4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
4ETNA 4IVNA 3HZHA 1G3TA 1GCGA 1D5VA 5JVTA 4WXMA 4I02A 2JSCA 1KU3A 2VBXA 4Y15A 3TO9A 3K9TA 1O3SA 1YW9A 3RVKA 2YPRA 4RS8A 3EETA 5BRJA 1BN5A 1ZREA 1W4MA 3HUUA 5DD4A 1AB5A 2IT0A 3VEPA 3T1BA 4N0PA 4P96A 2FMFA 4LLNA 2BE5F 2A68F 2CW0F 3ZMTA 3KE2A 3M8FA 1PDNC 1ONVA 3P9IA 2I6FA 3NNNA 3O74A 6ABPA 3ILYA 3LA7A 4MR7A 4RAYA 3JS5A 5TJJA 2WJWA 1MKMA 1D1QA 1QGPA 1KA8A 5FD5A 1Z15A 2VE8A 2V0NA 1R22A 4FT8A 4MRMA 2RNJA 1DPRA 2EFQA 5D5UB 1UCRA 3SAJA 3HSEA 1DP7P 2FBHA 1ZN2A 2ZBKA 2FE3A 2W24A 3DKWA 1ZLKA 4G0MA 1FYKA 1TW2A 3LFKA 4KZKA 5DUIA 3GBPA 3HUGA 4ENNA 3F6PA 1BBYA 4ESBA 1F4VA 5PNTA 4M71A 4F3TA 6CHYA 5AONA 2E7XA 5IX8A 4JASB 5ERIA 2WY2D 5CNKA 2FQ3A 1T98A 1A2OA 2AYXA 1ON1A 1R5HA 4EVIA 3JPYA 2OA4A 4ZYHA 4I0AA 3WODF 1BIBA 3JTEA 2TMYA 4EQQA 2GXGA 1ZAYA 1XMAA 3E61A 4HNQA 5LHIA 4BNCA 4N0BA 1EH7A 3GO5A 4YFXF 2O6GE 3D02A 3LUHA 2DW4A 1MDMA 1R00A 2GX6A 3N8IA 1R23A 1Z1DA 5TPWB 1T6SA 4EV0A 2FN8A 1M5TA 1PEAA 1H9CA 1BIAA 4ZPJA 1MGTA 1YW8A 2HTSA 3HM9A 3O3KA 3DP7A 3HSFA 3D8UA 1P6RA 5D5WB 3SXYA 1BDJA 3I4PA 1TQIA 4GO1A 2FN9A 3CJNA 1FYMA 1MB0A 4QICA 3Q41A 3RPUA 3FX3A 4FX0A 4EGSA 5FFZA 3RVLA 3V8JA 2L4AA 2LF8A 1VTNC 1BI2A 5KQPA 3MF4A 1AOYA 4RSMA 2RGYA 1TVMA 2NT3A 1DZ3A 4D74A 1J0RA 1P2FA 5ABPA 3IPAA 2CQKA 2F5DA 4EVQA 1R1TA 3LUDA 2G9WA 3DPTA 2W57A 4P1ZA 3HUTA 3ZMVA 2XRNA 1YMVA 2LDUA 3CKMA 4EGYA 3CUQA 3E5UA 3SFZA 3RVJA 4D0PA 4KV7A 1GLGA 2B0LA 3KG2A 1Z26A 4G6QA 2MYPA 3H3UA 1S7AA 3F3XA 4OMYA 1RUOA 3I45A 2E4UA 3HCWA 3K2ZA 3KYJB 4LK0F 5FO5A 2O03A 1ZG5A 5CVRA 2IVMA 4L18B 2HZTA 1PEYA 3KP6A 1YO5C 1D8JA 3H3ZA 5K5OA 2HFHA 5LHHA 3FFWA 4ENKA 3LAPA 3LMKA 1TQMA 3E6BA 3HSYA 3HDGA 3GFJA 3O1IC 4BAYA 5BQTA 4YFKF 3IWFA 3ZMSA 2M1BA 5D4RA 4G7ZF 2ISZA 3CU5A 3RVSA 1MVOA 3I59B 1OYYA 3DLBA 5DDGA 3OQMA 2HSGA 3I59A 2EFWA 2NRAC 3IPCA 5ED4A 1YK0A 5IEBA 2IPAB 4MS1B 4WWHA 4UHJA 2QVCA 4O6JA 2X0LA 1HW5A 1D8KA 1JHZA 2RDMA 2OQGA 4QPJC 1FP1D 4FX4A 4RY8A 5ICEA 3JVDA 2O61A 4MGRA 1QMPA 3EUHA 1O7LA 3TOBA 4HF0A 1K68A 3OM0A 3TX6A 2FEPA 3F8CA 3N53A 1B9NA 3WTZA 4HQEA 4LE2A 1BOAA 3T8RA 1B1BA 1YVUA 3B2NA 3RKYA 4KUMA 1H0MA 4MR9A 3RVQA 2H3HA 2XDYA 4EM1A 2IA1A 1E6MA 2VT2A 5IBQA 2PKXA 2O20A 4A0YA 1RZRA 4DNCA 2VC1A 5BPDA 7ABPA 3JVIA 4MS3A 2DRIA 1ZESA 5ICGA 5EWMB 2QZ8A 2NS0A 1H9GA 1IIBA 1W9HA 1NXXA 3LOPA 2DPUA 5DCLA 4S05A 2QBYB 2ZJ2A 3GV0A 4HX4A 5L3GA 4G7OF 1LJUA 1TNTA 2QQAA 3IP9A 3E3VA 2QENA 4AIJA 4OINF 4MQVA 4UVBA 4HX8A 1FBQA 1LNWA 3URMA 4G0YA 2AYZA 4YGXB 1ZDMA 1IN4A 5HM6A 4U88A 2VBYA 3GFLA 3KHTA 5JI6A 2ZNZA 4IILA 3KSMA 4LMYA 2EB7A 4KQ9A 2D2WA 1IRGA 2XAQA 1O3RA 1Z6TA 2HTJA 2LF7A 5JR3A 2JB9A 4Q4ZF 2AS5F 5EWJA 3TO6A 3HDVA 1KMIY 3A0UA 5DV5A 2EV0A 1O3TA 1ZRFA 4OATA 1WSUA 2NYXA 5EWLA 1KRXA 1STZA 5E18F 5IEJA 5EWLB 1B9MA 5LLQA 3TD9A 3JAMK 3BILA 4NQRA 3QPTA 1P4XA 2YX7A 1YS6A 4W5RA 2XV4S 2KJCA 3R4KA 2ELHA 4XXHA 1Z16A 4M73A 3U2RA 5A2QK 3P9KA 3BJ6A 3EODA 1QQBA 1FYLA 5DGCA 2QR3A 1XCVA 1O57A 2PUCA 2M87A 2HQNA 5D4SA 3OLXA 3Q9VA 4UHKA 2TDXA 5TQ2A 4E7PA 5TQ2B 2PUDA 1TBXA 3SZTA 3WGIA 2H0AA 1SFXA 1K7AA 1WRJA 1DCKA 1U5TB 3C7JA 4QWQA 3CLOA 1T2KA 3BBLA 3WG9A 1TQPA 4CICA 2XASA 4KMFA 1SD7A 3ROUA 4G0QA 1JDNA 2HPHA 4RXMA 4ENMA 4L9TA 3I54A 4MAAA 3RQIA 4IMIB 1ISRA 3RPQA 5L3EA 1APBA 4KIFA 2Q0OA 2R47A 3GVAA 3G73A 5JNRA 4N9IA 4H60A 3J81K 5D6EA 1IN5A 3W6KB 3VNBA 2FBKA 3L09A 4UV8A 1XHEA 1J9IA 2DQRA 3T6KA 1Z05A 1Z17A 3WTYC 4IRHA 4L4UA 4P5OA 2PMHA 5JNVA 4NB5A 4G0PA 1B59A 1HW1A 2WWYA 5E1XA 3K0LA 2CFXA 3FDFA 2XAGA 1JFTA 1DBWA 3KFWX 4MLCA 5IT9K 1SFUA 4BXUA 3OMWA 1DCMA 5HDNA 4IXAA 1TLHB 2J5PA 4MHGA 2GAUA 4XLPF 1M5UA 2HOEA 2VBWA 4FHTA 2VOPA 5D8KB 3WTXC 5BMZA 1FFSA 2QVOA 5HLGA 4W5NA 3LA3A 1Z7UA 4U7DA 3LUJA 1B6AA 4Y9TA 4OTZA 3K4HA 4WT7A 1JYEA 4YFNF 2E1NA 3GW2A 3RI4A 1P92A 4XSXF 1WETA 4RK5A 3QP5A 2CHFA 2M98A 1JHHA 2XAJA 3H1FA 2QBYA 2BGGA 4G97A 4ZMSA 1K66A 1XSXA 3ML6A 3RKXA 4LE0A 2FA5A 4FE4A 1YMUA 4HX7A 5KI6A 4EYKA 1U8TA 2L01A 5TQ0B 3CUOA 1FLIA 3I5UA 4YIFA 2MA3A 5BPIA 2ADUA 4S04A 1YTYA 5JNSA 4I09A 3H5VA 3QEMB 5HDGA 4ZYLA 2WMYA 2A5YB 2XIGA 3GBVA 3ZQ7A 4Q5SF 3ZP5A 1FSPA 3B02A 2GBPA 1T39A 1YIOA 5DEQA 5BOXA 2MH2A 1Y0UA 3GX4X 1HKTA 3GZ5A 1ZRCA 1C0EA 3EQ2A 5JS2A 3M8EA 4O5AA 1BAPA 1V3FA 4EYQA 1NXOA 3HEBA 3S2WA 2WTEA 1GUBA 3TQNA 3BRQA 1UFMA 4RB0A 4TMYA 4L5IA 3FMSA 3H6GA 2FEZA 1Z12A 3L6UA 1FFGA 3Q7RA 4GCVA 1D2AA 5H6QA 3IDOA 3Q7TA 3HHGA 5DKFA 3OLZA 2QU7A 1HXDA 4LZLA 3RVNA 2OBPA 1BVHA 3KS9A 4A0ZA 2VYCA 2IW5A 4IPAA 4CXFA 3BP8A 2P5LC 3N75A 1TM2A 2IYNA 4IJAA 2KYRA 2XAHA 3ZMZA 3MZYA 4HNRA 1CGPA 5LGUA 3GWZA 2GKGA 3CHYA 5KQMA 4L9JA 2JPBA 1Z91A 5E3JA 2QV0A 4HBLA 3F8BA 4EVSA 3TDUC 5LEJA 2UWMA 3IP7A 3TB6A 1XD7A 2OU2A 3V4GA 4YG2F 1EH6A 3C97A 1M2FA 3NHZA 4HLXA 2G7HA 1D1PA 3FF5A 1ZG1A 4PICA 4RXUA 1JLKA 4IRXA 3CUQB 5T7BA 1HKSA 3L00A 3IHUA 1QP0A 5DYMA 3KCNA 4GYIA 2HR3A 3HVRA 5L3BA 1Z13A 4LD5A 3WTWC 2NZUG 4GYGA 3ECHA 3RVRA 3JPWA 2B4AA 2HS5A 2EV5A 2QQBA 3EQLF 3QOPA 2HQRA 2DLLA 3MFKA 3CZ5A 3FMQA 5J8CA 2UXNA 2HEOA 2FRHA 1ZH4A 2PG4A 4DQ2A 1QO0D 1SAXA 2G7UA 3LA2A 3HTUA 1JH9A 4L9VA 2WB4A 4TV7A 4M6XA 2IPMA 2FMLA 4XRFA 1LJLA 4KVFA 3C3MA 1ZLJA 1HW2A 3TDZC 2QVGA 1F1ZA 3L9FA 5HS8A 2V79A 5JS1A 4Z0NA 1OYWA 1W5TA 1DBQA 4RY9A 5JNWA 4JBAA 4A6EA 2P6TA 4Y13A 4LJZF 3H5WA 1JYFA 1J56A 3KKEA 2ZXJA 2M1ZA 2RGVA 4EJOA 1J7KA 2LKPA 1A0OA 1ZGGA 2VBZA 2IP2A 2OAZA 2RV8A 2QUFA 4WXHA 5LRSA 4G7HF 3AAFA 4I01A 4HDUA 4ESJA 3DLHA 3SQNA 2FXIA 3OLVA 3G3ZA 1EWTA 1GUDA 1R58A 1IAWA 1Z25A 2F5EA 1QQIA 3RH0A 3FM3A 3K69A 1FT9A 3OQOA 3I58A 1IUYA 2P7VB 4KREA 1OKRA 4ML3A 1ZITA 2GWRA 2PJUA 4Z9BA 3MAJA 3O6BB 1X3UA 3MWMA 4A6DA 3EYYA 1LVAA 3HIFA 2WJAA 4EMSA 3LUCA 3SY8A 1FBUA 4PZ0A 3QLTA 1KQ9A 2E7WA 2EA4A 4KMUX 4LLGF 4EJTA 4LE1A 3O2JA 1DPUA 2P5KA 2BV6A 1D4ZA 2DQLA 4QLCU 1K78A 2QXYA 1EHCA 2EFPA 4M9XA 1LEBA 5ICFA 4F11A 1R7JA 2L2QA 5DLEA 3VODA 4CO8A 1RZRD 2MSWA 1IF1A 4ETSA 2ZO4A 3EGCA 3HK2A 5A2QZ 2RDPA 2JK1A 5CNIA 3FM5A 2K86A 2FSWA 3NNSA 3U9GA 1HSJA 1XDUA 4RB3C 2C6YA 5K1YA 4JP1A 1QO0A 4JB0A 2RKHA 4KNYA 3E3MA 4HDVA 2STWA 1YYVA 3I0TA 2O0YA 2Y0MA 2FU4A 4MRMB 4LRQA 3M7GA 5FWXA 3DGEC 1BI0A 5FWXB 1W7PD 5EWMA 4MQ9F 1I6XA 4EGZA 4CGZA 1PNTA 3BWGA 2QW1A 5TPZD 5L3DA 3MQ4A 2ESNA 3E6MA 1I27A 1PUEE 5FBHA 4Z4IA 2A6HF 3OLWA 4AIHA 4A12A 4PEVA 5AIPA 4WF2A 3GFMA 5BRAA 3MCZA 1U78A 1G3YA 4CBVA 4EYGA 4PGHA 4MQFB 4YV7A 4EM0B 3ABUA 3LUAA 1Z6RA 1DRJA 2X4HA 4MQEB 4WK8F 3I09A 2P9HA 3CFYA 3REOA 3BREA 3RTRA 1IXCA 2H09A 1A04A 1ZGZA 4Z4GA 1C4WA 4MLDA 1FP2A 5TRDA 2W84A 1TTYA 4N0QA 5TQ0A 4NQWA 4RAZA 2EFNA 5IULC 2F8TA 2JCGA 2L17A 1XGOA 2ACJA 2B1JA 2BGCA 1S29A 4P9UA 1JDPA 1IN7A 4E70A 5LHGA 4N03A 1ZG3A 2PUBA 2L19A 5LGNA 1JFVA 1U8RA 1AWCA 2FEKA 2MYTA 5IT9Z 3MZHA 2NUBA 2LSOA 1QZZA 4WUTA 1XN7A 3GA5A 3HOTA 2PL1A 2DTRA 2VC0A 2EV6A 2E1CA 4JOQA 1MJBA 1KRWA 1NATA 3QRFF 4H3KB 1TNSA 3QELB 2FMYA 2KJBA 3HXMA 3I71A 3LTEA 3T38A 5JNUA 4NCBA 4EJUA 4MYRA 2NZVG 1XDSA 4L0YB 4QYMA 4KIBA 4Q7EA 3KCCA 3J81Z 3ROFA 2FOKA 1SXHA 1MZBA 4F06A 2IPQX 1W25A 1I1GA 3Q15C 2K4BA 4ZH4F 4PZJA 1QP4A 4N9HA 4YP9A 1XHFA 4MS4B 3EAFA 5HS9A 1S7OA 4JAVC 2ESHA 3FFXA 3MA0A 3CO6C 1LB2A 1IW7F 3GRCA 4LDZA 4OOIA 5IUNC 4AD9A 4QYWA 1L5YA 4B09A 1OYIA 2JVKA 4KYWA 2YHBA 5K5QA 5BR1A 3QPHA 1JFSA 4Z4CA 1AB6A 4RXTA 4CDGA 3M9XA 5HVQC 3OO1A 4IHTA 3QLVC 1FSEA 4O5VA 4BHPA 2WV0A 2H6CA 1USGA 1SMTA 1EWVA 1T38A 3IRQA 1DRKA 2DO7A 5BS6A 3LAJA 3KEOA 1S3JA 3F23A 1USTA 4EVRA 2EK5A 4EM2A 2V9VA 3ABTA 4YIIA 4I2OA 1OPCA 2BYVE 3F72A 3N6VA 3BROA 4RWEA 3IKVA 1DUXC 2MBFA 1JHFA 2A61A 2PUFA 1DBPA 3A0RB 4G8XA 3KEQA 1PHRA 1ISSA 4UHTA 1QKKA 2K27A 4R79A 5E17F 3EDCA 1U3EM 1ZARA 3FXQA 4D6YA 4HZFA 1SD4A 2VT3A 1TW3A 2L54A 2J5OA 3DXJF 1K6OA 3BPXA 3QELA 1GVJA 3Q9SA 2GA2A 5FWYB 3ROTA 1JL3A 4G6DA 3K1MA 2YU3A 1T0FA 5CLSA 3NHMA 1GXPA 1GCAA 1JE8A 1P6QA 2Z99A 1XCBA 3NQOA 3N0RA 1LDJA 1FWZA 3CRNA 2CGPA 1SFEA 2ISYA 1ZH5A 4MS3B 1MJAA 1PP8F 1W5SA 1K78B 5DCMA 4PDKA 5DCFA 2VUHB 5IUKC 1XMKA 4RGSA 2Q5CA 1NXVA 3L49A 4NHJA 3DFGA 4XSZF 4U7BA 2A69F 3DBIA 1ZHHA 1LEAA 1M2EA 2D1HA 3N0XA 2FXAA 4LLLA 5E8IA 5HLIA 1T34A 3FWEA 1XB4A 2O8XA 2F5CA 4Y17A 1ZGAA 3CG4A 1H9TA 4MTEA 1UHWA 1RXIA 2A9QA 4H3HB 4IRGA 2XHKA 5L3FA 2FW0A 3RYRA 8ABPA 2NT4A 1E2BA 1L3LA 2P8TA 4Z4FA 4LX8A 1QNLA 4RGXA 3KLNA 3RKWA 1B00A 3GFIA 3B73A 2FMKA 2CYYA 1Z9CA 4HNSA 2R4QA 3IP6A 3WGGA 1RPJA 4WWCA 2Z5UA 3FXUA 1LK0A 5CHYA 2L3DA 1MDMB 2P4UA 2N9UA 3ZN0A 2H94A 2PUEA 4ASNA 3OV8A 5E20A 1LBIA 3D5LA 2STTA 1YLFA 4MGEA 3HJFA 3K9CA 1U6GA 2Q2EA 3CDHA 3TO5A 4KRFA 2IPNA 1ZAOA 4F7ZA 4GNRA 1FPQA 2JVJA 4RDCA 1LDDA 2RVCA 1O7FA 3E6DA 3QU6A 2GQQA 1MJ9A 3IWZA 3QX8A 3CLKA 2EJRA 3BOQA 3ZMDA 3J7AO 5FD6A 4YO7A 4P55A 3QLUA 4MR8B 3ECOA 3KLOA 2FBIA 3F8NA 1P4AA 1R1VA 4W5TA 3DEUA 2HQBA 3T0YA 4Z4HA 4G94A 2HKXA 4WZZA 1KU9A 1WQ2A 3WE2A 3LUFA 1DP4A 4KN7X 4EJVA 4CYDA 1FZPB 4U0YA 2CO5A 4HW0A 3NRVA 3QU3A 4E7OA 2EWNA 1JWLA 1IXSB 2DU9A 4UXNA 3E5QA 4IRIA 1ZYRF 4JA2A 3JW4A 1HBXG 2LUOA 3R6SA 3V7CA 4UVCA 4R1HA 3RDIA 4MR7B 4HV6A 3UKJA 2W42A 4KFCA 4HQMA 1XSVA 3WTTC 4GPAA 3IP5A 3BZ6A 4UVAA 4IF4A 3KP7A 4U0VA 4N76A 5LEKA 2F8SA 5ICCA 5CVVA 1V4RA 5D2CA 1L0OC 5EEHA 2YX4A 1LQ1A 1CEYA 1RXEA 1XWWA 3FXRA 1YFHA 3DGFC 3GXOA 3CNBA 2ID7A 5KK1A 5DTEA 3QAHA 3OM1A 1OMIA 3P9YA 1W7PA 3CO7C 1R8JA 4RKRA 4NICA 5HDKA 2A9OA 3OLYA 4EY3A 5B3JA 3J80K 3Q7SA 1XGNA 4MNUA 2VE9A 4RS3A 3H6HA 2FSPA 5TE9A 3S99A 1JXSA 1U5TA 4YCSA 3JTHA 3FHZA 5ILVA 4JB2A 1VPWA 4MR9B 1RUNA 2OZ6A 5AIQA 5DCMB 4KQCA 2JPCA 1J59A 2VXZA 2D45A 2M30A 1KYZA 4PGGA 1YTUA 3K1PA 4XLTA 2L4MA 4KT5C 5D6FA 4H0EA 3O1HB 2MC3A 3IRRA 4WXDA 2F5FA 1CHNA 3H1GA 3MIZA 5B3JC 3P9CA 2LBPA 2GZWA 4MQEA 2WRZA 1YW7A 2CHEA 1DG9A 4RY0A 3SM9A 3JTGA 3LWFA 2KKOA 4OIRF 5KWSA 3GUDA 3QP6A 2FQYA 4LB5A 3R60A 5TPWA 1G4DA 5HKOA 2BBYA 3WU1B 1IN6A 2PMUA 4I0BA 4ESFA 1KU7A 5ILSA 4LG0A 4UNOA 2PUGA 4OMZA 4R8HA 2FF4A 2HYFA 1YG2A 1EAYA 3CTAA 3TO7A 2FQXA 3HV2A 2DBBA 2PI0A 4ZYEA 1OXBB 3JSOA 2E4VA 2XVCA 1FC3A 1FSHA 3CZCA 3MMNA 1DDNA 4RK6A 2F2EA 2M8EA 4P98A 5K5RA 2PUAA 5KQGA 1NTRA 2ZAYA 3COAC 5J6XA 3V7SA 3KZZA 2Q8KA 2P5VA 2NNNA 4CHUA 3C1DA 4BHBA 2CWDA 3F8MA 1TLFA 2R25B 3RIRA 4K2EA 4OIPF 3KJXA 2HGCA 3NNDA 3BJAA 3F22A 1G3WA 4P9FA 1QPMA 2RN7A 2A6EF 2QYOA 2LPMA 2DFIA 1E6KA 3CUQC 3GT7A 4PE5B 1L5ZA 3TOAA 2HKOA 1MAVA 5GQSA 1LJ9A 5LBQA 2FMIA 2IKSA 4RB1A 3E6CC 1PNRA 1XSDA 2LIVA 2IPLA 1EH8A 1QPZA 1KYWA 2FLKA 3P7NA 4XFKA 1R5GA 4RK0A 1LBHA 4CZZA 2R3SA 3JAMZ 4IGAA 3PQJA 4MEYF 1LDKB 2JRLA 1B4AA 4L0ZB 4HV5A 2E4WA 2V1XA 4Q6WA 3HTSB 2M5WA 5E1WA 2DK5A 4HAMA 2MLKA 3EDPA 1IRFA 4OBBA 4Z9AA 3QEMA 2RQPA 2JVIA 4TLLB 1S8NA 2OENG 1J5YA 1CF7A 5TQJA 2CG4A 3WGHA 4NCAA 1DC7A 2FKAA 5IC5A 5DUKA 3N97A 3HSRA 4HF1A 1UB9A 2QLZA 3FMVA 1HEYA 3VNAA 3C3WA 1Z2EA 2E4YA 3C6QA 4ENJA 4PYRA 4TLMB 1MB3A 3KTOA 3E97A 3RYPA 4ETMA 3MM4A 5C5EA 4M88A 2QSJA 1BI3A 4KMRA 4AVPA 4DADA 5D5XB 2DI3A 2V1DA 1P8AA 3CS3A 1NHAA 3ELKA 4M9ZA 3RVOA 3O2PE 3KETA 4GGGA 1U2PA 2MD5A 1Y1LA 3RVPA 1EV7A 2HWVA 2CSOA 3H1EA 3FMRA 3LSTA 1SXIA 3GEZA 1QBJA 4YLEA 2FVYA 3GWGA 2A3SA 4LK1F 3N4MA 3H92A 1R36A 2MYNA 2P7CB 2LNBA 2R48A 1SRRA 2R7DA 4HOBA 2LP4Y 3DZDA 3V8KA 5FLXK 3UUGA 2YSRA 2DT5A 3SG0A 4KIGA 3D0SA 2KIMA 5HS7A 4A0XA 4F12A 5FB2A 3EQZA 3LFTA 3WTVC 3NBMA 4TN5A 3ZPLA 2MYUA 4MS1A 1YQAA 5F6FA 3JSPA 3LQRA 1U2WA 1FNNA 1E17A 2FMHA 3OMXA 4F8JA 1HQCA 3M1EA 4WXCA 1BC8C 4EJWA 4OIQF 4EUKA 4KICA 3O1JC 4KDPA 1RI7A 3CTPA 3FGZA 1W7PB 3GLXA 3H5IA 2P6SA 2MSKA 3F8FA 5HSGA 3KP2A 3R0JA 2GA1A 3R0AA 5CVJA 3GYBA 4U0WA 3GL9A 4RGRA 5FWYA 4MEXF 5CYVA 2K7LA 1ZGJA 4LDAA 3MQ0A 3O75A 1ODDA 5GOTA 4IHSA 2UXXA 4Q6BA 5L3CA 4LG0B 3JY6A 3L7WA 5HOOA 1BDHA 1EWKA 4ZZLA 5LGTA 3O21A 3C3KA 1NXSA 3T8TA 4N47A 4M74A 2HQOA 2PL9A 1ZVVA 2JT1A 4IMJB 3TGNA 4DN6A 1DJMA 2JZYA 3H75A 3LKVA 1PUXA 5CJ9A 2PLYA 4XARA 2PQ8A 2UZKA 2K4JA 3QLVA 3DV8A 2FNPA 2PN6A 3WU0A 2PE5A 4D6XA 3UK0A 3HYIA 4ZYDA 2D1VA 3T8YA 1TJYA 1KGSA 3BPVA 4FB4A 4G9YA 2DK8A 1USSA 3HOSA 1QZYA 2P4WA 5E1ZB 3WE3A 4BYYA 1JGSA 5D5VB 1I5ZA 1SD5A 2XAFA 3HRUA 2RJOA 1FBSA 3MEXA 3SHFA 3V7RA 2YR2A 2HDCA 4AWXB 1FX7A 4RB2C 3W9SA 4L9NA 1GHCA 2KIFA 1FY7A 4PCQA 3OQNA 3LQQA 2VN2A 1XGSA 3F21A 2RJNA 3IKTA 2ZCWA 4RV5A 3EYIA 2GI4A 3QLUC 2ZNYA 1QQAA 4OIOF 2GXBA 3HRMA 1CYEA 3VOEA 2DPDA 1QNTA 5ILUA 2COMA 3K1NA 2ZWMA 3V8LA 5KC9A 1UHMA 2PJPA 4JK1X 5IUJC 1SD6A 1F4KA 3DQVC 2IJLA 3NEUA 1BC7C 5KC8A 1O3QA 4OG2A 2OQRA 3GF2A 3I42A 1JF8A 1USIA 3O2QB 1VLZA 2FLWA 1U5TC 4KK4A 5HQJA 1TMYA 3TKYA 1BI1A 5F1RA 2ZKZA 4EYOA 3ZMUA 2PFBA 2Y75A 2Y48A 4YS6A 2KRFA 4I7HA 3KYIB 3VFZA 5KQLA 2V6CA 2QQ9A 2FNAA 3BRSA 3VB2A 1K79A 4KPYA 2IA0A 1URPA 2H6BA 4BQAA 2A9RA 2Z33A 2VK2A 1QP7A 3R61A 4G86A 3I5AA 4XLNF 1RNLA 4UUVA 5HLHA 4XBFA 5D8LB 5DD8A 2FQWA 2PAFA 5C5CA 1OXKB 1ZH2A 2EFOA 3OO0A 4G0XA 3MYYA 2ZMEA 4ETIA 4W5OA 2J48A 1FOKA 1ABFA 4RK7A 2K02A 4Q48A 5FGMA 2IDMA 3CG0A 1SXGA 4O1IA 4OLBA 4NV3A 4A5MA 1U0SY 3M9AA 4LB6B 3HS3A 3G1WA 1Q1HA 2AXLA 1VRVA 3BY6A 1YS7A 1BA2A 4FE7A 1E2XA 4LGWA 4RGUA 1NXPA 4MS4A 4M6YA 1Z2DA 2V1UA 2QM3A 2QZJA 3DF8A 1CF7B 2R7FA 4MTDA 1S6LA 2GIVA 3E5XA 1ABEA 1E6LA 5H6RA 3M6MD 2VONA 3DPLC 2E4ZA 3N0WA 4Z99A 3SNKA 1BDIA 2VOOA 2E4XA 4MQFA 3F73A 3LUGA 3I64A 4MPTA 1P4WA 1WI9A 4RU1A 5CNJA 1WKMA 3EJWA 4ON0A 1F51E 4UV9A 4DQDA 1F5TA 3HRTA 5CVUA 2PBIA 4ZYGA 1GXQA 2KIUA 1KQ0A 3EULA 3F6OA 2HJ9A 3BJOA 1NXWA 3A10A 2FEWB 2X7XA 3GYHX 4JQFA 3T5XA 4G0ZA 5F64A 2MSLA 3RJPA 1P6UA 1ZHFA 5EEGA 3QK7A 2JTVA 3I53A 2JBAB 3TMYA 5T3YA 3A3KA 3HRSA 4M72A 1USKA 4GXOA 2L18A 1MIHA 2NNYA 3GZ6A 2A9PA 3PFIA 2CD7A 2WC2A 4OU0A 3PQKA 3W6JB 4KA4A 1DCFA 5JFRA 5CVIA 4WX9A 5J8FA 4YRZA 3BDDA 1DC8A 3ILHA 2Z9OA 2O3FA 1ZY2A 4HLYA 1F9NA 3ISPA 4BHCA 3T95A 3HO1A 3KP4A 1D3YA 4N41A 3G85A 2QWWA 2ETHA 4RZSA 1KU2A 4MR8A 4A5NA 4M9SA 1U2QA 1ON2A 1JBEA 3KP3A 4LFUA 4KN4X 4Z2YA 1REPC 2ZMEB 4L85A 2DAOA 1BM9A 2BEOA 1U04A 4KK3A 2L02A 4Q47A 4A2UA 1HSTA 3KZYA 3L2CA 1RZ4A 5H20A 4WCGA 1ULYA 1BJAA 3ZN1A 1UDRA 3F6VA 4AIKA 3HHHA 3LKBA 4YR7A 3QX9A 9ABPA 1VKRA 4XAQA 4ZJPA 5JNTA 2XKPA 3RVMA 2XUBA 5E8GA 4BH9A 6PAXA 2PLNA 2JRTA 2OZUA 5IT3A 3H5OA 4ZMRA 2PMCA 3LUKA 4B8XA 4O3MA 3QEKA 2WWVD 1SMYF 5KVRA 2W25A 2CWEA 5TPZA 1HKQA 2XGXA 5JHUA 3H5LA 2MH9A 4G0OA 4O1HA 5EWJB 4L5JA 2RC4A 3ULQB 1C0WA 1ZRDA 1KQ8A 2XKOA 5FLXZ 1G6NA 3FZVA 3WTSC 5BQ3A 1I1SA 1FQWA 2IOYA 3C18A 2HYGD 4XASA 4HYEA 3SZPA 5CNMA 1D5WA 2XROA 3ERED 2W85A 3OOPA 4HA8A 3J80Z 2ID9A 4WXEA 2M45A 1XGMA 4RKQA 1PP7U 1J2XA 1RIOH 2JBAA 3WTUC 1FFWA 4HF2A 1NY5A 2PEXA 3U1DA 1G3SA 2MLGA 2VODA 2VUIB 3M9WA 4Z4EA 2EA2A 2YHAA 1JX6A 1IZ1A 4YWHA 4W5QA 2IA2A 2A07F 1R1UA 1OR7A 3KP5A 5I4CA 3Q5FA 2H27A 4RK1A 4OLAA 3IL2A 4RK4A 2ZFWA 1WWXA 1J75A 3F6CA 1EFAA 3H5TA 1IXRC 3IC7A 1I3CA 1NXTA 5LRRA 1YK1A 1MD0A 1IN8A 3O2SB 2Z3YA 4I98B 5FFXA 1Z18A 2OD5A 2IRFG 3FFTA 5FBKA 3F7NA 4ZZDA 2NAZA 2FTKE
chains in the Genus database with same CATH superfamily
1TUIA 4MVJD 2ZU0C 4IVNA 1FYXA 3MTGA 1RKUA 2BUCA 3R41A 4E0BA 5IDQA 4LWZA 1O0BA 2JSCA 1KU3A 3LIPA 1ZU5A 5FO0A 4XB2A 5COBA 1G3UA 3H36A 3K9TA 2L9RA 2VQ6A 3BN3A 1O3SA 1OLOA 1RR6A 3AB3A 1ELOA 2X5XA 2YPRA 4PJ0C 2YWXA 1VKHA 3IULA 3BGDA 2OXCA 2BSAA 2FDRA 4KFUA 3SXJA 4G0WA 4Z8YA 4KYUA 3TP0A 2GA9A 1Z8FA 1LA2A 1YR6A 1K08A 2O2YA 1F8FA 3C7KA 1A4XA 5G41A 2DTXA 2NIPA 1ZREA 3BR6A 3HV0A 4JWTA 3ZEAA 3JQBC 3UNXA 1QHHB 2C58A 1WE2A 5DD4A 4MDEA 3B51X 3VOSA 3VEPA 3T1BA 1JWAB 3HB0A 3Q4GA 4N0PA 4KAAA 4Y2TA 4F9GA 4QDOA 2IGTA 1EHIA 1Z0IA 1V5IA 3DOJA 4X0EA 4J0GA 4Z6YA 1XD2A 1JEYA 2DFPA 2DKFA 1KNXA 3QLEA 5F3WB 3QYFA 2IYFA 3IVCA 4OWRB 4M3GA 4IVQA 4RULA 3AXSA 5EIFA 3DPUA 1QYRA 3GJQA 3ZWMA 6PFKA 4TWBA 2FH5B 3TW7A 1G8JA 3GVPA 4J76A 3P9IA 1TEXA 2K5UA 3MUFA 4FOOA 2X4IA 2X0KA 3NNNA 4TRRA 5JY6A 1Y1SA 1WJGA 3ILYA 6ABPA 5JXIA 1HOMA 1JFLA 2QI9C 1GPDG 3JS5A 3PHGA 4JI3B 1RDFA 1I4TD 3SZUA 4DQXA 2C7OA 4D1YA 3CH5A 4EATA 2GF9A 4EFNA 3NAQA 3KKLA 3SDZA 1D1QA 1W30A 1QGPA 2OT3B 2Q1SA 3ZDFA 3DLPX 2HWXA 2G6BA 4DLLA 4CQLA 1NRIA 1Q16A 3NEJA 3WLSA 3H6KA 3WK6A 3LFHA 5AM2A 4D8VA 3D43A 4QGHA 1VQ8I 4H7DA 2X0EA 1G6OA 4LMPA 3SSOA 2E19A 2FJ1A 1XDZA 2FN3A 2X8WA 1X1CA 1FP4B 2OLKA 2WFMA 3AUTA 5A62A 2OBFA 2VK1A 3ZWOA 3ISJA 4AKGA 4FZRA 4KWTA 4NZ9A 4YALA 2QI9F 4ZIRB 1UCRA 1UWVA 4IKFA 1C7EA 3ZGYA 2R96A 1Z8DA 2C5HA 4M22A 1NH3A 2Y77A 1EFTA 2NO9A 3FM9A 3U5ZB 1YB4A 2BHLA 3DA8A 1TT5B 3G2KA 4G0MA 5JLXA 5BMVF 1ZGCA 2I76A 1T1JA 1C0KA 3PQFA 1OH5A 4NCBA 1DJNA 2ZRHA 3LHKA 3F3YA 4HKTA 3R5FA 1YBMA 5EMLA 1PJBA 4KAXA 3X2SA 3K8ZA 1JIKA 3ZJTA 3GBPA 4H7IA 5JECA 5JJLA 3KC2A 1R0YA 1BBYA 3SBXA 2E0IA 2Q4BA 4Q9JA 1KAOA 1JVBA 3BSFA 4EB3A 2B34A 4M71A 4FKBA 4UEJA 3FBGA 2E7XA 3K0FB 5IX8A 1IRIA 1K89A 1MQSA 1FMCA 3LGAA 2R7SA 4TMXA 5DLDA 4ZT3A 1HR0B 2AYXA 1A2OA 3ROKA 3WLLA 2OYSA 4X54A 1ON1A 2DA3A 2QW8A 1DEHA 4B2PA 3NC1C 2GN2A 2O4CA 2BY3A 1C0IA 2GLTA 3MGBA 3VBCA 5FDFA 3A6GA 5L3VA 4BKQA 3U44A 3U44B 4LZWA 3H9BA 4IMRA 1VE1A 1U7WA 1Z39A 3RS7A 3JQ9C 1FLVA 2Q62A 3BCHA 3ZD6A 2X85A 5FLEX 1IWBB 1MPTA 2AGVA 3JQAB 3JTEA 2TMYA 4HQRA 2DDAA 3NANA 4M7RA 3Q6IA 3OQVA 1ZIOA 4PYKA 1LQUA 4JCCA 4I08A 3COJA 2B7LA 1ZAYA 3P9XA 3A9RA 3AF5A 2HVRA 3IUOA 1KSJA 1E3DA 1XTSA 2ELKA 2B2CA 1TTHA 2I3GA 3KM0A 2I4OA 4HNQA 4WFKA 3SYLA 3TBFA 2YZMA 5J1YA 1JR3E 1T1EA 3LQKA 1Y3DE 3WHCA 1IY8A 2C0PA 2OUKA 4YI3A 2FCAA 5AOAA 5KJEA 3ZWKA 1H3FA 5JJCA 1MDMA 2H8RA 3AB7A 1R23A 3AEQA 2D0OB 2YR0A 2BIFA 2R5FA 1C9KA 2A1IA 4UU7A 5MN4A 4REQB 2WD7A 2WAEA 5FOSA 1IXYA 2VHCA 2V5AA 1I5OA 5CTJA 1WKBA 4ILEA 2FZ4A 4BACA 3U7EB 2ILVA 3M8KA 4JBXA 4KQXA 3GUYA 1BIAA 1B3RA 4NV1A 2QR5A 2V0GA 1YFKA 1KI8A 1YW8A 3BWEA 3ZCPA 2OZEA 3FNRA 5EXEA 4PNPA 5K0LA 5HOQA 3HM9A 1VHWA 3GEEA 4PZEA 4RMIA 4FMPA 1WF3A 4NH4A 4XRMA 2VAVA 1P6RA 2J0UA 3AFGA 2ZK7A 4RDHA 2BFWA 1LLFA 1TQIA 4GO1A 1OWNA 2EKDA 3GZNA 5LKRA 5L6LB 4AUNA 3QSYA 1FYMA 1MB0A 2B2NA 1GQ2A 4HWRA 3W2TA 2LDXA 5FFZA 2D1TA 2EJVA 2FEAA 3I9FA 1OUMA 2QG9A 2W48A 2W43A 2HPZA 2ZDHA 2BM0A 5A7GA 3MF4A 3QU2A 1QVRA 2P0YA 3D7LA 2J07A 4JQSA 3QQAA 4E1AA 3OICA 4EELA 2MABA 5A3QA 3O9MA 3FOZA 3LSKA 2C4HA 4JUCA 2QP4A 3OCVA 4RGQA 3EW7A 3TLCA 2X22A 3TRHA 3N6XA 4RCZA 3U56A 4LOLA 1PFVA 3IPAA 3NBYC 2JGJA 5TGZA 4NABA 3MT9A 4NESA 1MMNA 5AVUA 2W57A 4XQCA 2EPFA 4KMOA 4P1ZA 2NVYJ 5M5XJ 3SMQA 5K05A 5KYYA 2PGNA 4LF6B 4LRTB 4R7ZA 3P19A 3O3CA 4ITUA 3T7DA 1K5GA 4FNOA 3W8NA 5EF6A 1T5OA 2CN1A 4D41A 2NYUA 3OZBA 4DIDA 4ABTA 3AT1A 1NOKA 5C8DA 3UN1A 2EJBA 1IEQA 3CR8A 3TUZC 1Z08A 5EZYA 4C0QC 2Q4OA 5K7FA 5DNUA 4HAZA 1Z26A 4FOTA 4NEHB 3A06A 2MYPA 1CRPA 3H3UA 3GFTA 3NUZA 1KAMA 1ZXBA 1MKYA 3OIPA 1MFPA 3F3XA 1CV2A 3TN7A 2OM6A 2I54A 3R6DA 5EFZA 4YREA 4ANFA 3I45A 5CDFA 4W97A 3M6LA 1LVKA 1WSBA 4WY2A 1UOEA 3BK7A 1ZNXA 4BBZA 3MWDB 5KNCH 3CUUA 1FPMA 1ZMBA 4FSHA 2Y9ZA 3EX7C 1ZMXA 3G3EA 4F3NA 3B9RA 1B8IA 1IOVA 3HN6A 2DHCA 3I01A 1R88A 4CLRA 3IDAA 2O03A 1ZG5A 4XTRA 1NR7A 5AIBA 1LQTA 3C3BA 5EE3A 1MBHA 5IDYA 5CVRA 4PXYA 2IVMA 1W94A 2HZTA 1XLUA 2VG8A 3KP6A 2QNRA 2W2MA 1YO5C 1JQ3A 3H3ZA 2YJTD 3KNZA 4LYYA 2RAFA 4GEKA 3CZMA 3EIUA 4PUSA 4HS4A 4RETA 5K5OA 5I9MA 1D7AA 3SICE 4D5GA 1GT91 2X15A 3FXKA 2Y6UA 4MJ3A 3PVCA 4BX3A 3TSAA 2GR9A 1ZCJA 3LAPA 3WBJA 2EIMH 1VMKA 5KSWB 3S3MA 3H1AA 3RYIB 4B3GA 1J9ZA 1YHNA 4JT2A 3A32A 2NUAB 4TRNA 4BAYA 1VJGA 3R8FA 4K5QA 4RANA 1A6QA 2D1FA 1CJBA 3GR6A 4H15A 3O93A 4O08A 2G7MC 5IKOA 5AI6A 5E38A 1IH8A 1XF9A 4NNOA 4QFBA 1CUAA 2DWPA 3MCUA 1ZONA 4JNKA 4OV6B 3HJAA 3A1FA 4Y2QA 4DOZA 2AOTB 3LY9A 3H0DA 5FLKA 5BOVA 3WHKA 5F9FA 1NL3A 2V7BA 5LP6A 1EX6A 3E5RA 3W4KA 1GGNA 4K87A 3GUHA 3OEEA 3TD2A 2A9JA 1CY4A 2H0QA 2XMDA 4UD2A 2NP6A 2CJWB 4ENUA 4ZAGA 1G3IA 4WW0A 3OTGA 3M3DA 2IZZA 3NIFB 4JYPA 4CMEC 1JHZA 4W9RA 3DLTA 2X4DA 3PNBA 1J0CA 1E3JA 3EIFA 4DIKA 3BWDD 3TLJA 1P5ZB 1ECCA 1G5TA 2QUHA 4L16A 3AINA 4MGRA 4ZVMA 2XLBA 4BLOA 1O7LA 3W1EA 1WV0A 1WXIA 2BY1A 1K68A 1WSAA 5HBGA 3TX6A 2QIPA 5AVQA 2HSEA 3N53A 3K0HA 1FS4A 1WW2A 3WTZA 1UK9A 1WHSA 4OAOA 2R44A 2E5WA 2PX8A 3CY6A 3H0KA 1C8KA 2EWWA 4NKRA 1EFDN 4LSGA 1YX3A 3T8RA 3KYLA 2BBSA 3UMGA 3WL8A 1DKQA 8OHMA 5LYYA 3B2NA 4G5GA 2DA5A 1L4MA 4NYJR 5SY9A 1MO5A 4CL3A 1UZCA 3K73O 1EBUA 1LY1A 3TOSA 1KZYC 1EJ2A 1XV5A 3P4UA 5F5LA 4CR6A 1XZLA 4EM1A 3WGYA 2W0MA 3F98A 3TQQA 5JH7F 3VYRB 1Z35A 5IBQA 2PKXA 3LKZA 2YBEA 1L5KA 1JQAA 1W4BA 1RQRA 2O20A 3RCBA 5EQDA 5M29A 4WESA 2EOAA 3RJ5A 1KYTA 1U2EA 5CIWA 1PJAA 2CNOA 5DI3A 2C1EA 4B7CA 721PA 3AM1A 1DGQA 3CH7A 1K4SA 4YRNA 3MN2A 1RPTA 3KT8A 3PHHA 3U0VA 1CUDA 1EWRA 3ZI7A 1H8EA 1KFCB 2BJWA 3DAPA 2PDAA 1QGUA 2JH3A 1LE8A 3UCFA 2DRIA 1WCIB 1J33A 1ZESA 1MOSA 3HLTA 1WUHS 2GOMA 1LE8B 1H9GA 3WHLA 2Z58A 1E9RA 1MBEA 5M5YJ 3ZZNA 2ZSKA 3RRFA 2QBYB 1D5CA 2WJ6A 3DE3X 2LY2A 3KYCA 3D6AA 4M99A 4DXDA 3CIFA 2BFBA 2QG4A 3CCSI 4HX4A 3JYHA 3QBEA 1A7UA 2BGNA 1TNTA 2DR3A 2FGKA 1N0UA 1U0RA 3G7UA 4PLYA 1ZEJA 4W5JA 5CEJA 3CW2A 1G8SA 2VNKA 4ON9A 2QENA 1H42A 3T5AA 2LDBA 1SBZA 1TWAJ 2DODA 4ZAWA 1SANA 2B5OA 1WXQA 4WXPA 2IEGA 4O2BF 3BWMA 4ZALA 3TB6A 3R7WA 1LNWA 4PQGA 3URMA 2X0FA 2SECE 1GNRA 1HURA 1TEVA 4DSOA 2FUG6 1ZDMA 2W6ID 3HSSA 4YGXB 1IN4A 3WYAA 4GI5A 5FF9A 1CRWG 3K09A 5JI6A 3LPAA 1LC3A 2F64A 1XWIA 2V58A 5E3LA 2JGNA 3PX3A 4HDSB 4MWOA 3CZRA 3UJ7A 1I0ZA 2GNOA 3EVCA 3H8VA 1NYRA 4GZ6A 3RFTA 4AG6A 4RDCA 1IQPA 4X8HA 3ROQA 3ACDA 2M3AA 4R3UC 2CXUA 2XAQA 3BZCA 5BNGA 4F9TA 1Z6TA 3S15J 2G40A 2LF7A 2CJWA 1KWGA 2J67A 5FUMA 1UMCA 4Q4ZF 4IUDS 2WB2A 4QTXA 2FWPA 1JLMA 3DNFA 2VP2A 4Q3CA 3ZY5A 3FPHA 1VBNA 5IF9A 1KMIY 3PUHA 3D8BA 5F7OA 1F7VA 5F0HA 2EV0A 2QQFA 4K86A 2HFJA 3SE0A 1WSUA 4Y9UA 4WJZA 2P9BA 3FETA 3QOWA 5DOZA 5E18F 2JFVA 2BF7A 4N4NB 3E9ZA 1IATA 4JUFA 4BFLA 1NOIA 1L2TA 3BWXA 3FUVA 2JDID 4R8MA 5CH8A 3BH0A 1V1MB 1NN1A 5G1NA 5U9CA 4WFIA 5CCEA 1FZTA 4WKOA 4HBGA 1P4XA 4OHRA 4LWQA 2V4JC 4CZ2A 3GD7A 2P5TB 1YS6A 1YB6A 4RCVA 1Z83A 4UTZA 4DMLA 3LW7A 4BAUA 2BEWA 2KL4A 3IRVA 3K32A 3U2RA 4IYJA 4OH1A 4JBGA 2B1GA 3MLEA 2BDUA 3SYNA 1M76A 2ZJ3A 3AEYA 1ZD2P 3GLGB 1GR0A 2JDIA 4A3LJ 1ISJA 3JQGA 1UKEA 1XCVA 2YDYA 2XZTA 1JJ8C 2CXTA 4E7JA 1ZD4A 4MPPA 2HQNA 5D4SA 4PBSA 3HDJA 4Y6LA 5HM6A 5KOJB 2D00A 3NV7A 4MK4A 4YJKA 2HK9A 2ZB7A 3L7OA 1QDUA 1EFVA 2BC9A 3OCWA 1J2TA 4MULA 4H0NA 4EABA 4E7PA 4FHEA 3DLCA 3K4QA 3OUTA 1FW8A 1G3QA 1O8BA 1ZUNB 1T4GA 3QF4A 3WGIA 2JGFA 1XHLA 4FBMA 4EKNB 1O95D 2JS7A 1LFDB 2H0AA 2Y1WA 3EEYA 2AN5A 3BIJA 3PICA 4O2AF 3ERMA 4W6QA 3HKZN 1MJFA 3AKEA 1EIZA 3B52X 1E7RA 2EZ4A 4QWQA 2MMGA 1CF9A 4ARSA 1ETYA 3VJLA 1TQPA 4FC6A 3HDDA 2R4GA 4KMFA 3AO0B 3L1IA 3NYRA 4M1YA 2BFFB 4MGKR 2OA0A 3ANYB 4D56A 3GU3A 5DNYB 1IQRA 1U2SA 3DMFA 1JDNA 1U1CA 4JX5A 1T25A 1DO2A 2HPHA 5B1DA 5BURA 2I6SA 4Y0AA 4CM1A 1NASA 3AIOA 1A97A 4JUDX 2J6BA 4MAAA 2IYLD 1GL9B 4BLRA 3S29A 1WVRA 1C30B 3RQIA 2J33A 3L7JA 2TMGA 2VDPB 4PQEA 2P7HA 3STXA 3BZUA 1TXGA 1APBA 3ZCUA 4KIFA 5KYWB 2JAXA 4YT5A 3QTBA 2R47A 3GLRA 4IV0A 3OYEA 2OXEA 4Z1OA 4Q4HB 5KTOA 1XNGA 2RHOA 4CNQA 2OORA 3OYJA 1TX4B 1XMVA 3FTFA 2FBKA 1O89A 3VX4A 3RAFC 3Q8MA 1E5XA 1CY2A 5AI8A 5L3QA 3D2BA 3L09A 1VSQA 1X38A 4LQLA 4YAWA 2IUFA 1I7LA 5COQA 5ALEA 4NCJA 1K7SN 1XN1A 4CPDA 2ILTA 3A1WA 2DQRA 4FQ7A 1I13A 3QNMA 5K8JB 2OO5C 3R5JA 5A0VA 3H1PA 1S5LC 4QOJA 2WNIA 3N76A 2XODA 4WLFA 3I4FA 3R9KA 4P5OA 4KPFC 2XR1A 2PMHA 2C3UA 2ZB2A 2V7GA 3N7TA 4KX3A 1U8FO 1W35A 2BCEA 2RGUA 1B59A 1HW1A 4QXOA 4PN3A 4BB6A 3ZZ0A 2WWYA 3HFGA 1YOBA 2O2XA 4OX9Y 4IO9F 2QRJA 5B3KA 2B83A 4EZIA 2BOVA 3H4TA 4RKFA 1WCXA 3KFWX 4FMBB 4MLCA 1I0LA 4BXUA 1SFUA 3C3YA 2NTNA 3RB8A 3CCYA 4X3PA 1A8SA 4OQMA 4MKFA 1EU1A 2JI9A 4M4SA 3UR3C 1JSRA 4DBRA 3K05A 4P4TA 5D3MA 1K8YB 2H9IA 1TUEA 2JAUA 4HAIA 3JQFA 2MR6A 4IXAA 3ZK7A 3K9WA 4JENA 1LGYA 2IXDA 1TLHB 3G2LA 3O8QB 4R54A 1MO2A 2JGRA 1D0ZA 2GXQA 3UAOA 2J5PA 4RHTA 4Z4QA 2XF6A 2ZYIA 3CINA 2AF4C 2IYSA 4JP3A 4P4NA 1VE6A 1QO7A 4PNHA 3V1NA 1MAWA 1I6WA 5I5EA 3QNUA 1PSZA 4MVXA 4JX9A 2FPIA 4RIFA 5IPFA 4Z3OA 5HLGA 2SCUB 5TB5A 1HFJA 1RWPA 4EFKA 4W5NA 5CXUA 4JEMA 1JI3A 4UUQA 5JI3E 3CR3C 3QKIA 3A01B 2A3NA 3CO0S 4YDQA 4AZTA 2BP7A 1F60A 1XC5A 4CJXA 4CU5A 5K3AA 3MB5A 2PX9A 2AL7A 2QRLA 3U17A 2EP8A 4CMAA 2EP7A 1TZCA 2XZPA 2FR8A 3FFAA 2BL4A 5GV7A 3V7FA 1OSNA 4B1FA 3INYA 1UOPA 1TCVA 2CXRA 4D99A 4XSXF 3FDXA 4YJGB 4K9OA 2Z16A 5H02A 4RK5A 3IERA 1JZSA 4YXWA 1NVXQ 4JJZA 4MTLA 2HQ5A 1JMYA 1FA9A 3C87A 3M7IA 3MJEA 2JFXA 1QYDA 2VUSA 4P5DA 1WUKS 4RKRA 4AN4A 1II8B 2XAJA 5HKLA 4F6RB 5EJ4A 5HQ3A 1XNQB 4BCDA 2ZBVA 2BGGA 3A1TA 2GPJA 2GBFA 1N3IA 4HMOA 5B36A 3DO5A 5FUWA 3ZQQA 3E8XA 4DYDA 3TOZA 1T91A 2CJXA 4R9UC 2YZGA 3FSGA 2V4MA 4E7KA 1R9TJ 1ZNQO 2FPXA 4ZVSA 1NUTA 1YMUA 3NETA 4CM4B 5HZHA 4MI6A 1N2CB 2YBDA 2C7BA 3X1XA 3S1SA 2G04A 1MEEA 5DLQC 5DGIA 4CT0A 5IZCC 3EUHC 4YBRA 3C1OA 4QC2A 3MGKA 5AI9A 4IKPA 5GGXA 3S28A 1ETHA 2F9FA 4M87A 1XP5A 2O2JA 1DOHA 2VH2A 4YIFA 2EH3A 4B48A 3DPIA 3PITA 5AM1A 4S04A 2NU7A 4ZVTA 4KV9A 1IGNA 4RKEA 5ALVA 4I09A 3QEMB 1ZA2A 2XH8A 1O2DA 3DDNA 4BV3A 3RBXA 5BN5A 5AXDA 3FX2A 1QR6A 4HFMA 4PO1A 2WMYA 1BDMA 3IBTA 3GCMA 2RJ3A 3QW2A 4A3JJ 5A5GA 3I76A 3HKDB 4LK3A 3ZQ7A 4Q9IA 4YMIA 3KWJA 2EBIA 4CCWA 2O0MA 5CA0A 5LQRA 3UPUA 2NOJB 4C3HJ 3B02A 1LBQA 1YIOA 1Q83A 4PCVA 4UNPA 5FADA 2G67A 2OY0A 2YCLA 3HB5X 4JLDA 3GX4X 2C3PA 1HKTA 1LPBB 2RHWA 3GZ5A 1ZRCA 1C0EA 3T3IA 4CUZA 5LYJB 4AM3A 2XUDA 1W47A 3FMGA 4TL6A 3K15A 2NZ8A 1YFLA 1LBEA 1SKYB 3ZHSA 3KSBC 4RZXA 1UPXA 3HEBA 4V0NA 5EP4A 2GBYA 4OAZA 1B76A 4GRDA 4Y6GB 3VYUB 4PQFA 3C48A 5DNCA 4MINA 1FU8A 2ZSIA 5IDWA 5JH7B 4H3VA 1PJZA 1T13A 4DLNA 3EUAA 4GX2A 4RB0A 2Z04A 2AMLA 3IHWA 2FUG2 4HEJA 4TMYA 4WTOA 3OT5A 5GV8A 3OWHA 2ZAGA 1D5YA 5J59A 1ZUHA 2VJQA 3OM9A 2OFPA 1FFGA 2RGBA 5HFNA 3T7IA 3PPWA 4GCVA 2C8VA 1OFCX 3DZGA 4J1TC 1Z75A 4M1WA 3IRUA 4G63A 3SEAA 1HLFA 2R2AA 3OJEA 3Q7TA 3VR6A 2CUFA 5DKFA 1V16A 3OLZA 5CAEA 4ZRNA 1ONOA 3DVQX 4PSWA 4LZLA 4EJSA 4B43A 1AMOA 5TY0A 3OMLA 4PAWA 4CQLB 5JHHB 2RI6A 3IAS6 3ZQ6A 3EY4A 1R0LA 4X20A 3HEAA 2IHZA 4IJVA 3HI4A 3SC2A 3JD3A 3GJ7A 4V2IA 4KLNA 1CWUA 3PSIA 4FQGA 3JRGA 3LHIA 3NV9A 1PK7A 3D7MA 1DAFA 1GTL1 3H2BA 1CY0A 1NKTA 3DMTA 4WN9A 2XAHA 3ZMZA 1CF2O 2UDPA 3JWHA 3PUZA 1GTG1 4HSEA 2CUZA 1VQ1A 3MZYA 2IT1A 2XPCA 5M34A 5CM8B 3N7UA 1FCJA 3V46A 3U9TA 3M2TA 2P9QA 4NAHA 4DIUA 5FBVB 3RRNA 5AW2A 5DM7F 1LI5A 4IIGA 4NMXB 1IZ7A 2RB4A 1M6EX 3GZ4A 1UADA 4D46A 2INGX 2IS2A 2JPBA 2RB5A 5IT4A 1Z91A 3ZVKA 4M1EA 2XRZA 2OBMA 2PT7A 2DTEA 2WTXA 5TGDA 1IO2A 5EJCA 4UEKA 4ZFNA 1PR3A 4HBLA 4L8YA 1XRRA 4Z86A 4C05A 2OYRA 4V3BA 3H97A 4Q3BA 4K8OA 2JH8A 3ED5A 3Q10A 3OUZA 1XD7A 1ISMA 3FDYA 1VJ0A 5M5WJ 3I28A 3V4GA 3AL2A 3ORHA 1E2NA 1T9DA 3UAYA 4YMVA 2JCSA 3KXKA 4PX5A 3VAZA 4DPLA 2CVOA 4QQKA 4JA0A 1ZG1A 5KNDD 4AO7A 3H05A 1PKXA 4NMHA 5DN9A 4B3AA 4OK3A 1JLKA 1XNRB 4IRXA 3P2KA 4P84A 3FMOB 1ZK2A 1EK0A 3OPQA 2V3VA 3L00A 3OQBA 4O2LA 4TOIA 1NQ5A 5HJ2A 3B1WA 2PRKA 2CHQA 1CR1A 3T9BA 3HVRA 1Z13A 1YS1X 2F1KA 4EL5A 2HO4A 3VZSA 2HMYB 2VKDA 4ITRC 4EHLA 1DX9A 3TNFA 1OI3A 3UJAA 1I10A 5CLJA 4NXNB 4ND8B 4GYGA 3ZQHA 5DU2A 3SVZA 2YRFA 3RVRA 3G89A 5E3HA 2B4AA 1JB1A 4WLVA 4IDHA 4C6HA 3FKSD 1IWOA 3DFZA 4L95C 3IMKA 1JFFA 4QHSA 3TX2A 2BRUC 1VI2A 3S7ZA 3QOPA 3SS8A 1QSGA 3FMQA 1DJQA 3RODA 2FZKA 2UXNA 2IOFK 1ZH4A 1F0YA 4NC8A 5LFAA 2HEIA 2PGLA 4QGSA 1W29A 2TS1A 4QT0A 3VI4B 1E8DA 5L95A 1CZKA 5BSHA 3HTUA 2A57A 2BSXA 3A9WA 2CNNA 4JJEA 4OHKA 4JLBA 4QFCA 2WB4A 2FJPA 1P2UA 4YDHB 2Q9UA 2Q7DA 4TLCA 4WLUA 1DFGA 5BSTA 3C6BA 5CCDA 2XMQA 1U1IA 2ABWA 2VQDA 3ZWVA 1TCUA 1KC3A 1ERDA 2IPMA 3CXRA 1T56A 1CJVC 3G0CA 2BMJA 2FMLA 4XRFA 1LJLA 1RR7A 1NFFA 2C2ZA 4JXKA 4KVFA 1F14A 3C3MA 3L2VA 1BTOA 1ZLJA 1QJCA 3ECCA 3G2OA 3DONA 3KOWA 4GPZA 4YUAA 4NK4A 4NQZA 4KMMA 5E9WA 3PFBA 3PUYA 3ZNQA 1YZYA 1OZHA 4I1IA 1MEOA 1RI3A 5HS8A 3LBHA 1KH1A 2I80A 1I6HJ 1O4VA 2VSXA 1DBQA 2R86A 3AU9A 5T41A 1QGYA 3PTZA 1NN3A 4JBAA 1W0KD 4V3CA 4A6EA 2P6TA 3KUKA 5BYJA 4AO8A 2MSDB 2QMZA 2WA1A 2YVQA 3R40A 1PU2A 4I5IA 1RBQA 1TQ6A 1U2DA 4AS3A 4ER3A 5C51B 2M1XA 2HO5A 2H57A 2RGVA 1GZVA 3LVRE 4RABA 2AQHA 3L7NA 3OQJA 4B2IA 2IP2A 3D3JA 3OEHD 2Z2YA 3QYEA 2HM7A 2JLYA 2DQYA 2VJCA 2QUFA 5TLSA 2VO1A 1AO0A 4ESJA 3AAFA 4I01A 2QV7A 3H18A 4S12A 3WY9A 3SQNA 2NS7A 1E79A 1F06A 1QRSA 5DDIP 1QVWA 5B7GA 3L79A 2HVQA 5IASA 3HVJA 5K8LA 3ZGZA 2CEAA 2ZJ5A 3T5CA 4BO2A 4LYJA 1TF7A 4MIYA 2I6GA 3S2FA 4UJ3A 4Q9HA 5DLYA 5DNVA 5EIAA 1FT9A 1BCSB 1U9OA 2ZT6A 1S1MA 5CM2Z 1Z2NX 4A36A 1HKHA 3GBGA 3JRAA 1BE0A 1XDDA 1XKTA 3DC7A 3MJHA 3R24A 2HHAA 4EPRA 1N6PA 4KREA 1VHDA 1Z0FA 2OZLB 1DEXA 1EVYA 2EDAA 1RHJA 2ZEJA 4OJKA 4E2WA 1E7SA 2O7NA 1VG1A 2I4MA 4NE7A 2AFHB 2AUMA 2IGNA 1KI1A 2GAFA 2ZITA 3MLBA 3H13A 4W1SA 4U5QA 5DYIA 3ZUGA 1L5SA 4AKTA 2ZI5A 5JCOC 4LZPA 5IXSA 2H7CA 5A05A 1XA0A 1X3UA 4BKXA 1J70A 2Q3FA 3KB2A 2XT0A 4IJMA 4LV8B 3SF0A 1LVAA 2K2WA 4NWIA 3T1OA 2P6RA 1IBSA 3OJFA 1WY5A 4LGVA 5FEMA 5K3DA 1WI3A 1M2VB 1MD9A 4IXNA 5DNEA 5EJIA 1GQOA 2P62A 2VWGA 3O4HA 1NVGA 4LXTA 2E7WA 4LLGF 3KZOA 4W7SA 1JAXA 1JG3A 2LVSA 2AOTA 4BPBA 1YDMA 1A95A 2FV8A 4NECA 4TXHA 1CP3A 4QLCU 2F3SA 2HSJA 4DG9A 2C31A 1EHCA 3QV1A 4G1CA 1OJLA 3W2VA 4M8SA 4AS2A 1NA5A 4HT3B 1LEBA 1IC6A 1KSHA 5ICFA 2DETA 4LXHA 1GZHB 2J5XA 2WMDA 4M76B 1ZJ4A 1JQEA 4N7MA 3ROMA 1DGWY 1V8FA 2NUAA 4JWKA 1ETUA 1PUFB 1GVHA 1QX3A 1AHDP 3K6KA 3RQSA 2BGJA 3LT5A 1ZK8A 3R7FA 1HMPA 2A9FA 1GZUA 5DW3A 5FLMJ 1N8KA 2ZIGA 3IAEA 4L4XA 4XYEA 1FVFA 2CL0X 1IE3A 3TIIA 2VLIA 4W5WA 3GLUA 3FOFC 2RDPA 5GADl 1TT0A 2MW8A 2OTLI 4GFDA 1YAJA 3NVDA 3B12A 3FM5A 3L1UA 5CNIA 1KL7A 2HY7A 4QPZA 3L05A 3OCZA 4MVJI 1IK6A 1CJTC 1NQOA 2NUTB 2PBZA 2M2EA 1XQ1A 2Q27A 3QY9A 5DGXA 2RK4A 3VH4A 5EKSA 4RB3C 4ZOLA 4CQMB 5JMTA 3P0HA 5JZ9A 1J39A 1CUGA 3A04A 2HGZA 3HL0A 2AQIA 1HKUA 4KNYA 1JEOA 2PSSA 2Z4SA 3F5MA 2I6QA 1YYVA 3I0TA 3BTJA 1EQAA 1YACA 3HH8A 2O0YA 2FF5A 3NJ4A 3KWFA 4NENB 3A27A 3HUGB 4RE5A 5DRYA 4MRMB 4F93B 2ZI3A 3IB3A 3EG9B 4DANA 2BHYA 1NF9A 2W2VA 2M6LA 1E8NA 1K8RA 3EOAI 5ER9A 4WBNA 5IN4A 2D7DA 4TUYF 4C03A 4JVOA 4Y1RB 1P45A 4ZI3A 2R7NA 1J0EA 2DHQA 4MV6A 1R0BA 1C1DB 2Q41A 4H9GA 4QUBA 4WY5A 2O50A 5LQAA 4WAUA 3TI9A 1M8JA 2Q0XA 3UCEA 4ALKA 1ZN9A 4G8BA 4W9MC 4TSFD 3FMIA 3RRXA 1XQYA 5L3DA 3TRKA 4HNVA 4C7BA 2Y4OA 3MQ4A 1PUEE 1LX6A 4HVLA 3R0QA 5K2OA 4A12A 4PEVA 4QECA 4WF2A 5FOQA 1I80A 4PPYA 2AN4A 3N8DA 4XOIA 1PUJA 2ZWIA 1XZMA 3EAGA 3UH1A 1PZHA 2OHXA 4R8LA 5ECDA 5AOVA 4ZZ2A 4R9RA 3Q88A 2JI8A 2I03A 3FPGA 2WZDA 1KAEA 4ZTFA 1RZUA 4M8NE 2JLVA 4OYRA 2H18A 1DRJA 5MDHA 1WFXA 2X4HA 4MHSA 4XX1A 1Z0JA 3I09A 3UJDA 4ZQBA 4BNMA 1XX5A 3ZIDA 3BTIA 3REOA 1T2VA 2WYIA 3K9BA 4ZOAA 4YP6A 3RTRA 3P4XA 1I5EA 3EA0A 4FGSA 3TTWA 4EA7A 4N01A 4G4SP 1A04A 1ZGZA 3GZNB 1T3ZA 2HF9A 3F47A 4W82A 2WU1A 5KHAA 4TM7A 3G5LA 3LSMA 2R85A 1BMTA 4G1MB 4ZOCA 3ZDCA 4NC9A 4XVHA 5G0VA 4OYHA 5KAPA 3P0RA 5LYJF 4N9WA 5HTOA 1RWOA 3LM8A 4YRCA 2L17A 2B1JA 1WGXA 2DA4A 3TP3A 4RPLA 3X2QH 1VDZA 4KOEC 4NONA 1IN7A 4E70A 1F2TA 4QDXA 3CKLA 4W63A 4XM2A 3PBKA 4N03A 2HOSA 5A4KA 5MGBA 4RPJA 1Q12A 2VQEB 2G1JA 2O05A 1KBOA 1U1FA 5C52B 2D3WA 2YN4A 3V8PA 1XS9A 2WP0A 1WXFA 1OQAA 1SWVA 4UZEA 1QGED 4BQEA 1JU9A 1Z74A 4A2PA 2ZSUA 2VJOA 2W6IA 2FEKA 3LWBA 4HV4A 2GCEA 5F3RA 5C35A 4CMGA 3OTWA 4XJXA 3KD2A 2ZTHA 3RROA 4A0FA 2LSOA 3GAMA 3CCVI 4AQDA 5BVGB 3CJRA 1QZZA 1W76A 1VF9A 4LGMA 4P8RA 2DQSA 4PCLA 4WUTA 5DM0A 4A16A 2PL1A 1V96A 2DTRA 3DDUA 2XGOA 4UU1A 1HQKA 2NV6A 3AUFA 1M1NB 1IL0A 2GDJA 2HUPA 3T34A 1YIJI 4YIKA 1I2CA 4BZWA 1MW9X 3T5DA 1KRWA 3PJEA 3O3OB 4B6PA 3PIPF 4XLEA 1BWQA 2G5CA 3MRTA 2CW7A 3ZWXA 1DXQA 4BJHB 1N6IA 1J9GA 2QY9A 2ZWOA 3PEFA 4M46A 2WE8A 3LTEA 3QVUA 5AKIA 4Q3KA 3VM6A 2QMOA 5A2GA 5LXTF 3T38A 1G59A 2HMUA 4M55A 1CK4A 1NF2A 1Q91A 4FP9A 4MYRA 4YRFA 5FR1A 5KNDA 3LVFO 3IQEA 4K88A 3OYBA 1FNMA 4DR7B 3BGIA 3EASA 3U40A 2V7VA 2X77A 4OK5A 3WLMA 1X77A 1G291 2EG9A 1Y7HA 3D3WA 4YJ2B 4Q7EA 3CYFA 4AX4A 3KCCA 1EE1A 1NBMD 3PENA 4A8JB 1XZIA 2KM1A 1VQNI 3VH2A 1D1TA 4A15A 2ZJ6A 1SUBA 4X7RA 2BW3B 4BE2A 2QLTA 3BR1A 3HPQA 1PG2A 2BMVA 1DQPA 3VGJA 4BKRA 1DWPA 3ZH9B 2DJ5A 4PFPA 3AEZA 5AI0A 5JAOA 5JJBA 2M4GA 3AOGA 3GRAA 4OP2A 1H4VB 1YJAA 4BNWA 2PZ8A 3HC7A 5B64A 4AJLA 1EA5A 2GK4A 2QVXX 5HOEA 1NI4A 2OK8A 4RCYA 2DFFA 1NF3A 4K3UA 2WR8A 4ZK2A 4JR2A 3AF0A 4B2LA 4PXAA 5FWDA 4DBLE 5B58C 5BVHB 3HR7A 4Q24A 4RF5A 1QP4A 3IJPA 2YW2A 1QIGA 4MS4B 5HS9A 3H2GA 4KZPA 5D1HA 4BZPA 2ZSBA 3C74A 4G01B 2GZ1A 2QRKA 1S7OA 2CFOA 3ZE2B 3ACCA 3WBFA 4JAVC 1JPNA 4BAGA 5JWHA 1T5LA 4LY6A 3QE0A 4GS5A 2H2DA 3MA0A 4PZUA 5CPRB 3CO6C 1LB2A 5DTMA 3JD0A 4OOIA 3PGA1 3OZTA 4AD9A 1EA3A 1BW6A 1IM8A 1Q0LA 1R37A 2OQ2A 3MPUA 4MROA 2EDCA 1QB7A 1IIRA 2C07A 4I19A 4MVJG 1VOTA 5D6NA 1VMDA 5KYXB 4A03A 4KYWA 4E3ZA 4ITVA 1AKNA 1I1NA 5K5QA 2PS9A 3ILVA 4EB8A 2V3CC 3QPHA 1IG0A 3H4VA 3VGPA 3UA3A 4ESOA 1OOEA 3SKXA 1U1DA 4JVMA 2BEKA 2IWRA 4ARVA 4TTJA 1NX6A 3SJAA 1NVEA 1F0NA 2OLJA 4DBZA 1R6VA 1A82A 2ON6A 5C8VA 3DQZA 2DUUA 2GYUA 5IY5H 3TW8A 4MKIA 4XPIB 1CYDA 3MTBA 4OQDA 5ALJA 3JWPA 1NSTA 5AD1A 1TIPA 1OYOA 2IJGX 1N6OA 3CT6A 2V5UA 2XHEA 1Q95A 1J22A 3EEFA 1LRJA 4K3VA 5EHNA 1V5GA 1NAIA 5BPFA 1WABA 1MRSA 1XEWY 1GFSA 1XRSB 3F7TA 1NBME 1RHKA 2EK5A 1VRCA 2I2BA 2JANA 3QW4B 4H7KA 1I39A 3BG7A 1P31A 3IBSA 3LY5A 2HMSA 2A5GA 3JQAD 1XL0A 3PDUA 4NZZA 4U6QA 1UT8A 3ROXA 3U3JA 1IY0A 1HC7A 5FUBA 3OHPA 4ZU6X 4BBAA 3Q9LA 2JFQA 4D0NA 4BOYA 2C77A 3PWSA 4LHVA 4E7HA 2O1EA 2ZJAA 3TXXA 2H1WA 3DB2A 1QKIA 3HWX1 3ZE8A 5ITZB 4E2ZA 3CSDA 3OEWA 5EHZA 2MBFA 4UMFA 1A5JA 1R5NA 1EE2A 3PNLA 2A61A 4RA6B 5KJFA 1DBPA 3EIXA 4K6GA 2BDEA 2IHNA 3AR9A 1MH4A 4G8XA 1EJ0A 2OHHA 2AFVA 1FEXA 2KRCA 4MLZA 2CBXA 4JN6B 2K27A 1CY6A 1B7GO 1E92A 2HMTA 4JGIA 1YQTA 4DT1A 1X1AA 1QOPB 1TJ4A 2XA9A 3CX4A 2LW7A 4X65B 2P75A 1UF9A 1E7MA 1SD4A 2ORVA 3AVQA 2QRZA 2VT3A 1TLLA 1ZUIA 3NI2A 1NZDA 3PPVA 3ZWQA 5FTLA 3PLRA 1RJ9A 1G6KA 4CKEB 5TS3A 1DUSA 5EJ2A 2CLEB 1XGKA 1JH8A 3I1IA 1Y63A 1TWCJ 4EQ6A 4YAJA 5KYUB 5CFQA 4ONEA 3PR1A 4LISA 3BPXA 1GVJA 3Q9SA 1KR5A 5REQA 1X7YB 2FVXA 2WAXA 1T0FA 1DARA 1YS2X 1SBYA 2ZYAA 1QG6A 3FDJA 2ET6A 4U0JA 1DWOA 1GXPA 2VUTA 1N78A 1V3QE 2EARA 3L77A 2B0JA 1GCAA 1BE8A 2ZJZA 3UTDA 4I1RA 1MQ8B 1AGRA 3CF4G 4NBKA 4XW2A 1P9OA 3HOWJ 2B1IA 3NQOA 3LDAA 3MD9A 4ZYAA 2PKWA 5EKXA 2H4JA 1GTRA 4YRTA 1FWZA 3VR2A 4WZAE 1ZM4A 4F52A 2ISYA 4UUBA 1C14A 1U0OC 4MS3B 2QU8A 4XM1A 4EA6A 4CEIB 3PIIA 3ZVNA 1Z3YA 4F55A 1RQXA 3TI7A 5IKMA 5A7FA 5G3YA 4JZYA 3UYLA 5C1IA 2PX0A 1K78B 3ONNA 4OL0A 4PDKA 1P4RA 5IUKC 1IUFA 1P73A 4BEVA 1NKSA 4B3FX 4QRIA 4AC9A 5TMDA 1IHOA 4L22A 4ZO4A 3W8FA 4HAUA 3DFGA 1WMBA 3GG9A 4LG1A 1L5NA 1W4RA 5KTKA 1CUHA 2E55A 4B3DA 3MJDA 2A69F 2PZAA 3MKYB 4N5LA 3BTLA 4J3JA 5T4HA 4H6PA 5K45A 2G3YA 3ZI0A 4YT4A 1LEAA 4ALJA 5H3LA 4C9BA 3L5KA 4ZYTA 4F5YA 2FXAA 2C2YA 5G1OA 5E8IA 3SU8A 2AO9A 3JD2A 3FWEA 4C0XA 4NOKA 2ZXEA 1JPJA 2HCRA 4QDUA 1OI2A 3ETHA 1PT6A 2VVTA 3UOWA 4ACBA 4X1IA 1CFJA 4DMFA 1UQRA 1CIJA 1KFJB 4DJTA 1Y5NA 5KPDA 1ZGAA 3QQ5A 2BTOA 1FRQA 4X6UA 1G1MA 1MW8X 1CLUA 3DAOA 2VEOA 3EPHA 4RH0A 3D6NB 1GTJ1 4H3HB 1QO9A 2WYUA 3RUFA 2XHKA 2I22A 4XLHA 3ZJYA 2XCTB 1OLUA 3AUAA 3PYXA 5DF1A 1SBTA 3RYRA 1QRDA 3C3JA 3F6BX 4KP7A 4MIEA 4IQ4A 1GPH1 3DPSA 5FI3A 2WWFA 2G6TA 3QWAA 3T0FA 1L3LA 1R9GA 1QNLA 2HYJA 2OCGA 2R62A 2Y0EA 2XMPA 3KLNA 2GARA 3CLVA 4DZZA 3DO6A 5IKPA 4OMCA 3QBDA 3GPLA 1XD2B 1E7YA 1XQXA 3KQLA 2Z8XA 2BISA 2ZRFA 1GTVA 3IP6A 3F1KA 5IWCA 2JFFA 3NC4A 2Z5UA 1OFIA 5DNDA 4YRVA 2FFHA 4HF7A 1JTFA 3L0SA 1PF7E 1K2WA 1VPTA 2GN8A 1QQTA 2MHCA 3KUXA 3HCCA 2K6GA 4IEFB 1VHQA 4KTVE 4QE3A 3SD7A 4NCHA 1C2TA 4CLXA 3P0JA 3VH3A 3GCWA 1QHIA 4J1QA 2K5CA 4CM9A 4QUKA 3IVRA 4KXLA 3TLXA 5BYAA 1QRYA 2PUEA 3I4MJ 3L7MA 4JSYA 3MHTA 621PA 2EAUA 2QTRA 2ROQA 4CCYA 1KMNA 1F6DA 1PWXA 3U1VA 1BQEA 2BFEA 2DF8A 1YLFA 2I78A 2JJ1D 2QL7A 4JFAA 2WAQN 2F43A 1NNI1 4RZUA 4TYMA 5FQOA 3K9CA 2HRCA 2VXYA 2C9ZA 2XW6A 4GLJA 4KBYA 2Q2EA 3CDHA 1SFOJ 2QZ9A 3KXIA 3L7BA 5EPOA 1NG9A 2HRDA 2PGIA 3NIBA 3TO5A 4CG0A 1N57A 3M4YA 4KRYA 4R2WA 1FPQA 2VDNB 3NRJA 4ZOLF 2VATA 2JVJA 3E7LA 2FLVA 3TSYA 2MGQA 2X1VA 3OZVA 2HU8A 4UAUA 4Y2HA 5DS9A 4YRLA 2RVCA 3T35A 3K0EA 2NVXJ 3HJNA 3L6DA 1CUVA 4MP8A 3HPGA 4UASA 2OQVA 3O84A 3WWEA 5IJ0A 1MJ9A 3OPYA 3V55A 3IWZA 2WHEA 3AEUA 3CLKA 2O8EB 1QHSA 2K3PA 2FOWA 3UBMA 1TWHJ 5KJ1A 5FD6A 4PZAA 4L3OA 2OBYA 3DZCA 3QLUA 3KRTA 5IXYA 2PUTA 3I0ZA 2RNGA 2F17A 2VDWA 2XB5A 3R2JA 4X20B 2O19A 1DG1G 2OGUA 2WG0A 2HHCA 3B78A 3PZBA 4J2TA 3B6ZA 3KB1A 4N0DA 4XD7D 4X60A 3T54A 3PSFA 4ER6A 2BR3A 1AMNA 1K3TA 4WK6A 4YYEA 4EF6A 5BUQA 3BTSA 1ILWA 1YB1A 2J7PD 5C1OA 3DEUA 1O6BA 1H0SA 2GTHA 2XD9A 4JOCA 4LOCA 1YXMA 4EHBA 2JASA 5FJIA 5HIJA 2I0FA 5IN5A 4CIWA 3KELA 2QSFX 2ETVA 1KU9A 1YS9A 1WQ2A 4ZPXA 4PRZA 3G2HA 3V8RA 1BN6A 1BEEA 4CYDA 2GZSA 4LNAA 3TZEA 5DM60 3WAGA 1HRKA 1T15A 4IW3B 4IIJF 4MB6A 2V45A 3NRVA 4IIXA 1CBUA 2XGEA 1SUFA 3DTNA 3PRYA 2WV9A 4NATA 5JZBA 3OCCA 4I4NA 1ZYRF 2K85A 1E9BA 1OIXA 5D51S 2FPUA 1KFBB 1S3FA 4AJEA 2Q2OA 4Q7MB 5AJWA 1U28C 3RDIA 3IMFA 4PNEA 1PVOA 1IONA 4HV6A 1LKZA 1WHUA 4KFCA 1SR8A 1U8XX 2H11A 3H8JA 3LHFA 3A9CA 1I3OA 2H2GA 3WTTC 5JVDA 3VPDA 1EZ4A 3IP5A 4F7WA 1BCSA 1C7QA 1TVKB 2H7YA 3EZ6A 3L6RA 3O0DA 2H00A 4EW6A 1UXJA 1J07A 3ZE6A 2Q2WA 3O8BA 3ITNA 3VR4H 1YR3A 2EZUA 2HCTA 3PNMA 5D87A 1RJEA 5LBUA 3AR3A 1XDBA 4F2GA 1JEYB 4JLWA 1ESMA 2PKQP 5JPDA 3SFIA 5BSUA 2E5LB 3JVUA 4OI2A 1I7DA 4XWWA 3L1HA 5IH7A 3BSWA 2VPPA 2YX4A 4RVHA 4HPWA 3X43A 5JV5A 4YCMA 4JJ6A 3IE0A 1KE2A 5LKAA 4GC5A 4CQNA 1QDEA 1JIXA 2J30A 3K5HA 4JKIA 3RAPR 2NO7A 5EP2A 2YV1A 2IUTA 3PHBE 4RF4A 3S6JA 3ZLTA 4ZJYA 4RTJA 2OC9A 3TZBA 3GXOA 3VPCA 2O14A 5EPEA 4B0OA 2BDTA 2IE0A 3M2PA 2IHBA 4MRNA 5IBRA 2P0WA 4QYSA 5F9HA 5CGQB 1M83A 2VBCA 5HZMA 1LDNA 1PDVA 2EGUA 2H8KA 3WOHA 5HDKA 2RC5A 3OLYA 3S40A 4WBSA 4CMHA 5PGMA 1QB8A 1S2IA 2W22A 5B3JA 4B81A 1A5BB 3WGQA 4MGYR 1K06A 2YZKA 1XGNA 1X0VA 2FSPA 2RHDA 3HDTA 2KI5A 4RQBA 3S99A 3C8ZA 1U5TA 4PAMA 5FYQA 1PFYA 3VC3A 4B4DA 5KVSA 5ILVA 2A84A 4PHHA 2VF4X 2I4IA 1JZTA 2ZB4A 4LDQA 4JYMA 3DTEA 1J59A 3PGVA 2PRZA 3RIXA 4YJDA 2D45A 4YBZA 1T6BY 2M30A 1WO8A 2CSUA 3AV0B 4PGGA 1N7JA 3FR8A 2NACA 2W8BB 3K1PA 3EF1A 3BRCA 3LRTA 3OPYI 3TEFA 2VP5A 2CFCA 1TC3C 1QIJA 2WOJA 3NO4A 3JALB 4X94A 4P7FA 2DPXA 2QA4I 3O1HB 2MC3A 3A31A 3N8KA 2VB6A 4MCJA 2W4SA 2F5FA 5KTNA 2HW8A 2RAEA 3H1GA 1QYWA 4PG4A 1PS9A 1U02A 2AHRA 4M3EA 2LBPA 1U8ZA 3K0FA 1GZ4A 2MT9A 3M4JA 3DE1X 3TIVA 3Q12A 1PL8A 1YW7A 1KEUA 4BQOA 1B42A 2PFKA 4B9EA 3ANSA 5DGTA 2CK3A 4U7JA 4XTCS 4ROTA 1D9ZA 3ZGOA 2P30A 3LWFA 4PY2A 3M9LA 2FG6C 1C3LA 1FTNA 1HZZC 4OSEA 3SBEA 3OQ1A 1GDDA 2OBBA 4JGBA 4PR3A 3FWZA 4Z49A 3SEZA 4R4JA 3QP6A 4EJFA 1JDTA 3FUXA 5KNDH 1MO4A 3OP4A 2FPSA 1XAHA 1G4DA 4V24A 3LQYA 3RSCA 1OIVA 2BBYA 4XKVA 1OFTA 4I5GA 1WWKA 4I0BA 1HA3A 1EAMA 4ESFA 4OP3A 1UMQA 3L0BA 5KX5F 1TWGJ 1ISPA 3A11A 1WBDA 2DMQA 3UZUA 3U61B 3GYGA 3OPMA 2FF4A 5I5GA 2HYFA 3A6KA 3WJAA 3Q7PA 4GH5A 4NYMQ 5ES4B 1YG2A 1JQDA 5KNBH 3TEDA 2FQXA 4B31A 2PMZN 4PRKA 3PUFA 2JARA 2ZYWX 1TMKA 5EQJB 3CP2A 4ZYEA 2D2XA 1Z2CA 2WU8A 4JMPA 3JSOA 4FEEA 2Q50A 2XVCA 2VQGA 2PUWA 1KAGA 5D3ZA 3FVVA 1GU7A 4I5DA 3R6LA 1XDWA 2YIJA 3NS7A 1BOFA 2YJZA 4IQGA 5FOTA 5ERXA 4P98A 2A88A 5THXA 3HA7A 3Q40A 3E5NA 4TTVA 5KQGA 1C3OA 2IUEA 1NTRA 4OCZA 3E3OA 3EZYA 4MYTA 4R05A 2V7EA 1V41E 2P11A 5AHXA 3V7SA 2ZAOA 3OX1A 3P4YA 5DSXA 1IU9A 4JS0A 5F21A 4FJ1A 1Y0BA 3K9LA 4F9EA 3LSGA 1VSTA 2QEXI 1QE5A 2I3BA 2HHLA 1YJ5A 2PM8A 1DI0A 1SBQA 3LBYA 2FG7C 1SKQA 5K51A 2HI0A 4A5SA 4BZQA 5KCZA 1UZAA 3JZFA 2E3JA 2I1QA 2ZUUA 3AERB 3C1UA 4IUYA 5DM2A 5THQA 4DV7B 5CJ2A 2ZUBA 4K2EA 4BQQA 2YVAA 3DYVA 3V2GA 2WKRA 1WY7A 3BJAA 4UUNA 4U00A 3V7UA 1NBOA 1NP3A 5B5SA 4XORA 1B0AA 2F9MA 4P9FA 4MV9A 1D2EA 1EVIA 1PYVA 1OFVA 4LC1A 2LPMA 5DBEX 4C2AA 5JCJD 4DUYB 2NVUA 2PLRA 4PE5B 2PV7A 4JLMA 4E7SA 1EA7A 3BXHA 3RKUA 4AJ9A 5IVIA 1NY6A 1ISHA 3O73A 3EGXB 4ZT7A 1KE1A 1Q1QA 2XNHA 1NNEA 5IMSA 3WL3A 1IBCA 5MGNA 1LJ9A 1QA6A 3E22A 3PLAE 2O2CA 5KMGB 2FEOA 5C3UA 1KVTA 2F4OB 3HL4A 1KQOA 1Q3KA 1RKBA 2EWVA 2IKSA 4RB1A 3E6CC 4FDAA 4EX6A 4CIYA 1PNRA 4FFMA 4CTMA 5KYYB 2ZETA 3EZNA 1R5OA 1IFXA 3GTQJ 1V1RB 2ZUDA 2VA8A 4G5SA 4XFKA 3JU3A 1Y1QA 1L6IA 3TSCA 3MWJA 1X2MA 3P8ZA 2IRWA 3E05A 4IBOA 3CF4A 3MNFA 3PQJA 5GP1A 3I2IA 3ZDQA 2AD1A 4FNAA 3VUEA 1VQ4I 4CCMA 2YJNA 3B7PA 3DXXA 4AP6A 4Q7LA 4BJ5A 3W5DA 2B61A 2IEBA 1ATZA 4L0ZB 1FSGA 2V74B 3CDIA 4LF7B 3NBKA 5A9TA 2E4WA 2JZCA 4Q0MA 3SJBA 3WI7A 4WA7A 1WHTB 4BMDA 2XA1A 4AROA 3S1NJ 2IPOA 4Q6WA 2I91A 3HTSB 4UEQA 2VL8A 1QDLB 3PK0A 2M5WA 5UKDA 4NBTA 3ZKWA 4V2GA 1JP7A 1IBKB 3EAQA 5G3ZA 1ENYA 1PCXA 4PK4A 1P0IA 3WLOA 4TZ6A 5LDGA 1XZEA 2YQ4A 2JVIA 4O4HA 1SPXA 1S8NA 2J0UB 3INNA 2PGXA 3GEHA 3HJRA 2CG4A 4IWXA 1LFPA 3WGHA 4F3YA 1V35A 5KAMA 1DC7A 2VL7A 3M6IA 4UBIA 3G5TA 5IU6A 1V8PA 3IAUA 2VZLA 1WZ2A 1I30A 3FMVA 3NARA 3A4LA 4H7PA 4DC1A 1TJ3A 3QFCA 2PKRA 3A3OA 2E4YA 3WLFA 1GG8A 2YICA 3C6QA 1VPDA 1TZKA 5E2BA 4RHEA 4PYRA 1QNFA 2WK1A 3LOCA 3GP3A 5FTJA 1M1YE 1H05A 3V1TC 3DT8A 3F6SA 4DNQA 3LO5A 3P5BA 3K6GA 1Z0UA 4R1LA 2DC1A 4ETMA 2QZ4A 2C5SA 2HA3A 3OM8A 1VGVA 2IPXA 4C07A 1PD0A