZEA 3MMZA 1PZNA 1DBIA 4JNCA 3G0CA 1L7BA 4E1BA 2XBMA 3TQIA 3DR3A 1TCAA 9LDBA 3LGSA 4DBLC 4LDNA 4E4YA 3DU6A 3W5AA 2FKNA 3EAQA 4C06A 4UOEA 3DXXA 1VYVA 5JCZA 4TYWA 1ZP6A 4CF5A 1P18A 5T64A 4ALNA 4HF2A 4MPPA 2CBGA 3UAGA 3FKSA 3MUNA 4AKGA 2UUAB 1IRGA 2IKSA 4KMMA 4V2UA 1IPEA 1TI7A 2RKBA 3ZY3A 4U0YA 4Y6SA 1JZQA 1GG9A 4PZEA 2ODBA 2XB5A 1MHTA 2FWRA 5AJTA 3TO7A 3PKZA 4MWDA 1MAAA 5AI6A 5DX0A 4ZTBA 4ZH4F 4IHYA 1R49A 3WLKX 3WLHA 5H3LA 2CF5A 3SZUA 3HGYA 4E7LA 1O6ZA 3IPLA 1LFPA 1K61A 3KYDA 4EPWA 2V26A 2NMVA 2E6UX 4N0BA 3LLSA 3VRHA 1U2DA 4HNSA 2M32A 3EVDA 1MH3A 1H22A 1TUGA 3OZBA 5DLYA 4XYBA 5G0SA 1HT1E 3P4YA 2O3QA 5CT4A 1C4OA 3Q72A 4F7ZA 3N59A 1AS3A 5I01A 3QP6A 3ZKWA 3TG8A 2BGIA 2QRNA 2H9YA 5GPCA 4DJAA 3A9WA 3DAFA 1IJEA 2BVLA 3QLVA 4G6ZA 4YRSA 4M2LA 1LPOA 5JJIA 1U9IC 3KRTA 1P0PA 1UR5A 4AY3A 2EJCA 3D0RA 4REQB 4BB6A 4N5MA 1P7IA 4B1RA 3CLTD 3DMGA 1T8IA 4X64B 5AW9A 1LEBA 3HSSA 3SICE 2FMIA 4QG3A 1H2AS 1BZYA 5JALA 1MBKA 2ISZA 4J03A 1J70A 5AKXA 1U9ZA 3E9QA 2C4NA 3H18A 1CC1S 1K3TA 3PGMA 4Y6LA 1PR9A 1QGDA 2JIZD 2Z57A 5FFMA 4DIMA 4LJLA 3OE5A 2UVDA 4DIUA 3KQYA 2AYYA 4QTTB 4WLEA 1L7QA 1U5TA 4IS2A 3GAMA 3CX3A 1YOBA 4MW6A 3CFYA 2DFHA 3EETA 3UH1A 3T7RA 3SJUA 1YI2I 4X1OA 5AP9A 3E6DA 3CCVI 2YJGA 3AHDA 4DV4B 4R98A 5ICSA 1BXRB 3MAAC 2HBYA 1HE2A 4LPSA 1UBGA 2OBLA 2PRJA 2BUBA 3ZE7A 1SG9A 4XVQA 4BQEA 3IA2A 2PXAA 4NFLA 2HDOA 2ZIAA 1G9SA 3TB4A 3WMWA 1QHHD 2OPTA 1N4DA 3DEFA 5IJ9A 4CNQA 3WAJA 1PZGA 2CKMA 4TXMA 3D8RA 3D8NA 1AE1A 4KO2S 3U3ZA 2I66A 3NTVA 1Z9CA 2VJBA 4MNUA 4CICA 4GI2A 3QU4A 1U02A 2WABA 2JRTA 3ILVA 1OMOA 3DUFB 1UBFA 4LS3A 3I23A 3AUAA 3ILSA 4OB8A 1VQ5I 5FOUA 1EUQA 3D0KA 1GA4A 3FGPA 4L73A 4P35A 3KFWX 2BZ0A 4KIJA 3Q9SA 1JA9A 4V19K 4IIDA 4YIHA 3K6SB 4FMBB 1OJLA 2EX1A 1YTUA 2DH5A 2MSDB 2JGLA 1NN3A 1UPTA 1W4CA 4WZAB 2PGDA 1MBJA 5ALIA 4U7WA 2VPYA 5DM60 2NVQJ 3IPCA 5FULA 1ZITA 1PSZA 1U90A 1R37A 1YRNB 1AUQA 1DPUA 3WK6A 4TXNA 2VPRA 4ZXFA 1KARA 2HEGA 1GEEA 1CS0B 2I78A 4ZYVA 1V7QA 4UUMA 1FYVA 2VF4X 4HKTA 4F55A 2DPHA 1TRKA 1O7LA 2G7ZA 2RN7A 4YK7A 3C3DA 2F4OB 4B40A 2R5ZA 5KQMA 1FJHA 3PQ5A 821PA 4U6NA 4MP8A 5EE0A 2LKXA 5E6RB 3B6ZA 2KLBA 1CP3A 1M7BA 3O1HB 5CUQA 2NQ8A 2VRCD 2JRMA 1UADA 4E3WA 3EVNA 1BRMA 4HMOA 1XTTA 4ZCQA 4V0SA 4GRIA 3UIEA 4G25A 4BNHA 5GAEJ 3HBFA 4BQFA 4JY7A 3OIDA 2D5LA 2GBYA 2XT9A 5BN4A 4P81A 2Q5OA 2FBHA 3E4DA 1FZTA 1E4OA 4ND7A 3FI0A 5H70A 1SH7A 4R8KA 3E2MA 3GA7A 2ZK7A 1TKAA 3E22B 1KXZA 3QF4B 1IOVA 5KJCA 1XELA 2IEGA 2WMDA 2COKA 3C48A 5AH0A 4MYSA 2WM9B 3FTDA 1QV9A 5JAOA 4OJYA 4XB1A 4QD3A 1D2CA 2QM8A 2EU8A 1FBSA 2PSSA 3LE8A 2H92A 2ZIUB 3WHKA 4OI2A 1E58A 3O9VA 5CBPB 2EP8A 1RJEA 1RZUA 5FBQB 5AUOB 3FYUB 3PFCA 3WISA 1CBUA 3MCUA 1KI2A 4QTRA 1JDUA 3L04A 1EE1A 3T7TA 4PO9A 4Q6WA 1MOQA 4FKZA 4NOLA 1EBBA 1TNDA 3KJHA 3VO8A 1PUFB 3DYVA 1BGXT 3ND8A 2X7HA 1XRMA 4EJSB 4AUMA 1JDSA 3I34X 4QEZA 5HLGA 3EBPA 4QDKA 1KEEA 3KAPA 1QH1B 4LNUB 4QJ5A 1OTXA 4TKUB 1ZZGA 5L7YA 4RY8A 3HWSA 4BKUA 1UBOS 4POOA 1U0GA 3W5UA 1P2SA 4P93A 3BMOA 3THOA 5BSVA 3TEFA 4A0FA 1XZJA 4CLRA 1VPEA 1YCDA 2ODPA 3MYRA 1MQ9A 5AHRA 1BE6A 1G3MA 3HGQA 2I0FA 4TLLB 1BXZA 4MW5A 4ZT2A 1Q0LA 4GXQA 5BWCA 1F2UB 2Q27A 2PR2A 2XEXA 3SCZA 4WBNF 3SGLA 3PL5A 1GQSA 2Z3VA 1G0NA 4H7PA 2DR2A 3BS4A 4BTVA 3PT5A 4Q21A 3RS2A 5B4VA 2XB8A 3JYNA 4B8ZA 3RYPA 1XNGA 3ILYA 5JNTA 3AERA 5L3SA 1V45E 2ZJ6A 1PL8A 2NNWB 5L3ZA 3GF2A 5DM6F 5IBQA 3TQQA 3HJHA 4KQJA 3IVXA 4D4LA 1A8PA 4DIDA 2OTCA 5C4IA 4JJGA 5CRIA 1JTYA 2QSHX 4TTPA 3UUFA 3FNRA 4JI6B 1TQ2A 1IUKA 5JVDB 3HTSB 4AZWA 3Q4GA 2R44A 1XGNA 4KN9S 3NIBA 5LGTA 5CLSA 4KQFA 4N3CA 4LRQA 1VLJA 4YONB 3COPA 2HL6A 3QH4A 4GLJA 3RIYA 4ENNA 4ZDLA 4UHJA 3OLVA 1CR2A 4DLRA 1IEWA 3P2MA 4H1HA 3F3XA 4B3HA 4RVHA 2GBPA 1Z67A 4HPJB 3FPBA 4LA4A 4D9EA 3RK1A 3E9RA 2VK2A 3FFXA 3DAPA 3GJZA 3N8NA 5CLGA 5LP1A 1NXTA 1PGPA 4O2LA 2PGJA 1YA8A 3H5IA 3E3OA 5BOVA 1N9GB 3MF4A 4R79A 1XA4A 1MV5A 3SYKA 1RYEA 3LS2A 2AOVA 3C24A 4RA9A 1FTWA 2P75A 2ISYA 5IJ0B 2HNAA 1GHCA 2ESNA 4TM7A 1VB5A 1IG7A 4GLOA 1RMQA 1DCMA 2YJZA 2W25A 1KJ8A 4IBOA 5BQOA 1PE0A 5T67A 3R9IA 2WV9A 3B13B 3ZC3A 1DJOA 3DFMA 1QIGA 4NBUA 7GPBA 1SIUA 4MV3A 2PAAA 1Z4OA 3ZDCA 3FMQA 3OWOA 3NHRA 1G5QA 1MGPA 2FG7C 3TUIC 2BKUA 1H5UA 3PXDA 5B1AH 1MRSA 2FDRA 4MHOA 4BNXA 3CY6A 1CPYA 3OSFA 2AG0A 1WX1A 3A01A 1EGAA 5AWFC 5I8WA 5EJFA 1AH2A 2WADA 3LKVA 3L5OA 3RTBA 5DT2A 4ZVVA 1B9NA 1WW2A 1H85A 2AN4A 4JUAA 5DTJA 2AJDA 3QIVA 1SD4A 1OLUB 2Y4NA 2HA5A 3LRTA 4TGLA 5BT8A 2H7CA 3RJMA 3K9BA 3K9HA 4Y1FA 2OZKA 3DZDA 3EPHA 2F1IA 2GCEA 4EHLA 2CYCA 1EBUA 4UCQA 3H1PA 2IJLA 2VPLA 3DZBA 2ZWOA 1YJBA 2CQKA 5TPZD 5FNVF 1QF7A 3GLFB 1UKVY 1H8EA 1KY2A 1XC7A 4BB5A 1T98A 2IPNA 4OWRB 1EHIA 3GZNA 4BNNA 4CMHA 3VBEA 3W1EA 1CERA 4RDHA 4HQRA 3R7BA 3QQ5A 2BC9A 3GQVA 1M67A 4IZ6A 4MMZB 2G08A 4Q00A 4MR9A 2Y66A 3PWKA 3FVRA 5LJIA 4KQGA 4KQEA 3G89A 2F90A 1YFLA 1HSZA 2QLNA 3NV9A 4DEXA 4YP1A 3K1PA 4GX1A 1RKBA 1Y8AA 3IPAA 2AO9A 1K6IA 3S70A 4UDOA 2Y0SA 2OCIA 5ED4A 1UL1X 3GEIA 2RH4A 5C8YF 1I2BA 4NFHA 4ZRMA 5H59A 4IWNA 1RKUA 3VUFA 1XMOB 3ABIA 2V9VA 4TUYF 3Q3EA 4YRNA 1EK1A 2GCIA 4P0QB 4KMFA 4DMKA 4H7IA 4MW0A 1SG6A 3CLRC 4JT4A 2YJ6A 1XQWA 1VQKI 2EC5A 2VBFA 2REXB 1XDBA 3K2AA 4LSGA 4DLTA 4FCWA 3H2JA 4X9XA 1HFWA 4N47A 1QR6A 5HM8A 2QK4A 4F3KA 3AAFA 2R5WA 2P7IA 3B1ZA 3DXFA 4RCZA 2ZO4A 4JKYA 3GH1A 1UBSB 3K5WA 1NG7A 1M6VA 1WG8A 1RPNA 2Q1SA 1GT91 3ELKA 2H85A 3RKYA 3E3LA 1CZRA 3PICA 1J0DA 1CEXA 4RX1A 3UB4A 2UUOA 4KK4A 1YD7A 3NYRA 2DULA 2FCRA 4OLAA 1EGHA 4Z3KA 4UD2A 4J91A 1NG6A 3TSWA 1LF5A 3A04A 3UFBA 2I9KA 2DHQA 1OBFO 2VPWA 4CETA 1D1CA 4D81A 2DA7A 4PF1A 3TEMA 4RJTA 3A2KA 2PKEA 4X6XA 4JL6A 1WKBA 4ODIA 2CNKA 4URFA 2ETVA 5IYZA 7REQB 2GVZC 2PCLA 4GG1A 2Z95A 2DT8A 3PZBA 3LDFA 3PV0A 5CHYA 4ARVA 2EJUA 3L1HA 2JF0A 2GFIA 1RYZA 4EJTA 2IT1A 4W1QA 1ZRNA 2ISQA 2GEFA 3ITEA 4F60A 3NLLA 2R68A 1Z5VA 1MRNA 5BWNA 1I32A 2P3LA 2EWVA 3RRBA 4DR7B 4JI8B 5CDGA 1HZZA 2NOAA 1UT5A 4ITVA 2RHGB 2ZTVA 2VVTA 2MYSA 3OMYA 2JD1A 2YH2A 2O0HA 3LZ6A 2BEJA 4NRDA 2DOAA 1E18A 3KR2A 4BMYA 1RI7A 4RTQA 1IONA 1LS1A 2GAUA 3RJ5A 3F7NA 4QIHA 1VBFA 3O4JA 1N5MA 3VPFA 3GCWA 2ILVA 4OL9A 4F45A 1UT8A 1KIAA 4K9SA 2Y30A 3KPHA 4GI1A 4GAEA 3ROUA 5LEJA 2KB0A 1NMXA 2CD9A 2IA2A 4ESBA 2O4UX 4CGYA 3HKDA 4B1FA 3JQ8A 3ZIDA 3CLRD 4YRIA 1UANA 3UTCA 1GWNA 2WM8A 5BT9A 3BQ9A 4EVSA 3NXKA 1KH3A 4NBQA 1FY7A 2XTJA 3RUHA 4XPZA 3QFRA 3VR1A 5BXQC 3BJIC 2G3YA 1Y6FA 1PEDA 2BRUC 1DP3A 3C14C 3JRAA 5BY2A 2PH5A 2VUSA 2B78A 5JH7A 1VLZA 2JT1A 3A9RA 2HLDA 5FBRB 4FCTA 3PUJA 5F7OA 1S2IA 3WL3A 3GJSA 4UUPA 3BFVA 4MULA 2WPDA 3ENNA 2OV6A 1KQ9A 3RJZA 2PZMA 2B3DA 4GNRA 2WAAA 3QQAA 3MN1A 3DEAA 2AMJA 1J8QA 10MHA 1IZZA 1U3EM 2OQIA 3UG7A 2W4IA 1NUQA 1R3UA 2QLBA 3EXFA 3UY4A 4G9GA 4CKBB 4O1MA 1T2FA 2BF4A 3ELYA 5LQUA 5EXDA 4D57A 1NOIA 2W8BA 2GZDA 4BGDA 5L7WA 1VLVA 4Q66C 1MG0A 1ORWA 1E7RA 4E88A 5BQPA 4UM9B 1TIPA 3B6JA 2OTJI 3CJTA 3O0DA 1VB3A 3TOXA 5DE3A 1FVFA 1Z6QA 5CLJA 2H16A 5LZ7A 5M5WJ 2VWHA 3K8ZA 4UVEA 3ABZA 3V8RA 3DPLC 5CB6A 2EFPA 3GRPA 4YREA 3JREA 4Q34A 1OFUX 4WXPA 3OM8A 5SZJA 1FQWA 2MHCA 2DYSH 2H48A 3TLGA 1JTEA 3BRSA 1RWBA 2C7BA 3VJKA 2X2FA 1LLUA 5A0FA 2E1PA 5FORA 5FPPA 1F9AA 4A0GA 3HYNA 3ICPA 3FZGA 5JIBA 5E6UB 4I6GA 4ZZDA 1EUCB 3IQHX 4JP8A 1EUYA 2GCPA 1WAMA 1DAOA 1OA0A 2ZRPA 5EWJB 2WRZA 1FLIA 2EYUA 3Q7PA 4JLBA 2BFWA 5FWYA 1N75A 4JLVA 1G8XA 4PHFA 3F6CA 4EGJA 4Q9KA 4YCLA 5DF1A 2BHRA 1W88B 1L7MA 4M55A 2HA0A 4IIBA 1ZD5A 3ZHZA 3C2GA 4IAOA 1GCUA 4CR8A 2BBWA 3TX2A 2CL5A 5IXJA 2WOOA 3L6DA 1YO6A 1Z13A 3FAKA 2WTMA 4B4UA 4LJ4A 2DU9A 2XQGA 1Y39A 4BVKA 3WE3A 1J07A 2SKDA 3DVRX 3UJPA 2WSBA 5TR9A 1N6LA 5DGDA 4MCIA 3MWMA 4NFYA 2ZWVA 4HSGA 2ZU0C 3LIIA 1A35A 1H3EA 3C16C 4R41A 2P6SA 1OX4B 2LCIA 1JYFA 1P17A 4ZT5A 3WL7A 2IE0A 5U9CA 2E5ZA 1QVRA 2XE8A 2JH9A 3HNPA 1X70A 1M1ZA 3R7LA 4WLFA 4LBVA 5FPYA 2AFIE 4I0WB 4QOGA 1M2WA 4PXAA 4KITB 1GXSA 1P1BA 2PUEA 5GWXA 3SHOA 3CLOA 3X44A 4Q3DA 5FUBA 4DMUB 5D1HA 4S0HB 5C1PA 5KSOA 5LP6B 2H08A 1E99A 4Q05A 1VL0A 4YMVA 4E7ZA 1T24A 4EHDA 2P6MA 5EHXA 1U04A 4XR4A 4PSUA 3BWDD 5AKLA 2P67A 1KU2A 4OHYA 2WMNB 3ZTWA 4ZVPA 4BBJA 2ZFUA 3H16A 1QIFA 3BCBA 4KVZA 1Y3HA 4RSRA 2AEEA 1A2BA 2BFAA 4IIXA 4KR6A 1ODKA 4BY7J 1N77A 2ZUVA 1VFPA 5HF9A 2J3DA 3DA8A 4RQAA 4M1QA 3CJRB 5THQA 1GOTA 2NTEA 4RM2A 2PDAA 3AR4A 3JV7A 1CR6A 4H16A 3PCRB 4GGPA 5DTIA 4I8XA 4HTFB 3V4LA 1S29A 3CA8A 4DMCA 2W57A 3K4CA 4CLOB 1I2MA 2BFFB 1K6JA 2XHZA 3AIIA 2Q28A 5TDHA 4I76A 3SXUA 1W59A 2G80A 4K28A 1NFQA 3AX6A 1YB6A 5KCMA 3LRPA 4PZ0A 1TL7C 1JQAA 2QD4A 3ZDYB 4BNIA 3VO1A 4ZGWA 4YCMA 1BHJA 1PVOA 1ZGJA 2B7LA 3LHIA 4E4RA 3SI7A 3AKYA 3DKKA 3C97A 1ULTA 1G4HA 3NAZA 2PPLA 1UZUA 2LF7A 1ONOA 1DC8A 4C04A 4MYUA 1Z2OX 3B12A 3LLCA 4MW9A 4BP9A 3WVNA 5K3OA 1XN1A 4ND8B 4PAQA 4HFNA 2ACWA 2WSSA 5D4SA 4HOYA 1HNWB 2ZIXA 4YP7A 2IX9A 4RCYA 5HZHA 1XV5A 1JW9B 4QIWN 2XUKA 1I3LA 2PUBA 1L1FA 1RAHA 3ZU3A 1R6XA 3DV8A 1I7LA 4UE3S 2CC2A 2GPNA 2PX6A 4FHDA 1WV0A 2WUWE 1R8JA 5KTTA 2IGNA 2D2FA 2J48A 5B1IA 4CHTA 3MC1A 2P4WA 4KISA 1L5YA 1P62B 2GEJA 2XB9A 2AHOA 2ET6A 1M7HA 1R9JA 1BVYF 1S4MA 1QZ3A 3D5EA 4ZMRA 3EIHA 1MJAA 4YAUA 1CSEE 1CEYA 4ERNA 2I1VB 2OBYA 4QC2A 3CVWA 1R74A 3IR6A 4EA7A 3FB1A 4TMYA 5KVCA 3S8MA 5ECWA 4NNOA 2NNYA 1T3GA 3BHMA 1YDFA 2XJ9A 4OQEA 2QGFA 3WLQA 1H2FA 2RHOA 2MH2A 4GKVA 1L6IA 3MJFA 1X7YA 1N0IA 4IZHA 5FBWB 3ZK8A 5ANRB 2AOTB 3GLHB 2XZOA 5F1YA 3ROEA 5GZ1A 3ZQFA 4LHWA 1UXIA 4FX0A 4YT5A 2R6JA 2DGDA 7MHTA 1HDPA 1U0EA 1U8XX 3K0LA 2H2IA 3DNMA 1IG0A 2FOIA 2V6MA 2R4GA 1Z2AA 2BDUA 1Z2PX 5K5QA 1ICEA 2O2IA 5A4KA 4DYDA 2EXXA 3KOYA 3I52A 2F3TA 1QX3A 3X2QH 3OZGA 6AT1A 2CJYA 3U1KA 4W5HA 1MB9A 1FU4A 1KVTA 1X1DA 4OK6A 1JFTA 1AHDP 2Q3CA 5DGCA 4EKIA 4B6OA 1E3LA 3TDNA 1CRWG 3PQDA 4Z4FA 1JFVA 3AL0C 5T4HA 4JBWA 2OY0A 5HNHA 1LBEA 2JTVA 1UEIA 4JN6B 4CG0A 5L7TA 5K4AA 2LBFA 3W3CA 2KDZA 4B2IA 3AUYA 5BUCA 2CUKA 2OAP1 3UWKA 2AR9A 2C5HA 1IH8A 4AJNA 1R22A 1KMIY 3AF3A 1TJPB 4LDAA 1NE2A 5IS2A 3UQZA 1X7DA 3W6NA 4RFLA 3HCRA 3FX2A 4CYDA 1DGWY 3D6UA 2BBYA 4EENA 221PA 3ZHCA 5EUBA 2FPOA 3VO9A 2P5TB 4M9QA 4NCIA 2IYOA 5DULA 4DLVA 3FRIA 1WMBA 3FHCB 1H93A 2F6RA 5IX8A 4PG4A 4OINF 3HACA 4MUEA 3C98A 4CCAA 5D1NA 1VA4A 4IP0A 1T8UA 1YIDA 1K3FA 1NYTA 1MMDA 3BUSA 1JVNA 3BPXA 5CNMA 1ON1A 1KNXA 4X85A 3FD8A 3U7GA 5LC1A 4MRMB 3WLLA 1DCTA 1RFLA 3GGPA 2AR0A 2WJ6A 3QLUC 5EJ9A 3OZUA 4FC7A 4LBWA 4L15A 1TZJA 2H5EA 3DOIA 3RKWA 1IY1A 3H3FA 3UOWA 5LKRA 1V8OA 4W9NA 3ZI4A 3EW9A 3LY9A 4I4TA 2NVUB 1V9CA 4HLQB 3MOSA 3OQNA 1MMFB 2YFYA 4RK7A 2ERYA 3CXUA 3D8HA 5JOQA 1ZS9A 4L22A 3HOYJ 4E21A 2XAGA 3QNUA 4BKRA 1EFTA 2SKEA 1JKXA 2XDVA 2CDAA 5IWCA 2FNPA 1I0ZA 2PMCA 5ALWA 3L7NA 4V02A 5BNWA 3NT2A 4RHYA 4U7TB 3ROXA 2NO6A 3SS7X 1HXDA 3M9XA 2V4UA 2HT1A 5C81A 5F3DA 1NOKA 1Z62A 5LU8A 1EPUA 3E5UA 1E3WB 3CYFA 2CSOA 4YDRA 2H1SA 1NXWA 4J2OA 1QVZA 4PGHA 2E19A 2W6QA 4KXNA 4MGZR 3QPSA 4K9LA 4XLCA 4NMLA 4NC8A 4LEIA 2OT3B 5D5HA 2BFMA 2HIGA 1RR6A 2VBGA 5K3AA 2Y3IA 4QPDA 3BZBA 2HT6A 3EQZA 1EG7A 5EIAA 2EP7A 4YDHB 2DQYA 2QR5A 1C4KA 4AP9A 1L5LA 3S1AB 1MAWA 3I05A 2ID6A 4DQDA 2OHIA 5HS4A 3CO0S 2Z16A 3KBBA 4WADA 2RJNA 2VUUA 5D5PA 1PT9A 3EGXB 5BR1A 1X7XB 4NHOA 4FX2A 4PG7A 4LV5B 1QRDA 2CL6X 3DJFA 3TBIA 2V54A 4EM0B 2WAQA 3OCCA 5AHOA 1GTSA 2RHMA 4DCTA 4MI9A 5LOVF 3PEUA 4HWTA 4N4NB 4FK8A 5EP3A 4YO7A 3KNZA 1DIHA 4WVFA 5BYKA 2ZR9A 5CJPA 2VPQA 2CO5A 4PZYA 4MS3B 4BACA 2F48A 4LJ8A 4BGIA 1KIFA 3H2BA 3C39A 3OUZA 1LVKA 1I3AA 4QOEA 1BIBA 2CGEA 4RDUA 2J3KA 2YNMA 1JIIA 4X6UA 1NVVR 1NRWA 4N0EA 1UDCA 3U17A 1DRWA 4C0HA 4EG1A 5IZCC 4RADA 2XYVA 4GYYA 4ARBA 3LBAA 4QGAA 1B0UA 4GOXA 3ZCRA 4MXDA 4LXTA 3M5CA 1T33A 1PWHA 1H0MA 2Z2XA 4GLFA 2BXZA 2HF9A 1KKLA 2KHMA 5I51A 1JT0A 4UE2A 5BURA 2FUKA 1FDOA 3K94A 3GCMA 3CEHA 4RYDA 2DPUA 5H83A 2O2CA 4K6FA 3I92A 1DBQA 2EX0A 5B7NA 1ZONA 4OXXA 1I39A 4BAGA 3GTMJ 1LPAB 1ZIPA 3HDGA 1S89A 3BMCB 1WXDA 1U0LA 2MC3A 3IXQA 3TLEA 4Z9FA 1DC4A 4NHJA 2QTCA 2XGJA 4DMGA 4HT3B 5DWDA 1BD3A 3ASUA 2PKXA 2ZAIA 3AF1A 1OYOA 3CC2I 3ABSB 3U9SA 2QD5A 1FX1A 1A72A 1WUIS 4CKEB 1HE5A 4P2GA 1DKLA 1QHGA 4FEAA 1JQ3A 5C53B 1S5PA 2JZNA 3E82A 3W6KB 3K1MA 3HM2A 2W5UA 2DA3A 5T6MA 4NZZA 1FYDA 5EG0B 4G81A 2E7ZA 2RG7A 3LYHA 3O9ZA 1U2PA 1E9SA 3C45A 3IOBA 2QTTA 4KFUA 4GZMA 4ABZA 3FJYA 4C3HJ 5U1PA 3ROMA 2MLKA 4IHAA 4KI7A 1JILA 2FDXA 4Q82A 2Q3MA 1CEEA 3NGMA 4EP1A 1U0TA 2AF3C 3K30A 2DR3A 4NF2A 1E6UA 1LK5A 5AVSA 2MOKA 3ANLA 2IH5A 3OE7D 4MITA 2HKXA 1U2QA 1P3JA 2DSNA 1OX5A 3MWEB 4Q24A 3DLIA 3AFOA 3EEIA 2VKEA 4Q1FA 1ZRFA 1ZPDA 2QN6A 4D7AA 1K7SN 3UF0A 1V26A 3S2FA 2I65A 1BX0A 1B8UA 3RV4A 1ZN2A 3TFOA 2BMDA 1BW9A 1SWWA 4HRXA 5LZ4A 3D31A 1YZHA 5DP1A 1O94C 2VT2A 3ZE1B 5B3LA 2IWHA 2X2EA 5E0KB 1BRTA 3U7HB 3EMDA 1MGTA 5KWSA 1CRZA 1LZLA 3L7CA 3EIUA 4IILA 4CCSA 2AXNA 3QEJA 2YS7A 2ZJ0A 1OAKA 2WAOA 4EI7A 4U4AA 4CLEA 1E5DA 4S2EA 1J42A 4RTMA 1BAPA 1C9KA 1ODCA 3A4MA 2JW5A 3P0RA 4AYBA 1WZEA 3BTVA 1U2ZA 4XIDA 3NBYC 4W5NA 3CRMA 5C37A 5CT5A 3NEJA 3O4IA 4ZV7A 2Z9BA 3O83A 3LMKA 2ZZKA 2VJJA 4GFDA 1Z75A 2AC2A 2Z43A 1K7EB 2JGRA 3ORFA 5LUBA 3SXYA 4KO3S 2HV8A 2YDXA 3MTJA 1T2AA 1U3VA 1I8TA 1I3OA 2H6BA 4M7RA 3IVRA 4OHWA 2FPXA 2AQIA 5TVGA 1SKUA 3CUQC 3QLTA 4YJ2A 3E2PA 4LECA 2G4LA 1SC7A 5IDVA 4RSMA 4U5QA 2D6FA 4UHDA 1G7RA 5EHZA 3G9QA 1N0UA 3HVIA 1Z7BA 5DN6A 4CA0A 2AR7A 5FRDA 4RAYA 3UWOA 1S2NA 3QPVA 1AJEA 5C8XA 4ETWA 4PX5A 4JLKA 1LDDA 2YZGA 3PFWO 4IL5A 3M8EA 3L7JA 2HJ9A 5J2TF 3IP1A 3L8GA 5ER6A 4AWAA 5ARBA 1ND6A 3F6SA 3DLTA 5MF6A 1K98A 4EABA 1VMIA 3MW8A 1G5IA 2L69A 2PUJA 3GWGA 3ZQHA 3DMRA 4C5CA 2P4HX 4EX6A 2Z5LA 3IQFA 5HSGA 4MX8A 5ALGA 5ESDA 1Y1VJ 4HADA 4II7A 1O94D 4HDRB 3T38A 3HLTA 3OOUA 3ST7A 3KZNA 1CUIA 5LQNA 3O1LA 3TMYA 4I7EA 1B76A 3ERCA 3U9TA 3WGOA 5DU2A 1KTVA 3P2IA 2AX3A 4J0KA 2DT6A 5AKJA 5B58T 3K70C 3BB4A 2LY1A 1MJ9A 2F4MB 4QXAA 3AETA 1N2GA 5D51S 3BR2A 4EY3A 1T3SA 3C2HA 2ZXIA 3BE6A 3BREA 3CF6R 3ZGVA 5K8JB 3FWYA 2ZW9A 2OEPA 4IMPA 2YV2A 3TL4X 5TQ2A 3K35A 2BW3B 1XCVA 3EZNA 1PBNA 2HKOA 4JLJA 4EM6A 4OQDA 3K8YA 5EUMA 1WKMA 3CLSC 4YHHB 4ZO7A 4ARZB 2HBZA 4RTOA 3H97A 1ISMA 4KV9A 2W6CX 4M0DA 5K6AC 2IIVA 4KGVA 5A9SB 3IEMA 3QVLA 1ZREA 4WK8F 3TNDA 2D0OB 2Y1WA 4RZSA 2CL7X 4YWJA 2XWJI 2AFRA 2QLLA 2VTVA 4RNCA 4HZUA 4RY9A 1UJBA 4ZC1A 3ZW7A 4G85A 1Y48E 3HCAA 1BDJA 1TF7A 4AAYA 2RH5A 4EFDA 4C7BA 1JEYA 3VZDA 2OTLI 4F6RA 4HRYA 3CO5A 4BE0A 4XD7D 1A4IA 4X8MA 1LFDB 4V0KA 1JR2A 1PR2A 1YBHA 4AX4A 2O19A 4OAYA 4EB6B 3K3PA 1GZ6A 2WSIA 1P72A 1ZGHA 2QAGA 3CCQI 2PZAA 5CFQA 1V16A 3BCHA 3K6RA 3I54A 2DMUA 3OZDA 2MFZA 4MPJA 4BO7A 2G4CA 4LBZA 4ZOLA 1H23A 3O26A 5CDSA 2UYQA 3WSVA 3ESZA 3TFQA 1VKJA 4AK9A 2PUTA 2CHEA 1YFZA 4UU1A 1SK9A 5CB0A 2RQPA 3WLOA 4Q1AA 5HRAA 1C8BA 3K70D 3VHXA 1G66A 4ND6A 5HODA 1YQXA 1ZARA 4X6LA 2CXNA 1KP3A 3C7AA 1N5JA 4C2BA 1VMEA 1YE5A 1XZHA 5DCMA 1V3FA 1G5HA 4TQ9A 2OCLA 2QL6A 2GOXB 3TINA 4S1WA 3SF8A 2NTJA 4MKRA 2CW8A 1PLKA 4WESB 4JUCA 3CLSD 2WF6A 1OW3B 5G0WA 4UASA 2XVXA 3GNQA 1DKUA 4XLAA 1ECPA 3W6JB 1UOQA 2W2TA 1C1YA 4RFVA 1YRLA 5BSTA 2QGNA 1YRBA 5E1ZB 4J6FA 1G5TA 1NVMB 2PMKA 4KVGA 2QGUA 1FXWA 4R3NA 5BN3B 1Z6XA 3X1YA 1NW9B 3I0ZA 3ADPA 4DIKA 3JZAA 1ZIXA 4PHGA 4PO8A 2B7CA 4CTKA 1BDIA 4M9UA 3SM9A 5DEIA 2XUBA 4NESA 4ZTJA 3BWEA 2J0UB 3HM5A 4UTOA 1JIJA 1KQPA 3M1EA 2P9ZA 2G06A 3MJEA 3KQPA 1RR7A 2WD8A 3VHRA 2EFJA 4UBMA 2BI7A 3TTVA 1ZM4A 3AO0B 1DT3A 1EXWA 1HSTA 4QTUB 1R0ZA 4RFSA 5CEFA 5CPRB 1LXCA 4XVCA 1MIOA 3L6CA 4UQOA 4BDYA 2AZXA 1BN5A 3C70A 2TMDA 4FHGA 1LBQA 1DC6A 2UV8A 2B2CA 4BFLA 1C9EA 1EFCA 2NU8B 1D7OA 3ETEA 3GDWA 1AURA 1AU7A 2HVRA 5K03A 4FGJA 3RKUA 3O4HA 1ZBDA 4BFSA 4Z1MD 2UVPB 3RO7A 1XZCA 2WDZA 1XEAA 4QYIB 1Q91A 3N87A 3R3ZA 3TIXB 1YB4A 5DVZA 3P9KA 1RWNA 4UTXA 2I2CA 3QU3A 2XBLA 2VXCA 1GPH1 3HR4A 3LBYA 1EFVB 3B3AA 2BVNA 4ILEA 1ZVQA 3X1KA 3L7OA 2OD7A 5JRJA 4JC0A 1TT7A 3RIMA 4G37A 1XCOA 3I5UA 2M7AA 2XF6A 3C0KA 4IOKA 2G9UA 3QOYA 3JTMA 3QP5A 2RC6A 3DZJA 3STHA 1W0KA 4PR0A 4KL8S 4YUAA 1A6IA 3WR5A 1FSFA 2GIVA 4Y0NA 5FL7D 1T9GR 2D06A 2GA8A 2JFHA 2FSHA 2VJDA 1HOMA 3UG6A 2J67A 5FI3A 4GE0A 1ZJ4A 2IGOA 1WMFA 5BYJA 3MT9A 2OCKA 1JR4A 4S12A 4KXWA 4K2EA 5HUJA 5HKLA 3II6X 1LUJB 3I6BA 2MSKA 1SXJB 4WWHA 5GPBA 1Q15A 1T26A 2W4MA 2F4NA 4O08A 2HGSA 1GTRA 2X58A 4N3BA 3GN2A 4DZPA 4L28A 4Q4CA 2JZOA 5FUMA 3M6AA 4Z7JA 3UMGA 2M0MA 3WIBA 4RY0A 4ZEVA 2Z4TA 1THTA 1CY0A 3FXRA 5LWQA 3MTIA 1OLSB 4Q1BA 3F78A 3CE9A 1HYBA 1J0CA 3TKYA 4ME6A 1KS2A 4FSHA 5IJZA 3PNLA 5FEMA 1YLFA 3C3KA 1GDDA 3LF1A 1GAJA 5EP4A 1XZDA 2FJ0A 3NAMA 3IJEB 2KDOA 3I6MA 4QG7A 3ZU2A 4P38A 5KSWB 1MFPA 3WQHA 4QXRA 2HM7A 4MWGA 3L3BA 4TYMA 2PE5A 2PUAA 4AD9A 1OH7A 4LF7B 1DIAA 1TRHA 3KM0A 3ZLJA 1AIPA 1MNQA 2WPNA 3QPBA 2EIHA 3U26A 1G8KA 5AOCA 4U87A 1QTRA 3NWOA 2QD1A 4YMIA 4RKYA 5DN9A 4C6TB 4ZZ2A 4GM1A 5D5UB 1T0PA 5FGMA 1US8B 3WYFA 3PL8A 4LZZA 4BVFA 2OZLA 5KNDD 2XGCA 2B98A 1YMQA 1Y0NA 3OJWA 4L6IA 3ETJA 1UCFA 1T8WA 4HEHA 4AECA 2ECFA 4FDVA 3S68A 4RPJA 4YCCA 1Q1NA 3LA8A 4IL6C 2IZZA 2W37A 4P86A 5B53A 2O2YA 2PO7A 4LFBB 4GP9A 1XMIA 2RHWA 2E4XA 2J32A 1BOFA 2VODA 4AKTA 2ONCA 5EEGA 1WJAA 1GCIA 1KEUA 2GDJA 3DLAA 4YJHB 4CEIA 3T1HB 4HWKA 5F3WB 3S14J 2EFEB 4WRRA 1Z0SA 1M1EB 1XN7A 1V5FA 2IOHA 3ZZ1A 2QZ9A 4HRIA 1U8CB 1BMFA 1Q21A 4WACA 3V9PA 2EFYA 2PSJA 3QLEA 3ONEA 3F49S 3Q0IA 2A9JA 1AM4D 2FPGB 2I4MA 4Y4RA 2C8JA 2ECBA 1H2ZA 1ZD9A 5IK2D 2WKQA 3HZRA 4M6YA 2XCLA 1XQYA 1X1PA 1M2KA 4DSNA 4CT4B 2GN9A 1DEKA 2IELA 2BFBB 1B8PA 1T56A 1JKRC 4L08A 2WJ4A 1YL6A 1P4RA 4OAQA 1EJBA 2RIRA 2VK4A 2F1RA 4U8HA 5SY4A 4L9VA 2IEIA 3CSDA 1NW5A 1Z38A 4TV7A 2KQUA 4ZVRA 3OIYA 3M4ZA 2DO7A 5GTIC 4R40A 3TRDA 4OPMA 3MKYB 2AFIA 4R7ZA 3KB6A 1G6Q1 1KRHA 4NX2A 1NC3A 4WFJA 4BX2A 3M5PA 4QYWA 5EFOA 2P9YA 2WE8A 2O07A 1BCRB 4LX8A 5C31A 3R3VA 3E5XA 3THWA 1MX3A 5GOZA 3A11A 1Y89A 1CFZA 3CN9A 1ZUD1 1C0IA 1F3LA 5B3KA 3T95A 2NVWA 2BZTA 4P92A 2QPOA 5K2MA 4IDFA 5EJEA 1ODLA 2KLHA 3AINA 1BE8A 2E4WA 4B6PA 1UMDB 3WC4A 4IGFA 3DCNA 4V0RA 1P31A 2R8RA 1UK7A 4CXFA 3VSLA 1K4SA 1JJ7A 3V46A 1NZDA 4TMVA 2XMBA 4HBLA 3OOEA 4YWHA 1QAMA 3MJTA 3O21A 2A5YB 3P4UA 2DQSA 4RANA 4TV9B 2AMYA 2Y8EA 3UKOA 3QK7A 5EKXA 1XJ0A 4X1EA 3KKPA 4JBIA 1HE1C 2R85A 1RJGA 2CLSA 2DQRA 3S29A 4BWVA 3I9V2 2X4HA 3QKSA 3H83A 1MOPA 3G1MA 2BKLA 1Q1QA 5D3MB 4FP9A 2HU9A 1IHYA 2HZ7A 3BBPA 1HWYA 1YI0A 4CF4A 2L0XA 5E2BA 5E4FA 4OA5A 4G0YA 3LU1A 1PDOA 1NF8A 3EIQA 4DT1A 1GNQA 3CESA 4XWOA 1J00A 3H0DA 3M6IA 4A0YA 2FW1A 1DTEA 1D4OA 1HDCA 3P71T 1P33A 1F0YA 5JJLA 2FEOA 3BTSA 3OZWA 2CCJA 3MHTA 3GVPA 3A2MA 5CCEA 4IEFB 3HXQA 4BE4A 3UKJA 3DZHA 3IFSA 4WOPA 1HC8A 3DP7A 2FUG1 3U1VA 3NDBB 3BIFA 2NYXA 4YQEA 1DLIA 1GGMA 1UZLA 1LU9A 3BICA 2VJ5A 3ENKA 4FT8A 4OOFA 4QBIA 1IUOA 5DD4A 4KFSA 1RBZA 4B8XA 1VHQA 2WDPA 1F1JA 3PC4A 2HCBA 4IRMA 1VYTA 5BVGB 3SSMA 1JDZA 4IUYA 1RRKA 2PG4A 3B5IA 4OQZA 2LSOA 4ZT4A 4R8MA 2VC0A 4V1CA 3H3XA 3DHEA 2VI5A 3N1UA 1VSBA 1VJTA 4GHWA 5B7GA 4K81B 3JQFC 2X23A 1VJCA 5CA1A 3H17A 1BCSA 3OT1B 1S8AA 4A0QA 2FMXA 2W6MA 1KY3A 4TTSA 1IHPA 4M1WA 2ATEA 5JZBA 2FE4A 3UV3A 4OXKA 1C9JA 1RQLA 3CCSI 1WDLA 1ACLA 2VTEA 3RASA 2C96A 1IUNA 1ZSYA 1EK5A 4M3BA 4FIZA 3SQMA 1C7QA 2GPSA 3B52X 3W8DA 3WYAA 3AI7A 1KO4A 4J1TA 1OCEA 5EKDA 5E20A 4Y6RA 3CHYA 4LDJA 3VR4H 3ZPLA 4OQNA 3PHCA 2FWAA 2O4CA 5D8LB 1EKXA 1JAYA 2YIMA 5AI0A 3MVEA 2OR3A 3WHLA 3LUAA 1MTOA 5CG2A 2G1KA 2E55A 1EVEA 1FQKA 2X85A 2HREA 4W9RA 2UXNA 3VV2A 1D8TA 2KT0A 2IU4A 4KPGA 1PJ8A 2H4XA 1T3TA 5J40A 2FWJA 4IJKA 5JSHA 4DCJA 3JRDA 4IFEA 4IKFA 1XPRA 2F3PA 1GGFA 1PG5A 3C3EA 2NVYJ 3I64A 2DEUA 4DWWA 1M1UA 3ZXUB 2YPRA 3CVJA 3RUDA 4IUDS 2LR0A 4YFKF 1J99A 3A9VA 1S7OA 2O50A 4D4MA 3QBEA 4U3JA 5F2KA 3RW9A 3J81k 1GQ2A 1FYFA 3LSGA 2I6GA 1XMAA 2XQKA 1UBKS 2KMLA 2IY7A 3GH3A 1VI5A 3U2QA 1TL8A 2D1HA 2BY4A 1RLOA 5JCJD 1XNJA 4E7JA 1UJMA 3NZEA 3EIXA 4XYLA 4J0FA 2WHRA 1SKQA 5LQJA 5EI5A 1L7XA 3UMVA 4ZTFA 4RLFA 3E3MA 1ZJYA 3DBRA 1JKOC 2WNIA 2N75A 5JPDA 4E2WA 2J3MA 1VP9A 3A0RB 3MOIA 1UAAA 2AWOA 3KQHA 4RTRA 3LZDA 4WOCA 4O29A 1LVUA 3U4IA 3TMKA 4BNTA 3BJOA 3NQ41 5DX1A 3AXTA 1ORTA 2EZ9A 4X24A 3EULA 4YP9A 4BECA 1P1KA 3ANXA 3M82A 1DAGA 5DHSA 2JK1A 1BXGB 5KAMA 2DBQA 2X0JA 4RH1A 2VDWB 2HFJA 4FT2A 3N2NA 1TGYA 6ADHA 3F6EX 4KNVA 3K9TA 1DQPA 5L53A 5BUSA 1R66A 5A9RA 2ECCA 3UJ9A 1N7HA 3AEUA 3MUFA 2J7KA 3NPMA 1GPNA 3D7MA 1I4LD 1XALA 1DQRA 1ACIA 3FA2A 3FCEA 2O3SA 2X0FA 4NCXA 5J2UB 3N2YA 4E33A 3LL7A 2XGSA 3PVCA 5ER9A 2PR7A 3R5SA 3JZFA 2ARKA 3KE9A 3R0JA 1Z08A 4G0VA 4HF1A 4RELA 1K6OA 3QRWA 1K0FA 3THSA 4X1YA 2JJ2D 1FEZA 3KZIC 2Q1YA 4RB2C 3BRWA 1HETA 2X1LA 1TM5E 2O8NA 2V1UA 4RF2A 1PS0A 1MT3A 2C20A 3U3JA 4ZODA 3VU9A 4PY2A 1CQTA 4HV4A 4IDGA 1ES9A 1WOYA 3K0HA 3MJ4A 2QQEA 2QTZA 4CZ2A 2COBA 2GFQA 2VP9A 4PC7A 4XFDA 3WK5A 4ROSA 1PL0A 5AR1A 1PG2A 3CN7A 2GJKA 2XNDD 4TL7A 3L4EA 1PGJA 2K5UA 2R6AA 5AVXA 3IHKA 4KYTA 4B8YA 1YRYE 4OGFA 5DKFA 1BX1A 2VT7A 3J7ZI 1NVAA 3D0QA 2AVNA 3N70A 2WF7A 1BX3A 4CHUA 1XJQA 4E1AA 4G6QA 2QTLA 3ETGA 1OAOA 2B6NA 3DL2A 4Y1RA 3RSFA 1TQ4A 3ODPA 2OO3A 5JXGA 4OQLA 3DTVB 1W48A 5DYMA 3BOSA 2FD5A 2GBIA 2L7MP 1JH9A 3JQCA 3FBIB 1GUAA 3H2ZA 4ZQGA 4ETSA 5AVJA 1FNSA 4Y2SA 3A58B 2M9MA 3PQFA 7ADHA 3I5YA 2DFEA 2FWIA 3HB1A 4X1IB 3VNVA 2CLEB 3DOOA 1TM3E 3W4IA 2JBHA 3ZQUA 2J59A 4YJ3F 3KCNA 3R0ZA 3EDYA 5HOEA 4N82A 2R84A 5EFZA 3OZSA 3WHIA 3TBFA 4NB5A 1WXXA 3PD7A 5E79C 1OR8A 2HX1A 1ORKA 2JZYA 4IOCF 2A3SA 5IABA 5JYBA 1Q3HA 2ZDHA 5LDDC 4U8GA 2XZTA 4C0JA 3LYLA 2IW3A 5BNTA 5CB4B 3NYQA 2OOKA 3LQ1A 4MIOA 3IELA 2VS1A 4BNYA 1HG1A 4DV1B 1FFWA 5F64A 2H2HA 2OCCH 4D42A 4YEDA 3P26A 2ZMEB 2R8PA 5DGIA 1NP7A 2HXOA 1SKYE 2Z2YA 2QN8A 3L9WA 3V1TC 3GCGA 3PHJA 4ZYZA 3SOZA 2Q49A 3H9QA 2W4SA 3K6GA 4W7IA 3KCCA 2JVHA 4Z7NB 3Q12A 2L0KA 1LA2A 1T39A 3P9CA 3SEQA 4O2AB 3KP6A 5LBTA 4LXYA 4MKXA 1O0SA 1OJ7A 3RSSA 3ZDEA 2WNHA 3ZTYA 1YZVA 2ECPA 3OURA 4MGEA 2C7GA 4RZXA 1KO1A 4U6SA 2QSGX 4RJKA 4HPQA 4ZP1A 2HPHA 4I1IA 3G13A 3UHPA 4Y52J 4L3OA 3ZDBA 1Q7BA 2KLOA 2YW9A 3RGWS 1IF1A 5FBLB 3BEOA 3GFQA 3C1OA 4J75A 1QH8B 3D2BA 2WTXA 1XYGA 3JRNA 3IP8A 1PFYA 4BLOA 3KYIB 2O8BB 4A10A 1GGJA 4BXXJ 3D4OA 1NDUA 2B0CA 4G1VA 2X6QA 4MEAA 3DHYA 3O8QA 4ZT7A 1CZKA 3K4QA 1MD0A 1C3JA 1WJDA 1ST3A 4MLCA 1C7IA 4B5KA 2PWYA 5GVRA 3A36A 1HR0B 4UNNA 1YR7A 4H59A 3RUFA 2E1MC 5NULA 3USES 2OHOA 1N6NA 5BW8A 2JSPA 3EF3A 2C2MA 4AZSA 2FRHA 3QW2A 4LYHA 5BS6A 3RNOA 3IVAA 4XCXA 2QUAA 4PM4A 2VOEA 3HU5A 2VIXA 1UJNA 2VJOA 2FSFA 1Q14A 2VKTA 1T8RA 5ENZA 3LCVB 1WETA 4ML3A 3FZQA 2B8JA 1QOQB 2Q6VA 4H0CA 4RU1A 4R1MA 4EJ0A 4Y2XA 4AP6A 1A9SA 5F78<