4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
2FN8A 3ERED 2QV0A 2E4WA 3RVKA 1ZLJA 4L9TA 3DLBA 1HXDA 1SD6A 2CG4A 5LHGA 5FWXA 2NRAC 4D6YA 4EYQA 5FFXA 3AAFA 4RXUA 3NNDA 4XFKA 1FQWA 4P9UA 1EWVA 4Y15A 3V8JA 2CW0F 5D6FA 2PUBA 4EVRA 2P5KA 4UHKA 4JQFA 2KIMA 1KGSA 1P4WA 4A2UA 2MSKA 3CTPA 3Q7SA 4ESJA 3MM4A 2O0YA 4YS6A 3BP8A 5E17F 4ML3A 2XGXA 2YHAA 1RXIA 4MGEA 3CZCA 1PP7U 2RNJA 2ISYA 3KEQA 2M5WA 4ON0A 1S7AA 3LAPA 3CUQB 3KP4A 3GL9A 2O8XA 3FFXA 1CF7B 2HQRA 1ZG1A 1ZLKA 3IWZA 4YFNF 3GZ5A 1APBA 1U5TC 1HSJA 1KYWA 5F6FA 4U7BA 3G85A 2GZWA 3OQNA 5KQMA 1ZHHA 3GBPA 1IN7A 2PUCA 1BN5A 3H6GA 2IA0A 5ICEA 1K6OA 3CU5A 4G0XA 2HQNA 1MB0A 2ADUA 2PAFA 5A2QK 4RB1A 5HKOA 5LGUA 3EYYA 5IBQA 4KQCA 4OTZA 2O6GE 3JTHA 1HEYA 4M72A 3WTYC 3HOSA 4RK5A 1DJMA 3CHYA 5BQTA 3COAC 4KVFA 4QICA 2UZKA 3LA2A 4OLAA 1UFMA 4RXMA 3TO6A 3B73A 4N03A 1WI9A 5EWLA 4MLCA 3QK7A 4LGWA 3C97A 1P6QA 1QP7A 1LDJA 2LPMA 2R3SA 3VFZA 2JCGA 2VODA 1E2XA 3MZHA 2NUBA 2VXZA 2XAJA 1O7LA 1SFXA 4MS4B 2PL1A 3JSPA 2A9OA 1FNNA 1DZ3A 4L4UA 4RAYA 3PQKA 2FNPA 3MZYA 1Z1DA 3TMYA 1BDHA 2A9RA 2MYTA 2FMIA 1BDIA 2WB4A 2QENA 1XCVA 3HM9A 2V6CA 2XUBA 1DC8A 2ZO4A 4LLLA 2CHFA 2PMHA 4L0ZB 4EQQA 4MQFA 1MVOA 1S7OA 3TDZC 3CO7C 1Z18A 4LRQA 3ULQB 1AB5A 5GQSA 4RGSA 3QX9A 4IXAA 4Z2YA 3MIZA 3I59A 3C3MA 3TO5A 1YS7A 3VEPA 2LDUA 3REOA 3KYIB 5T7BA 4MQFB 1JDPA 3GRCA 2H6BA 2FVYA 2HR3A 1E6LA 1QP0A 3E6DA 4HQMA 2WRZA 5JS2A 3BDDA 4LFUA 4N76A 3QX8A 1TNSA 2V79A 2XDYA 5KI6A 3FM5A 1KU3A 3F8BA 2J48A 3BJAA 3M7GA 1ULYA 2ZNYA 1W7PA 1YO5C 3L00A 4Z0NA 2OQGA 4OU0A 3HZHA 1VPWA 2W24A 2YR2A 3LUKA 2DK5A 4H60A 2X7XA 1B59A 1KRWA 4HF0A 2RVCA 3CRNA 4OIPF 1QMPA 1U2PA 1HQCA 5LBQA 5HLGA 4H3HB 4G86A 2EFOA 3BILA 3FFTA 4H3KB 5ED4A 4Y9TA 4HDUA 1SXIA 1OR7A 3IP6A 1ZRDA 3M9XA 4WXCA 3DF8A 3G73A 3R60A 2L3DA 2FQ3A 1C4WA 1R7JA 3QLUC 1PP8F 3I45A 2W42A 5DCLA 2A68F 5FGMA 1YG2A 4M9ZA 3IRQA 2JK1A 1L3LA 3TKYA 5EEGA 2FOKA 3NEUA 5IT9Z 3TGNA 3SXYA 2V1DA 4OIOF 2AS5F 5J8FA 2W25A 4R79A 4MQEA 2PUDA 4ZMSA 1RXEA 4G0YA 3ZMZA 1ONVA 3IC7A 1XGOA 2JVKA 3WGIA 4XRFA 1E6KA 2L4MA 3KYJB 1R1TA 2GKGA 2WC2A 4XLNF 5HDGA 4KMFA 3H5LA 2FN9A 3A0UA 3F21A 3JTGA 4L9VA 4MTEA 1SXHA 4HNSA 4MQ9F 4EGYA 1R1UA 3GA5A 4MPTA 3VB2A 1JHFA 5EWJA 1BVHA 4HV5A 5ICGA 2OENG 4IILA 5KVRA 5JFRA 3KKEA 2HYFA 5EWMB 4I0BA 5DD4A 2DU9A 1RPJA 4G0QA 2FE3A 3DLHA 3KP7A 2Z33A 4XXHA 3SZTA 2RGYA 5L3EA 3N4MA 3L9FA 3HDGA 2K27A 4KMUX 3MCZA 1DCMA 4UHTA 4MTDA 3QRFF 4I09A 1B4AA 1FP2A 4LD5A 3BROA 3CJNA 3LUAA 3JY6A 4A12A 3GW2A 4IMIB 4XBFA 2RDMA 1R00A 7ABPA 3FMRA 4KT5C 4M9SA 5JI6A 2FMLA 1OXBB 1J56A 1TNTA 4RKRA 2G7UA 3ABTA 5FFZA 5E18F 1XHEA 4ETIA 3FXUA 5AONA 4NQRA 4LJZF 3EUHA 2ZFWA 1XB4A 1LBIA 4ZYLA 5KK1A 1MJBA 1FSEA 1LDDA 4NHJA 3FWEA 4R1HA 3F6VA 5ICCA 5DV5A 3CFYA 4BYYA 2H94A 1DBQA 3LUDA 2NT3A 3KCCA 1XSXA 2PL9A 3F22A 4GYIA 4EJTA 1EV7A 1M2FA 4OIRF 3EODA 1KRXA 4RU1A 2D1HA 2FQYA 4DNCA 1SMTA 1NXPA 4WUTA 2L4AA 2NS0A 2XRNA 3GYHX 1U3EM 3RVSA 1F51E 1NATA 3JPWA 2IA2A 1W7PD 2F8SA 4GNRA 1FBSA 4EM1A 1M2EA 5D5XB 3BREA 4A6DA 2JSCA 4PZJA 1WRJA 3SHFA 3W6KB 2R48A 3TOBA 3RTRA 3GO5A 4MR7A 4UNOA 1BA2A 4MS3A 1IRFA 4IVNA 4MS3B 3OQMA 2QVGA 3MEXA 3O2PE 1IXCA 3C1DA 2IA1A 4LB5A 3LQQA 2A3SA 2P4WA 1ZGGA 5JHUA 4MYRA 3O3KA 5EWMA 1OPCA 1YTYA 2WTEA 4Y17A 1JWLA 5KQLA 2OBPA 6PAXA 1DCKA 1QQBA 3SM9A 5CNKA 4YCSA 4M6XA 4RB2C 2L02A 2QM3A 1B9NA 2FF4A 3HHGA 4KN4X 1IZ1A 3IKVA 4RK6A 5L3CA 4A5NA 1M5TA 1NXTA 5FWYA 2EB7A 2QLZA 3E5QA 3U2RA 3R0AA 3HDVA 3S2WA 3I42A 2VBXA 4CHUA 1SFEA 4BXUA 1ZY2A 2IPAB 3T8TA 2EFNA 3T8YA 1G3YA 4JA2A 1YW7A 5DTEA 4LDAA 1FWZA 4ZJPA 3KTOA 2CFXA 1M5UA 2FKAA 5D5VB 1U5TA 1ZVVA 4WXDA 4ENMA 1YTUA 2FMYA 2Z3YA 4HAMA 3R6SA 3PFIA 3OLZA 3PQJA 4NICA 3RVLA 2GA1A 3DEUA 4ZYDA 3BPVA 2VYCA 2PKXA 1UDRA 4ESBA 4ZPJA 2CYYA 4IRXA 1QPZA 2M30A 2HEOA 4OINF 4RKQA 4Q6BA 5L3GA 2LBPA 3EQLF 1YK1A 1JHHA 2FU4A 5TQ2A 5B3JC 2HDCA 4YFXF 2VONA 4KZKA 3RYRA 4YIIA 4IPAA 4F8JA 5LGNA 2XROA 5HS7A 3LUGA 1QO0A 5CVJA 4RAZA 3RJPA 2C6YA 3K9CA 3QLVA 5FWXB 4GGGA 1OMIA 2JTVA 1C0WA 4ETNA 1OYIA 3SY8A 4HF2A 3HSRA 3LFKA 4KK4A 1Q1HA 3JAMK 4JB0A 3DPLC 3NNSA 2HZTA 1K79A 3HSYA 1RUNA 2R47A 2BEOA 2EK5A 4CYDA 5DD8A 3FMSA 4LE2A 2VBWA 4Z4EA 2BE5F 1XDSA 3SAJA 1U2QA 3WODF 1EAYA 4O6JA 3H5OA 4AD9A 4HW0A 3IP5A 3QU3A 1L0OC 1DDNA 1DCFA 2QR3A 3EAFA 2BGCA 2ESNA 4GPAA 2HKOA 4G9YA 4JBAA 2E4VA 1CGPA 1TMYA 4MLDA 1J2XA 4IRHA 5IX8A 1ZH4A 2XASA 3JTEA 2ZMEA 4P9FA 3JW4A 3V4GA 1CF7A 2H0AA 1HBXG 4D0PA 4MRMB 4NCBA 3IRRA 4KYWA 4YLEA 1QNLA 4OG2A 2WJAA 5DKFA 2ZMEB 4I02A 2LKPA 2XAQA 4KICA 1REPC 1ZN2A 5IUNC 2E4ZA 3RVQA 4M6YA 4FT8A 4DN6A 3ZMUA 5ILVA 1Z25A 3LMKA 2JRTA 2MH2A 2RQPA 3A3KA 3IP7A 2P7VB 3WTZA 1MJ9A 3LUCA 2L54A 4OMZA 1WSUA 1USKA 4PYRA 4G7OF 2L18A 4ZYHA 4BQAA 3UK0A 2GI4A 4TN5A 4GCVA 1MJAA 1P6UA 4PEVA 4Z4HA 2W57A 3F6CA 2VBZA 3O2QB 1A0OA 1GUDA 1FYLA 4O1HA 5TPZA 4CGZA 1J59A 3EYIA 2F5FA 5EEHA 5IC5A 5DCFA 5FB2A 1W9HA 4EVSA 4ASNA 4HX8A 1T34A 4KNYA 1AWCA 2XVCA 2ESHA 1UHWA 1Z91A 2IVMA 3I71A 4Q5SF 1PUXA 5TPZD 3V7SA 4FX4A 3P9KA 2E1CA 1ZGAA 3A0RB 2CHEA 1T2KA 2VE8A 2DFIA 4M9XA 1GHCA 3Q7TA 9ABPA 2MH9A 3K69A 2IJLA 3NHMA 3EDCA 4I0AA 4U0VA 4Q6WA 1XGNA 4MR9B 4O3MA 1QO0D 1EHCA 2OZ6A 3HHHA 1ZAYA 2XKPA 4XLTA 4XARA 1QKKA 1XGSA 2YPRA 4L9JA 2M1BA 2JVIA 2ACJA 4U88A 2DK8A 1BBYA 1SD5A 4RGXA 1SAXA 1KU9A 1WKMA 2V0NA 1KYZA 2K02A 4TLMB 2A6HF 4UXNA 3NNNA 4UV9A 2EWNA 1ZESA 2DBBA 4QYWA 3VOEA 2HQBA 4NCAA 5BRJA 1R8JA 3WTSC 1BI1A 5K5QA 3VNBA 2EFWA 1U5TB 3GLXA 3HOTA 1LJUA 2TMYA 3RQIA 2HQOA 3KLOA 3MAJA 1ZH5A 4D74A 4MEXF 1O57A 1PNTA 5BR1A 1Z05A 4HDVA 1T39A 2F5DA 4PGGA 4IMJB 3ISPA 3DQVC 2NNNA 1Z16A 2X0LA 4OLBA 3SNKA 3M8FA 2WWYA 4BHCA 3HTUA 4N47A 1BC8C 3HUGA 4Q47A 3IHUA 1Z2EA 1YVUA 4W5TA 4E7OA 2FQXA 1STZA 1BIBA 3DZDA 3LA7A 2OAZA 4LB6B 4BNCA 4F11A 5D4RA 2ZBKA 1FOKA 3GFIA 2VOPA 2Z99A 3TO9A 2FEKA 5DYMA 3ZMSA 1OYWA 5JS1A 2QZ8A 3CTAA 4PCQA 3JVDA 1U6GA 2HGCA 3JAMZ 1FC3A 1JLKA 5H6RA 4EGSA 2PE5A 5KWSA 2STWA 3OM0A 4RZSA 1ZDMA 4RGUA 4MS1A 4ZYEA 1ODDA 1TBXA 3KCNA 2B0LA 5L3FA 1DRJA 5D5UB 4EJOA 3F6OA 3RKYA 1P2FA 4RY9A 2QXYA 3URMA 1DBWA 1J7KA 3WTVC 3WGGA 1QPMA 2E1NA 2OD5A 1E17A 3ILHA 2HOEA 4W5NA 3GWGA 4LE1A 2Q2EA 4XLPF 4O5VA 4IHTA 4S05A 3HIFA 1FSHA 4TV7A 1LNWA 2D2WA 2JVJA 5IEJA 3SQNA 4CXFA 2IW5A 2VK2A 3EETA 2PUFA 4HBLA 3RVPA 5ILUA 2AYZA 4FE4A 1U78A 3FM3A 2CWEA 1XD7A 5LHIA 3KZYA 1W5SA 5BRAA 2FW0A 1S3JA 2KIUA 3MQ4A 2O3FA 3V8LA 5BQ3A 4GYGA 5LRRA 1TLFA 1UB9A 1KQ0A 3U1DA 5DCMB 1A2OA 5E1WA 3OQOA 3HSEA 2JPCA 4EY3A 2LF7A 3W9SA 2MC3A 3RKWA 8ABPA 2A69F 5KQGA 4F06A 1HW1A 4FX0A 1LJLA 3CO6C 1F9NA 1FBQA 2JPBA 2JRLA 3FZVA 3K1NA 4Z4GA 4MR8A 2XHKA 4EGZA 1K68A 1Z6TA 5J8CA 1QNTA 1L5YA 1YS6A 3IWFA 4KDPA 2ZCWA 2AYXA 5FD5A 3OMWA 3KS9A 3O74A 3GXOA 3O1HB 4CICA 1D5WA 2YHBA 2NAZA 1TQIA 2DQLA 5ILSA 3HRUA 4MR9A 3RVNA 2K4BA 5E3JA 1OYYA 2PBIA 2FEWB 4MQEB 2G9WA 5TJJA 3TD9A 1DBPA 2LUOA 4S04A 4KFCA 2HPHA 2CO5A 3I0TA 1IIBA 3H75A 5EWLB 3J81Z 2YX7A 3QLVC 2WMYA 3WTUC 2ID9A 1U8TA 3QLUA 4PGHA 4Z99A 2P7CB 2E4UA 2VC1A 4QLCU 2M1ZA 5DGCA 2GXBA 3H5WA 1QZZA 5CNMA 3QPTA 3LUFA 3N75A 1D4ZA 1QBJA 1V3FA 2MBFA 1E2BA 4HV6A 4I01A 2YX4A 2JB9A 2MYUA 3OMXA 1JFVA 4RK1A 5FBKA 5TRDA 1J9IA 4D6XA 3K2ZA 2P9HA 3B2NA 3C3WA 4WWCA 4N0BA 3TX6A 2RGVA 3EDPA 1QQAA 5CNJA 3FMVA 3UKJA 1H9GA 1Z7UA 3H92A 3GF2A 2FTKE 3HO1A 1EH6A 1EH8A 2A6EF 2PEXA 4XAQA 3OM1A 2O03A 3ZPLA 2FBIA 4G0OA 2PQ8A 4RY8A 4HYEA 1F1ZA 1Y0UA 2EV0A 1G6NA 5F1RA 4HLXA 5CHYA 1BI0A 2Q0OA 2BYVE 4F7ZA 4E70A 1XMAA 1D8JA 1G4DA 4L5JA 4I2OA 4LE0A 2XAGA 5K1YA 2KJBA 4YG2F 3L7WA 4JOQA 2OQRA 3MA0A 1USGA 3FXQA 3N0XA 1T38A 4Z9BA 5IT9K 3L49A 2FBHA 4IGAA 3F72A 5JR3A 3HUTA 4MR8B 5JVTA 4DQ2A 4WZZA 4JAVC 4EJVA 3BRQA 1XMKA 2PLNA 4MQVA 4O5AA 4MGRA 4WT7A 3VNAA 4KRFA 3V8KA 4W5RA 3RPUA 4RV5A 4XSXF 3KLNA 1IUYA 2XAHA 1JE8A 5LLQA 5E20A 2QU7A 1FPQA 1NY5A 1BI3A 3DV8A 1G3TA 1P92A 2BBYA 4G0PA 3KZZA 1F4VA 3KP6A 3KHTA 3HV2A 1IN4A 2GBPA 3J81K 4EJWA 2CGPA 4BHBA 3M8EA 3GBVA 4YV7A 4MRMA 1DG9A 2HS5A 3IP9A 2XKOA 1BDJA 1S8NA 2WV0A 3N0WA 1RIOH 1JFSA 3T1BA 5D8LB 4KV7A 1CEYA 3GWZA 4ENNA 1ZG5A 1I1SA 1DPRA 3TQNA 4M88A 1BOAA 2R7DA 3WTWC 2R25B 3WU0A 3OOPA 3KFWX 4EM0B 1HW2A 2FLKA 1USTA 1ON2A 1P6RA 3P9IA 5BPIA 4RDCA 1WETA 2IPMA 1ZITA 5B3JA 3C6QA 3GT7A 3M6MD 2V9VA 3CLKA 2L17A 1LQ1A 1BJAA 2R7FA 3BRSA 1BC7C 1EWTA 2O20A 3Q5FA 3LA3A 1JBEA 5IEBA 1TW3A 2DPUA 1TVMA 3QEMB 2R4QA 1CHNA 4EMSA 2DPDA 4FB4A 5TPWA 2AXLA 5CNIA 3F8NA 4LMYA 3ZP5A 3KJXA 4Z9AA 4MR7B 1ZRCA 1JX6A 4P1ZA 2IYNA 2VT3A 2N9UA 4HQEA 1YLFA 4ZZDA 1URPA 3IPAA 3GEZA 3RVRA 1QGPA 2RC4A 3F3XA 1TJYA 4OATA 3ZN1A 2PJUA 1XCBA 2QQBA 1NHAA 2P6TA 3JPYA 4Q4ZF 1F4KA 5FD6A 3O6BB 2F2EA 3JS5A 1AB6A 3QEMA 3ZN0A 2QBYA 2LP4Y 1TQPA 2MD5A 1XSVA 1USIA 3R61A 5CVIA 2H09A 1JXSA 2GWRA 2COMA 3R4KA 4A0ZA 2RV8A 4HNQA 3BJ6A 1VTNC 1FYMA 2ZXJA 3HS3A 1IRGA 2MLKA 2QBYB 1R22A 3E5UA 1ABFA 3RDIA 1GXQA 4G7ZF 3I58A 2TDXA 5HQJA 2A61A 1OXKB 2X4HA 4UVCA 3J7AO 2O61A 5GOTA 3U9GA 3H1GA 1D3YA 3MQ0A 3MF4A 3HXMA 4N9HA 3F8CA 2RJNA 1TTYA 2M98A 3EULA 2VE9A 1KQ9A 3RPQA 2ZNZA 2D45A 3E6BA 1ON1A 4QYMA 1NXVA 2H27A 4A0XA 1FYKA 4Q7EA 5D8KB 5HDNA 2DQRA 3Q7RA 5EWJB 3FXRA 2MLGA 3OLYA 3CUOA 4LX8A 1VKRA 2QUFA 4EYOA 1Z17A 3LOPA 1R1VA 3OLXA 3ZMTA 1YW9A 4HX4A 4OOIA 3BY6A 1S29A 5HLHA 5HLIA 1ZRFA 2IPLA 4OBBA 1DP4A 1ZG3A 3K1PA 3Q15C 1WWXA 3HRMA 5CJ9A 4HA8A 6ABPA 4Z4IA 4LZLA 3IPCA 1BI2A 3EQ2A 3F8MA 4M73A 1IXSB 1G3WA 3WE2A 3KP2A 1EFAA 1P8AA 4A6EA 4AIHA 1KQ8A 5C5EA 2HTJA 1XSDA 1Z15A 1ABEA 1O3RA 1X3UA 2P5VA 3K9TA 3W6JB 4ZZLA 2OU2A 1MDMB 3H5TA 2EA2A 4KK3A 2L2QA 5DUIA 1ZGJA 2E7XA 2XV4S 4RK4A 2LF8A 1KMIY 3ILYA 2ELHA 4P98A 5FO5A 1QQIA 5I4CA 4JP1A 2LSOA 2KJCA 1RZRD 3I64A 3RVOA 4UHJA 2DW4A 4I98B 2P6SA 1SXGA 2RDPA 3ABUA 3WTTC 3MWMA 1RNLA 5HM6A 3MYYA 4WK8F 1YYVA 1K66A 3J80Z 2BGGA 3FX3A 2WJWA 4KIFA 4L5IA 3QELA 4W5OA 1J0RA 5TQJA 4QWQA 3OV8A 2PUAA 5CVRA 4RB0A 5E8IA 5A2QZ 4CZZA 1FBUA 1MD0A 3ELKA 4PICA 5LRSA 1R5HA 2RKHA 1LEBA 5TQ0A 3KP5A 5DCMA 3MFKA 1A04A 4AIJA 5ICFA 5LGTA 1W25A 4U7DA 3Q9VA 2NNYA 1PEAA 2FNAA 1LBHA 3RI4A 2FXAA 3H1FA 3QU6A 1J5YA 3RVJA 2VC0A 2KIFA 1JYFA 2KRFA 2MYNA 4WWHA 1D2AA 4LLNA 1O3SA 3EQZA 1IN6A 2GA2A 1U04A 1JH9A 3F6PA 1V4RA 4AWXB 1GVJA 4H0EA 2A07F 2HFHA 3H3ZA 2ETHA 4AVPA 3H5VA 1MZBA 3CUQA 2F5CA 4IF4A 3LWFA 1SRRA 4G0MA 4ZYGA 1VRVA 1ZH2A 2M87A 3E6MA 5HS9A 3F7NA 3GX4X 1KA8A 1R58A 1IW7F 2DAOA 1MAVA 3I5UA 3GFMA 1K7AA 3J80K 3FF5A 2DTRA 3OLVA 1SD4A 2I6FA 3GFJA 2XAFA 3BWGA 1K78A 1H9CA 2ZJ2A 3BOQA 5LEJA 2CSOA 4RK0A 4KA4A 2FQWA 3O75A 4MAAA 1JYEA 4F12A 2W85A 1NXSA 2FSPA 3M9WA 1PHRA 3N53A 1IF1A 4ZH4F 3WGHA 4RWEA 3F23A 3D0SA 4G97A 5JNUA 2FSWA 5TE9A 1JF8A 1F5TA 1FZPB 4WX9A 2CWDA 2E4YA 3QELB 5ERIA 1P4XA 2V1UA 3HRSA 3TB6A 3HRTA 4HLYA 2Y48A 1R36A 5KC8A 4JASB 1U0SY 1MKMA 4ETSA 1B9MA 3E61A 1FSPA 4WXHA 3UUGA 1H0MA 1LEAA 2M8EA 1PDNC 3N6VA 3HCWA 4G6DA 5IULC 5JNRA 1QZYA 5HSGA 4EM2A 2Z9OA 5CLSA 3WE3A 2PUGA 4YR7A 1RZRA 4A5MA 3A10A 1R23A 2LIVA 1DC7A 4ENJA 2Z5UA 2QZJA 3BBLA 3NRVA 4K2EA 1FLIA 1ZREA 5HS8A 1EWKA 3Q9SA 2D1VA 3OO0A 4L18B 2FA5A 2PLYA 3L6UA 4UV8A 1TW2A 1BM9A 3WG9A 1J75A 4UUVA 1ZARA 1JDNA 3NQOA 1E6MA 5JNSA 4RY0A 1WQ2A 2PG4A 5F64A 4NB5A 2BV6A 2IPQX 2W84A 4YP9A 1KU2A 5K5OA 3H6HA 2H6CA 1Z26A 5HVQC 3HSFA 2EJRA 4XASA 4GXOA 3O1JC 3QLTA 5D6EA 1DPUA 4OMYA 5HDKA 4Z4FA 4IRGA 5LHHA 2PN6A 3K4HA 1Z6RA 5IUJC 1ZAOA 1DRKA 1I1GA 3GVAA 1AOYA 2EFQA 1FFWA 1W4MA 3DFGA 2NZUG 3E6CC 4YGXB 3LQRA 3B02A 1KU7A 3E5XA 1IAWA 2EV6A 3IL2A 3FFWA 4N0QA 5IUKC 4EUKA 5C5CA 3I59B 1NXOA 4KREA 1K78B 4A0YA 4NV3A 3T6KA 1XGMA 4HX7A 1D1QA 4MS1B 1GXPA 2F8TA 2FLWA 5L3BA 4FE7A 1RUOA 3M9AA 1YK0A 1HKTA 1TM2A 3KE2A 4RS8A 3ECHA 1NTRA 4BH9A 2HSGA 3E97A 3TOAA 1HW5A 3JSOA 3QP6A 2MSLA 2Q8KA 2QVCA 2WWVD 5L3DA 1YIOA 1ZYRF 4RK7A 4B09A 1SMYF 3WTXC 3WU1B 4G8XA 3N97A 3I4PA 4EVQA 2Y75A 5BS6A 4KUMA 2K4JA 2IDMA 4PZ0A 3KETA 4O1IA 2MSWA 5BMZA 3T95A 1O3TA 3T0YA 4IRIA 2A9PA 1LK0A 1JFTA 3FDFA 4E7PA 2A5YB 3T38A 2YSRA 2UWMA 4MNUA 3V7RA 3ROFA 5BPDA 3L09A 3N8IA 3TO7A 4PDKA 4TMYA 1SFUA 1RZ4A 4Y13A 5T3YA 1T6SA 2IRFG 2CD7A 2JT1A 1JGSA 4KQ9A 1I5ZA 1U2WA 2ZWMA 5AIQA 4L0YB 3H1EA 2K86A 4WXEA 1I3CA 1ZHFA 1XN7A 4HOBA 1O3QA 3KP3A 2JBAB 1NXXA 3P9YA 1CYEA 3RVMA 2JBAA 3GFLA 4P55A 2GX6A 2ZAYA 2E4XA 4JB2A 5CVUA 2MA3A 4IHSA 3N0RA 1D1PA 1ZGZA 1PNRA 4GO1A 4EVIA 4RS3A 1GUBA 2QW1A 3E3VA 4KIGA 1LB2A 3LUJA 1YQAA 4N0PA 3G3ZA 2PMUA 3DXJF 5KQPA 4G0ZA 4G94A 2IPNA 2CQKA 1FY7A 2J5PA 2QSJA 1PUEE 4PE5B 5DUKA 3S99A 2MYPA 5FLXK 3GYBA 3I5AA 4OIQF 3RIRA 1YW8A 2Y0MA 2B1JA 2WY2D 1FT9A 4DADA 3HYIA 1UHMA 3HVRA 2DLLA 4M74A 1DP7P 4EYGA 2ZKZA 4YFKF 3I53A 1G3SA 5H20A 4ETMA 3LKVA 1T98A 3EGCA 4HZFA 3KEOA 4G7HF 1XHFA 2A9QA 3BPXA 3LKBA 4CBVA 4HNRA 2PUEA 3TDUC 1H9TA 2QQAA 4P5OA 5JNWA 3H3UA 3NBMA 5JNVA 3KG2A 5TQ2B 5D4SA 1JHZA 1ISRA 2PFBA 1YFHA 3FGZA 2ID7A 3ROUA 3SFZA 2FMKA 1RI7A 1TLHB 3ROTA 2OZUA 3I09A 1VLZA 2YU3A 1B00A 4KIBA 3QAHA 3Q41A 4JK1X 4I7HA 3QP5A 4MEYF 3CG4A 4LK0F 3LSTA 4WXMA 1LVAA 1D5VA 4RSMA 4CDGA 3CZ5A 1LDKB 1FP1D 3QOPA 4KPYA 3HEBA 1QP4A 3HK2A 3I54A 1Z13A 2VN2A 2NZVG 4Z4CA 5HOOA 2V1XA 3DP7A 2VT2A 1HKQA 4U0YA 3C3KA 1EH7A 4N41A 5CYVA 4EV0A 4TLLB 2HKXA 1GCGA 3HUUA 2EFPA 3IKTA 3DBIA 3GV0A 2ISZA 4U0WA 5J6XA 3DKWA 4LG0A 1S6LA 3CNBA 3FMQA 2HJ9A 4ZMRA 1IN5A 4YIFA 4YWHA 1OKRA 3SZPA 2FRHA 2LNBA 4RXTA 2K7LA 2VUIB 2PJPA 5TQ0B 2QWWA 2EV5A 5AIPA 2FMFA 1MB3A 3GUDA 5ABPA 2HTSA 2HYGD 3ECOA 3DGEC 1I6XA 2UXXA 5FWYB 2JZYA 3BZ6A 3H5IA 4BHPA 4WF2A 2FEPA 5CVVA 5E1XA 4P96A 2L19A 4BAYA 2P4UA 3K1MA 3RH0A 3MMNA 4Q48A 5IT3A 4CO8A 2IKSA 1XDUA 4KN7X 3F8FA 1HSTA 4LDZA 1GCAA 4QPJC 2QVOA 3V7CA 3O2JA 1JL3A 2VUHB 3RYPA 3GZ6A 3G1WA 2GXGA 2DRIA 5FLXZ 1FFGA 3T8RA 1B1BA 3QPHA 5E8GA 1NXWA 3F73A 2IP2A 3T5XA 3CG0A 3JVIA 4RGRA 3CS3A 5DLEA 1USSA 1R5GA 1XWWA 1MGTA 3CUQC 2NYXA 5TPWB 2G7HA 4DQDA 4IJAA 2KYRA 4F3TA 1W5TA 3HTSB 3O21A 2VBYA 2F5EA 4EJUA 1ISSA 1D8KA 1FFSA 2RJOA 1O7FA 3CKMA 3IDOA 1L5ZA 3KSMA 3NHZA 1GLGA 1FX7A 2OA4A 2QQ9A 1Z9CA 1Z12A 4LLGF 1PEYA 3D8UA 3CDHA 2GAUA 5DDGA 1I27A 2HWVA 3LTEA 1MIHA 3O2SB 2EA4A 4NQWA 4N9IA 5D5WB 2FXIA 2FMHA 5LEKA 3OLWA 2J5OA 1Z2DA 3C18A 4XSZF 3SG0A 1DUXC 4LG0B 1P4AA 1C0EA 4L85A 4WCGA 2Q5CA 2RN7A 5K5RA 3C7JA 2KKOA 2IOYA 5PNTA 3HJFA 4M71A 1TQMA 4ESFA 5JNTA 4W5QA 4FHTA 2FEZA 3QEKA 4AIKA 2NT4A 3VODA 4MS4A 5KC9A 2B4AA 2STTA 2XIGA 3M1EA 1SD7A 2E7WA 1YMVA 4RB3C 3LUHA 4LK1F 3ZMVA 1T0FA 2GQQA 1UCRA 1U8RA 3K0LA 3RKXA 5FBHA 1MDMA 2DO7A 4ENKA 3OO1A 4YRZA 3DPTA 4KMRA 4R8HA 3ZQ7A 2M45A 5H6QA 2PMCA 3D5LA 3BJOA 4UVBA 4L9NA 3ZMDA 2DI3A 3L2CA 4YO7A 2DT5A 1Y1LA 1IXRC 3P7NA 3DGFC 3D02A 4EYKA 1HKSA 1YMUA 5D2CA 6CHYA 2VOOA 2L01A 2IT0A 3ML6A 3E3MA 2UXNA 1LJ9A 3O1IC 2P8TA 2P5LC 3LAJA 4MHGA 1IN8A 5DEQA 4HF1A 5E1ZB 2GIVA 3CLOA 2PI0A 1BIAA 4B8XA 3FHZA 2FBKA 4G6QA 1B6AA 1BAPA 2H3HA 3EJWA 5BOXA 3LFTA 4UVAA 2QYOA 1W7PB 3P9CA 3R0JA
chains in the Genus database with same CATH superfamily
2FN8A 2JLYA 4MICA 2CFIA 5JXJA 3HYSA 4ASUA 4L9TA 1ORVA 4ABYA 4KT6A 3CMMA 2OB2A 2X3FA 4I9GA 1RQNA 3RYHB 2ZBVA 4EEXA 3N6RA 4J07A 4Q4CA 3PUWA 4JLJA 4BCBA 4YHBA 3VPCA 3HVIA 3PGXA 1UBTS 4HCJA 4U63A 1IWPB 5TR9A 4K9KA 5F2NA 3AAFA 3DKYA 1GDTA 1HTWA 2AQHA 2BPOA 1JQ3A 2QQEA 2XA1A 2Y92A 1SMKA 1TRKA 3FUUA 4YWJA 1N57A 2C42A 2Z8YM 3NNDA 4NBRA 1FQWA 3AEXA 5EP2A 2WJPA 3U4CA 4FI3C 1QS0B 3FOFC 3ER9A 3V8JA 2ZBEA 3AKCA 2CW0F 4AO7A 4X1YA 4LZZA 3FOWA 1GV5A 5HYVA 5KREA 3T3NA 2KIMA 1UBKS 2A33A 1GPH1 2WTNA 3CTPA 4AIDA 3ORSA 4UUMA 1XUOA 5AKIA 3UMJA 2IH5A 2ZBDA 4FJ0A 2HBRA 4BFCA 1TWCJ 1IVNA 3UOGA 5AIBA 5EYRA 1JPUA 4KAAA 2JGLA 1E3TA 5E17F 4RKFA 3U1TA 1DFIA 2GAFA 3W5CA 2YHAA 3LLSA 4AZ0B 2ZR7A 3NHRA 1DPFA 2M5WA 3K7AJ 4IQJA 4NE9A 1S7AA 4BV8A 1MO2A 1FIPA 3LAPA 3CUQB 4CQNA 4RPJA 3GL9A 3V6LA 3EX7C 3X2QH 5EE3A 4RVNA 3FKIJ 3I28A 4NIMA 3RDPA 2NACA 2FSUA 3EYWA 3IPRA 4MITA 4OHOA 1DAOA 4DLBA 3FFXA 1E0KA 2XRFA 3OS0A 1CF7B 1O5OA 4HB0A 2D2EA 3IAM6 1DXOA 1A69A 3CTMA 1VTKA 1XSEA 2QORA 2ZSJA 1Q91A 4I50F 1K63A 1WULS 3B1WA 1ZG1A 5KTSA 3IHKA 4KO2S 1YE9A 2IBDA 4IF6A 2HA7A 4YRFA 1UMDB 1APBA 3PNSA 2W6NA 2X76A 4CG3A 3FJ1A 1JSLA 1XLVA 1U5TC 1X2BA 4EBFA 1E1QD 1PUFB 4ZYXA 3HEFA 2IEGA 2Q3CA 3F9RA 5F6FA 3ZKWA 4CMJA 5A9SB 3LC2O 3OQNA 3U40A 2IVFA 4L9SA 5KQMA 2LWIA 2UAGA 4WKNA 3OX3A 5JSHA 2PRZA 3MCUA 3O93A 4GICA 2G36A 1CJSA 4G1BA 5DHAA 4ZV9A 1BN5A 3PR2B 4F96A 2IA0A 3BXEA 3T41A 4K6GA 5ICEA 2C2HA 4M6WA 2QTFA 3AX6A 1H8EA 1ZRNA 4D9BA 2HQNA 1MB0A 3EISA 1N5JA 4PPFA 3THSA 2DTZA 2DX7A 4FKMA 4NC7A 4BQOA 2V5VA 4K26A 1R8SA 4IJQA 1FDWA 1SCUB 5A2QK 2IQ5A 3AEKB 3D2AA 3PFCA 5D5QA 5FULA 2NZ8A 3B3AA 4LAFA 3H4IA 4J1QA 4K88A 1WG8A 2HIAA 1YE3A 3SC6A 5FV4A 3ZQIA 4RVCA 1KSGA 5JEDA 1HEYA 1NA5A 1S3SA 1YR6A 4PNEA 3NHPA 3G49A 5THQA 3WTYC 2D59A 4Q7KA 2H8KA 1HETA 1Z8DA 3NIDB 4YAEA 3FCYA 5BQTA 3COAC 1C1XB 2R7ZJ 3GAMA 3H9JA 2WJJA 5AI8A 4B40A 4D42A 4GR5A 3LA2A 1Y9DA 2TCTA 4ZT3A 3V80A 1I6LA 1OWLA 3MJ4A 1PFGA 3GRFA 1TVEA 4O3FA 3C97A 1Q7CA 4KGVA 2AV6A 5PGMA 1P6QA 2ZRFA 2CHQA 2AO9A 4UEOA 3O92A 4WKCA 2HUNA 4CQLA 1L2TA 3AP2A 3RS4A 2VXZA 1CVLA 3LCRA 3QXHA 1YJAA 3CXUA 3ER8A 4MS4B 2PL1A 1OI2A 5C3UA 5EJ5A 4BKMA 1C9JA 1FNNA 1R4MA 2Y1KA 4UM9B 3DV0A 3ITKA 1LBEA 1P7WA 2OZLA 3PQKA 4PO1A 4TQ9A 4BUZA 4HAXA 1SXJD 4NTZA 4QJBA 3HM5A 4HO1X 3MZYA 3SC2A 4BIIA 2WIAA 2VBGA 1UXOA 1Z1DA 4XD7D 2YXPX 3IJRA 2IXBA 2VZEA 5P21A 2MYTA 1DXHA 2O7RA 4UVIA 3JR7A 4XIIA 1BDHA 1EJ6A 2R1TB 2WB4A 2OD9A 5FKMA 2YV4A 4II2A 3TW7A 4C7OB 2XUBA 1KJ8A 1DC8A 1OBCA 2WILA 1UWLA 2QEQA 2QGFA 4PR3A 4RHEA 2W6CX 1KFBB 2R6JA 1ESEA 3CN7A 1EI9A 2CHFA 1CFZA 4FKBA 5DNDA 4FE3A 4V1CB 1Z0ZA 4N0EA 3TLJA 4LITA 3E7XA 4Y6OA 3G5TA 2ISCA 3D1VA 1S7OA 3ZDDA 1X2NA 5K5EA 1O1YA 1PYGA 1WVIA 3AHFA 1JE1A 3CO7C 2H5JA 3GRUA 4LJLA 4NYMR 3IH2A 4PG4A 3N3BC 3RWMB 3VKFA 3HA5A 3WHKA 3KXPA 2AJBA 4DPLA 2QDXA 1E4EA 2JJ1A 3WNCA 5GTHC 1K3FA 5I7FA 1WABA 1UK6A 4MWCA 3I59A 1WKCA 3C8MA 2XPWA 2RBEA 4MEJA 5AXAA 1Q92A 3RUEA 3UH1A 3VEPA 1OZGA 2REBA 3REOA 3ESBA 3W5HA 3R9IA 3VHXA 1AQIA 1N9GA 5T7BA 4CDMA 1MA0A 2HXIA 1WUJS 2AZMA 3COWA 4L6AA 4NYIR 3GG2A 3NVKI 1WHTA 3OYIA 3AGPA 1EFUA 3FHJA 3UK7A 4BVAA 3IDSA 2L9VA 1STOA 2WW8A 4Y2YA 3VU9A 3BDDA 2PO5A 4EW6A 1WBBA 1Z5OA 4J00A 1PRYA 1U7HA 2ID4A 1DT5A 4N76A 2WSBA 3K71B 3QX8A 3HZZA 1FX1A 1RFGE 2DR3A 2P35A 3QVOA 1SCJA 3AR9A 2HMWA 2VDJA 1R0KA 2J9RA 3P9QA 1CNMA 3GVHA 1JEDA 3TZKA 3GG9A 2QB5A 3P5SA 2GO1A 3NDIA 4FTWA 1W0JD 2PQ0A 4AS2A 1W7PA 1BS1A 1Z83A 1TNDA 2WM9B 3R7AA 5EJCA 3AH8A 2HWYA 1EUCB 1QAQA 4JOSA 1PZNA 2R8OA 3GIDA 1NQXA 1GILA 1YHNA 2C20A 2Q46A 4RGYA 2DK5A 2QTLA 3FGOA 4H60A 3DV2A 4DR4B 4TOIA 1QHGA 2HK9A 3R3WA 3SEAA 3HHEA 2XT9A 1RKBA 3RGWS 1LSUA 2JGKA 3IURA 3U62A 1GGNA 2IYRA 4H3HB 3VHRA 5ICSA 1NUTA 3EDOA 3C3EA 1JQJC 4LXHA 2P77A 3BD6A 3HACA 2FE4A 5AM4A 5G1PA 1SUBA 4WZAB 3WSWA 1WHSA 5IJ0B 1K8QA 1SXIA 3WWZA 1I2MA 1T29A 1L7XA 2BM0A 3EXG1 3G89A 4RS4A 3K4PA 4HRYA 4J16C 4XUCA 1OF1A 2O1SA 3AXTA 1L4YA 2ZVQX 2VJNA 1JI8A 1OX5A 3RYCB 1WO8A 2UV8A 3KD2A 4M0DA 4PLTA 1FLVA 4UM8B 1UPTA 3AERB 1PVOA 1R7JA 3W5BA 4S1TA 2L9SA 2JZNA 1N6HA 1V54H 5DCLA 2W48A 2BGKA 4ZCIA 2GN8A 4M99A 3RAEC 1CUSA 5EEGA 4C76A 3KOYA 4JI5B 4CLHA 3EFBA 4N7JA 3RIEA 1I2DA 5F9HA 3G2BA 2AG5A 1R18A 4DIKA 1FXSA 1Y3BE 4EA8A 1PZFA 2K2WA 3AP1A 4HNAA 3BEDA 3UKOA 4OIOF 2W25A 4R79A 3BZCA 2P40A 4MQEA 4ZMSA 4G0YA 1QLHA 1FRNA 4PG5A 1ONVA 2LGJA 4BB9A 5AHKA 5J2TA 4L0DA 3SKYA 1YH3A 4CMIA 1YZ3A 3IUYA 4OQPA 1OLOA 2XXJA 3IMKA 1BE1A 4ZRNA 3QSYA 5LQMA 2NWQA 1E6KA 1IUNA 2L4MA 2XJ4A 4QJ5A 4Y30A 2IYEA 3PFFA 1TEZA 4UARA 4PJMA 1MZVA 2WIJA 3IH3A 1MABB 2GKGA 3IUQA 3L0YA 2P81A 1AT1A 2WC1A 1V11B 2W4IA 5IHPA 3HADA 2C29D 1EUDB 2PKQO 3DQZA 3IHTA 5HDGA 3U0VA 1CY8A 1QGED 2OC9A 2TRSB 4AQDA 4NCKA 3SVZA 1JECA 5B1DA 2J07A 1MOZA 2NQ2C 4LA4A 4KXXA 1H94A 1EB8A 1SXHA 4UHBA 1MEJA 3ZLUA 1M8JA 3TUZC 2I54A 1JHFA 3FNGA 1E92A 1G41A 4NOKA 1YBMA 4C9BA 3MG9A 3IVXA 1KK2A 2QJTA 3FCOA 4K0KB 2OENG 3RW9A 4DHWA 5EE9A 5C31A 2XYPA 5JFRA 4NDZA 3WWEA 2UU9B 3PUJA 1TTQB 2HYFA 2VK4A 3N86A 4JGBA 4CF3A 5IH7A 4I0BA 4N3NA 3I62A 1NDHA 3RRJA 1RPJA 5FB3A 3RNLA 1Z6XA 2DQ4A 1I4TD 3K9WA 3GGSA 4X6AJ 3E58A 1HORA 5EG0B 2A05A 1TYDE 4H3VA 1AZSC 4L57A 4O25A 3R3JA 4Z86A 5L3EA 1E9RA 3N4MA 3OPYI 4DBLE 2O1XA 4MVWA 2Y1LA 3VNUA 3HDGA 4MX8A 1P5FA 1WCIA 4DCPA 1I10A 1U7PA 3L7BA 5J9FA 4UHTA 3RBVA 1RRJA 3QRFF 1SK8A 3C8UA 2NX2A 3EVNA 5EC8A 2WUGA 4ZT5A 3FVWA 4KQWA 4C5BA 3L4SO 4B3DA 4CMBA 4I09A 1B4AA 4LD5A 1SUDA 1T9GR 2PS1A 3BROA 3CJNA 3LUAA 4TMXA 3T7TA 1TGVA 3PC4A 2JLVA 4IMIB 1XZLA 3NV9A 1R00A 2YYAA 3GJ4A 4O4HA 1Y6ZA 5FBQB 4RZUA 1E1MA 4CLEA 4KT5C 4M9SA 5JI6A 1B74A 3MUEA 3S1NJ 4IFTA 3N2IA 2PX9A 4OYHA 2GETA 4PSAA 3NO4A 4Q1DA 2JFQA 2G7UA 3ABTA 1PJLA 2ZBGA 3OKAA 3X1MA 1NUHA 3G2PA 1CUCA 5AM1A 4ETIA 2BH2A 4LJZF 4MOWA 5AVZA 4BO4A 3EUHA 2ZFWA 1IVYA 1HQDA 1RZUA 3RCBA 5L3QA 2CVFA 4TT3A 5EUBA 3BDIA 4AP5A 5HZHA 1LBTA 4OIFA 1ONSA 3OZDA 3TE7A 1B0PA 1MQAA 4FHCA 1FSEA 4KN8A 1ZUD1 2QN8A 4OAZA 3FWEA 4R1HA 2F7SA 4PLPA 3WL3A 4Z54A 4E4YA 1TLLA 3EMKA 2QRMA 2H94A 5BN1A 4DLVA 2VYQA 4EG0A 2RBGA 4EEFG 3JQ6A 3U5ZB 1TC1A 2DSNA 4MO2A 3S1RJ 4I0WB 4AJ2A 1A9OA 2VLIA 5KJEA 4IHYA 1ZOPA 2AN3A 2QAGA 4HTFB 4TT3D 2CEAA 2TMDA 3WIDA 4OIRF 1M2VB 2DKFA 2ZQ5A 2D1HA 2AEEA 2BI8A 3H8WA 3T34A 2MC4A 3CMEI 1NH3A 1YVRA 1J8MF 4WUTA 4RD3A 3RSOA 2D0DA 2MINB 1V1JA 1ZVJA 3OZXA 3T99A 3S17J 3JPWA 4FYKA 1R8QA 1V45E 1E4OA 2GEFA 1P7IA 1L5WA 3EHDA 3C1OA 3MPOA 5C44J 3QHAA 1FBSA 3P20A 5P8WA 1KDVA 3TPZA 4E1VA 1DKQA 1MVNA 1O4XA 4A6DA 2F3TA 1FXUA 4UEKA 1WRJA 1FYFA 3VYVA 4K9SA 3SHFA 3MKZA 1BXKA 1QKJA 2R48A 4X97A 3K4MA 3TOBA 4YP0A 3GO5A 4MR7A 3ZDZB 1X8XA 4OQYA 4UNOA 1BA2A 1FVHA 2WIFA 3EUEA 3AESB 3L7CA 2DY1A 2FE1A 3OCZA 1WZUA 3TI7A 2QW0X 3DVLA 3R0IA 1IRXA 2CQXA 4IVNA 2IHTA 2ZM6B 4F4DA 5C1BA 3ZHYA 3QTBA 1TWGJ 2V8BA 3QFCA 2PGIA 5GVSA 1ZN8A 2VZ8A 1T9DA 4A91A 3UJBA 1RM0A 1L1QA 4E4TA 4HNUA 2XGSA 4UFOA 2X0IA 3UK2A 3O2PE 4L8LA 3GDOA 1M1YA 3D3WA 3KQOA 4M7PA 4X3OA 3WDLA 3WL4A 2IA1A 1K1EA 3AG5A 4H77A 4FFWA 2Q2VA 4TXJA 2VNAA 3MT8A 1GFSA 2VHCA 2DFDA 3G8YA 2RARA 1YS4A 4A8JA 3NT2A 4BNKA 2P4WA 4D4MA 1GAEO 1ZGGA 2QTNA 4M1QA 3IV5A 2FB9A 1L8XA 5I4KA 1PX0A 2E3JA 3E9CA 1OISA 4JU8A 3L8YA 3RC1A 1A4UA 2UYHA 2WTEA 1HOMA 4CKBB 1YS1X 5DHQA 3D2LA 5KQLA 3SNHA 2K7ZA 2BVMA 6PAXA 1DCKA 5A0FA 5GP9A 2WHRA 3SM9A 5CNKA 1XZNA 3BXOA 4G5XA 421PA 5KYXB 4M6XA 3R0QA 4RB2C 3UBMA 5CD1A 1QX3A 4DOZA 2F4NA 1IPFA 2XADA 3RF7A 5LQDA 1RWPA 3HHGA 4KN4X 1FYXA 1TI7A 2BTOA 3WI7A 4A5NA 1M5TA 4I36A 4KAXA 4DLYA 4BY9E 1SNYA 2EB7A 2QLZA 4BY1J 2E7ZA 1Y8RB 2H2GA 5AI6A 4ZV7A 4YJGA 3U3KA 4B6OA 3U2RA 2G72A 1DUSA 1ZM3A 3C3CA 5D3MB 1PFVA 3S15J 3QHPA 3R0AA 3QU2A 5E0KB 3RU9A 3HDVA 3S2WA 2OBBA 3I42A 3SQMA 3T1NA 2MOKA 4CHUA 2PBRA 1X8JA 2HQ5A 4BXUA 1L5FA 1T4MA 2GJ8A 3JQAA 3TVTA 1QIDA 1ZY2A 2ADOA 4O2LA 2WZDA 3ZU5A 3T3OA 1EX9A 5DTEA 1PCXA 1FOYA 1QGDA 3QVGB 3UAWA 3HJUA 3OESA 4HGNA 4S1WA 4WBNF 1XA4A 3IV9A 3KTOA 3F4KA 1M5UA 3N7UA 3EAQA 3PT9A 3PC8C 5D3MA 1ZVVA 3LZDA 5B2FA 4WXDA 2GCNA 1P4SA 3E84A 1YTUA 3D3JA 3U1VA 4LXXA 2P67A 2BUBA 4CIXA 4RBNA 4N4NB 4JUFA 2LR0A 2RIRA 3SF0A 1Y1WJ 3OLZA 4IXTA 5EYPB 3WYNA 5GADl 2I1LA 2OM2A 4ZYDA 3C5EA 1OT5A 3TFWA 4P0PB 2PKXA 2AN9A 3LBHA 3LCCA 4RCZA 3SFTA 4IHVA 3RVDA 1MSFC 5D3QA 2QLMA 5GAGJ 4RTQA 1XQ6A 1VZ3A 4QRDA 4BXOA 4RABA 3AILA 4URZR 1PFYA 2RGDA 2R93J 1YS2X 1YOVB 3SIXA 1JT0A 3EQLF 1ECBA 4HNHA 1YK1A 1OZFA 2Z4SA 3AEUB 1SM4A 5CPBA 5TQ2A 4YFXF 4K9RA 3PUVA 3ZQ6A 4JEHA 2D1RA 5E2AA 1GAXA 3E6AA 4J3NA 2RHJA 2XNSA 2YVUA 1K9VF 2HK7A 3TMKA 3FOZA 1UBCA 2F1IA 4IPAA 2O2IA 1M6WA 3L77A 3SS9X 4CM9A 1XROA 1KSHA 5ADVA 4LF4B 3EIHA 1P7JA 2XROA 4IYJA 3ROQA 4AZ3B 4EH1A 5CDFE 4ZICA 2FSIA 3MGAA 2IBMA 3H42B 2R6R1 3P94A 4NQWB 1BE8A 1H4TA 1J33A 1ZIYA 4BEHA 2C8JA 3AESA 4TTTS 4CV1A 4G9BA 4C6TB 1OMIA 2JTVA 2R2GA 3CUEF 3BWEA 4ETNA 2V4UA 4XRSG 2FJ0A 4M0FA 2L9NA 1DJNA 4HF2A 1NI4A 2VZLA 1JKOC 1P74A 2B9VA 1Q1HA 2A3NA 4KK4A 4JB0A 3E0JB 3K4LA 2HPMA 3E1SA 1G60A 1N5DA 2R79A 4MH0R 1THZA 4NCNA 5IDWA 2VTBB 2ZIXB 3S2FA 2O2JA 3G71I 1DKNA 3KNZA 3WWCA 1RUNA 2ZLBA 3BR3A 2GILA 3CUWA 3ANTA 1A9QA 3FPKA 5KYWB 2BEOA 2EK5A 5C81A 5GOZA 1DAEA 3EXHC 1VG1A 5T4EA 4CYDA 1V1MA 3TRKA 3WKAA 4EPVA 3QVMA 1JXQA 8GPBA 5HJEA 3B51X 1I4WA 3GH1A 5JHGB 4Z4EA 5IMBA 2D2VA 1N7IA 3JREA 2ZAGA 1TQ2A 3V3TA 3ROFA 5IVDA 1TKAA 2F6CA 4KKXB 5K51A 4WLNA 3WLTA 4BP9A 3ACDA 2R6ZA 2JGDA 3P4UA 4FPXA 5FUWA 1WOYA 1L0OC 1N7HA 4QJ4A 4PU0A 3W9UA 4ZCRA 2G0AA 3HV0A 4MNTA 2R86A 4U2DA 4HG2A 3B1ZA 1AC5A 1OW3B 2HKOA 4G9YA 1B0UA 1UBGA 1AG9A 2E4VA 2F3RA 1D6SA 3CJTB 1ESCA 1JJBA 1RM5A 2P8JA 1W1UA 2P79A 4G1UC 3D1LA 3Q2OA 1R0RE 2I76A 3VNQA 4A8JB 1QLWA 4PHHA 1J2XA 3KR1A 3RTCA 1CUAA 4IRHA 2M9MA 2C3UA 4BBPA 1Q3HA 5KDDA 2J7PA 4R41A 4A26A 3JTEA 3ZY2A 4X92A 3Q5EA 1VCOA 2EC5A 1A88A 1P18A 2X2EA 1KDYA 1SUCA 4KH1A 3OPMA 2AGVA 2GWHA 3FJYA 1SHZA 4KMOA 5JBNA 4UD2A 4U2KA 2R8ZA 4NY1A 3WYEA 3ISJA 3K2EA 4IUCS 5IJXA 3G5UA 1EXMA 1YL6A 5AXBA 3VR4D 1Z0AA 4MKFA 5CB0A 3BVPA 1BX1A 1FFEA 2BI7A 1PQPA 3NBYC 2HI0A 5IP6A 1WZIA 1JP7A 1M66A 1OASA 2J45A 2ZGVA 3L0BA 3PF8A 1OU0A 3MCVA 3VKHA 1MENA 1EXVA 3HA7A 1FSSA 4C01A 4XWWA 4E31A 1QRRA 1Q5PA 1YB2A 3QENA 3CBQA 2BGUA 1UZMA 2ES4A 4J1TA 4XYGA 4ERNA 5EXEA 2E4ZA 2YZNA 3RAFC 2ZS7A 1NKTA 1OX4A 3OU6A 2YJNA 4A6PA 3AOGA 3E05A 3Q3CA 3KB8A 1KJWA 3UUFA 4ZZIA 1TF7A 5A2GA 5G53C 2JRTA 4CL0A 3SQXA 3RYFB 1L0BA 4ZU1X 4BKRA 5EP3A 1BC5A 2V98A 3A3KA 3I2KA 3IP7A 4DC1A 3ONFA 1NE2A 3I9NA 2BGRA 2F2TA 3OC0A 4J0QA 5CLIA 1QA6A 1P9WA 3A6PC 4PYRA 4G7OF 4Y1EA 4ZYHA 1ZRSA 2PWYA 3PXDA 4EKNB 5AVKA 4BMNA 3IVAA 2EYQA 4TN5A 2E37A 4NARA 1OJLA 5LP6A 3L8CA 2EZHA 2X9LA 2OQVA 6REQB 2YJTD 4AFNA 3O2QB 4DC0A 2JA8J 1V7PC 3HHPA 1IBSA 3VYTB 5FTWA 4A0SA 4WCFB 5LP6C 1CUYA 1TK2A 4XFJA 1X7ZA 3NAQA 1RTTA 3JQ9A 4QTUB 1HTTA 1DE0A 2P62A 2XLCA 3IAS1 3PEVA 2ON6A 2EFHB 4WXRA 5FB2A 2GPBA 1W9HA 2WMNB 3E8XA 2NYVA 5BN3A 2IHJA 3ELDA 4XJTA 4LY6A 2QTRA 4LWQA 5CFMA 1Y34E 1E1NA 1XU7A 2XA2A 3OKCA 3U9LA 4E5YA 3IDFA 2IVMA 1U5AA 3I23A 4FYHA 4RE5A 4UU0A 1PUXA 4RTJA 2WT4A 4IOCF 1MW9X 1UXIA 4P4SB 2NS7A 2XQIA 4TSKA 4TN1A 3K6JA 4FX4A 3GN1A 1HGXA 1P3DA 1K4TA 2K7FA 2E1CA 4LWZA 2XW6A 4A2QA 2KZVA 2R7KA 1P17A 2P5SA 2XUQA 1R9TJ 1E7QA 1FXWF 4UBJA 5CH3A 4YXWD 4GGMX 3VSAA 1IOVA 5FD8A 3CVVA 4NBWA 4BV3A 1Z3YA 1E7MA 2VE8A 4BEHB 4G65A 2ZSBA 1TQ6A 3Q7TA 3UATA 1SBCA 3BCSA 1NN1A 4F3KA 4IOJA 1I6MA 1M1NA 4Z7JA 5KYUB 2XEDA 2F5VA 1P2VA 1IPEA 4ITVA 1H9AA 3EHEA 4U0VA 3MLBA 3TYXA 4F4UA 3PQEA 1TC2A 5KYKA 3UXHA 1XGNA 4B6RA 4O3MA 1FOWA 2DHDA 4BCCA 1EHCA 3CF4A 3V9PA 2BW0A 4FXPA 4UHHA 3SJCA 4AMZA 1T8WA 4ZT2A 4BNHA 2JGIA 4CU5A 5CVCA 2QRUA 2YPRA 1J0XO 3COSA 1KYYA 2EQAA 5ARCA 3K7EA 1IJWC 4KO1S 1JU4A 1QQTA 2OHVA 2PQ2A 2QTGA 4H27A 4BXOB 2F1RA 4DPMA 4DIOA 4FGKA 4NF2A 1BBYA 1DQPA 3PSHA 1PR1A 4KZPA 2B7CA 5FL7D 1AQ6A 4B79A 3ZG6A 4C0LA 1WKMA 1NWHA 2HJRA 3ZNOA 5KUTA 1DGQA 3I76A 2BMJA 3H18A 4MDEA 1EUYA 2ODBA 2ZUWA 3IQZA 4TLMB 2HN9A 5BPFA 1FTZA 1K61A 2EYUA 2YIDA 1ZESA 5HHTA 4F3YA 1REQB 2CJWB 5IS2A 3VOEA 2HQBA 1WCXA 4JLAA 4LVOA 5BRJA 3OJ0A 1KQOA 2M0MA 2AZ4A 5IXYA 1C30A 1VMIA 1R8JA 3EOAI 4RGQA 1JUPA 4GIBA 5HKOA 2JI4A 3GFQA 2IE8A 4DCNA 1RPZA 4FYIA 3B6EA 3EZXA 3UWMA 4BECA 3RQIA 5ALIA 3AG4H 3EVGA 3I6QA 1LWOA 5DM70 4CR7A 5A9RA 1TCBA 4E7KA 4M7WA 4MEXF 5F21A 4D74A 1Y5LA 4M37A 1SUAA 4HGRA 4XKWA 5AM5A 5BR1A 1T39A 3GXBA 2HWKA 1GHTA 4B3JA 2X77A 1AQUA 4X00A 3K09C 4Q34A 4GEKA 4DCCA 2BFWA 4YRQA 2NNNA 1Z16A 4CUJA 1JTEA 4B4OA 3SNKA 4J2HA 1Y4DE 3M8FA 3FPHA 1DO0A 1IV8A 3CESA 3QKRB 3HTUA 1KH3A 4G81A 1BC8C 1XE3A 3JZIA 1NC3A 1BA3A 4HS4A 3VKVA 3TKLA 3HTXA 1Z2EA 1PBNA 3R5XA 1IJKA 4JLUA 1J00A 1TTTA 5LBTA 3ZEAA 4IFEA 3HP4A 1P1IA 4WXMA 3OEHD 4IDBA 4BO9A 4R40A 1YC2A 3DZDA 3I3OA 3UK6A 1WR8A 4NR0A 4U00A 4BNCA 1T0FC 1JNYA 4TPKA 1Y7HA 2A0WA 2ZBKA 3GRPA 1FOKA 1BJRE 1XZPA 4XE5A 2AZTA 2L2OA 2IOHA 2XTMA 5FBWB 3GFIA 1RXWA 4B44A 4LECA 1FCJA 3AV0B 4R7TA 4XM0A 2RD2A 1A1VA 4C5AA 1UKEA 1Y1VJ 4PO3X 1JIIA 1GPWB 3U4IA 5JS1A 1YJBA 3QWFA 3K9QO 3K4QA 3ZH2A 2LBFB 2Z3VA 3JVDA 1U6GA 1XWFA 3S2GA 3SC2B 1HOXA 2LCQA 2R66A 3GLFE 5CDUA 4B17A 3BR1A 5HILA 4EGSA 2TSYB 2E2HJ 2F62A 3ROZA 5BR8B 1ZIXA 1XPUA 1I4OA 4MS1A 2CN1A 1THMA 5L3FA 4B6PA 4C3HJ 3WIVA 2W2QA 3F6OA 3RKYA 5E95A 3NWJA 4WFIA 4GOOD 2G04A 3NWEA 1DBWA 1J7KA 3EA0A 1S2DA 1Z2OX 1DXQA 3RYFA 1JHUA 1KYQA 3WJAA 3WGGA 3A8TA 3IP1A 2E1NA 1E17A 4JP8A 3QBDA 3WOVA 4W5NA 1R71A 2AMLA 3AP3A 3GWGA 3PFKA 3CCEI 3A4NA 4LCBA 2BIFA 3KQYA 4A93J 1UJCA 2B4RO 4O5VA 3IQDB 2XUKA 3UWOA 4M46A 1CY7A 1RJFA 2RAFA 2VUTA 1G291 4CHGA 4CXFA 3KU4A 4UTZA 5IEJA 1IM2A 1RRGA 1N9GB 3EETA 1CP2A 2IUYA 3ZE1B 1VQMI 1LXCA 2XZPA 4RQBA 4W63A 5B2ZA 4ALLA 5HZMA 2AYZA 3OUTA 3OPYA 2H0QA 1XJ0A 3REQB 1SQGA 1F48A 3OR2C 3ORQA 1XD7A 3DM9B 5IC4A 4G5QA 1TVCA 1T0JB 3HKCB 1W5SA 3AB7A 3LHSA 2AG1A 4EHLA 2JEYA 4FOLA 2FW0A 3TQOA 5AKHA 3RU3A 2D3WA 4DDTA 4D9NA 2O3FA 5I9SA 3EVCA 3OF5A 1H8HA 2KRCA 2QKYA 4OOFA 2C4WA 3RYTC 2OXTA 3RTDA 2E1MC 3KT3A 2GM5A 2VDWB 1UB9A 2VYND 4DHEA 5DCMB 2I4LA 3K96A 3MK31 3E7PA 3VTAA 2NVUA 1S3GA 4V2IA 1Y56A 2XNDA 3WLQA 1Z5VA 2OWDA 4DMMA 5DN9A 1J8FA 2GCIA 4ZD6A 2X3YA 5A7HA 2DUNA 1YHZA 2NSJA 3UJDA 3WADA 3G6EI 5FOVA 1RBMA 1T10A 2OFXA 4NK5A 3R7FA 3PEEA 5E1WA 1OFIA 2CV0A 1Q0SA 3SKXA 3VXKA 1DDOA 3C41J 1H69A 1N32B 2BHNA 4A8JC 4P9NA 1I7PA 2LF7A 2VPRA 2Z8ZA 3W9SA 3RKWA 4M9RA 4AZSA 8ABPA 1V7QA 5ALLA 3EF0A 3ZI4A 4TV9F 2XNDD 3LT2A 2WT8A 1M5RA 2IHKA 4I76A 2JPBA 2UYYA 2X5KO 2Z3ZA 3LQFA 4BLWA 3FZVA 5KNCA 4B5LA 4JLWA 1S3FA 1JKQC 3CLQA 1XTVA 2OUKA 1DL5A 3TXAA 5BMVB 3EZ2A 4M21A 4CLRB 6GPBA 4Z4GA 3C7KA 4ZOLA 2ZJZA 2OFWA 1VSVA 3OFJA 3CM0A 2R8EA 3KX2A 3DUWA 1Y6QA 3KZ1E 1SVMA 1BCRA 1L5YA 2YWRA 3ONWA 2C07A 3NR2A 4GGOA 4JBXA 1M1YE 3DBOB 4B2YA 4C3IJ 1QFYA 1ZINA 2R7QA 1I6KA 2QRKA 1GO2A 2NVOA 4KR0A 4F56A 1ZL0A 3GXOA 3CBGA 2POCA 4TM7A 2WJGA 5DCUA 2NAZA 4YX9A 1TQIA 3WMEA 4L8WB 3HRUA 3WU2C 3D8BA 4R9NA 1EH5A 5SY4A 3UXYA 3UYKA 3SZGA 1VXRA 1Z7YA 2ERYA 1UC5B 4MQEB 5TJJA 3TD9A 4F7DA 3OIOA 1NBMD 2EIMH 1OI7A 2GBIA 2H7CA 1WI3A 4S04A 4ND6A 1Z3XA 3OEYA 5IM5A 4KFCA 4ZI7A 3E82A 2AZDA 3NBUA 1KF0A 1RBZA 2BFBB 1KPHA 3AM3A 3GFGA 3S0JA 1Q3TA 2FG5A 2JFFA 3PNLA 2HPHA 3T1TA 3B1JA 3I0TA 5HNFA 1T8SA 4RAOA 1M1ZA 3HY4A 2IX3A 4TYWA 4D8YA 5C7LO 3UAGA 3BIOA 1V11A 4J19A 1W94A 2DFFA 2YX7A 1PWXA 3QMVA 4IDCA 2WMYA 2DOEA 1NBMA 1SR8A 4A4DA 3G0HA 1WXWA 2ID9A 5I7OA 1U8TA 2IOFA 5E6RA 1HRKA 3RS0A 1WPXA 1EIWA 4DMRA 4D02A 4YMUA 2DFHA 1RYZA 3G2QA 4DQUA 3LGSA 4RFSA 3WX0A 1PWZA 2AR9A 4RORA 3VR2A 4A3FJ 2OE2A 5TJHA 2BZSA 1SUPA 5T41A 2P7CB 3GZNB 4MUBA 4O2RA 2DM6A 2VPXA 2QUHA 2YBDA 3ABIA 4NVRA 5FQNA 2MHCA 1NAIA 5DGCA 4ZIRA 1RAFA 3MWKA 3QU7A 3A6KA 5CQEA 2Q3FA 3BL5A 3N75A 4HAOA 2FW6A 2GJKA 4CM7A 3OZWA 1XDDA 2DAPA 3KYDB 2MBFA 1M34A 2IXEA 2XCOA 3QM1A 3V2UA 2PIDA 4OHUA 5EYPA 2JLUA 4JV5B 4I01A 2RGWA 2MYUA 3RREA 3OMXA 4H7IA 2JEOA 2HIGA 3ADCA 1K4MA 2BEUB 1LI4A 3QF4B 2HDNB 2JRCA 1HO3A 2OP1A 5EIOA 2EKBA 5E1DA 5L95A 2JIDA 1GRQA 2CYBA 4EHAA 5TRDA 1ZI6A 3GK3A 3KPYA 1R50A 4AT1A 4ID3A 3DAYA 3V1UA 4EB3A 4GBMA 1GT6A 1HFEL 5IZ4A 4A3JJ 5EXDA 2AF3C 4R0MA 1HLDA 4LWOA 1DWPA 5FA5A 3PUKA 1QQAA 3HH8A 2J3LA 2IITA 3UKJA 4H1WA 1H9GA 3FYDA 3H92A 3QXGA 4FN4A 4IVQA 1XAHA 3GF2A 4C1BA 4DQVA 2FGJA 3IO3A 2AI2A 4BKUA 1EH8A 4C07A 2BR3A 3DVQX 3ZBPA 2R92J 1GR1A 2NO9A 2NVQJ 4PFQA 3X2SA 1OFUA 3RYHA 4G0OA 3ZQKA 1JSCA 4MFDA 4CIAA 4RD1A 1VYVA 1GM5A 7REQA 4UVEA 3TR6A 1Z2CA 2OAQ1 2QR2A 4NATA 1JBKA 3RSGA 5B30A 4DKJA 1M3SA 1PGPA 1E1CB 3LF1A 3FHTA 3MJHA 4K2AA 1X38A 3TUIC 4J03A 1Y0UA 4M3DA 1WH7A 1C2YA 1JKJB 1MORA 1Y1PA 2BBSA 1G6NA 2BF4A 4HLXA 1WPGA 2PEZA 2ZEJA 3EGXB 2B0CA 4FJ1A 4RZQA 5CHYA 3CC4I 5CJ2A 2BYVE 4DG5A 3LSHA 3RC3A 4NJEA 4BZQA 5TGZA 1VQ8I 2FUCA 4S24A 2FZWA 4UE6A 2Z30A 3K2AA 2EINH 4BAUA 2WYUA 1W59A 4MW6A 1NR7A 5MGBA 3FUWA 4MW0A 2Y9ZA 4I2OA 4W8GA 2X9QA 2WR8A 5U4QA 2PWZA 3V7YA 4AKSA 2RHRA 3THXB 2Z2YA 4UTRA 5BT8A 5IVHA 1S6YA 3CO0S 4JT4A 1NG6A 4P5EA 1YFLA 2B37A 3O8RA 4YG2F 2O9LA 1VBMA 5DXJA 3FOAA 4JOQA 5C53B 3F5DA 4Z3DA 4B6GA 2OQRA 4CV3A 4EUKA 3SOPA 2Q5QA 2I71A 2YW2A 3OE5A 4NU6A 4YP6A 4E30A 1USGA 5JSQA 3FNEA 2C04A 2WINI 3F1KA 3T5GA 5F1JA 1MH1A 2G70A 3L49A 2JH3A 4BV9A 4CIDA 3QYFA 2X6YA 4L7VA 3RT9A 4HB4A 1D9XA 4YCMA 3H3XA 1D2MA 2PZBA 3I5MA 5JVTA 4H59A 2RH4A 3EB9A 3JYQA 4H18A 4JKOA 3KQSA 2IY7A 3CW8X 4QJIA 4XVRA 1ETXA 1XMKA 1T5HX 3KQUA 2BOLA 3WQQA 3LCVB 5K8TA 4DRZA 2Y1DA 1KHHA 2VF4X 3E3NA 3VNAA 1SKBA 2IL1A 4YCLA 2V7PA 1T3GA 3OE1A 4XSXF 3WYBA 1YT5A 1OD6A 3LDFA 3IFSA 1I0ZA 5DGIA 2B69A 2V3VA 3HVUA 3I1YA 1ZVMA 2YY7A 4N7BA 4TMZA 3OT1B 3VWBA 4F4JA 5BYKA 5LLQA 2Q1YA 5E4JA 3AJEA 3EZYA 2BFFB 2HF9A 3LZ6A 3RNOA 3WWDA 1U3FA 2W4MA 3I9LA 4DV5B 1MH3A 1U9IA 1NUPA 4ZEOA 1NY5A 3CKYA 1G38A 1TA9A 3LOQA 4JBNA 1OIWA 1G3TA 1Q0RA 2I03A 1SCDA 2NTYC 4V0NA 3CO5A 3DEHA 3Q2IA 3K73O 2AFIA 4CV0A 4RAGA 5WRFA 2VQGA 2P91A 4LSMA 4N65A 4TS4A 3RVBA 1OB5A 3KP6A 2OCIA 3PUIA 5JD4A 4ZO8A 1IO2A 1KY2A 1T0PA 2W9XA 3KHTA 2C2BA 1X0XA 2A5GA 1CR4A 3LBAA 4XLHA 2PVCA 3DZGA 2WB1N 3HRHA 4CCNA 2PWBA 4HAZA 4D25A 3IQHX 2CGPA 2CQQA 3M8EA 1VYHA 1JEQB 1Y33E 2J6CA 1IZ9A 4V24A 4AW9A 1AGRA 1COWD 1Y0NA 1DG9A 2C8LA 2ZSIB 3FUCA 3S3TA 3ANNA 2XKOA 1VYUA 2XB5A 3QODA 1QZTA 1S8NA 3DE5X 4OB7A 4LISA 3OZAA 5HIJA 4N5HX 4LXGA 5A03A 4KL8S 4EENA 2VPIA 3T0FA 3TNDA 3QEJA 1S7CA 4QECA 3IAUA 2K9QA 4FHFA 1YZNA 1TDJA 1V95A 3BK2A 5ERGB 3TUJC 1SA0A 4E12A 4BUJA 1NW5A 1COWA 3STUA 1F0NA 2XT6A 3IVMA 1I1SA 3UZUA 1DPRA 3ANMA 5JCOA 4CR6A 1CERA 2RGCA 1Q95A 1Z7WA 3WMWA 3DL7A 3MILA 3SD7A 3ZW8A 2P4HX 1XB2A 1V7ZA 2ZDHA 4PONA 2B35A 5JCXA 2LIPA 1OE0A 5AYVA 2RHDA 5E8RA 2ZM5A 3ZVMA 2Y0PA 4IRUB 4U5XA 4DLWA 4ZTZB 2R7DA 3FDJA 2ODEA 5LUAA 3UTDA 1UFOA 3AL0C 2GYVA 3P9NA 3DVSX 2D1FA 4CIVA 1R3UA 3OOPA 1H1LB 4ZYUA 1YKSA 4RELA 3GUZA 2X6XA 4C2MJ 3W7BA 1OCRH 2FFBA 1LPMA 3BMCB 4EM0B 3UMMA 1VA5A 1MT0A 2GZRA 4K3UA 1FU4A 1CJTC 5IK2D 1RR8C 1Y3CE 2AJDA 3BJEA 5DZSA 4AZ0A 5BUQA 1ZSYA 4WGFA 3LD9A 3T1HB 5HQ3B 4RTSA 1ON2A 1C9EA 1T9GS 1WS6A 1J4AA 2IV2X 2R6GA 2O7NA 4TZKA 2XKBA 2ILTA 3AIOA 2WE7A 1ZITA 1ZMRA 4WOBA 5EZYA 2XI4A 5AT1A 3EPRA 2QRZA 1UADA 2IU3A 2C58A 1RU3A 4UBMA 4LQ4A 2CUJA 3M6MD 4NENA 1CR0A 3KXLA 3RBAA 4CM4B 1LQ1A 1UM8A 3THYA 1IK4A 1BJAA 3FYTA 4GVLA 1CNFA 4HH4A 3PXXA 5GV7A 2PX3A 2NU8B 2KFDA 3LA3A 4M0EA 3RJMA 2CJFA 5CEFA 4Q19A 3I56I 1C3VA 1W5FA 2W71A 1XKLA 2I6XA 4UEQA 3FD8A 2GPJA 2QY6A 2A59A 1ORKA 3DVAA 1JAXA 2YMMA 3QEMB 1D2GA 2HF8A 2R4QA 3B7WA 4QBIA 2GCGA 4EMSA 2W70A 4CLOB 2DPDA 5B5SA 3ZUGA 4FB4A 4W82A 1HV8A 2I2DA 1Z22A 2GZ2A 5EIBC 1XX5A 2AXLA 5EZYF 5AVUA 1MB9A 4WIAA 4DV7B 2VSFA 4KQMA 4M9UA 3F8NA 1P19A 2C2KA 3JQCA 1EF4A 1Z8NA 1PVEA 2NXWA 5J58A 3KJXA 5JQGA 2HNBA 3PE4A 1U8AA 3VSCA 3G82C 4XN0A 1JX6A 2Q29A 5ALHA 1EINA 4LVCA 1CEQA 1SIUA 4UBIA 3U39A 2RHLA 3UICA 1YLFA 1BXRA 2M1XA 2TMKA 3CIOA 4ZZDA 2GJ9A 1P2DA 1RWNA 3IPAA 3S3OA 1A71A 3FISA 4HWTA 1SXJE 3R3SA 1AK9A 1GGVA 3F3XA 5H0IA 1QYVA 1XFAA 1Q17A 4QRIA 3ZN1A 2PJUA 1D6JA 4FFRA 4H4CA 4BHTA 3V2GA 1T5OA 1NHAA 2LTPA 2P6TA 3HOYJ 1U3VA 2GEBA 2GN0A 3ZDFA 4TZ6A 1KC1A 1K8ZB 4P36A 2AXPA 4ZQFA 3W06A 1XNRB 3Q0UA 1P9QC 3UY4A 4MWOA 1S89A 3B20A 5C46F 3QEMA 1UC9A 3ZN0A 2XWJI 3A6JA 5DJ5A 2HK8A 1Y81A 4Y9SA 4ZANA 1Y8AA 4INJA 1X7WB 2JGRA 1T08B 3IB6A 3DTVB 3DZCA 4FSXA 1USIA 5FLYA 3F6BX 4EY8A 3R61A 3E3LA 2H09A 4N3GA 3RBXA 2VF2A 4DSTA 3BDVA 2Y99A 1JXSA 1GNRA 4JYKA 2Q1WA 1AS2A 1ZNXA 4FNOA 1NY6A 2JQ7A 2IYOA 4M0UA 3R4KA 4BFWA 1KO7A 2NW6A 3IUMA 5CAEA 3EPLA 4P93A 1G4AE 1X0VA 4X84A 4Q1FA 4MV1A 3TTVA 3LJKA 3D6VA 3HS3A 3WV4A 5KWVA 1DV1A 2QBYB 3JYHA 2ZJBA 1TF2A 1R22A 3AJDA 3E5UA 3V8NA 5JH7B 2EFYA 4G7ZF 1ONNA 4OHMA 4CMEA 1KEUA 4YELA 1ZNQO 4GMXA 3WYCA 1GU0A 3F7TA 5LIPA 2C7PA 2X4HA 1ZRMA 3J7AO 4YDRA 3DW1X 3U9GA 3SWWA 1J9GA 4L50A 3GC6A 1HT2E 3RROA 4ACBA 2PUHA 5AJTA 1PEDA 4GZMA 5KHLB 3BA6A 3PX3A 4FZ5A 3UXMA 4ZYZA 4BV2A 4E2YA 5LU8A 4I1PA 2BFOA 3HXMA 2FPPB 1NFFA 5GGXA 2HPIA 1E3OC 1AKEA 4N9HA 3F8CA 1KJQA 2QG6A 2QLFA 4TRRA 1X42A 2NXJA 1TJNA 1G9XA 3V8EA 5FLVA 2JS7A 5THKA 1WCWA 1I5RA 3OFVA 4R2KA 2ZUVA 4TLDA 4BBJA 2ZNZA 3B60A 2GN4A 3C5HA 5HCNA 1D9ZA 1TTPB 3TLEA 3BQNB 3CSDA 3K0KA 3E6BA 5EZYB 5C32A 2V54A 3F1LA 2JAXA 1G2IA 2LD4A 3G8DA 4QYMA 5D01A 2HZDA 4ZKEA 5C8YA 5AM3A 1RHUA 5LU9A 2VSNA 5EZ5A 3EN0A 3K0AB 3PC7A 1J70A 4P4LA 4Z9YA 3JVVA 5C18A 2ZRKA 3MVEA 2V7TA 4GI5A 1PS9A 4D5FA 1LC3A 1O95A 3AG2H 3HCDA 3ZIAD 1GPDG 4H4DA 2ELJA 3DYBA 1G18A 1Y6FA 5L4NA 3OLYA 2YY5A 2XGDA 3CUOA 4MKHA 4YRLA 3C6YA 4Q3DA 1OXMA 2OGSA 4XR6A 2QM8A 4QREA 1YFJA 4CQMD 1Z17A 2ETXA 2QW8A 1U5BA 1YHYA 3ZE7A 2IEKA 3OJXA 1QX4A 1YW9A 4NFYA 2Q3HA 3DCFA 3I2YX 4AY5A 2QS9A 1Y4ZA 2XRYA 2A5DA 3K4BA 3R0XA 3QBTA 3SFIA 4I3FA 3TDNA 4JBWA 4RPKA 4E5VA 4DMHA 3TFOA 4GXTA 1GT91 3M49A 1Z77A 3OA0A 3BWBA 1UOOA 5HLHA 1LLQA 3KWFA 3CPHA 3CLVA 3BBPA 5BV0A 2PX5A 2IPLA 1PJ4A 2VKHA 2BFDB 1ZG3A 1Y7IA 3VV2A 1L7AA 3DM5A 5LBIA 1WWXA 1FDTA 4YCCA 1ZKGA 4XLAA 2HEGA 1DT3A 2P90A 1GPMA 1U31A 5A71A 5JATA 3C6KA 3I0MA 2HHLA 2RHCA 5HGXA 1W9MA 1UT5A 2FG7C 2O0JA 2OV6A 2ENWA 4NBTA 4B3GA 4PF1A 3I8XA 4CTKA 2JJ2D 2IGMA 4AP9A 2W6OA 1F6WA 2YXNA 2HGSA 4M73A 4DNFA 4EB6B 1IXSB 3VYWA 5FLMJ 4V1CI 3MT9A 3A3PA 1EA5A 2DUMA 4BTEA 4HMOA 1GT0C 1C8VB 1U80A 2WY8Q 2VG8A 2ZUDA 3P9PA 4AIHA 2HVRA 1PDVA 2A0XA 4GE3A 3GA7A 3KR9A 4G07A 4X1OA 1N2EA 3C2HA 1M33A 4BMXA 1J25A 1ABEA 4NZPA 5FKLA 2P5VA 3GAZA 3O3CA 2IUUA 1TAQA 3IELA 3C1UA 3LZCA 3K0HA 1GPKA 3NTUA 1TZKA 4URVR 4PO9A 2X5OA 4YUVA 1NSFA 2YVLA 3M89A 4B4DA 5KHOC 2XV4S 5F04A 3LY7A 3MWGA 4RK4A 3IOCA 3U49A 4EA7A 4AF7A 1Z4NA 1SVUA 4CLRA 2ELHA 2VJPA 3FA2A 1RKTA 3EAGA 2YKGA 5FO5A 1IB0A 4MJ3A 5I4CA 1GU7A 2LSOA 4A6XA 1XDZA 3C3XA 1NQAO 1AA9A 2DYSH 2IDKA 2XYVA 4NPAA 3RVOA 3TW8B 1N8TA 3GFSA 4QL3A 3HO8A 4EFKA 1GUFA 3OL3A 1GYPA 2H4HA 2QJRA 1U81A 3CPJB 2IOFK 4HH1A 4L95C 5DH9A 1T8IA 1RMTA 1LPOA 2VKVA 2QUKA 5HM6A 3OA2A 1QAMA 3QWIA 4NKRA 3PFYA 3J80Z 1TCCA 2VJBA 3FX3A 3JATB 4HVLA 3N28A 2HF2A 4KC0A 2X13A 3NV7A 3AL3A 1IUPA 3JYLA 4GR4A 3TL2A 3UJ9A 3LSJA 1Q12A 2N75A 4KIFA 4BPRA 4DLNA 5F27A 4RCVA 1BE0A 4W5OA 1J0RA 2EW8A 3O3NB 3FHOA 1QF7A 4CZ2A 3TEDA 1ODFA 2VH2A 4L9AA 2E0IA 2JJ1D 3VMFA 4ER0A 2PUAA 1OV6A 1OCTC 5DSZA 3CEMA 5CVRA 3T5AA 3RIXA 2BFNA 4ZVNA 3HFJA 5E8IA 5A2QZ 1JKFA 1OOEA 3HJRA 4JZYA 2XQJA 2YDXA 3NWTA 1JBQA 2ZYSA 1R5HA 5DHSA 3CLUC 1F5NA 2P0YA 2Q62A 2YWJA 4XIGS 1V5WA 2H00A 3KOXA 4DCMA 5LGTA 1ITYA 4RNDB 2W37A 5E1OA 3VPDA 1VLHA 3KRTA 4U7DA 4IPTA 4WKGA 4UHDA 5IVIA 1XTRA 2D5BA 2C4UA 3BHIA 4XNFA 2NNYA 1L4BA 3UGKA 3EK2A 2ACKA 2FUEA 3ESZA 3PGA1 4TTPA 4MJXA 1IHUA 5GTIC 4OLHA 4XAQA 1D09A 1IXZA 1R5OA 4R2LA 1FX0A 1N92A 4KIJA 1M75A 1P1BA 4KFRA 1PV2A 3RVJA 2BDEA 2GK6A 4HWOA 1VGQA 4MB0A 3V1MA 3CVOA 1QZEA 2V7WA 3K3PA 5HKKA 1H2BA 5K3EA 5GMOA 1L5KA 1XVUA 2HJGA 3LI2A 1OTHA 3ETCA 1Y89A 2XWQA 3ILVA 1PYOA 1N33B 5CGQB 4K87A 1ESMA 1Y82A 3D3NA 2Y77A 3D0QA 2AF4C 3JWPA 1TA0A 1JYSA 5EIFA 3OYJA 3EQZA 1LA2A 3W2GA 3WZMA 2IGTA 4O4JF 2NXNB 1R6AA 2PMFA 1DUVG 4EB6A 4KR6A 4HS9A 5FP0A 2NU9A 4HDRA 2GUWA 2BMAA 2OTCA 2WVHA 3KIPA 2G82A 3NIGB 4IUDS 3ZS8A 1L5HA 2OBFA 5HKKD 1BG6A 1Y3IA 4GX2A 1BWPA 5JLWA 3ZXYA 4NOMA 2ETHA 1YO6A 2P8SA 3MUFA 1NVAA 5ES3A 1OVGA 1E2EA 2NNWB 5H80A 4IF4A 3DEZA 2F5CA 5ALMA 1OPXA 2A2ZA 4FR0A 5F3DA 4KEAA 3RC7A 3RTAA 5AH0A 4B73A 2MGQA 1SRRA 2I6TA 5A4DA 2IBTA 3JRNA 1XDWA 3L1HA 4HTAA 1ZH2A 2GHIA 3HWWA 3NGXA 4NS1A 5JQGF 3D8NA 3BQYA 5HS9A 2NVTJ 4C3VA 4OXKA 4N39A 1XKQA 3F7NA 3JRWA 1D1SA 3MJTA 1OH6A 1AS3A 1F7UA 2FSVC 3MJFA 2E5NA 4MO7A 3L43A 3B6ZA 4MCIA 2EPFA 2CV1A 1YI2I 2R97A 5H02A 5DN6D 1Z4OA 1IW7F 2DAOA 1JSXA 2WD7B 3DEWA 3LT5A 5HGJA 2QP9X 3ZPXA 4D45A 1LW6E 4D9MA 3ZDCA 2A84A 3I5UA 4KACA 1HCRA 3F46A 3V6MA 3FF5A 2VJAA 4XM3A 4PAGA 4S1OA 1SWWA 4QKQA 1FU8A 1VMKA 1Y7PA 2VUMJ 1QYIA 2WM8A 2VSQA 3OLVA 3W3AH 2PXCA 1P0IA 4IYRA 1LDMA 4IM7A 4OLFA 1MIOB 2ZJ2A 3RRMA 1NZDA 4AXXA 1TUBA 2KDOA 2HSWA 3AF6A 1EP9A 3SBOA 2Q5JA 5DO9A 3K6SA 1HT0A 5CXUA 3H5RA 2OGWA 3JWGA 4NPHA 4LZAA 4KV9A 4HZUB 2PGJA 1FJLA 2I2BA 2XMBA 3K6RA 1JYEA 2C5FA 3C3YA 4HJRA 4PZCA 4HL6A 2JFXA 3BKWA 3M9WA 1PHRA 2GAAA 4MMYB 1MQ8B 2O7QA 3CH7A 3H7IA 3KLPX 5CHEA 4TKVA 5TVGA 5FUQA 1F2TA 4ZH4F 2J32A 1JIKA 3F2VA 2V9KA 2YV2A 3F23A 4HI0E 4IXNA 1XRJA 2XF7A 4RIFA 3ZUPA 2EZ8A 3ZI7A 1JPVA 4XTCS 3HDDA 1OPRA 5C1PA 1MMNA 1NPYA 3OZBA 3P26A 4HP8A 2IHZA 4JR2A 3VOSA 3BERA 4AO8A 2QTMA 3M34A 2FSWA 5C34B 4WLVA 5TE9A 3UMGA 2DH6A 5F2KA 4E3WA 2CWDA 5KIAA 3GMSA 1YDHA 5DI9A 1HDXA 5ERIA 2CB0A 4NE7A 1SC9A 3HRSA 2V1UA 1GZ4A 5L51A 4HLYA 2NTNA 2WF7A 1NMYA 3B9BA 4OI2A 1ZR4A 1RRVA 2CMDA 3RFFA 1QH8B 3I55I 1U0SY 2WB1A 4ETSA 1B9MA 1TK3A 3E61A 1B0ZA 1RMQA 1FSPA 3QKIA 3HUGB 1ZA1A 5D87A 1G4UR 1JGTA 4HB3A 4D81A 1THTA 5AVVA 1PJ2A 1QQ6A 1W4BA 4CLDA 3VO2A 5BMVA 4BLQA 4B7ZA 5JADA 4CXMA 5IULC 4JIMA 4FUTA 5K0NA 2YNMC 3FMOB 2HADA 4LMAA 2Z9OA 2PRSA 2VCHA 4FFBA 5KINB 5CLSA 3WE3A 4V3BA 2Q2WA 4FHZA 4J0EA 1SG9A 3A10A 1X80B 5FQOA 4ENJA 1UBEA 1IQRA 2QZJA 3KJIA 3ZV3A 5L3ZA 2CQNA 1QBGA 2KLHA 5IFKA 3EZ6A 2D1SA