4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
4IXAA 4I0BA 3WE2A 1VKRA 3K4HA 4ON0A 3FMQA 1L5YA 1WKMA 1WWXA 3FZVA 5LHGA 3BROA 1QKKA 4QPJC 4L85A 4ZMRA 2DQRA 1YW7A 3FM3A 1R1UA 2BGGA 2HGCA 1Z6RA 3IKVA 4KK4A 2D2WA 3SFZA 3H5VA 3FDFA 3H1EA 5L3GA 2LF7A 2IP2A 4Z4EA 2KRFA 2KYRA 3H92A 4L4UA 1OYIA 1U3EM 2IYNA 3RVMA 1RXIA 2YX4A 4XSZF 1U8RA 1FFGA 2CW0F 5TQJA 1XMKA 2HYFA 3GV0A 5DKFA 5H20A 4GGGA 1R1VA 1UDRA 1XGNA 3KETA 3RVKA 3KSMA 5H6RA 2F2EA 5FLXZ 2KIMA 4IRHA 3LTEA 3RVLA 2R48A 4Q48A 2WJWA 2EFQA 1D8KA 1LDKB 5LEJA 2PFBA 4M9XA 1XGMA 3KEOA 5HLHA 3F8NA 3ELKA 4W5RA 3LWFA 3GYBA 5L3DA 3O75A 2V1UA 5D8LB 1YS7A 3FFTA 1HEYA 2XHKA 4L9VA 2MSKA 2PL1A 2D1VA 4KFCA 3GUDA 3QPTA 1PUXA 3PQKA 4FHTA 4FX0A 1K7AA 3EJWA 2J5OA 3KHTA 2VN2A 5HSGA 2L4AA 2DAOA 4WXCA 1ISRA 5HOOA 1T38A 1P4WA 2QYOA 1JDNA 1YG2A 2LF8A 2K4JA 1DCKA 2L2QA 5LBQA 4MS4B 1OYWA 2RC4A 5BRAA 3RYPA 1PNTA 1QQAA 3E61A 5K5QA 1G4DA 1PP7U 2K27A 1KQ8A 3IP7A 1DDNA 2V1DA 1PEYA 1EHCA 3OMWA 2GI4A 4OLBA 1QP0A 3WTYC 4OOIA 1XDSA 1D1QA 1S8NA 4K2EA 1SXHA 1XHEA 2UXXA 2GBPA 1IN7A 2FQYA 3KLOA 3I59A 3EDCA 1RI7A 3HRUA 1FFSA 1USIA 3DZDA 1ZGJA 1QNTA 3O1IC 1Z2EA 3BPVA 3I58A 2XKOA 4LE1A 3P9IA 2ZMEA 4JK1X 1ZG5A 1ZRDA 2A6EF 5TJJA 4QLCU 2CWDA 2ESNA 2NNYA 4RY8A 3F3XA 1ZHHA 2FN9A 4W5OA 4WWHA 5D6FA 1IUYA 4GYIA 2KKOA 5KWSA 4PYRA 4EM1A 1TM2A 3MF4A 5GQSA 8ABPA 1R22A 3QP6A 2IPQX 4LLGF 1J0RA 3E97A 3QLUC 4AIKA 1MJAA 3OMXA 2EV0A 3NBMA 4GPAA 2FMHA 3SY8A 1IW7F 5B3JA 2ETHA 1NATA 1KRWA 3E3VA 2PUFA 3QRFF 2Z3YA 3ISPA 4MQFA 4MAAA 2PUBA 3H3ZA 3FX3A 1GCGA 3JAMK 4MQ9F 5E20A 2QM3A 4A0ZA 2FF4A 4WK8F 2CHEA 2IPMA 4ZYEA 2KIUA 2A6HF 4N9IA 3CDHA 3RPQA 5DTEA 2STTA 4G94A 1MKMA 2ESHA 2CG4A 4HX4A 1OMIA 4QWQA 1Z12A 4KICA 3HTSB 2ZBKA 4G0OA 2MD5A 5HVQC 4O1HA 1P4AA 5CVIA 1QZZA 2M98A 3LUJA 4KZKA 3GFLA 4R1HA 2BBYA 3IP5A 1UHMA 4Q5SF 2PI0A 1K66A 1RZRD 1M5UA 4Q7EA 3LSTA 2HPHA 1ULYA 2O6GE 2EA4A 5FWYB 3S2WA 1DRJA 1CEYA 1Z91A 4Z2YA 3BZ6A 3I71A 3WGIA 5E1WA 5FLXK 2IDMA 3MIZA 3F73A 4BHCA 2A5YB 5DUIA 2MLKA 4OIRF 5C5EA 3KP3A 1KU2A 3HYIA 1F5TA 2PN6A 2X4HA 3V7SA 1F4VA 2M30A 1EH7A 2ACJA 4E7PA 4M73A 2PEXA 4L5IA 4MS1A 3QAHA 4S04A 2P5KA 5E3JA 2FBKA 5IX8A 4I02A 1JH9A 5A2QZ 1WRJA 3H5IA 3TDUC 4KRFA 2FOKA 3SQNA 1C0EA 3QP5A 5ICEA 1S29A 5ILSA 3D5LA 5HM6A 1BVHA 3RKYA 3N53A 3CNBA 5CJ9A 4N9HA 3IP9A 2H94A 2H27A 3DLBA 4HDUA 2O03A 1DZ3A 3QLVC 1IRFA 3VEPA 5DGCA 2FLKA 3N75A 3MAJA 4Y9TA 4CBVA 3UKJA 3OLXA 4KN7X 1B9MA 3R4KA 4UV9A 1Z25A 5DLEA 4RK1A 4G7ZF 5FO5A 4PGGA 1RXEA 5HLIA 1KYWA 3H6GA 5BRJA 4FE4A 4WXHA 3N8IA 3QPHA 3WTTC 1QO0D 3U9GA 3Q7SA 3CG4A 4I98B 1B4AA 1UHWA 3HRSA 3C3MA 4O5AA 2QQBA 1I3CA 1FPQA 3CG0A 4M71A 5CYVA 4OBBA 2BGCA 2MYNA 2VE8A 1U5TB 4HF0A 1HKQA 3P9CA 4A6DA 1B1BA 2Q0OA 1ON1A 1D1PA 5E1XA 3KP7A 3BRSA 2IOYA 2G7HA 2ZNYA 5IC5A 4A5NA 3LFTA 2WJAA 3NQOA 5E18F 4ZJPA 1UB9A 3J81Z 4NCBA 2HFHA 2L18A 4G0YA 1STZA 1E6LA 2WC2A 3OLWA 5FD6A 2DFIA 4IJAA 4KN4X 1ZH2A 1Z6TA 2PLNA 4MQEB 4P96A 3Q41A 1IRGA 4YIIA 3H5OA 1M2FA 1LQ1A 4ZYDA 2UWMA 1ZG3A 2BE5F 4LJZF 3BPXA 1D5VA 4MQEA 4RXTA 2RKHA 2ZXJA 4P9UA 1NTRA 2B1JA 3MA0A 3DPTA 2VOPA 2V1XA 3FWEA 2OU2A 2H6CA 2AS5F 4OIOF 4XFKA 2XASA 3RVPA 4HAMA 2Y75A 3DGFC 5LHIA 1TQIA 5DEQA 2IA2A 5DCMB 4WX9A 3JPWA 4D6XA 4WT7A 1URPA 2FE3A 1S3JA 1U2WA 4O6JA 2WRZA 2R3SA 4N03A 4MGRA 3R0JA 1P8AA 1FSPA 3R6SA 1R58A 4NB5A 4A0YA 5EWLB 2M87A 3CS3A 3EQ2A 3QU6A 1P6QA 3IC7A 4ENKA 1I5ZA 2L01A 1S7OA 4IGAA 2DI3A 1KA8A 3COAC 1DBPA 4M74A 3ERED 4CICA 3T8RA 4G9YA 1AB6A 1ZH4A 3GWZA 3JY6A 3AAFA 4KIFA 1FSHA 3H1GA 3RVJA 3QLUA 2VT2A 2W42A 1W9HA 3MQ4A 1RUNA 1CHNA 2ZCWA 3L09A 4U0VA 3BDDA 4FB4A 4KQ9A 4MEYF 3HSFA 3QU3A 3EUHA 4Q6WA 2GXGA 2M1BA 2E7XA 1YW8A 4OINF 1A2OA 2RN7A 1FYKA 3QK7A 3E6DA 1QP4A 5A2QK 1E6KA 2UXNA 5TQ2A 1JX6A 4IHTA 3SZTA 4BQAA 3ILHA 3Q5FA 3JVDA 3HUGA 1FP1D 1B59A 2HS5A 5EWJA 3FFWA 4Y13A 2A9PA 1YYVA 3ECHA 5I4CA 5CNKA 1DCFA 4QICA 1HW2A 2FNAA 4ZYGA 5BQTA 3HOTA 4MGEA 1GHCA 4KV7A 4UHJA 4EVSA 4AD9A 1X3UA 2XRNA 4N0QA 5IBQA 2QBYB 1JGSA 1ABFA 1O7LA 2L17A 2W85A 1DP4A 5FFZA 1SXIA 1U8TA 5TPWB 2I6FA 2QBYA 4RKQA 1XCVA 3A0RB 4RGUA 1YTYA 4RXUA 4NQWA 3TDZC 4KT5C 4KMUX 3GXOA 1HW5A 1K78B 3RVNA 4N0BA 3EODA 3K0LA 1T39A 4RGSA 3ILYA 1DC7A 1IN6A 1FFWA 3HZHA 3JW4A 4DN6A 3KZYA 2NS0A 4IMJB 3TO9A 1YMUA 1QBJA 1OPCA 3WTWC 3CO7C 2QVGA 2A3SA 2HYGD 3UUGA 4N0PA 1SFEA 3FM5A 1EWVA 2PL9A 1OYYA 3CJNA 4U88A 3QEMB 3NNSA 4KMRA 3J81K 1PNRA 3CZCA 5D6EA 4Y15A 5KQGA 4MRMB 2L3DA 4HV5A 3K1NA 2JPBA 3LUAA 3BWGA 5JNTA 4RGRA 4MTDA 4P1ZA 3IWZA 6CHYA 2WV0A 1PUEE 4YS6A 4EVIA 1QQIA 1I1GA 3RKWA 3IL2A 4HV6A 3GYHX 4ESBA 3WE3A 3MZYA 4Z9AA 3OLVA 2XV4S 1A0OA 2GAUA 3F72A 3O2JA 2TMYA 3LOPA 2EFPA 1XSXA 3WTZA 2QW1A 3TX6A 3I64A 1JE8A 2O20A 3RI4A 3N6VA 4M9ZA 1DRKA 2FMLA 5ICCA 4O5VA 3M8FA 2XKPA 3H1FA 3M6MD 3LAPA 4MR8A 1EH8A 3MEXA 3RIRA 1GXQA 1HXDA 4LD5A 3OV8A 3VNAA 4RK0A 5CHYA 1Y0UA 2A69F 5BOXA 3HTUA 4M88A 1IXSB 1JFSA 4Q4ZF 1AOYA 2N9UA 4OLAA 1KYZA 3DBIA 1G3TA 2GA1A 3RVRA 5EEGA 2YHBA 3UK0A 2FXAA 1GCAA 3HCWA 3GEZA 4EJVA 4MLCA 4YR7A 5TE9A 3TQNA 2M8EA 1BBYA 2XUBA 2DLLA 3EETA 4KIBA 3MZHA 2J5PA 1FLIA 1U2PA 1U6GA 3KS9A 4ZPJA 1EWTA 2FQWA 2RJNA 4UV8A 2F8SA 2Z33A 2QENA 1ZHFA 3D02A 1Z1DA 5LRRA 2WWVD 4KMFA 4MS3B 4G7HF 2X7XA 1ISSA 2P5LC 2QZJA 4LB6B 2DW4A 2M5WA 4MS3A 4OMYA 2HWVA 4L9NA 3WTVC 4KK3A 3GLXA 2PQ8A 5LGTA 4CZZA 4TV7A 3HIFA 3ROUA 4WXMA 3QOPA 3BRQA 3LQQA 4H3HB 1YVUA 1H0MA 5DDGA 3D0SA 1SD4A 5FGMA 2P7VB 5L3CA 5JHUA 2EV5A 2FMYA 2VC1A 1XSVA 2NAZA 1U5TC 1DUXC 5IT9Z 5FFXA 3DP7A 1YK1A 3H75A 3G1WA 4YIFA 3GVAA 3QELB 1J7KA 4M9SA 1R00A 3ROTA 1IN4A 4JB0A 1FWZA 1H9GA 2QVCA 4HQMA 1FSEA 3V8KA 3HJFA 3TKYA 2RGVA 4QYWA 4PZ0A 3KP4A 3E3MA 2STWA 4YGXB 3IHUA 5BR1A 3ML6A 1BC7C 5K5RA 1DP7P 1IIBA 3HHHA 3GFIA 3HO1A 1NXPA 3SNKA 5HDNA 2CD7A 4EGSA 2OAZA 4MS4A 4TMYA 1BI2A 5LLQA 4JB2A 1U0SY 2JB9A 1BOAA 1QNLA 3C97A 4ETSA 1M2EA 2HQNA 5KQMA 4KVFA 4GYGA 2LSOA 4OIQF 5GOTA 5JNUA 1D8JA 1MIHA 2P4UA 3MCZA 2NYXA 1DC8A 5HLGA 3LAJA 1QPZA 3I53A 2KJBA 5KK1A 2P4WA 1W5TA 2XAFA 3N0WA 4EYGA 4XLNF 1RUOA 1MZBA 1WETA 5D5UB 1REPC 4P98A 1BI1A 4BHPA 5D2CA 4YO7A 4B8XA 2NUBA 5HKOA 3URMA 3D8UA 4N47A 1MD0A 2ZWMA 4RS8A 4PDKA 3BY6A 1UCRA 1ZLJA 4LG0B 3SHFA 1USGA 4WXDA 4I7HA 3BREA 1EFAA 1LJ9A 5EWMB 1Z13A 3SM9A 5FD5A 2FKAA 2HSGA 1RNLA 3K9CA 3GW2A 3Q9VA 4OU0A 5FBHA 4WUTA 4OMZA 4EVRA 5CVJA 3BJ6A 2CGPA 3IDOA 1IXRC 1BM9A 4ENJA 4W5NA 4RK4A 4Z9BA 5CNJA 4ESFA 2AYXA 1LDJA 3WTXC 5ICFA 3W6KB 4NQRA 1W5SA 1NXSA 5CLSA 5D4SA 3GF2A 2OZ6A 1CGPA 1MJBA 1C0WA 4EV0A 1A04A 4HNSA 3N4MA 3ZMDA 2DO7A 3IPCA 1EAYA 4A2UA 5TQ0B 2LKPA 3LUHA 1ODDA 1Z7UA 1O3QA 1W7PB 3DQVC 5D5VB 2IT0A 2A68F 2QR3A 3OM1A 3HV2A 3P7NA 3IKTA 1YFHA 1KU7A 1FZPB 3JS5A 4PGHA 2K02A 4MLDA 2VBYA 1F51E 5D5WB 2A9RA 1W7PA 4GO1A 2X0LA 2HJ9A 4W5TA 3EQZA 4LRQA 1S7AA 2FA5A 2XAGA 1OXBB 1DJMA 4Q47A 2B0LA 4G8XA 3P9YA 3HHGA 2VC0A 3SZPA 4YWHA 3T1BA 1XN7A 2P6TA 1QMPA 5FWYA 1U78A 4GNRA 4L0YB 3B02A 3C3WA 3KYJB 2LDUA 3OM0A 5TRDA 2HDCA 1XWWA 1BAPA 2P6SA 2JTVA 1H9TA 2FNPA 2GIVA 5DCFA 4IILA 3K9TA 1OKRA 2GA2A 3TO5A 3T38A 2IA0A 2RV8A 2NNNA 1T6SA 4F11A 1ON2A 3F6VA 1D3YA 1JHHA 2OBPA 2ADUA 1ZARA 3TGNA 4HA8A 2E1NA 4JBAA 4JA2A 1PHRA 4IVNA 3GT7A 3W9SA 4ASNA 2FMKA 2K7LA 2CFXA 1RPJA 3KE2A 2A61A 2D45A 2XGXA 2C6YA 1KU3A 3F6OA 3HDVA 1XGOA 3B2NA 2JVKA 4XSXF 1T0FA 4A6EA 1R8JA 3P9KA 2Q5CA 4E70A 4MR7B 3WG9A 1PEAA 3KCNA 2UZKA 3LKVA 1R1TA 2WMYA 4LMYA 4HZFA 1P2FA 1J56A 2FXIA 4YLEA 1ZGGA 4EYOA 4HOBA 1ABEA 2Z99A 3F8BA 4Z4GA 3BP8A 4GCVA 2XDYA 1J59A 1ZVVA 4ZH4F 1YK0A 5ILUA 2ID9A 3LKBA 4YCSA 1E6MA 3NEUA 1FX7A 1TW3A 1SD6A 4HLYA 1FQWA 1MJ9A 3KKEA 5L3BA 4WWCA 1GUDA 3QEKA 2M45A 2PJPA 1TLFA 1U5TA 1IF1A 3V8JA 3T6KA 1FYMA 3KP5A 2FEKA 2QVOA 2ID7A 2R4QA 4DADA 4F3TA 2ZO4A 3KCCA 5D5XB 4CO8A 5IUJC 2PMHA 2R47A 1ZLKA 1Z15A 2DPDA 4G7OF 4Z4IA 1ZGAA 1ZDMA 1B9NA 4LDAA 1KRXA 2PBIA 1JFVA 4RDCA 1O7FA 4RY0A 2H3HA 2EK5A 3H5TA 4XLPF 4YV7A 3HUTA 4HX7A 2K86A 3FMSA 3Q7RA 1Z05A 3ZP5A 2DU9A 2R7DA 2A9OA 3T5XA 3H3UA 4UVCA 2VBWA 3I5AA 3A0UA 1VPWA 1KQ0A 4MYRA 2G7UA 4ETIA 3ZMZA 5T3YA 3RVSA 2L4MA 1BIBA 2O8XA 4ENMA 2PAFA 1I27A 1Y1LA 4PICA 3EAFA 4Y17A 1O3TA 3L49A 4L9JA 2CYYA 1SFXA 5DCMA 1NHAA 3RYRA 3RDIA 3V8LA 3ABTA 5K5OA 3CLKA 5CNIA 5FWXB 4HBLA 3G3ZA 4F7ZA 4KA4A 1T2KA 4S05A 3O2SB 2IJLA 2ZNZA 1F9NA 4JQFA 1WI9A 3GWGA 1NXWA 3EDPA 3HS3A 4G6DA 5EWLA 5LGNA 4IF4A 4HF2A 2EB7A 3E5UA 3TB6A 2RVCA 2FEPA 1Z26A 1XB4A 3LMKA 4XAQA 2F5DA 2CHFA 1CYEA 1KQ9A 4Q6BA 1M5TA 4ZZLA 2JPCA 2Y48A 3RTRA 3FMRA 4H3KB 3JSPA 4LFUA 5ED4A 3RKXA 4EY3A 1EH6A 2G9WA 2IA1A 4BNCA 2ISYA 3CKMA 2EV6A 2PE5A 1K68A 5IUKC 2MYPA 2JZYA 2MSLA 1BN5A 4IMIB 4JASB 4JAVC 1L5ZA 3SAJA 3NHZA 1R5GA 3MYYA 3VNBA 4F8JA 1L0OC 4U7DA 3WTSC 4MR9B 1YS6A 3V7CA 2K4BA 4OATA 3K69A 4ZYLA 3CU5A 3JSOA 3BOQA 3I4PA 3FFXA 2PUAA 4KREA 4MR9A 1EWKA 3F6CA 3CFYA 5BQ3A 3OO1A 3TMYA 1O3RA 1SD7A 3F7NA 3SG0A 4RS3A 4CYDA 2YR2A 1BJAA 1VLZA 3WODF 1BDIA 2FSWA 2HQRA 5ICGA 2R25B 4HDVA 2OQGA 3HDGA 2PUDA 5PNTA 4CGZA 5KC8A 2MBFA 3KJXA 4UXNA 2LP4Y 4G86A 1LK0A 4AWXB 2R7FA 2RJOA 5ILVA 2MH2A 2IW5A 2FMIA 3A3KA 3T95A 4U7BA 2COMA 1ZH5A 5TPWA 4UNOA 3I45A 4KPYA 3PQJA 2FEZA 1B00A 5CVUA 5JNSA 1OR7A 1SD5A 1K78A 1TBXA 3CTAA 1YW9A 1QPMA 1G3YA 1EV7A 1XHFA 2RGYA 1NXOA 1R7JA 3KLNA 3I54A 1DPRA 4BYYA 3FF5A 4KIGA 4UUVA 3CLOA 2YSRA 3KP2A 4A12A 4H60A 3E5QA 1FOKA 3JTEA 5JVTA 1DPUA 1HKSA 1LNWA 1WQ2A 2AYZA 2XIGA 3QEMA 3Q9SA 4IHSA 2L02A 2F5FA 1V4RA 3OOPA 2MC3A 4U0WA 4E7OA 3OQMA 2W84A 4H0EA 2E4YA 3F8CA 4HNQA 3CUQB 4MRMA 5C5CA 4RAYA 4RKRA 2PJUA 1ZYRF 4RY9A 2GKGA 3NNNA 1HKTA 4RB0A 5D8KB 3LA7A 1J2XA 4XRFA 2ELHA 2NT4A 3S99A 1AWCA 2BYVE 3DLHA 4WF2A 1QZYA 1ONVA 4YG2F 1TMYA 2IPNA 3T8TA 4UVBA 3VOEA 2F5EA 5K1YA 2V9VA 4YFKF 5LRSA 3WGHA 1I1SA 2DT5A 3U1DA 3W6JB 1BI3A 3I0TA 1E2BA 4RB3C 2E7WA 4M72A 5E8GA 1E17A 2ZKZA 5H6QA 4RK7A 4FX4A 4AVPA 4RZSA 2DQLA 1D2AA 4BHBA 3RVQA 2JSCA 3LA3A 4OTZA 7ABPA 3M9XA 1Z18A 3Q15C 3ZMSA 4XXHA 2HOEA 2D1HA 2Y0MA 1O57A 3J7AO 5BPDA 1VTNC 4Z0NA 3TO7A 2PLYA 4TLMB 1G6NA 1QQBA 1G3WA 2JBAB 1YQAA 3LA2A 3M8EA 1XGSA 3KFWX 2BV6A 2OA4A 3LQRA 2JBAA 4PZJA 1FBSA 3CUOA 4EYKA 4XASA 1H9CA 3HXMA 3NNDA 3VFZA 2XVCA 2P8TA 1JFTA 4FT8A 3K1PA 4A0XA 5L3FA 2VXZA 2E4XA 3QX9A 2PMUA 4Z4CA 1JLKA 2PUCA 1RIOH 2B4AA 3B73A 3DV8A 1W7PD 4RXMA 5TPZD 4MQVA 3KP6A 1JF8A 3R61A 1W4MA 1J9IA 4IRIA 3CHYA 1FY7A 3G85A 3I09A 1BI0A 4BXUA 2QQAA 2E4WA 3QELA 3ZMTA 1LBHA 5F64A 3NRVA 2H6BA 1MVOA 3GBPA 3FMVA 1YTUA 1LEAA 3C1DA 2YU3A 2KIFA 3ZN1A 4RWEA 3KYIB 2WY2D 2WTEA 1FT9A 5AONA 1LJUA 4EJTA 2YHAA 3DEUA 2QWWA 4EQQA 4LK1F 1JHZA 2HKOA 2QQ9A 3O2PE 3ZMUA 2VODA 2JRTA 3ECOA 3HVRA 2XAHA 5JR3A 2FQXA 2MH9A 3GZ6A 1TNSA 1J5YA 2MLGA 3F23A 1DBWA 1O3SA 1U2QA 3F8MA 4DNCA 1GUBA 2FBIA 3O21A 3DFGA 3M7GA 1ZESA 3IPAA 5JNWA 2MYUA 1ZRCA 1U04A 1XD7A 2VBXA 4RK6A 3O1HB 1GLGA 3I59B 3GZ5A 3HSYA 4EUKA 3EQLF 2A9QA 1DBQA 1G3SA 3QX8A 1XSDA 1RZ4A 1TVMA 3WGGA 3K2ZA 4KDPA 4G0PA 1SFUA 1Z2DA 3BJAA 2VUIB 1F4KA 1NXVA 1HBXG 2ZMEB 4MPTA 4HQEA 3A10A 1P6UA 1HSTA 2VT3A 4D6YA 2BEOA 4N41A 4EGYA 1Q1HA 3ZPLA 2QSJA 4HYEA 4LG0A 2P7CB 3OLYA 3EGCA 3OLZA 3M9AA 5EWMA 1GVJA 2GWRA 4R8HA 5KQPA 3LUFA 4G97A 1KU9A 4CXFA 1APBA 5KC9A 3SXYA 1USKA 1FBQA 3DGEC 3REOA 3WTUC 1LBIA 5J8FA 2DTRA 3O6BB 5DD4A 3O1JC 4LZLA 3F6PA 4WXEA 2XAQA 3HSRA 3IRQA 2JK1A 2MYTA 1R23A 3BJOA 2QV0A 2L54A 4MQFB 2QZ8A 1MAVA 1SMYF 3JPYA 3ROFA 4LDZA 3N97A 2GQQA 2J48A 3GA5A 2H0AA 1OXKB 3F8FA 3H6HA 4I01A 3L9FA 5LGUA 3FHZA 3GL9A 3DKWA 4M6YA 5TQ0A 3R0AA 4NICA 4DQ2A 4I09A 4RAZA 1TW2A 5J6XA 2WWYA 5TPZA 4UVAA 4MEXF 1FBUA 4WCGA 2DBBA 4JOQA 3J80Z 4ZZDA 3N0RA 2YPRA 2LBPA 3OQNA 3C6QA 1TJYA 1KMIY 4RB1A 3IWFA 3GBVA 5DUKA 5IUNC 3R60A 4L5JA 5J8CA 4LK0F 1ZAYA 3CTPA 3DXJF 3HSEA 3PFIA 1D5WA 5JFRA 2FQ3A 3RPUA 5E17F 2TDXA 5E8IA 2EWNA 2IPAB 4AIJA 1Z16A 3GFMA 3N0XA 3E6MA 1YIOA 4G0MA 1S6LA 4O3MA 1NXTA 3I5UA 5DD8A 1JXSA 4G0ZA 5IT9K 3NHMA 1JL3A 3G73A 1T98A 2PKXA 4L9TA 4FE7A 1FNNA 4UHTA 2AXLA 5JNVA 5AIPA 5ERIA 4YRZA 4LGWA 3BILA 4EJOA 2GX6A 4ENNA 4MS1B 4JP1A 4D74A 1JYFA 2FSPA 3MWMA 2IRFG 4RV5A 1XCBA 1ZITA 4EVQA 2DK5A 2HZTA 3DPLC 2QLZA 4RK5A 3MQ0A 2MSWA 3HUUA 3CUQC 5E1ZB 1NY5A 1QGPA 3L7WA 5HS9A 2A07F 4HX8A 2OZUA 1W25A 3MM4A 4G0XA 2E4VA 4PEVA 3FGZA 2V0NA 3EULA 1FC3A 1TLHB 2HKXA 3V4GA 2PMCA 4MR7A 4OIPF 3GRCA 2VONA 5JI6A 3MMNA 1TTYA 5KVRA 2QU7A 5DCLA 3EYYA 4M6XA 1HSJA 1FP2A 1DG9A 1JHFA 1USTA 2JT1A 3ZN0A 3C3KA 1J75A 1R5HA 5KQLA 2P9HA 1HQCA 3HRMA 5CVVA 2JVJA 4EM0B 1LB2A 4ZYHA 2PUEA 4MHGA 1BIAA 4W5QA 4ML3A 2W24A 3U2RA 1SAXA 2E4UA 1PDNC 1ZY2A 1JWLA 1FYLA 4RB2C 4Z99A 3E5XA 3KG2A 4ETMA 4LLNA 2VBZA 4F06A 1R36A 1MB3A 4BAYA 3O2QB 4IRXA 2JCGA 2RNJA 1P92A 4RU1A 4TN5A 4LX8A 1SRRA 1ZGZA 3L6UA 3ULQB 3H5LA 1SMTA 4EYQA 2M1ZA 4PCQA 2XAJA 1USSA 2IKSA 4R79A 2HEOA 1QP7A 2OD5A 3O3KA 1RZRA 1BC8C 2NZVG 4QYMA 3FXQA 4I2OA 4GXOA 1ZG1A 2IVMA 3LUDA 3OO0A 5AIQA 1BA2A 4EMSA 5DV5A 3ABUA 5F6FA 5HS7A 4EJWA 1MGTA 2EA2A 2VE9A 1LJLA 2OQRA 2CWEA 3GO5A 5BMZA 4PE5B 3HOSA 5EEHA 1IZ1A 5HDKA 1YO5C 3CZ5A 1TQPA 4HF1A 1C4WA 4L0ZB 2HQOA 4ETNA 4KQCA 5BS6A 2LIVA 3J80K 3GFJA 3M1EA 5FWXA 2CO5A 2HTSA 2V6CA 3C18A 2MA3A 1JYEA 2FMFA 2P5VA 2F5CA 2H09A 4Z4HA 3OQOA 3L2CA 5LEKA 2O61A 3KTOA 3JTHA 2NT3A 4P5OA 3DF8A 1BDHA 4LE0A 9ABPA 4P55A 3IRRA 4ESJA 5JS2A 1IN8A 2Q8KA 4KYWA 4LLLA 3Q7TA 6ABPA 3K1MA 3T0YA 4D0PA 4B09A 2E4ZA 5CNMA 4WZZA 2EFOA 3LUGA 1BDJA 2PUGA 3E6CC 2ISZA 1I6XA 5IEBA 2KJCA 4TLLB 1SXGA 2FEWB 4MTEA 1TNTA 5F1RA 1TQMA 4RGXA 3O74A 1UFMA 4LB5A 4XLTA 4BH9A 3RJPA 4ZMSA 4EGZA 1YMVA 4RSMA 4HW0A 5HS8A 1LEBA 2ZAYA 1B6AA 4XBFA 3VODA 4NV3A 5JS1A 2EFNA 3FXRA 4O1IA 4YFNF 4YFXF 2VK2A 2ZFWA 2Q2EA 3BBLA 1E2XA 1JBEA 3LUKA 1Z9CA 5L3EA 1XDUA 2W57A 3VB2A 3FXUA 4HLXA 2FU4A 1GXPA 3CO6C 4AIHA 1Z17A 4NCAA 3M9WA 5BPIA 5TQ2B 2GZWA 1QO0A 3RVOA 2QUFA 1K6OA 1AB5A 1IN5A 4Z4FA 2FRHA 4HNRA 3TD9A 3HEBA 5EWJB 2Z9OA 3RH0A 2VYCA 1V3FA 1DCMA 3HK2A 2EFWA 2L19A 1CF7B 3IP6A 4KNYA 2O3FA 3L00A 4G0QA 2CSOA 2W25A 4EJUA 2EJRA 3JVIA 1K79A 3TOAA 3KZZA 4OG2A 1YLFA 1CF7A 3V7RA 3WU1B 6PAXA 2FTKE 2NRAC 2V79A 4I0AA 5FB2A 4LE2A 2DPUA 3HRTA 5KI6A 2HTJA 5B3JC 3QLTA 4L18B 3HM9A 2RDPA 4IPAA 3I42A 2DRIA 2VUHB 2O0YA 3EYIA 2E1CA 4P9FA 2FLWA 1IXCA 4XARA 2Z5UA 4U0YA 2FN8A 3F21A 3LUCA 3WU0A 2JVIA 1LDDA 2LPMA 2LNBA 3H5WA 2NZUG 2FBHA 5JNRA 2F8TA 3LFKA 5D4RA 2HR3A 4YP9A 4CHUA 2RDMA 5IEJA 2VOOA 1MB0A 5LHHA 1T34A 3F22A 4CDGA 1ZREA 5IT3A 2PG4A 2RQPA 5HQJA 4NHJA 1KGSA 3JTGA 3ZMVA 4G6QA 5FBKA 3CUQA 1NXXA 5T7BA 1P4XA 1P6RA 1IAWA 5ABPA 4MNUA 3T8YA 4IRGA 2FW0A 2CQKA 4EM2A 3CRNA 2WB4A 1D4ZA 3KEQA 5HDGA 2OENG 1L3LA 3GX4X 5CVRA 3MFKA 4N76A 1HW1A 2GXBA 2XROA 1LVAA 3C7JA 2LUOA 2FVYA 3QLVA 4F12A 2YX7A 3E6BA 1F1ZA 1MDMB 2QXYA 2IPLA 1ZRFA 4DQDA 2JRLA 4UHKA 1MDMA 3ZQ7A 1XMAA 2ZJ2A 1ZAOA 1JDPA 2HQBA 3RQIA 5IULC 1WSUA 4A5MA 4MR8B 4KUMA 3TOBA 5DYMA 1ZN2A 1PP8F 3TO6A 3JAMZ 1VRVA 2DK8A
chains in the Genus database with same CATH superfamily
5BYBA 5JAUA 3X1DA 4K8RB 2R11A 5CM8B 2GJ8A 3NIDB 1HNNA 3NYRA 3OJCA 3ZDQA 1HLVA 1R10A 4D81A 3SSAA 1G6OA 3EGOA 2W2KA 1P5JA 1ESDA 1GPKA 4DW6A 3RTAA 1PZFA 2J3LA 3CGWA 1WH5A 3U4AA 3AYZB 4E2XA 1OHHD 1N7HA 2QD1A 2KIMA 4IRHA 1DX6A 1J2UA 4LJ9A 2HXYA 3DKXA 4F5WA 4DCGA 5LEJA 2F43B 4O25A 3EHEA 1X77A 1U0TA 1GTJ1 1PG2A 4JLSA 4N6GA 3WHCA 2PL1A 2HNHA 4BU0A 3JQ8A 1S1MA 2JC3A 1P4WA 4I3FA 2PD6A 2E60A 3B5IA 1T6YA 4LBYA 4D1QA 3RYPA 3HNOA 1QQAA 2Q5LA 1G66A 1KQ3A 4YJ2F 1XQ6A 1EHCA 1MJNA 4DDMA 2BMVA 4LC9A 3A3NA 1G17A 5AVUA 1RI5A 5KCZA 1Q1QA 4PRLA 4CMBA 3FCSB 3DL0A 3BQZA 3A27A 3QU2A 2O7RA 3SPXA 3HRUA 3LQ1A 3A4TA 3VV3A 2V6MA 2B5OA 3NQ41 1ZRDA 4JCCA 1IDN1 4YP5A 2P4HX 1E2MA 2NNYA 3ROEA 4PCUA 4C3VA 2HRQA 4W5OA 3A25A 1BHO1 4JI8B 2H11A 2DERA 1UJ6A 2M34A 4BLRA 3TL6A 3MF4A 3QP6A 2IPQX 3IRVA 3K4QA 2DWOA 3QTBA 3Q11A 3LC7O 4N7MA 4D3DA 2PUFA 1PGPA 1CU1A 3JR9A 2GRUA 1HGXA 4LIVA 1YCFA 2JSPA 4OBEA 3IOCA 4UEWA 1FZQA 1CIVA 4I66A 5IKPA 4IDGA 4IYRA 3OCYA 4ZYWA 2MD5A 2XXBA 1TRKA 3MRSA 3GFLA 4D8VA 1IUNA 3GN1A 3HYSA 1UHMA 2PI0A 4NIMA 4QHSA 1PNQA 1XXHA 4OSEA 4E6EA 3B48A 3LSTA 2NO7A 5FXMA 3ZI4A 3INYA 1CTQA 2H2DA 4NU6A 2YWCA 3DFIA 2RREA 3K4NA 3P52A 3OZRA 1Z36A 3IUNA 2O0KA 4DNXA 4N01A 2FOLA 5L3VA 3GT0A 4FMDB 2AOUB 2PN6A 1UWKA 1VLQA 3VO9A 3T9FA 4M73A 2HUNA 2QN7A 4WKPA 2CY0A 3WC4A 1XZAA 3ZNQA 1YS1X 1W1IA 4I02A 2JDIA 2BXZA 3L8HA 4PLTA 2R8ZA 1GG8A 2FOKA 2PRJA 3GTOJ 5DN6A 13PKA 5B7PA 4ADSG 2W2OA 3VJRA 4HTFB 2H3EA 2PKRA 1MMDA 1DZ3A 4XJVA 4RA2A 4KN7X 2FG6C 4EM6A 5B1YA 4UOEA 4FTHA 5LZ4A 3MQFA 3H6GA 3IP4B 5FO1A 3DXYA 5EVJA 2BI7A 1QO0D 4BFYA 1V5EA 1B4AA 3HRSA 1OLUA 1CJMA 1IWBB 1NBIA 2Y0DA 3IJPA 5HW0A 3UMMA 4LJ5A 2IOYA 3EASA 4R0MA 3NQOA 1L5LA 1BMTA 3Q9UA 3W34A 5BORA 2VRCA 4OHUA 1ZUNA 5LOVA 3L1IA 2RARA 3W3AH 4GRIA 1E7WA 4G1EB 3VZBA 3WWZA 3L0BA 1E96A 1NTRA 2F00A 2X0DA 2Z30A 1JP7A 3RSFA 3KJNA 1PUIA 2IXSA 2QUZA 1ZJ6A 4IZOA 4FBLA 3FOFC 4PM4A 2QLMA 3UUEA 2OZEA 2CDBA 2VA9A 3FOCA 1WD5A 1R58A 1TM4E 4A1FA 2PJDA 3MMZA 3IHLA 3UXEA 4AJIA 1Q0HA 1E79D 2GBIA 2WIGA 5JALA 1CVRA 1R0KA 4M74A 3ZR8X 3VU9A 3MCUA 1XRLA 3C24A 1GEGA 3IT1A 1HR0B 4U0VA 2NP7A 2PQ6A 4XH9B 4O1MA 3OPQA 2WUWE 4XSHA 1RYDA 3QK7A 1R9JA 1QP4A 2QEQA 3VBCA 1VQ4I 4AZ3A 1OU4A 3D7RA 3AEUA 3HA7A 3PC2A 4DM4A 2LCQA 3ZZMA 3NM6B 1EA5A 3CZ4A 2K9QA 4AD9A 1UL1X 2VTBB 1ZI8A 1JGSA 3KQYA 2IV3A 2I6FA 4CPDA 3FY4A 5BSTA 3QV1A 3DTKA 2YCLA 3L7OA 1SKUA 4MW4A 3UKDA 2WE8A 5FLMJ 1T2NA 4PPNA 1TO2E 5TS2A 4HMQA 4MAFA 4YECA 2DQSA 2ZTVA 1CUWA 3J81K 3FN4A 3PFGA 4PTLA 4JLOA 3ZK9A 4Y15A 3DKRA 4LZWA 1M9NA 1LFPA 2JJ7A 1EEHA 3HZZA 1N8SA 2JI4A 5EJ4A 3X2FA 4CFSA 3GYHX 2YJTD 4H6WA 4V3CA 3MZYA 2FSUA 3VPCA 2D5VA 4HD8A 3O4VA 3FTEA 3DE6X 3TP0A 1P74A 4F71A 1PJTA 5JJKA 3NKFA 4JUIA 1SBZA 1C1DA 5KX5A 3IAS1 3D3EA 3LXUX 2X9NA 1GQYA 3M83A 4G9BA 3UATA 1O94A 1U7OA 1H93A 2OHVA 1Z0UA 1DWUA 5ECYA 3G6EI 1E5QA 5JVDF 1GXQA 2FETA 2V7QD 2DHCA 1JFSA 2P0YA 2EFHB 3MBOA 1A4UA 1IBLB 1P17A 1TLTA 3ICVA 3H19A 1PUFA 5TQVA 2ONYA 3K35A 2XUBA 4YUVA 4G65A 4ZDWA 3PKIA 1JE0A 1RWQA 4XK4A 5L7TA 1N2HA 2HREA 4W5JA 3ICQB 3U1TA 1UFVA 2DGDA 2WDPA 2K85A 2OZPA 5B66C 5ARCA 2HA6A 3GGDA 3N5KA 4ICIA 4L9NA 3S3MA 2AZTA 2PQ8A 4EW6A 1C1XB 3VH1A 4IUCS 3L41A 4I4TB 1NMSA 3GQBA 1KETA 3AV0B 4ZCMA 4QOSA 2LRDA 4DNPA 2Z2XA 1DUXC 5FFXA 4FGUA 1Y5LA 1TF7A 3G1WA 3R5TA 4AJLA 4IRUB 2F2TA 3B8EA 1V96A 3K5PA 5GONF 4QYWA 1Q6ZA 2FZ4A 4MYHA 1JR3D 5KOJB 3IHUA 2GLTA 1BC7C 3HUEA 2OAZA 4D4MA 1BI2A 1D8TA 5AW2A 2ZETA 3TPZA 2ODEA 4ETSA 3FLMA 1BC5A 4RQBA 2QMHA 2GXQA 2WF6A 5JNUA 4IQJA 3H9QA 121PA 1SKBA 2YIVX 3EOAI 1TL7C 2XOXA 3WTBA 5DCYA 3VVMA 3KHSA 2HMYB 3ZV3A 2JASA 4Y98A 2WAQA 4JKOA 2IH5A 4CKBA 2WNSA 3C7AA 1W1UA 4JCOA 1NA5A 4EVRA 5AJZA 5J5AA 1JA0A 2X5NA 2AV6A 3IA2A 2ZXUA 1LDJA 4JP2A 1K8XB 3LT1A 4AKSA 5AICA 1MJBA 3PBKA 1P1HA 4IIGA 4PTYA 5GTHC 5BNFA 3S7TA 4HC4A 3S16J 3KYCA 3ZHYA 1DAHA 4LIUA 1XJ0A 3BL5A 1W7PB 2QQEA 4Z86A 5AVWA 2QUHA 2VHTA 2XZPA 3KAJA 4OQFA 1XN4A 1OCOH 1R0LA 4KB5A 3ZQ6A 1DJMA 2WMOB 1BN7A 2IYPA 2OKCA 2OORA 5ALHA 1TA0A 3PXCX 1FPMA 3CLRD 3O4JA 3UJ9A 1ZM7A 3OZVA 3KZIC 4Y1RB 2PZMA 2Z08A 4LZZA 3EW7A 5I8ZA 3AU9A 4LJRA 4ETWA 2G0TA 4O4JB 5T8KA 1EHYA 4OFXA 1H2AS 4YLYA 5BRNA 3K6JA 4CYMA 4JK3A 3ZBTA 3DO6A 4WKBA 3O26A 4JBAA 3NOOA 1G8MA 3HKEB 3IAUA 2C6YA 4KR6A 3EXHA 1EWRA 4MIKA 3PLRA 1T0FA 4NATA 4S35A 2Q5CA 3JXEA 4L75A 1QIMA 4DIOA 3G5MA 3JSAA 2GJ4A 4TQUS 2A84A 1YRAA 2I34A 4N0MA 1YK0A 5ILUA 4MB6A 3BSFA 4LZAA 2AB0A 3ETCA 4PX5A 2MWMA 2P81A 3ZYZA 2HEIA 5KNCA 2OB2A 5GGYA 5LP1A 4CKWA 1Z74A 3TZEA 1SPBS 2VUMJ 1YRYE 1T35A 1F6DA 5BSVA 1A27A 4KXMA 2ZB7A 3T7DA 1U3GA 1E6CA 4FTWA 2DUWA 4WXYB 2P65A 1IUFA 3JYLA 3I76A 2P6RA 1XLWA 4J9UE 2OA0A 3OR1C 4IVQA 1I7QB 5ANRB 4L9JA 1Z0SA 3O95A 1FP7A 2CYYA 2VPYA 3CYFA 3WDKA 2R1ZA 1XLTC 4O4LF 2XADA 1GGJA 3KSAC 3HDYA 5EKXA 2GCNA 2NV6A 1Y33E 1IBCA 1SIUA 3D4NA 2DB3A 1W29A 4KO4S 1KP2A 1OI3A 4J6FA 3FXJA 2Y48A 3HFRA 3ZLVA 3OZXA 2G9WA 2IA1A 3QBVA 3F5DA 3BD7A 3D6NB 4K8OA 1O96A 2YMLA 4JAVC 4M83A 1IZZA 5FPHA 3ZV6A 3PHGA 2EIKH 2DA6A 1KI6B 3BDIA 3LCVB 3V7CA 4OATA 1G6Q1 3T5BA 2AOWA 2NSHA 3FFXA 4XWYA 2OGUA 2PKQP 2V55B 3ZNPA 1XMJA 5BN3A 3EMKA 2CH0A 1MP0A 5CIYA 3ZJTA 1Z4PX 3PQ2A 3UHAA 2IQ5A 4UXNA 4OOEA 3ASUA 3ZH2A 1O97D 2HLPA 4U7BA 2I29A 3S8EA 3MTEA 4XFDA 5IJ9A 1AMNA 4G4SP 2R7UA 1UZLA 2R7QA 3BK1A 3IA7A 5KYKA 4KMOA 5EQFA 3EPRA 1C9YA 3KLNA 4KIGA 3CLOA 3HXQA 2R8XA 3FLEA 3WGVA 2BVMA 1MD9A 2HRRA 1F5SA 1V4RA 4CKEB 1Z2PX 1HDOA 1AUOA 3DQPA 2SKCA 2VIIA 4XI9A 1K83J 2W0SA 3G2KA 1Z37A 3B1KA 4HRVA 4L3OA 3L1JA 4O2AA 2IUSA 2ZJZA 3GDOA 3T7IA 4TMTA 2BYVE 2O2HA 4I5IA 4B3HA 2WKPA 2GAIA 4D7AA 3AG3H 4YYEA 3VOEA 1XRPA 2TYSB 3UJDA 2QSHX 4FKBA 2IZ6A 2PGLA 1E3LA 4MMXB 5EZGA 2CF5A 4CCWA 3LX6A 2GOXB 3M3YJ 4EKNB 1MW7A 4RZSA 2XZDA 4IHJB 2C1EA 2WA2A 3B1XA 2LD4A 1USWA 3ETEA 2OECA 1WMSA 4JYPA 1G18A 2C1ZA 5EKTA 2PVPA 3CX7A 2W6OA 5TS3A 3M8EA 1EDOA 1TTPB 2VJLA 4RZXA 2KFDA 3DE0X 2PYIA 1K6YA 4XASA 1QHYA 5F2NA 3NNDA 1I2AA 1T2AA 2GPAA 3UQYS 3K1PA 4DRYA 1IUKA 1Q7TA 2PMUA 4CIWA 1O58A 5ELXA 2BZGA 3I8XA 4RXMA 1TMGE 3AI7A 5CU7A 2XYGA 2ZB9A 3QZUA 3ZEAA 1RRMA 4NABA 1DX4A 2YWJA 2ZC2A 1DX9A 3HR7A 4JJZA 1M8GA 5B30A 2BY1A 1U0HC 2F4VB 4JVMA 4C0AC 1ZMXA 5JRJA 3VYWA 4J4TA 1CQXA 1XQWA 1O1YA 1SVUA 2FDRA 3PFNA 2DFNA 3KXDA 2BH9A 3HL4A 2NU7B 4EL5A 5IZ4A 1U04A 2XECA 2BKEA 4BO4A 1ZCBA 1TD1A 5EE0A 1RZ4A 3OF2A 4X24A 3CJQB 4EJFA 1NY6A 2F3QA 4YMUA 2IHNA 4HSGA 2H51A 4JQOA 3HJHA 2ZMEB 1O6CA 3G0CA 2V59A 4U9UA 4EGYA 2OT3B 3VZQA 4C05A 4IHXA 3SJ7A 3L2OB 1BMQA 2WVJA 4EO4A 5DD4A 1R23A 2QV0A 2VKEA 2I65A 1MAVA 2J48A 3O4RA 3PU6A 4B48A 1C3OB 4UEKA 2IYXA 3U3DA 1VLMA 2PX6A 2ZJPF 3WL4A 2F8MA 4U63A 2O5CA 5EHXA 3CKKA 2X4GA 3HN6A 4X90A 4JOQA 5DX1A 2KM1A 3V00A 1CUXA 3U09A 3IR6A 3OI7A 1EI9A 1MH1A 5GVRA 4DEYA 5IFKA 1WXEA 1ICIA 3HSEA 2E2WA 4BN4A 3K70C 1D0IA 3W2AA 4XKJA 4JL6A 5E8IA 5CYGA 1COWA 1VOTA 1AQJA 2WR8A 1D6MA 3OOJA 3OZDA 3UJPA 2QTRA 5CLQA 1T98A 3I8OA 2GOYA 2YJ3A 4U7FA 3GJTA 4LJSA 1ILEA 4EJOA 5BUCA 1WDWB 2HDOA 3JRCA 4AY4A 3EVAA 3JQDA 2PGOA 3K3PA 1FMFA 3PO3J 3MQ0A 4BAUA 2JFYA 2ADOA 4G0XA 5ALGA 4OFZA 3O7WA 3QIAA 2RGDA 3ZWBA 3GG2A 5EP1A 4H9GA 4R41A 4KYTA 4DGQA 1S6YA 5EIBC 3O4GA 1SUWA 1HSJA 1R9NA 3PENA 2W11A 1R5HA 2AOTA 2AWNA 1D7OA 4OAQA 4HVAA 4KISA 3G2IA 4HDRB 2PUEA 4X95A 1H3FA 3LX4A 3NIFB 1XRSB 3HM5A 4S0ZA 3O8OB 1M1NA 1K98A 3KQKA 3MTIA 3A4VA 2DYRH 1EUYA 4EKYA 1YQDA 3AR8A 4CEHB 1JUDA 1QK5A 4GPIB 1JN0A 4IRXA 5BSWA 1WUIS 4BX3A 5E8RA 4I08A 4OFBA 3P5BA 4L5YA 1N1EA 1T1RA 1R0YA 4XPIB 3TQCA 4FGZA 5AW6A 4YJGA 4AWAA 1ZCJA 2WWFA 3CUEF 2DPHA 4YCNA 1MW8X 1SG0A 3DVSX 3K7EA 2DG2A 4BRZA 4PPFA 4O08A 1ORDA 4KH1A 3C14C 3PJDA 1QU3A 2LIVA 2KI5A 3UENA 1JJVA 2XT9A 2AMVA 1JYEA 4FISA 1VKOA 4NE9A 4Q9KA 2OQVA 1A5SB 2QL7A 1XKQA 3EXFB 1QDLB 6ABPA 4MSUA 4CCYB 1JEOA 1PS0A 2QF7A 5CCXA 4DJ5X 3IJEB 3UCFA 1G3MA 3E6CC 5F1RA 1VMAA 2WADA 2IEAA 3GZNA 4OIMA 1OU0A 3S14J 4NWIA 1LPAB 2HU8A 1KVRA 2OM6A 4TMKA 4J7UA 1XDUA 3SS8A 1L7AA 2QI9F 2SCUB 1SBQA 1PX2A 2GMWA 4LA4A 3Q5EA 2VDOB 3HUGB 3UWDA 4NNJA 2I66A 3M3DA 3TM5A 4UMVA 2C2MA 2O52A 4G1VA 2Q4TA 4PLFA 1SQ0A 5JIBA 1RRVA 2KHMA 4OG2A 2A57A 1CF7A 2G0NA 3V1TC 3X43A 2LD5A 2NQTA 3IUYA 2ONJA 1P61B 1OFTA 3KU1A 5B5SA 5T41A 4RF3A 1CLEA 4IPAA 4JLVA 1F2UB 1F4LA 3BFPA 5FTWA 4KYVA 2X1MA 3MW8A 3SEZA 2DHDA 1ETUA 4G25A 4R1TA 3F22A 4CDGA 5HQJA 1N25A 1UT5A 2OD7A 2JGDB 3S32A 4AZWA 1E1YA 2QM8A 2ZSFA 3EIHA 1ODFA 1L3LA 3LRXA 2R2AA 5FHQA 4EECA 4ZZ0A 2M6LA 3SZUA 3V7WA 3ZCOA 3NWBA 3CH7A 1ENOA 4WESB 1L3BA 3QQPA 4PAGA 4A23A 5BR7A 3WKDA 2H1LA 2X9QA 1J5EB 2ZVDA 4XJXA 4MR8B 1DAIA 4IKEA 1ZN2A 3UJ6A 4KBGA 3OX1A 3PSHA 1ETVA 4DMLA 1L5YA 5B2ZA 5FWDA 5HQ3B 3NR2A 5LA6F 2I2BA 4L85A 1LRKA 4V0OA 5DGDA 2G1AA 2JZNA 3LOQA 3K0CA 1A8SA 1VMDA 1YBMA 4P86A 3RI3A 1H2YA 1WUYA 1I3LA 5AK5A 4K86A 4RVUA 5TQJA 3M07A 1QUEA 2C4HA 2ECOA 4A0QA 1PYGA 4YRCA 3TBIA 4DR4B 4KJZA 2R6ZA 1UG2A 4PPQA 3VKGA 2WJWA 2EFQA 4TS9A 5K99A 3WRWA 2ZJ8A 3WFIA 4F3CA 2AQFA 3AEZA 2F1OA 1GZ7A 4RJLA 3NDJA 1H0KA 2HPIA 2CVPA 1YE8A 5G41A 2D1RA 1KC1A 3JYOA 3MSXA 4P3KA 4LVCA 2WG2A 3D8SA 3WV4A 1ZH8A 5GV7A 3RT7A 1W8IA 1DKQA 5F27A 3WDMA 1DQRA 2C2GA 2R7NA 4XB6B 2CNBA 2FQYA 2IQIA 3EDCA 5AOVA 2AEEA 1BG6A 2QRVB 5JD3A 3CB2A 4LFAB 4HB3A 3K9FC 1JNYA 4AYBN 1MW9X 4QSHA 2CB0A 3TTTA 4JK1X 1HT3A 5ITZB 4ZAYA 5ESWA 5GOZA 1QX3A 3OC6A 2FN9A 4D9IA 1MO6A 2R1VA 1P7ZA 3GLFE 1TM2A 5GQSA 4O4IF 2PSEA 1NJ5A 2CUNA 3ELYA 1N0WA 2QG6A 4K1LA 1C0IA 2Z9BA 1IW7F 4GLBA 5H1YA 1OCEA 5JO0A 2AE2A 3C87A 3E3VA 4ZRMA 3EUHC 4NX2A 1MVLA 5EZSA 5A3VA 4YYZA 2UYGA 4LDPA 1E77A 2ZKLA 2C3MA 4Z7OB 2DETA 1BGXT 4O2LA 4ZYEA 2RHDA 4EI9A 1Z83A 4G94A 1N78A 2ESHA 2QGZA 3ZUPA 4HX4A 4HB4A 4N5IX 4CUKA 1L5RA 2DTXA 3QVWA 4U8GA 2KRCA 4KZKA 3NETA 2BY0A 3ZGLA 2W58A 1SVSA 1T10A 2FK7A 5FR1A 4GECA 1K66A 5M7EA 2VJCA 1IZ7A 1UJBA 4JYKA 1BH2A 1P7VA 1N4AA 5TMBA 3OU6A 1H4VB 1X1QA 2JBWA 1T29A 1T6XA 3I04A 1CQPA 1LY1A 2D0IA 3C98A 2JJ1A 4XTCS 3F0TA 3NATA 5KOIA 4KMMA 3WQBA 4BUCA 1F4VA 2EJVA 1YZGA 3P9PA 3NVKI 3MT0A 3K9LA 1WG8A 4S04A 5E3JA 2F4IA 4E30A 3PWTA 2BH2A 1UDBA 3GUZA 4WZAE 1V5WA 5A2QZ 5LQCA 1G98A 4BLUA 1BWQA 1O4VA 1S29A 5ILSA 3D5LA 4N54A 3VR3A 4KRGA 5HFJA 4UZFA 4HDUA 1SN7A 1HQDA 1VQ1A 4P81A 5AQ1A 3UKJA 5CEEA 2JGRA 2C9OA 5B1IA 3NZEA 2BOVA 3MD9A 2BCEA 5GAEJ 3CC7I 4A3DJ 2UZAA 3A9UA 2BGCA 4TWIA 4C7OB 2C94A 5C7OO 5LU8A 2OUKA 1TYEB 2HK9A 3HRIA 1EQUA 3R3VA 2H7VA 4E7LA 4HXEB 4WINA 3TDKA 4G5XA 5G53C 3BXFA 4V2UA 3NTXA 3VR1A 1Q6YA 2OXCA 3CESA 1XX6A 1PWYE 2BE5F 3GGOA 4BECA 3D7KA 3UG7A 1NLZA 3ND8A 2NVUB 1G21B 1XE3A 3MWDA 4DA9A 1HDCA 4INZA 3H8WA 5JSKA 2B30A 2E55A 3OYIA 1GA1A 2O05A 1RQNA 3NANA 2PS0A 3M49A 1C30A 1GNPA 1P0CA 1E2DA 1W44A 1GTL1 3MGKA 4DV2B 2FWPA 2ZT6A 1IEQA 2ZCUA 1SC1A 5C31A 4QHYA 1KI8A 2L42A 3IC7A 5C4MA 2HRCA 2DI3A 1KA8A 3ZU4A 3ZOKA 4FOLA 4G9YA 1N0UA 4X93A 1H6DA 1VHWA 4IHKA 3QTLA 4C3OB 2R6FA 1KFEB 2C2HA 1OX4A 4XIDA 2WAAA 3HYLA 1Y37A 5J4LA 2Q0SA 3V48A 2WQ6A 2E7XA 1F0PA 4LVUA 4XKWA 5HJ5A 4S2UA 5HKAA 2YX1A 4MA4A 2C4TA 2E18A 4Y0VA 1B59A 4F96A 5EWJA 3R5FA 3ZIAD 3KK0A 1DCFA 5B12A 2BCJQ 1HW2A 1B72A 4BJ5A 1NKSA 1NYLA 2DPYA 1ABFA 3FYCA 1NMYA 3ONEA 2L17A 1SC7A 4RXUA 3M4NA 2DY0A 4BNXA 3D8NA 1X94A 1DAPA 3PSIA 2H52A 4TXMA 1UBSB 5C8YB 3QUQA 2OCPA 2H59A 3CO7C 1ZAKA 2BR3A 4N3AA 3R4VA 5IT5A 1KAEA 4DTIA 2WWIA 4M6WA 1BKDR 3QKUA 2XF5A 4RKFA 3D3JA 2J7PD 3DTTA 3DYBA 3ZGZA 4TS4A 3GLKA 5KQGA 1MBGA 1M2OA 1TZ2A 2O50A 4PGFA 4CM8A 4RGRA 1NW3A 1M54A 5LYJA 1JFRA 2VS1A 2QRPA 4FOOA 1YI0A 3SFVA 4ESBA 1XTJA 5JLWA 1U3FA 3S4YA 2Q5IA 2X4LA 1UKAA 3QQAA 1A9SA 2G0EA 4EO7A 3RI4A 4LOJA 3KPWA 3KJGA 3RF6A 2Q9UA 1GKUB 2HDNB 4O5VA 2P1RA 1GGMA 4DSZA 3KQLA 3RD5A 1POGA 2YR0A 1N5DA 5ILOA 5DOVA 3I37X 5SY6A 1WJAA 3LDAA 4FKZA 2QA4I 3BZBA 2K4MA 4Q4ZF 4OLAA 1CCWA 1KIFA 4M22A 4HGYA 4XYEA 5B57C 1KYZA 3I6MA 5J5CA 1KDOA 3ZIAA 3LAWA 1TGYA 4JSTA 4B3BA 3CSUA 1UPCA 2J9FA 4BEBA 2FPIA 3TNJA 1PKXA 1CRLA 3O3OB 2Q7XA 5E3MA 2VJ4A 4QL3A 2R7ZJ 2ZSIB 1E92A 3C5VA 1NXQA 1EWYA 2QZJA 2HSJA 4G8JA 2B2XA 4MS3A 2QYTA 4A8HA 4KK3A 3GLXA 4P84A 3LQ2A 2NQ8A 3TEDA 1MO3A 3ANYB 4D5CA 1SC6A 3UBTA 1TWCJ 4NFHA 3DP7A 1C7QA 5FJIA 2VT7A 4X60A 4WJLA 4M7RA 5A0TA 4ZT6A 4UM7A 2BTQA 1FWZA 5E6RA 4J2HA 4U6NA 1ZRNA 5KOHA 2FX0A 3UJ3X 1CNFA 1SOUA 1ST3A 1GHTA 5J2UA 4W5HA 5AHXA 1B76A 4R84A 1VE6A 4XQ0A 4OIQF 5DYNA 1E1KA 1JSZA 3MCZA 5HNHA 3CCEI 3LH5A 2J6CA 3I53A 1X39A 1P62B 3HH8A 4TV9F 4CTNA 3FYUC 2P1DA 4G1FA 3VPXA 2VA8A 2XE6A 2LGJA 3KL4A 1DHRA 5KUTA 2GESA 4RAFA 3GP8A 1PJ8A 1AA9A 3WXMA 3UCEA 4WXDA 1LJ9A 2Q1ZB 3S44A 3SYKA 3TQRA 3RYHB 5DEOA 2HMTA 3QYEA 1E9CA 3SEFA 4P93A 1XMPA 2QS9A 1W0KA 3GCZA 1CDZA 3TUZC 5AK0A 4ZZ3A 4W9RA 5JCZA 4OQXA 3W2TA 3W9YA 4RD2A 4ANFA 1X14A 2AIRA 1ZW6A 3ZMDA 2WLSA 4KUHA 2WD8A 2QSYA 4C43A 4QBFA 3W0LB 9LDTA 3ZHBA 3TBFA 3AJ9A 4BWYA 3CEMA 5KAPA 2OY0A 2B4KA 3UHPA 1HWYA 4OGLA 2I10A 3GCXA 1E6EA 2HYJA 3ZU5A 1YZTA 3EG5A 3L04A 1QIFA 2NP6A 2BP7B 3WNQA 2ZEJA 1P6XA 4O5OA 4ACBA 4CEIA 1W85A 3D31A 1GA4A 1HYEA 2GK4A 4LS3A 1ID1A 1NASA 1BW9B 1ZEMA 2RK6A 1ID8A 5FLVA 3MELA 1YZ3A 2F3RA 1HZZA 3TRDA 3MWLA 3TXYA 1PKEA 2XRYA 3GT7A 4ASNA 1ULUA 2CFXA 2C04A 4M0LA 5LP6A 4B3GA 3LSMA 4IOMA 5DE3A 5LQNA 1YFJA 3HNPA 1Y4DE 5HIJA 3D81A 5D00A 1NIPA 1SXJA 3FXMA 4R2JA 4MW1A 2ZYUX 4P4SA 1G8GA 1NW7A 1DPGA 4NK5A 3TAUA 4Z4GA 4V38A 3EG9B 4EHFA 4UCQA 4YCSA 1X7XB 4MGHA 4BKOA 1TW3A 4XIFA 4P0TA 4BFUA 1JMVA 2ZYSA 4PYQA 1SXQA 3MB5A 5D3ZA 4QXRA 2IBTA 5KMGA 1G16A 4M1MA 3EEBA 3H17A 1QAOA 5FOXA 3OEYA 1ZDMA 2C92A 2HJVA 3Q0VA 1Z6QA 4RDCA 3OP4A 3NEPX 1B2LA 5TEVA 4QODA 3QTTA 5BSRA 3CN7A 5B1DA 2DU9A 1L5QA 2R8EA 4AW9A 3RCOA 2GAOA 3THWA 4O6VA 1BIBA 3RUCA 1C4XA 1A9PA 4UOZA 3GFTA 3EXG1 1IULA 5FWXB 1GZ4A 2ZBGA 4MGKR 2OK8A 4RVCA 4DIEA 4JHLA 2XJ9A 5CA0B 2EKBA 1MG5A 4I9GA 1WVRA 4P3YA 1XD9A 2XLCA 2BFBA 2QKMB 2WPDA 1JPJA 4Z6KA 3CKYA 4XQFA 1MEOA 3L4EA 2ZRHA 2VBCA 4DOMA 1KVSA 3U3XA 2P2ZA 3LFUA 3OT1B 4LISA 3BN3A 2EIXA 4PVDA 3RJ9A 5CDFE 4R6XA 3IMCA 2B63J 3BG6A 2JZYA 1BN5A 4K40A 4G8CA 2PL3A 5JDCA 1Z68A 4DMUB 1BJZA 3ZS8A 1XX5A 3H8SA 4C78A 3RS7A 1JXAA 2Z57A 2C97A 1T0PA 3KKQA 1GLNA 1O3RA 1J8FA 1DO0A 4KFRA 4RTOA 4FSDA 1RPAA 2RBGA 1DI0A 1QCCA 4CR8A 2FSWA 4HDVA 2F59A 1QO7A 5PNTA 4PAWA 4RV9A 2LP4Y 5IHPA 2DA1A 4RE6A 2BJWA 1BU5A 2EQBA 2Y9ZA 3WZMA 2C9BA 1G20B 1QPMA 1Z5PA 1ACMA 2DHEA 5KJEA 3H5NA 1EB8A 4IUDS 1X4OA 4UUVA 2CV1A 1W93A 5CFZA 2IYEA 3D1LA 3VVCA 2RHLA 5JVTA 2DXIA 5IZCC 1JZSA 5CLJA 4CTKA 5AXDA 1UOPA 4YI3A 4HF7A 4FEYA 4RZ2A 1KIAA 4WY8A 1EFPB 4H0EA 2E4YA 2ZOSA 5TVGA 2WUEA 1NP6A 5C5CA 4RAYA 1G1AA 1L7QA 3JYHA 2V7FA 2V8OA 1SUPA 3PFCA 1AWCA 1DU6A 1G2HA 1QZYA 5K3CA 2VF4X 3WHLA 3TSCA 3RUHA 2EP8A 1R6RA 5EEAA 1R8YA 4X64B 1T2EA 3I0TA 3P1JA 2G3YA 1E17A 1BVUA 4AVPA 1MBJA 3CVVA 2YXLA 4IDFA 2X58A 2OXEA 2G08A 2HOEA 3WLNA 4AIRA 2L9RA 4ZVKA 2XXJA 2XNDA 5A05A 1Y3DE 1MABB 1M73E 3LQRA 1TYBE 4CU5A 4PZJA 2XRMA 3CUOA 2VKDA 4IXWA 3FROA 1GD1O 2Y1GA 4JSRA 1ZLYA 1TB4A 4Z4CA 1S3GA 3H0KA 3ZD8A 4M9UA 3NHKA 3ZGYA 5E9WA 1VL2A 4MUAA 2DPXA 3CJRA 5KTKA 4IRIA 1PQUA 1U2DA 3R3XA 1FNMA 1F1JA 4JD5A 2HV8A 4WGFA 3JQAB 1SUDA 1RJEA 3R41A 2QQ9A 4PHFA 2YXEA 3JATB 2OYSA 4FDTA 2WSLA 3COSA 4OOFA 1JR6A 2PFGA 2VZ9A 3WBKA 2ZSUA 2O4UX 4YVFA 3KVYA 4R9UC 3RJMA 4CTMA 4OO3A 4MIYA 3O21A 3M0EA 2Z56A 2Q3BA 2AVDA 1GRQA 3T41A 3V1UA 3ME5A 1GLGA 1RHKA 1KSHA 1HE4A 3S7ZA 3IEXA 2COEA 4I2NA 1M5RA 2JFNA 1H8HA 1S2GA 1AZLA 2VT3A 3RSZA 2GIZA 2QSJA 4KYUA 2J09A 1Z2NX 3TGWA 5KWVA 4UNQA 3OLZA 2VNIA 5EWMA 1XQYA 5JJ5A 4MUGA 5KC9A 5F1KA 3R9IA 3BWEA 2G1KA 2DTRA 3QEJA 1ENPA 5K7FA 5EI5A 1NNUA 1MLDA 1SK9A 3PNQA 3WKCA 4FQGA 3BJOA 3DYVA 4X7BA 4RLFA 4JXZA 8GPBA 1OHHA 1CJKC 4GMHA 3R6GA 3LVRE 3W3AD 4E4YA 2VO1A 1U8XX 5L4SA 4WCGA 1TX4B 3P20A 4LXIA 4L6AA 4UDYX 1Y4UA 5DGXA 5DUKA 1UXJA 4U4AA 2V9ZA 3ZCUA 2C9DA 4DMMA 1MTZA 1RMYA 2X8JA 1MVNA 3DEKA 3CLUC 4QDUA 1OJ7A 1AUVA 5CXUA 3UJNA 1YV9A 1OE0A 2GDJA 4MYUA 1ZVQA 1WF3A 1NXTA 3S29A 2A0XA 5DASA 4L51A 4ND3A 5COQA 5JU6A 4H1HA 3C3XA 3LSKA 1Z5ZA 4W9MC 5AOBA 3G2HA 2POCA 2IRFG 1BCRB 3VNRA 2H4JA 5EYPB 4C4YA 5KINB 1R27A 1Z67A 1TJNA 2Z2SB 3FYSA 1FDTA 1A5AB 3K6RA 1G5RA 1RWWA 2YRWA 2YHIA 1TKAA 5IAEA 4R8SA 1TLHB 1QIJA 3SQMA 2XDVA 3ORRA 1J9ZA 4GNKA 4TZTA 1CR0A 5KVRA 1XTPA 2X1EA 1CFZA 1LX7A 4IIEA 1U02A 3C3KA 1VL0A 1W49A 1W8DA 3CLSC 1HSOA 1NLUA 3ZQIA 4MHGA 1N75A 1PV2A 3L7DA 4GD3Q 1L8QA 4KXLA 1EINA 4IX9A 3AF1A 4HWPA 1Q2UA 4CQLB 1G64A 1NVDA 2IXTA 3RUEA 5GIOE 5CFQA 2X3FA 3GELA 1SHUX 1CY7A 2CLMB 4RAGA 2HXIA 1SUBA 1SVWA 2NXJA 3PD0A 4MAMA 3E53A 1HYQA 4CIDA 3PVSA 2HKIA 4BXFA 4LGMA 3T1HB 5BSEA 1XXHE 2C9ZA 1SIBE 2SNIE 4N5NA 5BMZA 4ND1A 4YIHA 1W0TA 3FPLA 4HF1A 1C4WA 2VJMB 3W78A 4BL0B 3GEEA 4ETNA 1OBVA 3J80K 5JY6A 2R97A 4URZR 4WDRA 1E64A 1Q7EA 1YR1A 3A6JA 4Z4HA 3KALA 4BVEA 2VRNA 2KZGA 3AL0C 2EFJA 4G5YA 2R7LA 1FFXA 3K0SA 4OQ4A 4JJAA 3EX7C 4WLNA 3VI3B 4KLAA 4MGIR 3FJOA 5K3BA 4WZZA 3ZQHA 1VSVA 1HV8A 4MTEA 1GAWA 1DB3A 5IJ0A 2Z6AA 1RJ9B 621PA 3DFUA 5AESA 2A9VA 4C4RA 5I4IA 5HS8A 4X97A 1U7XA 1NWCA 4DG5A 2KDOA 4D79A 5L3QA 1XO1A 5CB0A 1W87A 4RD4A 3VB2A 2X85A 2GZWA 1YQXA 4ZYXA 1QO0A 3P2EA 1F8UA 4MV0A 3BTUA 1QGAA 1PT6A 3TD9A 5HUQA 2GILA 2Z9OA 3RW9A 3ZY4A 3L00A 1AK9A 1BCSB 1E60A 4BX0A 3TOAA 4XRGA 2P40A 2VH1A 2LR8A 6PAXA 2ZIXB 2V79A 5KI6A 2B2NA 3GJQA 4CIVA 5JAPA 3NTLA 4N65A 5HMLA 5HEKA 5A0VA 5JSQA 4J1TA 2E1CA 4YH1A 4TM8A 1T3TA 3KVOA 1OVGA 1RLTA 4NECA 3KJQA 2FP4B 4X1YA 1GRCA 1EH5A 5BUQA 1TQ6A 3H42B 1ONPA 3F7OA 3PUZA 9LDBA 3ZE9A 2VOOA 4N49A 4WKOA 4IZ6A 5KJ1A 1Y81A 4YAEA 3IIMA 2EZ8A 4QDZA 3ZMVA 3FPBA 3I1FA 4OJYA 1FMLA 1R0RE 4M3GA 2FN3A 2WB4A 4IJVA 2J6HA 3RYFA 3I4MJ 2WA0A 4L0CA 4W1RA 1VFCA 2CE7A 1E79A 2W7TA 1VFNA 3QMPA 5LWQA 5LB2A 3CUKA 1B8VA 1F1ZA 3BZCA 3V7FA 1K6XA 4JLUA 1CQIB 4H17A 4EPVA 1PCXA 2JEZA 2IF0A 4EGFA 2NPIA 4ZZIA 2OV8A 4CF3A 5DYMA 3G2BA 1SFOJ 5I7SA 4MXDA 4BGEA 1HNZB 1JSLA 1RJWA 5FRMA 1JHUA 1R0ZA 2HHCA 1QKKA 4C9YA 3WYBA 2HC9A 3NXSA 2D2WA 4AU7A 1SUAA 4GS5A 4BMOB 3G0OA 1LBEA 4QDKA 1ZK3A 3GV0A 6REQA 3UGQA 4QO7A 1O0BA 2O3SA 4NPCA 4QUHA 2R48A 4LMAA 4M9XA 5EMJA 3GD7A 3QVSA 4K87A 4FZ3A 2XHKA 3RK1A 1PT7A 1PFGA 5CPBA 4I76A 5E2BA 2QMYA 4HDMA 3ET4A 4ZZ1A 1VLJA 3G89A 3HXPA 3KQTA 2EYUA 4C2UA 4ZV4A 4YDSA 3CMYA 3RYTC 1DL5A 3L1UA 4MUFA 5ALTA 3Q0UA 5BRAA 2BLLA 5AHWA 3HZOA 3IP1A 1SZCA 5IT0A 2GI4A 1LQTA 4OLBA 1N2SA 3M2PA 2EU8A 3IXLA 3WJ2A 2VP3A 1BX3A 1SXHA 1J25A 5FOUA 3WWYA 4X3OA 3ED5A 1PL7A 1HH4A 1CDOA 2EJUA 1ZGJA 2KL4A 4Z7NB 5K8TA 4IQGA 1G2QA 1ZD2P 3QOYA 2YOFA 3EK2A 3OQIB 3VHXB 2PRKA 3KPYA 4WLUA 4HQNA 5JARA 1EGQA 3UQZA 2V7QA 4I1OA 5F1OA 3I6ZA 2UUBB 1M2KA 2FWNA 2ZYHA 1GGHA 4LLGF 1J0RA 3D0RA 2RGUA 1IG0A 1T1JA 4QU0A 3OSGA 3HBJA 2C5EA 3B7WA 1KS2A 2NSYA 3P4UA 2VEOA 4HOYA 5G4LA 3GW8A 3LLMA 4B31A 1V95A 1XB2A 3ENKA 4Q9AA 2XQJA 4JX8A 2VNSA 5I7HA 2E6UX 2BUBA 3MZ0A 3DMHA 4YHHB 4EUEA 1V71A 3A1EA 2NZWA 2VJDA 1W7AA 4J94A 3HA2A 4JJ4A 2FZEA 1YDEA 4KXQA 3CJTA 1KMHA 2WB1N 4RJKA 3HTSB 5DNCA 3DOCA 4PYIA 4J75A 1RACA 3W7AA 2NOAA 1XS9A 1JAHA 1M5UA 4UKDA 4JLKA 3H9EO 4H18A 3X44A 4ARAA 3T7AA 4CT0A 1JR3A 2AEFA 5DUIA 1NVFA 5E38A 3IUMA 4JKYA 4FYVA 5ALJA 3NDIA 3OJXA 1ZGBA 2J85A 1ZJ5A 4Z53A 4A82A 5IANA 2HOTA 3OD5A 1JH9A 1TCUA 2R86A 1GG5A 1EFVA 2GYYA 1L6IA 1S3SA 4X41A 4CF4A 1V7QA 4B6GA 2PGAA 4YP0A 2VKQA 1C14A 2P30A 2VTVA 5AJHA 3ZH9B 4Q05A 3WLFA 1NVBA 1K3UB 2ETVA 1U1DA 1VBNA 3DW3X 2UXBB 3U9GA 1G6HA 1BD4A 3EWNA 5K3EA 1JEJA 2O8DA 4IW3B 3T9DA 1Q1EA 4YCLA 1HKQA 1OD6A 2DX7A 2XEDA 1DUIA 3RPEA 4IOCF 1I2MA 4JDPA 2Q99A 3EC7A 4FWTA 1AKYA 4PLHA 2BRUA 5DWVA 3DOFA 4WNCA 5EESA 3CVWA 2DFIA 4RMIA 3TE7A 3K7AJ 4MW0A 3ACDA 2WM9B 5KDDA 1VCOA 4YIIA 3H5OA 1RI1A 2R00A 1CJVC 4D3FA 4LRSB 1DEOA 3AMVA 1NI4B 4ER7A 1UJMA 1KEKA 3A6PC 2FHSA 4LCJA 1VHLA 5DCMB 1XD2B 4P82A 3IJRA 1NDQA 4GKVA 4ITUA 2GZHA 3FI0A 3R6SA 5LJIA 3VU3A 3MS7A 1AXGA 2QW0X 4NC9A 3K05A 3HB5X 4AKIA 2L01A 5EC8A 2ZXEA 4ABYA 2O59A 1NP3A 2EPFA 2ECQA 1FSHA 4ZOLB 4JOSA 4D4LA 3VC7A 1IOZA 4F3NA 4TKUA 2FSHA 1SQGA 4P92A 2I2AA 1HL3A 3NC1C 2B7EA 1KOLA 2GHQA 4QKQA 5B37A 5BV2P 2ZI9A 1FYKA 2OLEA 2P9YA 3RUPA 2WV9A 4Q5IA 4RSRA 5IXJA 2EGGA 2VRBA 3L8DA 2WSIA 3SZTA 3H7AA 4F4UA 1OFUA 1Y6ZA 1RVV1 1UMDB 1YYVA 2JIDA 2ME6A 5CNKA 2ZP1A 5H68A 2O1XA 2H4HA 5AYVA 3DULA 4MVJF 1U0RA 1W94A 3K4MA 3N2KA 2VJQA 4RGSA 2WIKA 3ROXA 1D2GA 5AVTA 1FFWA 1KAHA 4ER6A 4G4IA 2PO5A 5KYUB 2NS0A 3QW2A 2VSYA 1YMUA 4I6JA 3HDJA 1NV8A 4JR1A 2VSXA 3VMMA 5EHIA 4M8KA 3AB7A 2HO4A 3E23A 1NMXA 3QEMB 4FMPA 1QV9A 1EDBA 5ISMA 5FADA 3HEFA 2FFHA 1LSUA 2H7XA 4NCNA 3PEUA 4POAA 3QF7A 3BWGA 1JWAB 5CJJA 2BBWA 4GI3A 1X19A 4YNBA 3WE3A 4IJKA 1N2JA 2EOAA 1PWZA 5AM4A 3H0CA 3ZQKA 2C9YA 1KY5A 4M9ZA 2B21A 2IS4A 1MH9A 1UBKS 1BWPA 4TS1A 2LC2A 4RK0A 4OI4A 1SEPA 4EZBA 1A71A 4IM7A 3PDCA 2H18A 1I50J 3UK0A 2Y1XA 1U2EA 4AAYA 4KIBA 3H4MA 4ERXA 2J5PA 2Q5EA 5I9LA 4Q7KA 3ZIUA 4UV8A 5JPCA 2JLBA 5HCIA 2WWVD 3KE9A 3G1MA 4PY2A 3RS0A 1P1RA 1AGPA 4FASD 4L9WA 4IXNA 5FGMA 1MHPA 2VC1A 1E2IA 3P2MA 3B3GA 1U5TC 4O4HF 1GADO 3F5FA 4OYRA 1SQ5A 2OO5A 3AG5A 5K6AC 1J7KA 1GFZA 1R00A 3IDSA 2OE2A 3MBKA 4DEXA 4HDQB 3VPFA 3V8KA 2RGVA 5BNZA 3BFJA 4TKMA 4UTVA 5BUSA 3UWPA 2BHSA 3IAAA 1PHPA 5HDNA 4EGSA 2HJWA 2X5JO 2WW8A 1EXNA 5DXJA 4RUKA 3M4OJ 4E1VA 1QHEA 3TK1A 1LE8B 3DPUA 4R05A 4KWIA 5MF6A 3ELBA 1DC8A 4DR6B 5F2OA 2BKVA 4QPOA 5C32A 1QH1A 2X41A 2ZUBA 3U44B 5IY5H 1PT5A 2LIPA 4YDRA 3ASOH 4II7A 2JGNA 4N47A 1ZWKA 2MIIA 4R2WA 2UKDA 2PH5A 4C4ZA 1Z13A 1HYGA 3G1LA 1C3VA 4TTPA 1Z2OX 4JP5A 1GTMA 5B3AA 3K9CA 3GW2A 2EKPA 2Z5GA 4O2BF 4DWWA 3UY4A 3RJZA 5AKEA 5IJXA 4F3RA 2ZT8A 1DBRA 4DLYA 3JALB 1LNZA 4C0KA 1DIGA 1NVVR 2BEWB 1CZKA 1U9YA 4YCBA 3GF2A 4OHBA 3PB3A 3RNOA 1T9AA 5CGQB 2XVXA 5TQ0B 2OCIA 1GNTA 3U5TA 3OZFA 4DLWA 2H7CA 3IKTA 4PGHA 3BMOA 5JH7B 2PUHA 4J29A 1VQLI 3DT9A 1MA3A 4FS3A 2EX0A 1ELOA 3IALA 1I0ZA 2YN2A 3ABRB 5CXSA 2WB2A 4AKEA 2P6TA 3RKSA 5FWYA 2PBRA 1Y7HA 3PX3A 2ZIEA 1RXYA 4UQPA 4DOZA 3CBQA 3AVTA 2WJIA 1V11A 2CRGA 3FRIA 2I9KA 1L7BA 5K3OA 4BDSA 1PJ3A 1EG7A 2IXEA 4FJ0A 2RV8A 3WMXA 4IIJF 3T7CA 4HBZA 4I3GA 4BZPA 2AC4A 3W9SA 4B7ZA 3IMKA 4DIKA 4R1PA 2C3YA 3N2YA 4E07A 4A6EA 1H1TA 2BR4A 1RESA 1FTQA 3UJHA 5IYZF 1PEAA 2WMYA 5E7QA 2JIQA 3C74A 4MVJH 1TF2A 4W6QA 1DFGA 1DUSA 1AKUA 4WJKB 1RMTA 3DZFA 3F8BA 1ODKA 2HXOA 3KAQA 5K4GA 3L4BA 1UM9B 3A36A 4FVTA 4E6KG 4EPRA 1OWLA 1HY3A 4QGSA 1REQA 3NEUA 1A4IA 3SC2A 3M8JA 3I9V1 2DULA 1WW3A 3DDNA 3KR0A 1CP3A 2AJCA 4QAQA 4PU0A 3SZMA 3ZXYA 3KCCA 4UFPA 2KBFA 1BFUA 2ME0A 1FNDA 4TSKA 4F55A 4BKRA 1DGRM 3ORSA 1ZK2A 4ZEMA 1XMQB 4XLPF 3OTGA 2DWQA 4YGYA 5GZ1A 4OU4A 1FIPA 3FMSA 2XD4A 2CL0X 2UZ1A 2QSUA 1W36D 4DC1A 3RVSA 4UNPA 3UNXA 4Y17A 4RTNA 5JBQA 4GT1A 3UJBA 4OMFG 1MO2A 5J40A 2XZLA 1UIMA 2HN9A 2JCYA 1M10A 3A6LA 5GJCA 1WI9A 1Q1GA 3HS3A 5EWLA 4LAFA 1Q7CA 5AUPB 2FX3A 3I6YA 3E5UA 5HE8A 2RVCA 4YWJA 1Z26A 2R1UA 3DF7A 1OXXK 1BQ4A 4MQ6A 5H3LA 4G89A 3MMYB 5EJ2A 4BEVA 2CLFB 3R74A 4HFJA 3ZKWB 5DHFA 3CKMA 2PSHA 3UA3A 5FI0B 3T5DA 2MSLA 4M7PA 3CCUI 1R6TA 3K32A 4M0EA 1F7UA 1R5GA 5KCMA 1MFZA 3Q6MA 2FSFA 3HGGA 4UAUA 1TAUA 4BVJA 2WM3A 4I1VA 1XG1A 1K4SA 4A3GJ 2XUJA 2O48X 3MLEA 4LVNA 1SD7A 3UUFA 1TTHA 1VM6A 4MUXA 2W6CX 2MBFA 3OA2A 3TLYA 1E1QD 5EF6A 3PP8A 2MH2A 2Z3VA 1EFKA 3A3KA 3G2JA 2COMA 4GRAA 1LF5A 3ZQUA 4NBKA 3E5MA 1B00A 3JQ9C 3W1VA 5FJ8J 8MHTA 1GG2A 5BOSA 5KU1A 1EUDB 1FX1A 1G8SA 3RHFA 2HCFA 2OD2A 1JNXX 2P6PA 2ILVA 2WT4A 1CG6A 2P6NA 5K0NA 5L51A 1VSTA 4UAVA 3RC3A 4X8HA 1YZNA 3KKKA 2XIGA 2L02A 2ZJRF 4R31A 2NSDA 3OQMA 3EB9A 1Z6PA 4XDYA 3SK0A 3CMMA 3CUQB 4KX3A 5JC8A 2YW2A 2L2OA 4HX9A 5C7LO 1J2XA 2HGSA 4IQ8A 2K5UA 1YRHA 2YN0A 3DLHA 2IPOA 2TMGA 2QJOA 4J03A 1FOYA 3DP9A 4KJXA 1ODCA 1ATIA 4A92A 1GN8A 1Q74A 1D0XA 4AY3A 1TEXA 4KE8A 2H07A 2J5KA 3VHQA 3NKLA 1V7PC 1K3FA 3R23A 1IBSA 4M72A 5E8GA 1AKQA 5H6QA 1TC1A 3ER8A 1T3SA 2ZDGA 1EHIA 3FBGA 4QATA 1RLIA 5CYPA 3ZMSA 1NVWQ 5IBPA 2A0WA 1FS5A 1PFWA 5KVQA 3AHCA 2J0UA 1ZX1A 3WK8A 2GPBA 2A7QA 3DE5X 2XDQA 1Q83A 3KFWX 3TZCA 1FYEA 1FUUA 4DXHA 3MKWB 1YBAA 2X0FA 4FD2A 4Q01A 4ZVLA 3HXMA 5BT8A 3DLPX 1A8IA 2DUUA 1JFTA 4FT8A 1ND5A 4OQNA 4BN0A 2C9CA 3E82A 2OYCA 3H99A 3DAHA 4ZI7F 1E3JA 3O38A 1IEXA 4MI6A 2GRJA 2ID4A 1BI0A 2E4WA 1GGFA 1LEAA 1PQPA 3OT4A 1GKYA 1WXGA 2QPTA 1GGEA 3RAJA 2QWWA 1JI3A 3ASZA 3VSCA 3O2PE 1U7ZA 3K9WA 1U7PA 3LC2O 3B1JA 1NH3A 3F23A 2K7ZA 2FPPB 3F96A 5EMMA 4RMGA 1BSVA 2HCRA 3LK7A 4WFJA 1PJRA 4AROA 3QX8A 3ZGXA 1XSDA 4Y1FA 2OCYC 1VPLA 1ZVJA 3HJGA 1SFUA 2DOFA 2OB1A 3QLJA 3VKVA 3IOYA 3WLJA 4RHCA 4GMDA 1D6JA 3QA3E 5C1BA 4BNNA 3ZPLA 4AJPA 4LY6A 3UHJA 3LUFA 4J0FA 1K75A 4FGSA 5JQGF 5DTIA 1USKA 4Q93A 3WTUC 3FVVA 4UBKA 3CM0A 3EEYA 5DJ5A 4I36A 3C3JA 4NG4A 4Z3KA 4A3SA 4JU8A 5DCWA 4LDZA 3VGPA 1EM8A 3GA5A 2H0AA 5F0FA 1OXKB 1XEAA 3UXMA 5LGUA 1Y1WJ 1ONOA 1JHQA 5AW1A 4RAZA 5J6XA 4DNOA 5IM4F 2XB2A 4Q0MA 4G12A 2LBPA 3I12A 3K0FB 4U6QA 4YJ3B 1JGTA 2X48A 4RHFA 4IIBA 2X51A 3QKTA 1N8KA 3DXJF 2WF9A 5FEUA 1HURA 5AFSA 4M54A 2GD2A 2F1RA 1KIMA 2IPAB 4LWZA 3R7FA 5BXYA 1CZRA 2BMJA 2ZYGA 2XPWA 5CX1B 1U4OA 2PSJA 3OCXA 3ZU6A 4BHTA 1Y9AA 5DD8A 4DZRA 3C2QA 4ZI3A 4C6SA 3ZVNA 4L9TA 4JI1B 4JI6B 4Q4AA 4PIMA 5T3UA 2QSGX 3EGDB 5HWSA 2XQIA 3WWEA 2YDYA 4Q34A 4DLXA 1HE5A 4NAVA 2ZRCA 2HADA 1U2GA 3F3MA 2ZYRA 5F4ZA 1P7JA 4HX8A 2OZUA 3PFKA 3AVYA 2D0DA 5D3QA 1P4HA 3EULA 3A2MA 4HGQA 5FTLA 1KZHA 4A3MJ 1SPXA 2Y6VA 1H05A 5JI6A 1NONA 2R8RA 1TTYA 3K9NA 1Q12A 2Q28A 3PGKA 1PS9A 4B44A 1X42A 2CUKA 1QGYA 1RLUA 4MO7A 3HCOA 4NMXB 2W24A 1WCIB 3MILA 2WUGA 1E2PA 1EG2A 5CIQA 2F6CA 1PQ4A 2EVWX 1OSNA 1DUVG 3QKSA 2K9NA 3SCZA 2IF2A 1QHHB 2D5IA 4Y2SA 2ES4A 3ULQB 1KQPA 4BC1A 1IZYA 1S9DA 4KNVA 3RK0A 5IN5A 3UAOA 4QBGB 4EJWA 4L8FA 4PSKA 2ZUWA 3DHVA 2FQQA 5FPTA 5BR4A 5CEJA 4UUSB 4F6RA 3N2EA 4CN9A 3D6HA 2E9SA 2HFJA 1X1AA 4E5PA 3D2LA 2MA3A 5FFMA 4QM7A 2WTUA 4AC0A 3ANTA 4LE0A 3N8GA 9ABPA 1YCGA 221PA 4Z1MD 2R7VA 5JJLA 4QM6A 3U37A 3EDYA 3GXBA 1IONA 1GY8A 4OD0A 1S01A 1EPUA 3VBEA 2L82A 5UKDA 2P68A 1SXGA 3H18A 2FEWB 1ZJWA 5DXFA 3CMAI 1TADA 5C4GB 2BI8A 2AC7A 4EHNA 4CL3A 2G09A 1WFXA 4QOJA 2Q2EA