4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
b'MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional regulator BasR
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
1FNNA 5DKFA 3U2RA 2G9WA 2O61A 3EGCA 1QGPA 4HV6A 4G6QA 3MYYA 1JF8A 4MR9B 2XGXA 2BYVE 4EYQA 5EEHA 2QUFA 2XAFA 2N9UA 1NXWA 1WWXA 3O2PE 3WE2A 4H0EA 2H0AA 2LPMA 3JW4A 3PQJA 4WF2A 3LOPA 5HLGA 4N0QA 3K9CA 3KP4A 3LQRA 1M2FA 4LE2A 3G1WA 2HQOA 3WTSC 1IAWA 3IPCA 3RVPA 4L0ZB 1GUDA 5KQGA 4PDKA 2FSPA 1SFUA 2P4WA 1PUEE 3NHMA 2G7HA 5JVTA 4OIOF 5E1XA 3VOEA 1LDDA 1PDNC 4R8HA 4RK4A 3WTZA 3ROFA 2VYCA 3BJAA 3F23A 5KI6A 1O3TA 5ILVA 3GUDA 3LUDA 2K02A 4PCQA 3TO7A 1TMYA 1ZAOA 3LUFA 5TQJA 5FO5A 3TB6A 1PHRA 1OYYA 1ZRCA 2PUDA 5HOOA 2VBZA 2L4AA 1DZ3A 1TQPA 3RVSA 1E6LA 3KG2A 2OD5A 1W5SA 1ZGGA 2QQAA 1VPWA 4XSXF 5H20A 5DUKA 1ZHFA 4F3TA 3N0WA 1WI9A 3DGEC 1ZGJA 3H1EA 5IT9Z 3FMSA 3TX6A 3K1NA 2A69F 4OMZA 4R79A 2DQRA 2L54A 3VEPA 2FMFA 1JGSA 4DADA 4RK6A 1HW1A 2IA1A 1XGOA 5KWSA 4NHJA 1JFSA 2CO5A 4DQDA 1OKRA 1K7AA 2B4AA 3SZPA 3TOBA 3GBVA 1J56A 4ENNA 4ON0A 1H9TA 1LJLA 1XCVA 3RVRA 3ML6A 2QVGA 4LK0F 1XN7A 3RI4A 1JL3A 4Z4CA 3KEOA 3C6QA 4LG0B 4KQCA 4L85A 4YS6A 5HS7A 4KK4A 4MR8B 2BGGA 4N9IA 3NNNA 1IN4A 1JBEA 3I42A 1P4AA 3HOSA 2M87A 4LZLA 1QPMA 2UXNA 3N97A 2A3SA 1ZG3A 4NCAA 2HQRA 4P55A 2IYNA 3GEZA 1FZPB 3RH0A 3O2SB 5B3JA 3FWEA 5DD4A 3O2QB 4A0XA 3COAC 4JAVC 3DKWA 3E5UA 3E6MA 1Z7UA 4KMRA 2RN7A 4JP1A 5TPWA 3N6VA 3CTAA 4I02A 1IN8A 1SFXA 1SXHA 3JPYA 4EM1A 2GBPA 1EH6A 3LA2A 1S29A 3H3UA 4M9ZA 2NAZA 3W9SA 1Z2DA 4D6YA 3W6JB 4TMYA 4BYYA 1BAPA 3HIFA 2QWWA 2MSWA 2OZUA 3IWZA 4EM2A 2GQQA 4IGAA 1OR7A 4PGGA 4UHKA 3I4PA 1U0SY 2EV6A 4HAMA 1QQBA 1Z05A 2O0YA 3F8MA 1U6GA 3O6BB 4EYOA 5JNWA 2M30A 2PJUA 1USKA 2JVIA 3KS9A 1QNTA 3CLKA 3SM9A 3F73A 2FKAA 5CVIA 5L3GA 3T6KA 2H6CA 5TE9A 2FF4A 1O7FA 4PEVA 1FBUA 3P9CA 1G3TA 5IUKC 4BH9A 3HO1A 4G86A 3V8LA 2WTEA 3IKVA 2O03A 4G0YA 3I64A 3DP7A 2VXZA 3F8CA 4YCSA 5F6FA 2IA2A 3H5IA 2DK8A 2BEOA 4I09A 1EHCA 2PE5A 2YHAA 1B1BA 3F8FA 2R4QA 2DW4A 3FFTA 4WXMA 5FGMA 1FQWA 2L18A 5LRRA 2D45A 2EJRA 4WUTA 3IP9A 1WRJA 5KQPA 3CU5A 1S3JA 1JX6A 1BI0A 1U5TA 1U2PA 2MYUA 3SY8A 5JNUA 2ACJA 1DCKA 3CJNA 4G7HF 2X0LA 4MGEA 5E8IA 2AXLA 4ML3A 3SNKA 2P7CB 1YW8A 1ZG1A 3F22A 4Z4GA 2XKPA 4H60A 4KT5C 2JTVA 3HDGA 2DO7A 4AIJA 4G7OF 3OM1A 4ETNA 4FX0A 4CZZA 1TLFA 4HA8A 1J5YA 5C5EA 4A6EA 4L18B 1T34A 3GZ5A 1QBJA 5ABPA 2VOOA 2HOEA 4UV9A 4RB3C 5HDGA 2NS0A 1JE8A 3IKTA 4PICA 3KYJB 2MH9A 3TGNA 5D8LB 2QBYA 4OIPF 4MS3B 4UHJA 1DUXC 4JB2A 2UWMA 4L9TA 4O1IA 2HSGA 1T38A 3T1BA 3DV8A 1C0EA 4MQFB 5J6XA 1USIA 3I58A 3RPQA 2JPBA 3E6CC 5ICEA 2PKXA 3WODF 3KP2A 2XROA 4RY8A 3IWFA 4KIBA 3U9GA 4H3HB 2P7VB 4FX4A 1SRRA 1M2EA 4ZYLA 2HDCA 5TPZA 4WWHA 1KU7A 5FBHA 4N41A 2EA4A 2BV6A 3HZHA 3ZMVA 4Z99A 1MZBA 3MWMA 5DDGA 5A2QZ 1U2WA 3L9FA 2HQBA 1ZITA 1R36A 2ELHA 3ILHA 4G8XA 1E6MA 1ISSA 5D5VB 4E7PA 4Q4ZF 3HDVA 4L5JA 5TQ2B 3H92A 1MJBA 5LHHA 1MIHA 1JFTA 1D5VA 3WGHA 2W42A 5EWLA 2PN6A 4FT8A 2HKXA 3G73A 3RQIA 1UHWA 3ZMZA 1Z9CA 2IOYA 2K4BA 5JFRA 3G85A 4M74A 1D1QA 3KP5A 1RUNA 1KRXA 4TLLB 2RJNA 1BBYA 1GCAA 4NV3A 3L09A 3ILYA 3F8NA 1NXPA 1P92A 1AWCA 3ECHA 4HQEA 3LA3A 2XVCA 2QQ9A 1GUBA 2PJPA 4Z4IA 1TM2A 1HXDA 3I09A 2HR3A 5K5OA 4JB0A 4EV0A 1I1SA 4JASB 4EVQA 4QICA 5E17F 2QVCA 3Q41A 2JZYA 3Q7RA 4Y13A 4KA4A 1GLGA 3LTEA 2FXIA 4HF2A 5JNRA 4S05A 5FWXA 1NXVA 5BR1A 1JLKA 3MM4A 1DC7A 4PGHA 4MTEA 3RVMA 3K9TA 1DP7P 2IP2A 1CYEA 1ZH2A 2MYNA 5DUIA 1W7PA 5HS9A 3ROTA 2I6FA 4Q7EA 1B6AA 2FNAA 1L5ZA 2QSJA 2R7FA 4M73A 1YTUA 3O3KA 2NZUG 3F6VA 3BPVA 3ZQ7A 2O6GE 1ZH5A 5DD8A 1FC3A 4XBFA 4IHSA 1W5TA 5F1RA 2VBYA 2WRZA 2OU2A 4LGWA 2OQGA 3OO1A 3HEBA 2IPQX 3GBPA 1FX7A 2H09A 3O1HB 4F06A 4MS3A 1XGNA 4MS4A 3R0JA 3DXJF 2PFBA 1TW3A 3CTPA 2XAJA 2DU9A 3VFZA 1BC7C 1DBPA 1PUXA 3O1JC 1SD4A 1RUOA 5EWMB 1A04A 3LUJA 4MR7A 4M88A 3DLHA 1RI7A 5CVRA 2M1BA 4Q48A 3QELA 3EULA 2LSOA 4I2OA 2VUHB 2FEPA 2KIUA 1YIOA 3V7RA 1DG9A 3CNBA 3GL9A 2BGCA 4KRFA 1QP4A 3CUQC 1T39A 1D8KA 1UB9A 1GXQA 4HF0A 2RDMA 2EA2A 1OYWA 2FBIA 5J8FA 1IIBA 5DCMB 5KQLA 1K78A 2L17A 4I01A 4HNSA 1DPUA 5HVQC 3J80Z 4B8XA 1D8JA 1DRJA 3GYHX 3LUHA 3RVKA 2VBWA 3G3ZA 2FMHA 3O2JA 3BILA 3GVAA 4PZJA 1DCFA 5BQ3A 2ZKZA 2OA4A 2M98A 3BP8A 3RKWA 4Z0NA 4G0ZA 5L3FA 2DTRA 1IUYA 1KQ0A 4G0PA 2ZWMA 4RGSA 2QYOA 1XGMA 1W25A 1TVMA 3V7SA 3HRTA 1BI3A 3VNBA 1P6QA 1Z1DA 3P7NA 1IF1A 1FLIA 1EV7A 3M9AA 2MYPA 5B3JC 2VODA 1JYFA 4KN7X 1E17A 1DRKA 2IPNA 1MGTA 4ZZDA 3N0RA 3J81K 1USTA 4QWQA 2ZJ2A 5CJ9A 1GHCA 2M1ZA 1BI2A 4ZMSA 4ZJPA 3FMRA 3ULQB 3OQMA 5L3BA 1BDIA 2VK2A 2QM3A 2FEZA 4UVBA 4OTZA 1YW7A 2JPCA 2W57A 3AAFA 2PLNA 3T8YA 1U78A 5JNTA 1MD0A 2IJLA 2LF7A 3D0SA 2HFHA 4BQAA 3KZZA 1Z2EA 3CUQB 1T98A 3V4GA 2VE8A 2ZO4A 3Q15C 4S04A 4AVPA 3DFGA 5FD6A 1MVOA 4L0YB 3QX8A 4EMSA 2P5LC 3TOAA 2L3DA 2CHEA 4OIQF 4MS1B 1XMAA 3PFIA 2V1UA 1PP8F 1JWLA 1KGSA 2CGPA 1Z91A 5L3EA 3GW2A 3S2WA 4YFXF 2M45A 3T8RA 2P6SA 1TNTA 2HQNA 4U0YA 3OQOA 1TJYA 2YU3A 2VT3A 2WY2D 4ZYHA 3OMXA 1XHFA 2EFNA 2X7XA 1XHEA 3QEMB 5EWMA 6PAXA 4M9XA 5ICGA 2P4UA 2ADUA 2K7LA 1FT9A 1MDMA 1UHMA 4W5TA 3WTTC 1EFAA 3QLUC 2CWDA 3CO6C 4Z4FA 1KA8A 3KZYA 1BIAA 4UV8A 1ONVA 1W4MA 2W84A 3NBMA 5L3DA 4HF1A 1Z6TA 4EGSA 1F1ZA 4F11A 3DGFC 4P9UA 4YIIA 2ISYA 1YFHA 4PYRA 1BI1A 2ZBKA 4RB0A 2Z5UA 5HDNA 3E5XA 4N47A 4RS8A 1A0OA 3N4MA 1IN5A 3GFIA 3I5AA 2IPMA 1ZAYA 4XFKA 5BOXA 4LLNA 4F8JA 4MRMB 3D8UA 1USGA 3WU0A 4RY9A 5JNSA 1Q1HA 3K69A 2NT3A 5GOTA 5IUNC 1ZREA 3LKVA 5D4RA 5IULC 3I71A 4MYRA 1BJAA 3IL2A 3BROA 4EJWA 3QEKA 1EWVA 2JVJA 1CHNA 2HYFA 2R47A 4RKQA 2FA5A 1VRVA 1FBQA 2ETHA 4QLCU 3CO7C 3CS3A 1NXSA 4RZSA 1BDHA 4MNUA 3GFMA 4ZPJA 1FYKA 5LGUA 3KE2A 4IMIB 4LDZA 4M71A 1IRGA 1NXOA 1D5WA 4G7ZF 2K86A 5F64A 2O20A 5LHGA 4LK1F 2LIVA 3HM9A 1L3LA 3BPXA 4XLNF 3O74A 5D6FA 3IP6A 2FEKA 2YHBA 4QYWA 4YIFA 5CNKA 4ESFA 1URPA 4CGZA 1S7OA 1Z15A 2WJAA 1YQAA 2M8EA 3T0YA 4OLAA 3O1IC 1XWWA 1YK0A 2RGYA 3HSYA 2FLWA 4KQ9A 3KKEA 5AIPA 2BBYA 2L02A 2NT4A 1RZ4A 3I0TA 3MZYA 1PNRA 2E7XA 4TLMB 1PNTA 1J0RA 1D3YA 4BAYA 3BREA 4P98A 4A5MA 4HX8A 4MPTA 4HW0A 5E1WA 2IDMA 2OENG 3FXUA 3QAHA 2UXXA 2GZWA 1AB6A 3V8KA 4RV5A 2QENA 1UDRA 3QK7A 3QLVA 1CF7B 2CHFA 2RQPA 5IX8A 4G9YA 5TQ0B 1U04A 4MR9A 2PMCA 4XXHA 2XV4S 1JHHA 2DT5A 4EVSA 2HZTA 2Q8KA 3GXOA 4ASNA 3NHZA 4L4UA 2H3HA 1RNLA 2OQRA 4UVCA 2FLKA 5FFZA 4EQQA 1ZN2A 3GF2A 4YV7A 5BPIA 4LE1A 5HM6A 4OOIA 3CUOA 1SFEA 1U2QA 1O3RA 3C7JA 1O7LA 2IPAB 3MQ4A 5E3JA 3H6GA 2CWEA 3KP6A 1T2KA 3GRCA 1BOAA 2LP4Y 1MJAA 1JDNA 2L01A 3Q7SA 3K4HA 1J75A 2FU4A 2V6CA 3FMQA 3PQKA 1B4AA 4HDVA 5HS8A 2WB4A 2CG4A 3WGGA 2YX4A 4GNRA 4LMYA 2GX6A 1Z12A 3DZDA 1LQ1A 2Y75A 3HJFA 1P6RA 3QLTA 5HLIA 2KRFA 3KLNA 3RDIA 2VE9A 2R48A 4EYGA 4Q5SF 1Y0UA 2A5YB 1SD5A 3M1EA 4CBVA 2JCGA 1ZRDA 4EUKA 4XLTA 2E4ZA 1FOKA 3EQZA 2ZCWA 3F6CA 2CSOA 4ENKA 5CNJA 2WC2A 4RY0A 1R5GA 1I1GA 3QP5A 1HW5A 1FP1D 2FQ3A 2K27A 1ABEA 2VUIB 3M8FA 3MF4A 5A2QK 1F9NA 3HSEA 1LK0A 5FWYB 4RSMA 2Z99A 4MEYF 4YG2F 2NNNA 3GX4X 3ZP5A 2QR3A 2XKOA 4RKRA 5BRJA 2CW0F 2IVMA 5DTEA 4Y17A 3HUTA 2DRIA 4RK0A 1WSUA 4KVFA 4IVNA 4NQWA 4LDAA 3SQNA 4M6YA 4O6JA 5D2CA 5LBQA 3KYIB 4WCGA 2HS5A 4A0ZA 3L2CA 2FMKA 1CGPA 5HLHA 2W24A 4Z2YA 2Z33A 2P5VA 3C1DA 4LG0A 1K6OA 4MR8A 3DEUA 3M7GA 2PBIA 5PNTA 3GA5A 4OU0A 4OATA 1LEBA 1Z26A 1R22A 1DJMA 2WJWA 2O3FA 1FPQA 2PEXA 1SAXA 1G6NA 2K4JA 1MJ9A 3DPLC 4OLBA 2A68F 5HQJA 4P5OA 2HKOA 4PE5B 3TDUC 3WTXC 2EB7A 1WQ2A 1P4XA 4G0OA 3R4KA 3FM3A 3CZ5A 1YMVA 2JBAB 5ILUA 1RXIA 2A9RA 2KIMA 2MH2A 3JY6A 1JHFA 1RIOH 4WT7A 3WG9A 1O3QA 3R0AA 4K2EA 3RIRA 1ZLKA 4KZKA 2VBXA 2QV0A 2RNJA 4NB5A 4W5RA 4E7OA 2YR2A 4EGZA 2L19A 1QO0D 2ISZA 3Q9VA 1RXEA 1O3SA 3B2NA 3IRQA 3IPAA 5CNMA 1Z18A 4KIFA 2D2WA 1SXIA 1R58A 2BE5F 1F51E 4KMFA 3F7NA 3HOTA 3HXMA 3QP6A 1G4DA 3NRVA 4AIKA 4ZMRA 3JAMZ 3JSPA 4RAYA 3F6OA 3P9IA 3V8JA 2KKOA 4IF4A 3GT7A 5DCLA 1ZESA 1FY7A 4KIGA 3OM0A 4BHBA 5DCFA 4UNOA 2W25A 3HUUA 3ROUA 2EFWA 1LB2A 2H27A 2A9QA 4MQEB 3RVJA 3GFJA 2MYTA 5IBQA 3ZN1A 1QQAA 2HEOA 2IRFG 2DBBA 4KV7A 3T5XA 1XMKA 3UUGA 3QX9A 5D4SA 1MB0A 3KEQA 4GPAA 3D02A 2F5FA 3EODA 1G3WA 3CLOA 2GWRA 2QXYA 1AOYA 2HTSA 4YRZA 1TBXA 2RV8A 3EJWA 2VC0A 3D5LA 3EUHA 4EJVA 3OLYA 1FP2A 2NNYA 1KU3A 4I7HA 2VONA 1XB4A 3HVRA 4UUVA 1R23A 3CZCA 4OG2A 2PI0A 5CNIA 4HLXA 1KQ8A 1DCMA 2V1XA 3HS3A 5H6RA 5FLXK 3C3WA 3KP3A 1U3EM 1K66A 1PEYA 4ENMA 2E1NA 3R60A 2P5KA 4IXAA 3BZ6A 1S8NA 2TDXA 1LDJA 4RK7A 1QMPA 2MLGA 2XAQA 1GVJA 1KMIY 3BBLA 3GFLA 2ESHA 4N76A 1VLZA 5LEKA 2Q0OA 2EFQA 5ILSA 3H5WA 4FHTA 4KK3A 3B02A 4UXNA 1TTYA 3LWFA 4ETSA 3BY6A 1R1UA 2DAOA 2A6HF 1Z16A 4MQFA 2DFIA 2GAUA 4FB4A 3RYRA 2MD5A 3RKXA 3MZHA 2ZMEB 1L5YA 1FSEA 1XSXA 2CD7A 4Z9AA 1IW7F 4IRIA 1M5UA 2XASA 3MIZA 1CEYA 1GXPA 4LLLA 1E6KA 3E3VA 4G97A 2F2EA 2GI4A 4H3KB 2YX7A 3E61A 4NCBA 3FGZA 1TQIA 4YR7A 4KREA 4N03A 3ZN0A 1HBXG 4HBLA 1YS7A 1R00A 1IRFA 2JBAA 4N0PA 2PL1A 5CVJA 2IW5A 3QU3A 4G94A 5TQ2A 2RJOA 5D5UB 4MQVA 2P8TA 1XDUA 2A9PA 2FOKA 3ECOA 1XGSA 2VT2A 3BDDA 2FN9A 3H1GA 5H6QA 3C3KA 4IHTA 2VC1A 3QOPA 4KPYA 5ICFA 4Y15A 3WE3A 2PUBA 4HNRA 1LEAA 3T38A 2FMLA 4YO7A 4MLCA 1STZA 3FM5A 2PUAA 2DQLA 4Z4HA 1I27A 5KK1A 4KDPA 1YTYA 1JH9A 2RKHA 5T3YA 3EDPA 4F12A 1C4WA 3RVOA 2IKSA 2E4UA 1E2BA 2LUOA 2EFOA 1B59A 3KCNA 3T95A 2FRHA 3ZMTA 1QZYA 1HSJA 3QLVC 5HKOA 1OMIA 1NY5A 4OINF 4FE4A 3TO6A 2NYXA 4XAQA 2ID9A 4XLPF 3IP7A 3H5OA 2F5CA 4ZYDA 4LE0A 3CDHA 5CVVA 4MAAA 1QQIA 3QPHA 4AIHA 5JR3A 5DGCA 1ABFA 2J48A 2V1DA 3I54A 4W5OA 3FHZA 3Q9SA 3VODA 4RXUA 1TQMA 1Z25A 1SD6A 3GYBA 5BPDA 4TV7A 3RYPA 4XASA 4RS3A 3EYYA 2H94A 3UK0A 4EM0B 1WKMA 3A0RB 3ABUA 4RU1A 3URMA 3ZMUA 1TLHB 3ZMDA 2DK5A 2B0LA 1V4RA 4N0BA 1JFVA 2F8SA 3LSTA 2WWYA 4P1ZA 4G6DA 4O3MA 5JS1A 4W5QA 4KFCA 5EWJB 5FFXA 4RXMA 1QZZA 2QVOA 1LDKB 5AONA 1QNLA 2E4WA 4GYGA 3A3KA 2ZFWA 2XAGA 3RJPA 3RVQA 3IP5A 5JS2A 3F21A 2LF8A 4HX4A 4WWCA 2ZMEA 3LA7A 3LQQA 1R8JA 3WTUC 1FSHA 4MLDA 1Y1LA 4E70A 4GGGA 4ZYEA 2LDUA 2FQWA 4XRFA 4EGYA 3R6SA 1FYMA 5J8CA 3L00A 1J59A 4KNYA 5IT9K 1UFMA 4I98B 3RKYA 1U5TC 4ZZLA 5L3CA 1S7AA 4WXCA 3J81Z 1YW9A 3E97A 2UZKA 4HLYA 3MMNA 5TPWB 4IRHA 5LGNA 3H75A 1IN6A 1NTRA 4RDCA 1P2FA 1YVUA 3FDFA 4I0AA 5DCMA 3T8TA 2LNBA 1DBQA 3U1DA 6CHYA 1MKMA 4F7ZA 4HYEA 2PMUA 4JA2A 4LB5A 3HTUA 4U88A 5IEJA 4ETMA 3OLWA 2MSKA 3FX3A 1Z17A 5IT3A 1W7PD 1P6UA 2MBFA 1TW2A 4U0WA 1R1TA 2F5DA 2STTA 1EWTA 5CHYA 3SXYA 3F8BA 1F4VA 4RGRA 4W5NA 3TQNA 2FNPA 4M6XA 1R5HA 4Z9BA 2HPHA 1G3SA 3OLZA 4KICA 5CYVA 1UCRA 4XSZF 3SAJA 1ZHHA 1DPRA 2DI3A 2RVCA 4GO1A 2B1JA 4WX9A 1B9NA 3TO5A 2G7UA 3J7AO 3K1PA 3NNSA 2D1HA 2XUBA 4LD5A 1VTNC 2A6EF 4IRGA 3F72A 3W6KB 1KYZA 3LMKA 3N0XA 3HRMA 2KJBA 2HGCA 2PQ8A 3M8EA 1NXTA 3HCWA 1D4ZA 3H3ZA 1L0OC 4Q6WA 4GCVA 2LKPA 1Z13A 4D0PA 1U5TB 2W85A 3MCZA 4CICA 1ZG5A 3L6UA 2FN8A 2ZAYA 1KQ9A 3CUQA 3E5QA 5LHIA 4HZFA 2LBPA 1LVAA 1QO0A 3F3XA 3VB2A 4Z4EA 1FBSA 4CO8A 1IXSB 4U7BA 4EJUA 3FFXA 4MS1A 2DLLA 3RVLA 1QP0A 5TRDA 3JVIA 1TNSA 1H0MA 3CKMA 1HQCA 2ZNZA 1I3CA 3KP7A 2PUEA 2VOPA 1H9GA 5EWJA 5E8GA 1G3YA 1D2AA 2XDYA 4A6DA 3TKYA 4UVAA 4YLEA 4D74A 4IJAA 5JNVA 1J7KA 1B9MA 3HSFA 1SD7A 2V9VA 3TDZC 4JQFA 2GKGA 2QBYB 2J5PA 3QEMA 3OLXA 2QZ8A 4KMUX 1I6XA 4RB2C 1QP7A 3SG0A 1ZVVA 2YSRA 3C97A 2Y48A 1EH7A 3MA0A 1OYIA 4U7DA 5JHUA 2FQXA 2GXBA 1A2OA 2WV0A 2FQYA 2L4MA 2CQKA 2PLYA 2NRAC 5DEQA 1KRWA 3I45A 4HX7A 3NQOA 3ELKA 2FSWA 3KFWX 4P9FA 3UKJA 3KTOA 1BVHA 1NXXA 1C0WA 1V3FA 1HSTA 4IMJB 4AWXB 1ZLJA 4RK5A 3I5UA 1Z6RA 3R61A 1JDPA 3WTWC 4CYDA 4MRMA 1U8RA 1F5TA 3WGIA 2Y0MA 1REPC 3O75A 2RC4A 2FMYA 1RZRD 1MAVA 2CFXA 3FXRA 4MQ9F 1XSVA 3BRQA 2X4HA 1ZDMA 2MLKA 2FW0A 2COMA 2KJCA 2MC3A 3RVNA 2QLZA 5EWLB 1YMUA 3JPWA 1QPZA 1IXCA 3LUCA 3L7WA 5K5RA 3EDCA 4MHGA 1HEYA 4DN6A 3HTSB 1ZH4A 2FMIA 2XAHA 2P9HA 2V79A 4WXHA 1EAYA 3WTYC 2E7WA 6ABPA 4AD9A 3QRFF 4IPAA 3OV8A 3ABTA 2EK5A 5E20A 3TMYA 4Q6BA 3MFKA 4YGXB 5CVUA 4RWEA 4YWHA 3C3MA 3DLBA 3Q7TA 3GWGA 4WZZA 3E6DA 1SMYF 4RAZA 3QLUA 3OMWA 3BJ6A 1LNWA 2HJ9A 4Q47A 1ZRFA 3GWZA 5FWXB 3OO0A 2IA0A 3K1MA 1ON2A 2PUFA 5D8KB 4TN5A 4R1HA 1XDSA 5IEBA 3ERED 1YS6A 4NQRA 2R25B 3HHHA 1W7PB 1YG2A 2KIFA 2TMYA 8ABPA 3OQNA 1USSA 3JAMK 4HQMA 1RPJA 5JI6A 2R3SA 3TO9A 4U0VA 1NATA 3I59B 1YLFA 4A0YA 3IC7A 4B09A 2F5EA 5ED4A 4NICA 1APBA 2Z9OA 3H5VA 1CF7A 2PG4A 4LLGF 7ABPA 3LAPA 5TQ0A 3VNAA 3JS5A 4Y9TA 2ID7A 4MS4B 4EJTA 4EVRA 4LFUA 1FWZA 4O1HA 2A07F 2F8TA 2XIGA 4GXOA 3GO5A 2AS5F 3ISPA 1P8AA 2EWNA 4MR7B 3KETA 4EYKA 3BJOA 3F6PA 3LUKA 4OBBA 2FBKA 3QELB 2EV5A 3BWGA 1YO5C 1BA2A 1OXKB 1M5TA 3Q5FA 4CXFA 3REOA 5BMZA 3N8IA 4G0MA 3EQLF 2NUBA 2KYRA 3JVDA 3IRRA 4P96A 3DQVC 4M9SA 5BS6A 4JK1X 3LKBA 3M6MD 5FB2A 1SMTA 3HSRA 1HKSA 4YP9A 1YK1A 3GZ6A 2D1VA 2PAFA 1K78B 4EJOA 2PUCA 3EQ2A 1XCBA 5LGTA 4DNCA 1ON1A 3MQ0A 3P9YA 4WXDA 3FF5A 2QW1A 5I4CA 3M9XA 3L49A 1J2XA 1HW2A 4KN4X 3A10A 3JTHA 2JSCA 5D6EA 1BN5A 3CG4A 5T7BA 1IZ1A 4DQ2A 2FVYA 2Z3YA 3LFTA 3QU6A 2QQBA 3RTRA 1HKQA 3LUAA 3HUGA 2HYGD 3SFZA 3RPUA 4ZH4F 4G0QA 2E4XA 1ZGAA 3FZVA 3WU1B 3JSOA 2NZVG 5E18F 3KSMA 3OOPA 3GV0A 1IN7A 1R7JA 1ODDA 3DPTA 4XARA 1LBHA 3KHTA 1R1VA 4M72A 5AIQA 3K0LA 1BDJA 1FFWA 5FWYA 2QZJA 3EAFA 1XSDA 4PZ0A 4MEXF 3SZTA 3LFKA 1OPCA 5LLQA 2STWA 1B00A 1ISRA 1FSPA 1ZGZA 3K2ZA 3EYIA 3MAJA 3J80K 2JRTA 4BNCA 4I0BA 3KCCA 4IILA 3S99A 1DP4A 2J5OA 1LBIA 4UHTA 2GIVA 4FE7A 2VN2A 1XD7A 1EH8A 3NEUA 3ZMSA 5D5WB 1KYWA 3LAJA 5E1ZB 2CYYA 3N53A 3B73A 2E1CA 1E2XA 1BM9A 4L9VA 3H1FA 2FXAA 4CHUA 2GA1A 1LJUA 3JTGA 3MEXA 2P6TA 1EWKA 2JVKA 3CHYA 3N75A 4KUMA 4L9NA 4RK1A 5C5CA 1HKTA 3I59A 4EY3A 3HYIA 5FD5A 1IXRC 3KLOA 4EVIA 4N9HA 5ICCA 3NNDA 3HHGA 4O5AA 3ZPLA 3IHUA 2XHKA 4YFNF 4OIRF 1JHZA 4L5IA 4GYIA 3HRUA 4L9JA 4A5NA 3SHFA 2ZXJA 3JTEA 2MSLA 1S6LA 4MTDA 4A12A 5ERIA 2PL9A 4O5VA 5GQSA 2RGVA 3LUGA 3WTVC 2A9OA 1P4WA 5HSGA 1ULYA 3GLXA 4HDUA 4ESJA 3I53A 5BRAA 3FXQA 1MDMB 1T6SA 4KYWA 3C18A 1ZARA 5DLEA 2RDPA 1FFGA 1J9IA 2C6YA 5D5XB 4QPJC 5KVRA 3HRSA 1MB3A 3QPTA 4WK8F 2PMHA 4RGUA 3A0UA 4A2UA 2DPDA 4HNQA 9ABPA 2EV0A 4JOQA 4RB1A 4RXTA 3BOQA 1YYVA 4LB6B 2H6BA 3CFYA 2GXGA 4D6XA 3OLVA 3KJXA 2OAZA 2JT1A 4HV5A 5FLXZ 1DBWA 4BHPA 2WWVD 3H6HA 1AB5A 4IRXA 3DBIA 1JYEA 5EEGA 2WMYA 1WETA 2R7DA 4ETIA 2Q5CA 1ZY2A 1T0FA 5KQMA 2JB9A 4RGXA 2HWVA 1BC8C 3IDOA 1D1PA 2M5WA 4MQEA 5LRSA 5BQTA 5HDKA 3M9WA 3HK2A 4G0XA 5DV5A 1QKKA 5TJJA 1U8TA 2L2QA 1GCGA 3FMVA 3CRNA 4ZYGA 2E4YA 3H5TA 1X3UA 2Q2EA 4JBAA 3H5LA 1KU2A 2ZNYA 2XRNA 2E4VA 3CG0A 5DYMA 5IC5A 2FBHA 1PEAA 1OXBB 2OZ6A 5FBKA 3BRSA 3E6BA 1K79A 2O8XA 5TPZD 4LX8A 1W9HA 1F4KA 4BHCA 1NHAA 2DPUA 4YFKF 5K5QA 4ENJA 1I5ZA 1ZYRF 3P9KA 4LJZF 1VKRA 2IPLA 4QYMA 2YPRA 2FTKE 3O21A 5KC9A 5CLSA 4CDGA 1LJ9A 1FYLA 2AYZA 2AYXA 5KC8A 3DF8A 3EETA 2FE3A 5IUJC 4BXUA 4OMYA 2EFPA 1RZRA 3HV2A 3V7CA 1O57A 2HTJA 2ESNA 1JXSA 1SXGA 4WXEA 2JRLA 1K68A 3E3MA 1KU9A 2QU7A 4ESBA 1DDNA 2IT0A 2JK1A 2PUGA 2A61A 1PP7U 1H9CA 1FFSA 2MA3A 5LEJA 2OBPA 4HOBA 3TD9A 1BIBA 3FFWA 1DC8A 2GA2A 2V0NA 5K1YA 4LRQA 2FEWB 4MGRA
chains in the Genus database with same CATH superfamily
3OZRA 5CAEA 1BX3A 1DNPA 10MHA 1D04A 4DSUA 1PWHA 5K09A 3HE3A 3NANA 1JF8A 5BWCA 2XKBA 3LGXA 5KNDA 3K6KA 2DA4A 1NR7A 2DJ5A 2H0AA 2LPMA 4Q9HA 3LOPA 4LWPA 5DCWA 2BEKA 1JQKA 4QDTA 1MNMC 4ZDIA 4Q4AB 2G09A 4DV6B 1IL0A 2YYZA 3W8RA 4Y1FA 1X0VA 1L7NA 1RLJA 1P5JA 2NGRA 1PDNC 4H6VA 1HCRA 4NDAA 4FP9A 4O0MA 1U2DA 3VH1A 4YRNA 2QD5A 5TARA 2R5NA 1ZICA 4WY8A 3KSRA 4C04A 4U4AA 4B74A 1CJBA 5I8ZA 1L5HA 1A8SA 3NIDB 4QATA 3RFFA 1ATIA 3ASOH 4C0AC 1VPWA 4LF5B 3IA7A 1PQWA 3T7CA 1ZHFA 5JZSA 2GWHA 1QS0A 4DJFC 1F8GA 4HDSA 1C7JA 5FOTA 2L54A 2FMFA 2BHLA 2RE8A 1CVLA 2VJMB 3WU2C 2R8OA 5BV1A 5AJTA 3WBKA 1JILA 4NQWB 3GBVA 5I7OA 4C0LA 3CUEF 4ZYUA 2XRMA 1PLLA 3JQBC 1N0UA 3O3MB 3QX7A 3H6KA 5IK2A 1M34E 4Q01A 2Z9DA 3ZK7A 3PGKA 1G6KA 2OV7A 2WHPA 4BQFA 3K1AA 3EEQA 1KIMA 1FDOA 3LSHA 4NCAA 2K9LA 1QYRA 2G1PA 5EKXA 4D7NA 4XQFA 1EH6A 5C1PA 3KBOA 5FOXA 4ONEA 6AT1A 1SCAA 3S55A 1UBKS 4EM2A 1I2DA 1I1OA 3OCJA 3CLSD 5F0FA 4TV9B 3SM9A 5CVIA 4D9GA 5TE9A 1FBUA 3LKZA 4BH9A 3KQYA 4EO9A 3EIHA 3ZE1B 5AXAA 5H8WA 2G83A 2RI0A 4YCSA 3V3TA 4G63A 1EHCA 1W1IA 4EFNA 2HD4A 4BKQA 3U26A 2X48A 4WXMA 2B36A 5EIEA 2J9FB 1Z8HA 1OFTA 1RKQA 4KVGA 2UXBB 2YUSA 4FHDA 1S3JA 4B7CA 1BI0A 2SICE 1QGED 4DLUA 5HZKA 1TI7A 2FG6C 3ZEAA 4LCEA 3CUVA 1O0SA 4EFMA 5ENZA 3IRVA 1KRHA 5BT9A 1ECLA 4ANFA 2QRLA 1GRNA 5C5EA 1FCJA 1X1SA 4WBSA 1ZIDA 1TKBA 3ORSA 2WJHA 4ZOBA 1XZBA 1TZ2A 1C4OA 1QFYA 4PRKA 2QBYA 3SBDA 2MR6A 4O1IA 2YJ3A 3PSFA 2NXNB 5IYZB 1USIA 4YMUA 2FAXA 2PNJA 3OE4A 4G8DA 4GBGA 2CW8A 3WODF 3ZGOA 5GVSA 2GASA 2M6LA 3LHIA 3U9GA 4ICIA 1XZIA 4EGAA 1SRRA 1G55A 1Q7TA 3Q8LA 4H1VA 3DXZA 3W8NA 5IM5A 3MWMA 2W2PA 1O6FA 2XE4A 2Q4EA 3WQHA 4GFDA 4CIVA 3OJFA 1OCPA 5TS3A 1X4PA 1AQIA 3E22B 4ZCLA 1UHWA 1Z9CA 3BR5A 2VNKA 1GQFA 4WK2B 4CG3A 3PFWO 2ELJA 2QTBA 5C7IO 5CPBA 3JQPA 2QSYA 1X1CA 4UCQA 3UJ8A 3DE1X 2X23A 2IODA 4D02A 3EDRA 5AQ1A 3JVUA 4BMVA 2VS1A 2ZKLA 1WMDA 3RAPR 3FJ1A 3PEUA 1Z5OA 2OD7A 2R5WA 4U2EA 3TYXA 2UYYA 1KPIA 1PLKA 5JH7A 5JU6A 5FI0B 2GPNA 2FNAA 4G65A 1L5ZA 1BGWA 3ZV3A 4A7PA 5K7SA 3F6VA 4CM1A 3S1LA 1EGVB 3CEPB 2VBYA 2OU2A 3OESA 2FDXA 3UJ7A 5JHGB 4MS3A 3R0JA 2WILA 4JWKA 3VFZA 4FXOA 2RHMA 3ULKA 1T33A 2FX3A 4BCCA 3LPNA 2M1BA 4UFNA 2FEPA 3U6KA 3V7RA 4V19K 2DHDA 1WSBA 2M0CA 3HKZN 1SVSA 1CQWA 1T2UA 1AG9A 3UAXA 4GX1A 4ARUA 1VL2A 3TNLA 4XFJA 3ZD7A 4HH1A 5A6SA 2FBIA 4G1BA 3D5RC 2OF7A 3MOIA 3GYHX 4EEKA 1TU0A 1DIRA 1DCFA 5BQ3A 2ZKZA 4XICA 3ONDA 3BP8A 4UHDA 4E5SA 4A6XA 2W0SA 4RGSA 4XQEA 3SR3A 1NF2A 2PJRA 3TW6A 2Z8YA 4B0OA 1N6HA 1FLIA 4BQNA 2EJWA 4CKZA 3GZNB 1EVLA 1NNLA 4GPD1 3ORFA 1Y5RA 4GT1A 1CK4A 1G9TA 1V3TA 3DBRB 3OFNA 3VH3A 3WXMA 4EKGA 3P32A 1K2VN 2CJJA 2Y2ZA 3S2SA 2GK6A 2XUFA 2O8VA 2XWSA 2ZRMA 5CFRA 1QNFA 1TYCA 5LJIA 1UK6A 4I4LA 4EG5A 2I6XA 1IBMB 3DV2A 3H05A 1KGSA 3BRCA 3AKDA 1JJ6C 4D9NA 5LCXA 1YHYA 1ZMXA 1XD2B 3TZCA 2R7VA 4U7HA 2B3TA 1M2VB 5JTUA 4RZQA 3CVWA 4K40A 3VGPA 3TQTA 5CDUA 2MR5A 1XQWA 5KYXA 3GLVA 4XVCA 2KLBA 3KWLA 3CR3C 2VAPA 4PBRA 2X8WA 1LLCA 1KZGB 2CWDA 3IIIA 4AO8A 2BMAA 3ES9A 2ZIUB 4ND8A 1XE3A 1U28C 1Z6TA 3OQBA 2IU3A 1W52X 1I13A 1G0OA 1LH0A 2YQ5A 1ZJ6A 3IA2A 1SOWA 4D8YA 4JBXA 1RR6A 2ZJ3A 2O50A 2FPRA 4XIFA 2P41A 4X6AJ 3LY8A 1ZREA 5D4RA 2P11A 1A2KC 5F1YA 4ITRC 1ZA2A 1TAHA 3R20A 3I56I 4F1WA 2ZUUA 1P0IA 3A4NA 5HLTA 1FUIA 2P9GA 3K32A 1QV6A 2E60A 5E4TA 3O74A 2FEKA 4XTCS 1K6JA 1R37A 5T41A 4Z3OA 4I9UA 1MMDA 1AKRA 3AM5A 1J24A 4N3CA 3ORHA 1E0AA 3AR7A 3I0TA 3BLYA 3VVMA 1PNTA 4LTMA 1J0RA 2QAIA 1DJLA 4OHFA 2DBQA 2XECA 3KU1A 5TV2A 4RESA 4IGKA 1VQ9I 2E6UX 4ASUD 2ZYGA 2C2KA 2P9CA 2PR2A 1IG7A 4LDRA 1A7KA 4TKMA 4ED9A 4B71A 3IFSA 2FA9A 3ACDA 4Y2HA 2DE0X 4RABA 4OUDB 3O9ZA 2DT5A 3MZ0A 3FF1A 1K5PA 3D5TA 4CLHA 5AJYA 1UEIA 4R1SA 1IDZA 4MI6A 2LZ0A 5HM6A 3ZDFA 3CUOA 2J8ZA 1IG3A 1KK3A 2C98A 4B80A 3FPEA 4LNUA 1JDNA 3U7QB 1N34B 3OOUA 1GZ4A 2IYEA 2ZOSA 3GJRA 4GNRA 3WOVA 2H2HA 3UA4A 4E1AA 1XYYA 4UTPA 3IXQA 4JC4A 3QPLA 1I3LA 4Q1AA 1JVSA 2ZIWB 1X7WA 3K0KA 1C30A 5AVQA 3IDAA 1MIJA 4YIRX 1DQUA 5SZIA 1Z0UA 3A8TA 4Q3LA 2CCKA 3KOWA 3JQFA 2C8JA 4KRYA 3M70A 1AY0A 1FMLA 4MEYF 3ZQQA 3X1ZA 3L4BA 5B12A 3GF4A 3LDUA 3L2CA 1K8RA 4B33A 3PUFA 1H69A 2Z4RA 3MGGA 3SX4A 4RJ2A 4K3VA 5D3KA 4Z7JA 2G9NA 1J9EA 4AS2A 3A0BC 2VRBA 2Q99A 4DABA 2K4JA 4OLBA 3T5BA 3PRJA 5TT1A 4KR6A 3M3PA 3WTXC 1TA0A 3E2MA 1RVV1 2XMQA 5KWEA 3ZQJA 5JAQA 1VPVA 2CVOA 3NKFA 1NW6A 1ESEA 3QH4A 5JLJA 4PZPA 4ACAA 4HVLA 1Z77A 2ZSDA 3OEYA 3RIRA 5MFPA 3ZC3A 1U3DA 3HA5A 1PFVA 3FOAA 2L19A 4JU9A 3ON5A 1Z18A 3ENWA 3HJBA 3NRVA 3IB3A 4FVTA 4A26A 4J2HA 1QPGA 1NE7A 3QWBA 1XMPA 1NRXA 3P9IA 1SCDA 3JALB 2A0UA 3UT5B 4AJ9A 3F3SA 1O54A 3OM0A 4GPZA 4E5PA 3BXXA 5CLIA 3ZWOA 4MQEB 1GPH1 4YT8A 2BGLA 1SVOA 3G9XA 3WHLA 1Z2AA 3GARA 1MB0A 3KOOA 2JI8A 4Y2SA 4U00A 3CLOA 2QXYA 2VTEA 3RD5A 3S2EA 5TVGA 4JX8A 3I6YA 2BI8A 4MWCA 1JEQB 4G6TB 4TZ0A 1Z6YA 1EP9A 2ASVA 4RD6A 1UKYA 4QE3A 3KP3A 3OECA 3CO5A 4KQ1A 2VJAA 1H93A 4JSRA 1N6PA 1PQYA 3SQMA 4CT4B 2F4VB 3V97A 4RX1A 3NMUF 2C7VA 5L4NA 1WB4A 3UGQA 1Z2OX 2ZP1A 4PY2A 1E94E 3F4BA 4ZVPA 3WK5A 1WBBA 3H5RA 2ZMEB 4P08A 1XSXA 1JLLB 5EJ2A 1IW7F 3D7NA 3NCHA 1HT1E 2OYSA 2VHXA 1NK3P 4V38A 1ULZA 4BP3A 2HJHA 4F9FA 1QGZA 1IRFA 4ZVKA 4HNAA 4MQVA 2FK7A 5FYQA 2AEEA 2FOKA 3LNTA 3D6UA 4YPFA 1R4NA 3NUGA 4WKOA 4XLLA 2DLNA 3IOEA 3IHKA 3UXMA 3HU5A 2PUAA 1IJWC 4YVFA 1XLUA 3BIXA 1GQSA 1F20A 1FP6A 2HC9A 3ZX4A 2PLRA 5F4ZA 2AI1A 2EFOA 4CNQA 2UZ1A 1X74A 1CNFA 4U7GA 1UEJA 5JH7F 1RWNA 3TK1A 2YIMA 3I9NA 2DFLA 3H8SA 2XUZA 2YS9A 3DLTA 2G25A 1XCLA 5EQFA 5T64A 1UBFA 1EVZA 1AKQA 2OGWA 3IXLA 1P1BA 3K6GA 1PUJA 1ESZA 3GROA 2DK5A 4G6DA 5JS1A 4ZO8A 3QBEA 4KEAA 1XXHA 2V5VA 4MGYR 4KWTA 2VB6A 3N8GA 2PRZA 2JCXA 1E1YA 2M2IA 4V0MA 3PPIA 5I5EA 2CLCX 1W8DA 5G02A 3F21A 4WWCA 3C3YA 5C4JJ 3QU7A 2KSQA 4ES6A 1C3JA 4RKWA 5G4KB 1T08B 1QZUA 4JC8A 1RXVA 2X8JB 2TMDA 3FTQA 1YRNA 5F2EA 3IE0A 1P2FA 3VR3A 4C6SA 5DCMA 3T8TA 2BFCB 2PMEA 4F7ZA 4TTPA 4HRIA 5K4HA 4ZYYA 4BAZA 2QW0X 3JAKA 1HI9A 1B16A 1EFPA 2JHPA 1Z39A 1OBCA 3PC7A 4YRPA 4FK8A 5C46F 4XI9A 1T6ZA 2JGKA 1UCRA 4YHBA 3FCUB 4FOTA 4DV1B 2O5CA 1KIAA 4YMLA 4R1OA 2BEWB 2Y1DA 2CXSA 2Z57A 3E58A 2ECQA 1F2VA 2Q5QA 1UFVA 5J1TB 3C5VA 1V5GA 4J2OA 2XDVA 1FS4A 2QD4A 1VCOA 1ZNQO 3HOYJ 1NR1A 4LOAA 4L2IA 1L0OC 2F64A 2W85A 2AOUB 4X1KB 3CC4I 2ZW9A 4C06A 2DYRH 2D4AA 4EJUA 2WQZA 4NSNA 1YE3A 5EUQB 3VNQA 3EOZA 4C3IJ 2QROA 1U8UA 4UE2A 3SFIA 1NKTA 3WFJA 1C0LA 1XPJA 3KWMA 1D2AA 5IAKA 2AG6A 4CE6A 4QBFA 1B9MA 1VZ2A 3LO8A 1E7YA 5CEEA 4QUGA 4OYRA 4KMUX 4DGWB 3H3FA 2Z0MA 4B1FA 1TQ2A 3OZAA 3P8ZA 4FILA 5F0HA 2R79A 4RA6B 4UFPA 2F43A 3RQ4A 5E3NA 3IE1A 1NVVQ 3G7UA 4DSTA 2DFEA 4E5NA 3GTGJ 5KNCH 3KTOA 4ZXFA 4DCGA 1E2FA 1H6DA 1GKKA 3TNDA 4O4IA 1N2IA 1RZRD 5FKLA 1HLGA 4OA8A 2JFQA 3H11A 1YMUA 3JPWA 3OLQA 2ZXHA 4Y2QA 4Q4DA 3WLOA 3OOJA 3H16A 5CFLA 1ZSVA 2A2ZA 3NBKA 1OB2A 4LMRA 4R2MA 3BMOA 4IPAA 2GZSA 2AZTA 2ZSHB 3OPMA 3PRKE 4CJXA 3QX3A 3IEUA 5B58C 3Q85A 3HP4A 1DE0A 3AK4A 3QA9A 3WB2A 3SD7A 1VRCA 1P9QC 1PZFA 2W2NA 5BOSB 3G59A 4R1HA 2X13A 2R25B 5H3HA 1T0HB 3UPDA 5D7BA 1J2YA 2Y76A 1MVNA 1I3NA 5CFPA 2VJCA 1X6VA 1FIPA 5ER9A 3GNSA 2FPGA 2ID7A 4AICA 4EBFA 3ISPA 5AHXA 1AKNA 1JPJA 1WJEA 2ADFA 3QI7A 3I9V2 4HKTA 3PUBA 4B1RA 5G1PA 3ZWCA 2EFHB 3RDPA 4XK4A 2PYDA 4PPFA 3TDKA 5B2ZA 2UZ4A 2CNKA 4GSKA 3CMEI 2D1VA 4X8OA 3LSGA 3IH2A 5K8JB 2O2IA 3LVQE 4OEHA 5AW8A 1VE3A 3T99A 1VF9A 2XQFA 3HXKA 7MHTA 1GNTA 3L49A 1QYDA 3JTHA 1FFXB 1MDBA 1KJIA 3BJMA 4ABTA 3BMCB 5BNTA 3D6NB 5KTNA 4I1OA 5DM0A 3C14C 2GLXA 5DTJA 3RYCB 5LYJA 2D62A 2QZPA 4O59O 4XJTA 2CDAA 1IN7A 1IY0A 3OZCA 1LBHA 3MWJA 3TTXA 3LL4A 1UDCA 2OM2A 1S3SA 1DKNA 2JGIA 5HS4A 3VNVA 3E5NA 1B00A 3PYXA 2PUWA 1VJ1A 1EE2A 4I0BA 2DCMA 4AAYA 2BJHA 4IRMA 3A01A 4YMIA 4B17A 3SOZA 3ROKA 1EG2A 1QDUA 2Q9CA 4TMVA 1FNBA 2E1CA 1ODKA 1E2XA 1BM9A 2WEKA 4ZZ0A 2YV5A 3QKSA 2XRZA 1VDMA 1VG8A 4B6QA 2JFWA 1EP1B 5JQGA 2ZSKA 1U0BB 1YIAA 4IZ6A 2HVQA 4L5IA 1VCHA 3FSGD 4UM9B 2MSLA 4IJ5A 4MTDA 1RBYA 2V3VA 1IHXA 4OGLA 4ZO9A 5BRAA 4LHWA 3R0IA 5DLEA 1U11A 3WHIA 1KEEA 3A0UA 4QTRA 5KTSA 3D6TB 2DPDA 2BHZA 4ER3A 3U60B 5D01A 1R0XA 5DN6A 2CLHB 5DASA 3CB4A 3EVCA 1PKXA 2E49A 1WETA 4S0HB 1PR5A 3CISA 3N2IA 1Y7TA 5T4FA 3W7BA 3I6IA 2A14A 2B30A 4FW8A 1L5HB 1CYDA 4L22A 3RC7A 3PR1A 4EGFA 4WNAB 3SYRA 4GKKB 3LO5A 1MAUA 5KWIA 3KVOA 3OE7A 1ULSA 3OYIA 1Y37A 5GPAA 2R85A 3TKLA 3O21A 4CN8A 3WAJA 3KFVA 4NU5A 3VR2A 1QVZA 2WLSA 2ZYSA 4AF7A 3WIDA 1WXWA 2V6JA 3QMVA 3AVPA 2X9NA 5JAIA 8LDHA 3HYLA 2YICA 5L51A 3C2HA 1DDNA 4D4JA 4B75A 1WHTA 1FMCA 2WHPB 4KW7A 1PO7A 4MKXA 4E5MA 1ID8A 4C7JA 1Q77A 2ODTX 3D7SA 2G9WA 4REQB 3I2HA 1R64A 1WKVA 4F5WA 2OL4A 3ZCXA 4H1TA 3WBFA 5EEHA 2QUFA 4UC0A 5KKAA 1WWXA 4OAZA 3O2PE 2PX0A 5AO9A 4GE3A 4WOKA 4XR9A 1QWSA 4PQRA 2EP7A 5KTKA 4U0KA 1NA5A 2IE8A 3MJ4A 3G9ZA 2AMFA 1SIWA 2H1HA 3E35A 4X5OA 1VNDA 2OWEA 1UMDA 4WADA 4XSVA 3WIOA 4XJVA 3W4KA 2IL1A 2XC7A 4AWAA 2C78A 5AVOA 4OQMA 3QHQA 1DZ3A 4EA7A 1TQPA 4NBTA 2XT0A 5HZGA 4TKVB 1Z6GA 2QDXA 3KYCA 3PD7A 4DCTA 2PQ0A 2O7VA 1KWKA 1CJSA 3SMQA 2O8EA 4KL8S 5DGIA 2R7MA 4ON9A 4NDZA 1Q17A 2EW8A 5EZHA 3OFKA 4NHJA 1PSZA 3R3YA 1VLHA 4ZODA 4YAUA 1Y6FA 1H9TA 2XOXA 5FPQA 4N7RA 2HRBA 2QVGA 1THZA 1SKYB 2H06A 3QPAA 5JWHA 2Q21A 2VXDA 4NH0A 2M87A 3HWSA 1E8MA 4Q3NA 2ECBA 4PZAA 4DDUA 3INGA 4O2BA 3UYLA 3V32A 4LZZA 4U1RA 3BSFA 4JP1A 2ENUA 3DL2A 4Q4JA 2X4IA 3LA2A 1S29A 3CRW1 3NHBA 1IV8A 3LXXA 3ZQKA 1ND5A 2BFFA 4ATNA 1O2DA 5KJEA 4NMWA 3IQXA 4UHKA 4EMBA 5DBFA 2YFKA 2OFXA 3T6KA 2RD2A 3QI2A 3DTKA 3VR4A 3Q8MA 2VXZA 1NJ2A 3UB4A 4Q9AA 3CZ6A 1LRJA 2DBRA 1YL6A 2CE7A 1TECE 3AYXB 1VIDA 1S89A 1V43A 2W6ZA 2FY8A 2IEKA 3I5XA 4D1QA 4GOLD 4HHEA 5K0JA 1K3FA 3ZHVA 3VR3D 1ZG1A 1CDEA 2XKPA 4H60A 5B1EA 2JLWA 1TK3A 3DCJA 1U2ZA 4RBNA 3ILXA 3C1UA 3EDOA 3OM1A 1ESCA 1J5YA 2GOMA 1POXA 3G8BA 3AEKA 1AO0A 4RHFA 2GLTA 3V2GA 2HOEA 4UV9A 5KNLA 1UC9A 3IAM2 3I9LA 5H4HA 4MS3B 4UHJA 1FP7A 1BKSB 1U8YA 3OJCA 3CF4G 1YDEA 4O4IF 1NMSA 4UTVA 3BXGA 1B72B 2Q2OA 2AD1A 2A67A 1Q12A 2H7XA 2A1UA 4JBNA 1KI3A 4PYNA 4A8TA 2BDTA 4MDYA 1JI3A 4URUR 2ZXWH 3CNHA 3HR4A 3K9LA 3ILHA 2JBHA 4PZEA 5D5VB 4IJ6A 4Q4ZF 4BVFA 1OV4A 2Q1ZB 3IHWA 4Y52J 3K70B 3HYRA 2FWAA 4BDZA 2VASA 1NMYA 1BWPA 2P69A 5J4VA 2HKXA 4TWZA 1IHUA 2A3NA 2VJOA 1Q0QA 1RI3A 3HKBA 1BW9A 1ZVMA 1RUNA 3O8LA 1IRIA 2FFQA 4CF3A 2WB1A 3L09A 2YNMD 2ECPA 4RZUA 1T3GA 1FC0A 1S2IA 3QBTA 1T5OA 3A1EA 3DWFA 4H0NA 4BFSA 1QLJA 1E0JA 4XEHA 3BL5A 4YQFA 1FNSA 1YVEI 1GDDA 5TC4A 4UDXX 4KODA 4MYDA 3HB0A 2R7WA 3TD2A 2JCYA 3B6AA 4PX9A 1SKYE 2CXNA 3RHZA 2YOGA 2XT9A 3QHPA 4P3NA 4GWGA 1YS9A 4DM4A 5I9BA 4M73A 2IH2A 1TQDA 3ZCVA 1PR4A 4FYXA 4B6FA 2P6RA 4OKSA 1UFRA 3CH5A 1OKKD 3GBPA 3MWFA 3R5XA 4L72A 4OJMX 3A0HC 1EWQA 1XGNA 3MTAA 3H04A 4LZAA 5DWQA 2PFBA 2JIMA 1PUXA 1MBKA 4FINA 1GG2A 3R4CA 3CP2A 1YIOA 2M32A 2QN6A 2GMWA 3GL9A 3KR1A 4BP1A 1GTL1 1NVDA 2XTNA 4I1RA 4GLLA 2OXTA 5J8FA 5LYJF 3LF2A 2LCFA 2GXAA 3JQAB 4M22A 2BH2A 3WICA 1I7PA 1O96B 3WKDA 1QVWA 4CN9A 3DO8A 2OA4A 1OXVA 5I4BA 1NLZA 1GYQA 4Z9XA 1KQ0A 2DR0A 5C1DA 1NJ5A 3IIKA 5IDVA 2R62A 3VNBA 3KBBA 2B35A 4YELA 5L6MB 1Z3YA 4BASA 5KMGB 5HP4A 1E9AA 1QHXA 5DLPA 4TWIA 2DA5A 1I4DD 4ZMSA 4LA4A 4XB6B 4G07A 5JQGF 2QM3A 3IP8A 1YW7A 2JPCA 3L7AA 4PINA 3AWDA 5JNTA 1P1RA 4CFZA 2PMZA 3NS7A 2PJDA 2C5FA 1BYUA 3W9UA 2P0WA 4M86A 3CUQB 1L5QA 4UUAA 4DA8A 4B3SB 4R68A 4LYFA 2YQZA 1EIWA 4OP3A 4JLMA 1MBEA 1PR6A 4I6ZA 2VSXA 4M8NE 3EUAA 1WQ4A 1P44A 1KAGA 5FWNA 3GW2A 3S2WA 1D2GA 1JZSA 2I4TA 1KOLA 2P6SA 3DCYA 4U0YA 3C2BA 3GPLA 1BNCA 2QTRA 1KPGA 3I30X 1XHFA 2NPOA 4ESVA 3PFKA 4EYEA 1W2GA 2OCBA 5GGXA 2WOJA 1K0UA 4W5TA 4M0LA 4LY9A 3DEYX 4CEJB 3CO6C 1KHHA 3WLIA 2W84A 1FFAA 1VQPI 3N9IA 4YIIA 3TW0A 2Z5UA 3CLHA 4Q1DA 1RMYA 1NJ1A 4WACA 4LLNA 3RSFA 4B6PA 2YJ4A 1WD7A 3FDXA 1ZXLA 4TV8A 1XDDA 4GP7A 3IL2A 2GQ0A 3W8EA 4BECA 3HPGA 5GOZA 1B3RA 2IZ0A 4PCLA 1BDHA 3LFUA 5JNLA 3NHAA 3WGZA 1HDOA 3BK2A 2F55A 3T3PB 2NYAA 4M71A 1NXOA 2FFHA 1XA4A 4DMMA 3L6RA 5JEDA 3GJYA 4OHYA 2OAGA 2C2GA 4YIFA 1N6IA 2E21A 3M83A 1PR9A 3T0YA 4OLAA 4MZXA 1YK0A 4O3FA 4RFVA 2RGRA 2QVXX 1E3JA 4RDXA 2JAHA 3QPUA 3HDQA 3AHCA 3C3AA 2R44A 4M0DA 1DRUA 2XZDA 3PSAA 3KZOA 2AX4A 4QQRA 4GX0A 4ER7A 3QTTA 3LQ2A 3JRBA 1NN1A 5H02A 1VXRA 1DIBA 4M9RA 1P7CA 1RM5A 4J49A 1QORA 3P52A 3FBGA 5JZBA 2HSWA 2YW2A 4E51A 1CR2A 3V7UA 5T3UA 3W34A 5M3BA 1EXNA 2ZRPA 3WWOA 3A2MA 4I8XA 1PJSA 1H1LA 4OBEA 5DBHX 1OX6A 3QSGA 1NSFA 3QJGA 4F2HA 1ZEMA 2FUEA 5C0OE 3WMXA 1U9IA 5EMJA 1A8IA 3K2AA 3WGGA 1T3TA 1G8GA 3S3MA 2JHFA 2IUUA 3EB9A 3HLKA 2XLBA 5DMHA 4R40A 3K96A 4DLNA 4Y2PA 3SZOA 4YRFA 2RI1A 2ZCJA 1YS4A 2JFNA 1DGQA 3K0HA 3AGPA 4JUBA 3DEZA 1E20A 4WH0A 5EYPA 1H5NA 1U1IA 4QJ5A 3S17J 1LK0A 1V8PA 1FU8A 4DE5A 1RJ9A 2XKOA 5ITWA 1O1YA 1BR1A 4EARA 2F1JA 1IJBA 4O2BF 5FR1A 4Y9SA 4BO3A 3RAEC 2R7TA 4RVOA 3TXAA 3LDFA 3R7DA 4I99A 2R60A 4WCFA 1YVPA 2P5VA 3VZPA 4DIOA 2PBIA 2UYGA 5ARCA 4FE3A 2EL7A 5FPPA 2JEOA 3JD1A 1LEBA 1Z26A 1J6UA 5TY0A 3ELYA 1V4VA 1LSSA 1OA1A 4CF6A 2PRSA 3FX2A 2JARA 1KWGA 1NC3A 4B83A 3V1LA 3OT5A 1P4XA 3UV3A 1VIAA 5DP2A 3RCOA 3FPFA 2PCLA 1RXIA 1NG1A 1TD9A 3LPCA 3BJZA 3B6MA 1NNI1 5JFGA 2H18A 5FORA 3IT1A 3BE4A 3ST7A 1QO0D 1R4NB 5EAIA 2IHUA 3OYCA 2D2WA 3S3NA 2BE5F 2CF6A 3NEAA 5HKBA 1G4DA 3Q8WA 2AR9A 2FSSA 3V4PB 2ZUEA 1EKEA 4BVJA 4ZANA 2GBGA 4R2WA 2NYUA 1CE8A 3S28A 3RUEA 4UTZA 2HEOA 4DMUB 1MO3A 3C4QA 2H8WA 4JQSA 2BBTA 3LG2A 2AN4A 1S8OA 4Y6PA 5JDIC 3D1NI 1G18A 1Q1BA 4BNDB 4PONA 4URHA 4X24A 2PX2A 1QR6A 3CZCA 4OG2A 4P8RA 4B40A 2FSVA 3OYLA 1NDHA 3PE6A 2FDCA 1CZKA 1I6KA 3F46A 2ESRA 4HXYA 5AOCA 4UVGA 4D8TA 2JA5J 3OYAA 4NBSA 3HRIA 5I4KA 3U4GA 5IZCC 3VZSA 3B02A 1ZNWA 1U31A 2ZB8A 1TM7E 3ESDA 3DMTA 3MKZA 4LY0A 1GA6A 2DAOA 1TLTA 5D87A 2GBYA 1H94A 3VR4D 3FXAA 1M1YA 4Z9AA 4N9QA 2DP4E 4Y9RA 4EJSB 1F1BA 2JK0A 1CEYA 5E9WA 5EP4A 5KWVA 2ZIFA 4N03A 1XUOA 1N5MA 1KZ1A 1BXKA 1G64A 5KWJA 5K3EA 3VHRA 3BDDA 3DLCA 1L1QA 2C2BA 3JAKB 4IHTA 3X1KA 4HNRA 4XRRA 1LEAA 1L5RA 3T38A 1STZA 1L7VC 3UCEA 3FM5A 1AS0A 2CMKA 1JRLA 4NZYA 1U1EA 4ASUA 1W9MA 1K75A 2ACKA 5IPFA 1W5CC 3S0JA 2CWWA 4GYYA 1ODTC 4W9NC 2VKDA 3TRDA 5BN5A 4H6XA 5BSWA 4KI7A 2J48A 1IATA 3VODA 1N2CB 3OKFA 1RXYA 4UUSA 5DFAA 3RYPA 1WVGA 3GRRA 3IPYA 2WG2A 1LPNA 3TR6A 4QO7A 3RS9A 4N1AA 1FRNA 4Q1EA 1J8FA 3QYBA 4NENB 2OXEA 3OS2A 2Z6QA 3BMXA 2WKQA 5AONA 4B46A 2DDBA 4BXOA 1YZGA 4E70A 4GGGA 4ZYEA 1Y6RA 4PYIA 3C87A 1IVNA 1UFMA 1UBUS 4ZZLA 5IU6A 2IW1A 2V0GA 4ZREA 4HLYA 5LGNA 3MG9A 3NEYA 2RGNC 4Y2GA 5I48A 3R7SA 3WGKA 4DILA 1II8B 4LJLA 3T0IA 4JA2A 1ZK2A 3RUPA 2RNGA 1WU8A 2XKKA 5B4TA 4B4OA 3H11B 1WH5A 2P9YA 4PO1A 3OKCA 1F4VA 4OL0A 4PPYA 3AY6A 4QNMA 2IAIA 4EIWA 2KDOA 3A03A 4R2IA 2F8MA 4RVGA 3HNOA 2IS6A 4BZXA 4K9SA 2XPCA 5J40A 4FBLA 4NKRA 3M1AA 1H2RS 1U3VA 1OFUX 3OX4A 5IT0A 2ZB7A 2FRDA 3KZNA 3CO0S 1JJFA 3MSXA 1PNOA 3N5CA 1XKLA 3M4XA 4NHOA 2VF5X 5FV7A 2PQ8A 1EVEA 3B9RA 3OD5A 4FYKA 1SU4A 2JQ7A 3OF2A 3VB2A 4HLUA 1N78A 3FFXA 5EA2A 1VSBA 4HS4A 4AUKA 1D6MA 3ZE7A 2IS2A 4EZIA 3NYWA 1PTJC 4OK3A 2FPXA 5GP9A 1VJ5A 4R7ZA 3OBBA 1WJAA 4NLLA 2LLKA 3CJQB 1KI8A 3B85A 3GTQJ 4UVAA 1J7KA 1J1IA 3CRQA 1P0PA 3D54D 1W7AA 1ZC3A 1THMA 1TIBA 2DG2A 4V0QA 4TV8F 3COZA 4XLAA 3AW8A 3MWEB 3TGPA 2DBZA 1H0HA 2CQKA 2ONZA 5HQ3A 1UDAA 1BVHA 1V3FA 4J8PA 2EIMH 1FMJA 3R61A 4CYDA 1YJ8A 4Z9FA 1ZPDA 1R5NA 3O75A 2HRZA 3KQPA 3FXRA 3BRQA 3EXHB 2B3DA 5C51B 4FYVA 1QPZA 4IDCA 3DTTA 3S27A 4OB6A 5KJ1A 1WV1A 2NUAA 3JASA 2CMGA 4NTZA 4HFJA 1N2CE 1EAYA 4PW0A 3E1KA 2CJPA 4J91A 1TWHJ 3GQVA 2XPUA 1JLMA 4YGXB 1ONBA 3L77A 2VPYA 2GCGA 2QLJA 1DV1A 5A3QA 1Q7CA 4PLHA 1J09A 3DFZA 3B6CA 1L4HA 2IA0A 1F48A 3KDPA 4GOJA 3AEZA 2C20A 4GQBA 1U5AA 3WLFA 4PZDA 2R00A 1L7PA 2R6HA 4N82A 1F5SA 4Z0TA 1MT3A 2PK3A 2BP7B 3HJCA 5A0VA 2GZRA 4XPZA 4FMCF 3CLRC 3NETA 3LBHA 4PAWA 3LAPA 2NZJA 3V4LA 1JU3A 4IHQA 3B6EA 3V4FA 4OMCA 2ZC2A 2ES4A 4OHRA 4J1SA 1BOOA 2UUAB 3A1YA 4TZTA 1BW5A 3K5WA 2IGNA 3REOA 3HFGA 4HEA1 1NIPA 4IW3B 2VO1A 4JVOA 3JVDA 2CT8A 2RMKA 5KUTA 1EK1A 4MMXB 4EGQA 2EZ9A 1ZUD1 3GGJA 1A8PA 4W7IA 2XF8A 2OECA 1Y81A 1TOAA 1D0YA 1OZGA 3M9XA 1M6WA 5EXPA 5IVIA 4XDGA 3TP3A 4HQ6A 5D6EA 2IJGX 2O2HA 2PZ8A 1H2FA 4YTEA 5HNFA 4MV8A 3TMKA 3SBOA 1Z08A 3RARA 1P5FA 2EERA 3C8UA 3RPUA 1VYTA 1JT2A 5K01A 3NALA 5IJ0A 2CZCA 2E4XA 4PHTA 3LBIA 4M2LA 3MN1A 1UKCA 5JT1A 5EGOB 4BL0B 4EBBA 2QZJA 2Q5IA 3DL4A 3K4KA 4RTMA 1JUPA 1QHGA 3KCCA 1G2OA 2J5OA 4UHTA 3GLGB 4H77A 4ECAA 2RHJA 3A27A 2YIVX 1F0KA 3T9FA 1DQRA 2O3UA 2HOTA 5FKKA 4L4XA 1A7AA 4TL7A 3AUXA 5HF8A 1TT5B 3WMEA 1O8CA 1M66A 2O5EA 1LFDB 3PEEA 2D00A 1PNVA 1DDGA 4B7AA 2HU9A 1PQUA 1RTKA 5GQSA 4EUFA 2A9OA 2GNOA 3IPRA 3T54A 1NBIA 1W30A 2HI3A 1Z0KA 3OQVA 3Q88A 4GMFA 5KVRA 1ZCZA 5C32A 4K6GA 4F1JA 5C4XJ 1TADA 2GHRA 2IVFA 4HNQA 4RXTA 7REQB 2C92A 3TW8A 2DMTA 2H6BA 3HG7A 4L08A 3VO9A 2G1UA 4DXDA 3Q3GE 1NL3A 3WGLA 3B3JA 1RHUA 2VP0A 1CUJA 2G77B 4RPKA 3U44B 5IVKA 3N5KA 5HOQA 3MNFA 1OLTA 3IAXA 3NHYA 3PDWA 3QWAA 1BX1A 1KU2A 4OQ4A 3AKEA 3ZVRA 1JXAA 2VJDA 1SVNA 2WJ6A 4FWBA 2IFTA 1SBNE 1W9HA 2FLVA 2FTKE 3K2EA 2QUKA 4I1PA 1KI4A 2QEQA 1RLTA 4MO7A 4K6KA 3DF8A 1DEOA 4WD3A 3FOFC 4QBHA 4Q4LA 2FPWA 5A5GA 4BNGA 1RZRA 2FPIA 2IEZA 4OLJA 2HTJA 2VXBA 1V9SA 3AP1A 1LV7A 1IULA 3IAAA 1RXSA 4TZ6A 1N2ZA 3JX9A 4U6QA 1WB6A 4R3WA 2P30A 1P9LA 1EJ9A 5T57A 4UDYX 3ZU6A 1B1CA 4PAGA 1WUTA 4Q4JB 3GUVA 3S81A 4HSEA 2J3IA 3M2PA 1FDWA 2VDOB 4I81A 3IPCA 4YJHB 4PDKA 4KXQA 5C18A 3KK0A 4D41A 2IUEA 2PXHA 1KMHA 1JHYA 1KZ9A 4RDHA 1GTJ1 2VYCA 2VA8A 3DOFA 3GUDA 5BW8A 1XU4A 5MFZA 4OX9Y 2QORA 4BV9A 2ZULA 3DCNA 2VQHA 1FRVA 4UVIA 3GLGE 1AK1A 3KSAC 1LFAA 2ECOA 4BY1J 1OIXA 3U6BA 3LCVB 2NOAA 4FHCA 2VC2B 4RK6A 4ZGWA 4B8WA 2BTEA 2RHTA 1I2AA 2XA1A 5HA5A 1Y8ZA 2QE7D 2B4AA 1DPGA 2OO7A 4KU4A 1JPVA 3AEKB 5EPOA 4LV5B 4TS3A 1UODA 3Q3HA 4L7QA 4KQCA 4KK4A 3DEWA 2XWPA 1M67A 1IN4A 2IBDA 1P4AA 3ZR4B 2DB3A 5B6JA 1QPMA 5BSFA 2A3SA 4N5NA 3K9WA 4L27A 4YJ2A 5D3ZA 3U4IA 7MDHA 4QD3A 2ALJA 1CTQA 2QX4A 2RN7A 1HOMA 3P5BA 3GJ6A 1G8AA 2CDRA 4N3GA 1Y9DA 2GBPA 4RE5A 3CC8A 1ZGBA 1W4CA 3SHWA 2JEYA 2JH3A 2GN4A 3NHPA 5LQRA 2DFKB 3QE4A 2QN7A 4R0MA 3UM9A 3MCVA 5CCXA 4QG7A 2PJUA 5C7LO 2LD5A 3FOEC 4CR8A 4CF5A 2BSQA 1KJWA 2E35A 3P9CA 4E94A 1WCIA 3HO1A 3R5JA 1NQWA 3MJEA 3F8CA 1N0VC 4Q1FA 4BJ5A 3H5IA 3FSGA 4GAEA 4R2XA 4DSOA 5ICMA 2CJWA 2ZSJA 4EQ6B 3A9VA 3UK2A 1PEDA 3ZXYA 3V4ZA 4ANJA 1XQYA 3UHFA 4EPWA 2FGKA 3TLYA 5D86A 3A3NA 2DHRA 3ZCTA 3B52X 4LRUA 3PWSA 4Z4GA 1V11A 5E9QA 3OA0A 3VNRA 2MINB 1FXSA 1Y7PA 4JYMA 5B2EA 1I2ZA 1TLFA 1FMTA 1SXJC 1I5RA 1PS0A 2P90A 2DMQA 4H7JA 3IKTA 1BD4A 1YDFA 1FIUA 3K9FC 2Y9YA 1CY2A 1ZOPA 3ESBA 2YWRA 6REQB 5FRMA 4IM7A 4HFNA 4HI0E 4FFWA 4BGIA 4ZOEA 3HEMA 2AE2A 1XYVA 1DKQA 4YCMA 3NDIA 4WWHA 3RCBA 5EHZA 1ONOA 5JRDS 2NO6A 4G8XA 4ARBA 4M7PA 3TOSA 5NLLA 3KYBA 4P4UA 4PG5A 4DZTA 2EIHA 3U4AA 1XPOA 3CZRA 3PVSA 4JX5A 4XWKA 3EASA 3K0AB 2RJNA 3K31A 3PKJA 3D6HA 1NF9A 1UMCB 2H2FA 2XVCA 2C5BA 4OUKX 2VK8A 1TM2A 3UWKA 4XRGA 4N7JA 1BJKA 1U9CA 3VRHA 4TXLA 3IH5A 4MQMA 3M1CA 4A8JA 4NJMB 3ZQUA 3AKYA 4G1UC 4HF2A 1VECA 3ZV5A 4OIFA 2AQKA 2H5IA 3TLXA 3N3AC 3MJVA 1L4KA 4P7JA 3LVRE 2OOSA 3NJ8A 4E3ZA 3WP0A 3K9NA 3IKLA 4R4JA 3BR3A 5EHXA 2VDJA 1DARA 3U1VA 4CM4A 4W9MC 5EKUA 3DMNA 2IPQX 2Z43A 1WMEA 3TSWA 1B8IB 5AM0A 4LRXA 4D4MA 2JASA 1IVYA 1VQMI 4FBMA 4C9BA 1SIUA 3UCXA 3QELA 3ESZA 4KC0A 1NRIA 2LSOA 3CPJB 2VHZA 3WX0A 3CF4A 3ZBQA 2ZVJA 3MB8A 1BEZA 5JXGA 1PVVA 2CQXA 3MINB 4EW3A 3G9QA 2Y4NA 4NC6A 3L02A 4XH9B 1USVA 4HNSA 1DS6A 4LRSB 2C4KA 4CQNA 3I05A 2H7VA 4FFLA 3TR0A 2VBWA 4ENUA 2ZYVX 4TV8B 1LQUA 4A3MJ 3OSFA 2IEBA 3GJXC 2BRUA 3CUKA 5L3FA 2DTRA 3IEIA 2IXTA 1VTKA 3BEOA 1YZYA 5E4JA 2QCOA 1U2GA 3P7NA 4WASA 1K89A 5CEJA 4J0JA 2G76A 4RQTA 4YJGB 1MGTA 4E7ZA 2O9LA 1USTA 3HLYA 5FH9A 3ZZTA 4ZJPA 4CZCA 4GPBA 1X7YB 3K4MA 3QE3A 3RBZA 3CH7A 3G2JA 1Q3TA 1S4MA 3EXAA 4OJQA 4GICA 1C9MA 2HKIA 2LWIA 3V4GA 3UH1A 4YR9A 5LMZA 4AMYA 1G21B 4QM6A 2XOKA 5BV8A 4MS1B 2CXOA 3RS0A 3ENZA 4E7IA 1QIIA 1VIMA 3RG2A 4KIUA 3S8YA 3B8HA 4FI3C 3LDHA 4CMIA 1T5DX 2H92A 2GVDC 2JIBA 1G20A 2VT3A 3AHIA 5BSGA 3F97A 3ZW9A 1BCSB 3W9BA 5LC1A 3OUZA 4JUDX 1AHPA 5K0EA 3RPUD 3H3JA 1YO6A 3QLUC 5DCYA 3OX1A 3O92A 1GGKA 1RC8A 3VJMA 3LZCA 1N92A 1B8OA 4FMCB 4Y3OA 5I8WA 3PFHA 4PYRA 2ZGVA 3GLKA 2GILA 3UXYA 3D4NA 1U7UA 2YWFA 4MEBA 2OVBA 4H08A 2HDHA 1MDFA 5CBPB 3UENA 2HF7A 1IEXA 1NLFA 4ZCIA 2IELA 3FYUB 4PGMA 2A88A 1E0DA 3SU8A 2CLEB 1QCZA 5L53A 2BBSA 4HUTA 5CDGA 4IJKA 1UQUA 1SKBA 1GP2A 4V0RA 4AJNA 1SOUA 2UZIR 4C5BA 5EYPB 4BKOA 3K35A 1MOZA 4BX0A 4DNOA 1Z63A 4CKEA 3OT1B 5H7XA 3AM1A 3UF0A 2YHBA 3EIEA 4NU6A 1RJ9B 3FBIB 1Z15A 4OO3A 2GHIA 5LZ4A 2XJ9A 3KKEA 4KX3A 1E1CB 5LWQA 1O89A 3WS7A 1PJ3A 4JXZA 5DCUA 3DOIA 1XEAA 2J41A 5ITVA 3PQ8A 1CQTA 1EJ2A 3MOSA 3FVRA 2PA0A 2YNMA 2OO3A 3D8RA 3V8KA 4HQLA 3L04A 3VDMA 1UDRA 1RYNA 4BFCA 2CHFA 2PYIA 2XAAA 4U39A 5IDYA 2Q0SA 1WVMA 1JHHA 4JYBA 4UUNA 5DPMA 2H0RA 2PMFA 1GAWA 4IR7A 1PVEA 3S14J 1IG0A 2QLTA 5BPIA 5LJLA 1TB4A 2DYSH 1U2QA 4W8HA 2IIBA 1P5RA 2QUIA 1UJ8A 2Y2VA 2JCVA 1T8IA 4R9NA 2W2XA 2XRLA 2CCGA 4LS3A 4C4TA 1W4LA 1DUSA 3QV1A 2BGIA 2P9TA 1OKKA 1HDPA 4PHGA 4Q39A 1IPFA 2I1VB 1LNQA 5CUQA 3JD2A 2B5VA 3HUGB 4BO2A 3FNIA 1YOVA 5CNJA 1RLIA 1G21E 2OTLI 1Y1WJ 1JU4A 3UK7A 4QU0A 1V8ZA 2ZUVA 4YYZA 4YG2F 3IUNA 2ZBFA 2JLZA 1LK7A 4YJ2F 5WRFA 4QARA 1W6RA 1G8FA 4F2PA 4O6JA 4WCGA 3F47A 1V7QA 1BR4A 4CUZA 2JWTA 1YAHA 2O6HA 2HF2A 1MX5A 3Q7QA 5EJCA 1NG6A 2H1IA 5DLDA 4EM6A 4XCVA 4BPRA 4P4GA 2Q1XA 2YXDA 3AFIA 3MGKA 1M1UA 3LZDA 5HQJA 1F1JA 1RYMA 2WAFA 3TDUC 2H11A 4BO7A 1ZD2P 3NH9A 2WTAA 1F2UA 1GFWA 4TLDA 1L5SA 1JHFA 2XSDC 3I6QA 2QA4I 1V26A 4P93A 5NULA 1Z4OA 3IRQA 2HIHA 1GLVA 3TTYA 4KMFA 3RRXA 3BE5A 1OQAA 5FA8A 1YJQA 1P3Y1 2WQ7A 2XNCA 1E0KA 3F6OA 2QRNA 2FEAA 1E9FA 5DNWA 3HUUA 4OK5A 1MJGM 4DMLA 2MYTA 1CV2A 1K63A 1QQAA 3G02A 4FIDA 3SFTA 2GN6A 3NAGA 4QULA 4K87A 1QZTA 5GIPE 4R1MA 1J8VA 1TBXA 1C9EA 2DQSA 4UUBA 3DV9A 4P5EA 1UBNA 3SDSA 3BH6A 4AY3A 1DMSA 3WL6A 4FZ3A 1R23A 2C9OA 3RUFA 1DBRA 2GESA 4EI7A 1X7XB 1U3EM 3HTXA 3PCTA 1JDBC 4BY7J 2IOQA 4H16A 1TAGA 3H1AA 1EG7A 4PHCA 5ILSA 2BEVA 2GF9A 2CDCA 4AMUA 3K7EA 2LY2A 4N12A 1Y63A 3DEHA 4BWFB 2BYTA 5BVHA 4CL3A 1CQPA 2F2TA 5CAEB 4WCDA 4BEHA 5CB0A 1GQQA 4M3FA 5KREA 2J9ZB 3IHTA 3ZN0A 1HBXG 2WPNA 5AYVA 4HDNA 1EA3A 2OCYC 1NQ5A 3C85A 5CVJA 3G1LA 3ESRA 3N8HA 5DHAA 4LWQA 1AXEA 5J4YA 4C30A 3SQOA 1WXGA 2BV3A 1WDWB 3O82A 5ICFA 2OK8A 4PUSA 2PUBA 2AOXA 4PIVA 4IXNA 4EHFA 5KK1A 3UUWA 1MBZA 3RVOA 1E2BA 3P2OA 3SXPA 1XYGA 3BK1A 4Q4HA 5SY9A 5FOUA 5A4AA 1XQ9A 4LE0A 4HEA6 4RDIA 1DTWA 5AJUA 1ZRNA 4K05A 2HSZA 3ZQIA 1ZAKA 3NATA 3FKIJ 1RRCA 3WJ2A 3ZQCA 1QS0B 3DJFA 4X0GA 5K8VA 1R5BA 4HDSB 2ME0A 2FETA 4W9RA 1U8XX 3V7WA 4YXWD 1PJLA 3U9LA 4YRAA 1V4RA 1RAIA 2CLDX 2GDZA 4CXMA 1ZTRA 2I3AA 1VB5A 1MMNA 1M83A 3ELUA 3ZGKA 3BL8A 2ORIA 3RS8A 4CDRA 1JWBB 1RI4A 1TYAE 1YDMA 4F6RA 3K1AB 3D3KA 1Q0UA 1Y1LA 2EKLA 4KXXA 3VKGA 2FQWA 2GGSA 2GJ4A 4J4TA 3M4OJ 3VSCA 5IT9K 4E5DA 1TK9A 4YASA 1IBKB 4ZT3A 1EUYA 3J81Z 1YW9A 4IKOA 4EKIA 1JJ7A 1AMUA 4YP1A 4U9IS 4ZWNA 4ZT4A 3D2CA 3HTUA 3BEDA 5A9TA 3UNXA 3AG6A 1L8AA 3JQ9A 2CGEA 3LXRA 2HVSA 4LFBB 2VKHA 1N32B 1G3SA 3H0CA 1I1QB 4IGFA 2DTEA 3RRZA 2Z30A 4XR4A 3QFCA 5JV5A 2CNDA 3L1VA 1Z67A 4AYBA 1FNDA 1TCVA 1MH3A 4PQYA 1AXRA 3CCYA 2E5NA 3VPHA 2O2ZA 1QOQB 3F72A 4CV1A 4YAJA 4ARCA 4RVSA 2DPGA 4QOJA 1BD3A 3T9EA 3EEIA 3R8XA 2WWFA 4FM9A 3EZ2A 1QO0A 1FBSA 2EKZA 4L8LA 1GM5A 2WSBA 1QLWA 4A3BJ 2CY0A 2Y8EA 1L1EA 4KDEA 4Q3OA 1OPXA 4YPOA 3KP7A 3KZ1E 4Z6KA 5HPYB 3C41J 1BE8A 1OX5A 2ZYRA 2QBYB 2W5UA 2VF7A 3B53X 2PH1A 5JXJA 2XQIA 2YSRA 4P33A 3SQWA 1KI1A 3EUHC 4KLAA 2FPOA 4Z54A 2H29A 2C7GA 2KRHA 4B3JA 4LJ9A 2IGKA 4PM4A 3ELKA 5BVGA 3QPDA 4RK5A 3FGPA 3KE9A 4XVQA 3AI7A 2NVWA 3F3MA 3O2NA 2WTMA 5I01A 3NAMA 5BV2P 1TJNA 4HAIA 2XGDA 1H88C 2XOKD 1GN9A 4PG7A 4QT0A 3L7KA 3EDCA 3KCQA 2F4IA 4KE7A 3HTSB 1OHHD 3PTLA 2YZ2A 1Q1VA 2FMIA 1LQ2A 3WGJA 2W93A 3IUOA 4AZSA 4ZN6A 2WV7A 1IK4A 5E20A 3D7LA 2CQ7A 1U1FA 4JI6B 3DLBA 2HGZA 3HP1A 3Q7TA 5C35A 4YXFA 2A7QA 2PLAA 1NMXA 3SS9X 3QKUA 4LVOA 2OA0A 5G0WA 3JU3A 1K7XB 1W75A 3Q6IA 3ZWYA 3L2OB 4ZJYA 5KAFC 4J0HA 3V8RA 3L18A 5JH7B 1YG2A 2KM1A 3D3EA 3T1HB 3BT7A 3NVKI 3JAMK 5ENDA 4DBRA 1D2NA 4HNHA 2Y3IA 3DD5A 1G38A 3IC7A 2YC4C 2GUGA 3H5VA 4LLGF 4C2MJ 1JHQA 3ONWA 5DXFA 1MC4A 4AUMA 2VDPB 1ISHA 4O1HA 2RIPA 1XU9A 3VHXA 2C8KA 1GGHA 1P0MA 2FBKA 4Y2YA 1X0XA 1E2LA 5JMWA 3NYQA 4JY7A 2F90A 3L79A 4JK1X 3ZLBA 5F5LA 2QG9A 1HKSA 5A6SB 2X6RA 2PH7A 1XCBA 1JZTA 4DNCA 1Q0ZA 4B8YA 3M6IA 2DFDA 5FUBA 4ZTFA 3NAQA 4KQWA 1H4VB 4I7EA 4UPDA 2DT6A 2OK7A 3THOA 2JFOA 5KYUA 1PT9A 3OYEA 4B2YA 2PJRB 3BBPA 1D6NA 2PFSA 2BKVA 3FZVA 3NHUA 4BNIA 3MTQA 2AQEA 3NTXA 1WMFA 1FTSA 4OPMA 4KDFA 1U7DA 1F38A 1MTOA 1ISRA 1ZGZA 2W6ID 5LB2A 2VDLB 4A0QA 3RTCA 3H8VA 1PFUA 4S1TA 4FOLA 1L7EA 4NK5A 4S1WA 5KAMA 4ZYVA 2YVUA 3OOEA 2XH8A 1JG3A 3H1FA 4TKZA 4CPDA 1LJUA 4R2JA 5C8DA 2Q8PA 4H7PA 4M0EA 4RK1A 5C5CA 1HKTA 1Q3HA 2W9XA 2YR0A 3VU1A 2B8WA 5KHDA 1L4EA 1OY1A 4BL5A 3MWLA 5KYXB 1JTXA 3W3ZB 2ACWA 1KO1A 3VU8A 4TTTS 2NX2A 4WK8F 3UT6A 4ND8B 1WHSA 3UKDA 2BY0A 3H4TA 3KZVA 5KNBH 1P61B 1Z68A 3JZDA 3SHVA 5FLXZ 3RJMA 4Y2RA 1JIJA 4XRMA 3T5AA 2PFKA 2VUUA 3DW3X 2GD1O 1A98A 2MHCA 3I83A 4FCTA 2MIIA 5DV5A 1AA9A 4R98A 3FMVA 1YBAA 1Z4LA 4OXQA 2CXRA 4CV2A 3UEOA 2ZYWX 1W93A 5DYMA 2BR3A 1KQPA 2WIBA 3PTAA 1V39A 1A72A 5TPZD 1TT0A 4HEQA 3GBGA 3W1WA 4FMBB 2YN4A 1QIJA 4XVRA 3IT2A 1IYZA 3WADA 2K87A 4KHPB 2BZ1A 3U80A 5AW3A 5SY6A 2VI5A 2IS4A 3VQTA 4FOOA 1BWQA 4DGSA 4C03A 1SPBS 4K8RB 4ODIA 2I8LA 2IT0A 2JK1A 1GQ2A 3WB1A 3LC0A 4I08A 3HH8A 1F60A 1PSWA 4QTUB 4NMHA 2HPZA 4G6QA 4B2IA 3EZLA 4UOEA 5K0ZA 4KUHA 4B3GA 3W3CA 3A6KA 1RRPA 4K0KB 2UVPA 5DIFA 2YIDA 1TTTA 1Z8DA 3W2AA 3KXKA 2PSHA 2P4WA 2REQA 1LDYA 4LNUB 3M6AA 4ZQEA 4I9NA 4HX5A 2CW5A 1KSJA 1QV9A 1XZDA 5A4MS 2FWBA 5F2NA 3LQYA 1WNTA 1O3TA 5ILVA 3LUDA 4PC1A 1E6CA 2OCKA 4GLBA 4J75A 1UAAA 4C1NA 1TMYA 4F5ZA 1CQXA 1X7WB 1C30B 3B48A 3UBMA 4G0VA 1AUPA 4CFSA 1SR8A 1SAYA 1UK9A 4B3MB