4S04A

Crystal structure of klebsiella pneumoniae pmra in complex with pmra box dna
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of polymyxin-resistance-associated response regulator PmrA in complex with promoter DNA.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription/dna
molecule keywords DNA-binding transcriptional regulator BasR
total genus 73
structure length 219
sequence length 219
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4s04A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s04A01
5LRRA 3RVNA 1LJLA 3MF4A 1HKTA 4WXEA 2IA1A 5KI6A 1XGNA 1YVUA 1TQPA 5D6EA 3CLOA 4MS1B 2XASA 4WXHA 3JVIA 5D8LB 5ICFA 1FP1D 2DK8A 2HQRA 3TGNA 5L3FA 2MA3A 4KFCA 1ZDMA 1HW5A 4N9IA 4D6YA 1JDPA 2YHBA 2NYXA 3M6MD 4CO8A 3BP8A 1ZHHA 4OIRF 3LUGA 4PICA 4ZMSA 5CJ9A 2Z99A 3UK0A 1OMIA 3F8NA 4I7HA 1BDJA 4E7OA 4RXMA 1FWZA 3DXJF 1DCFA 2FVYA 1LDJA 2TMYA 5IEBA 2HR3A 4ESBA 1MJBA 3WU0A 1G4DA 2GXGA 3OM0A 2H6CA 1JDNA 3FDFA 2ESNA 4MLCA 1JGSA 1MZBA 3M9XA 3KFWX 5ABPA 1XGOA 1QO0A 4G7HF 1Z6RA 4LD5A 1NATA 1ZY2A 2IPAB 2LKPA 3HTSB 3GRCA 3J80Z 4MR7A 5HDKA 3IPAA 1D1QA 3RTRA 3BPXA 2DT5A 3O2JA 1C4WA 3JTEA 3I4PA 4B8XA 1MB0A 4HF0A 2XV4S 4BYYA 3F6VA 2ELHA 1FSPA 2A6HF 3Q5FA 3GWZA 4LRQA 5FGMA 4MR8B 4KN4X 3PQKA 3B73A 4HNRA 2XKOA 1BJAA 1OYWA 3T95A 1KMIY 2ESHA 1APBA 1MVOA 2PQ8A 2ZCWA 4MS4A 2XGXA 4IGAA 2J5OA 4DN6A 2FMYA 3HO1A 1BBYA 3HRSA 4RKRA 2A68F 3GBPA 3LFTA 2RKHA 4UVCA 3SM9A 1V3FA 3SG0A 2OBPA 4KICA 1WQ2A 1AWCA 3CLKA 4WT7A 3HSYA 2P9HA 5LGUA 4UV9A 4G7OF 2PUEA 3IKTA 1H0MA 5EEHA 3U2RA 5HLGA 4QWQA 2IPNA 3ROTA 4NCBA 4YO7A 2RNJA 4MQFB 3JTHA 1PUEE 1G3WA 1FQWA 5KK1A 5IUNC 5TQ2A 3OM1A 4ENMA 4LE0A 1UDRA 4BHPA 2FQ3A 2UXXA 1U3EM 1W25A 2XKPA 3HRTA 4M73A 2QVCA 3MM4A 2ZFWA 5D6FA 1DDNA 5ILVA 3R0JA 5A2QZ 4XSZF 4LE1A 1B59A 4QYMA 4XLTA 2P5LC 5FFZA 2QV0A 5TPWA 5DTEA 3TD9A 3H1GA 2PFBA 3WTSC 2YHAA 2GX6A 2ZNYA 5KQPA 3I64A 1USGA 4JOQA 3GUDA 4RY8A 4M6YA 1YW9A 1BI2A 2NUBA 1FBQA 1KGSA 4CHUA 3F72A 4HYEA 3N97A 1BAPA 4L0YB 1T39A 5LHGA 2QQAA 1I6XA 1U78A 2PI0A 1ZITA 2RQPA 2GBPA 3KETA 4RS8A 3HOTA 3EUHA 5CNJA 4F8JA 1ZRDA 1KQ8A 5JNSA 3KLOA 1QGPA 2GAUA 1YK0A 2FSPA 2H09A 2O8XA 3F21A 3GVAA 1JE8A 3H3ZA 1YMVA 5EWLA 3OLWA 4QICA 4RGXA 3MCZA 1UB9A 3RH0A 4YFNF 1WKMA 4P96A 1F4KA 4UHTA 2LF8A 4A0XA 1Z1DA 3FFXA 3KE2A 4EGYA 2VN2A 3ZMVA 1BC8C 3QELA 4LK0F 2QQ9A 2HTJA 3IWFA 2MYNA 1SD5A 3QPTA 2NT4A 2NRAC 5E1WA 1HW1A 4IHTA 1B9MA 1JWLA 1Z9CA 4RK4A 4CYDA 1I1SA 4I98B 1P4WA 1S8NA 4ESFA 1YW7A 4MR8A 4ENKA 2E4YA 5HS7A 5TJJA 4S04A 3MIZA 3RI4A 2ZMEA 5ILUA 3SNKA 3BDDA 3QU3A 3F8MA 1FC3A 1EAYA 3N0WA 1LDKB 3K1NA 4ZYDA 4D0PA 1FLIA 1J5YA 4KK4A 2JBAB 3ROUA 3DV8A 5H6QA 2L4MA 3DBIA 2MSKA 4I2OA 4EY3A 2OZ6A 1KU3A 1ZGAA 4ETSA 3HDGA 1NXSA 3K69A 1CGPA 1GLGA 4RXTA 2PL9A 3W6KB 4ASNA 3HHHA 7ABPA 5GOTA 1JXSA 4MQVA 1REPC 5BRJA 3Q7TA 1XDSA 1OKRA 3H92A 1I1GA 5E20A 3JPYA 3T0YA 3JSPA 3OLVA 2GWRA 2QVGA 4NQRA 4NQWA 2VUIB 1QNTA 5HQJA 3OQOA 5FWXB 1ZG1A 1JYFA 3O2SB 3H5LA 5LEKA 1OR7A 5GQSA 5K5QA 1K7AA 3NNNA 1USIA 1DPUA 2M1ZA 3OOPA 3RYRA 3HUGA 2DK5A 5TQJA 4ZPJA 4Z4CA 4R1HA 5HS8A 3L6UA 2IJLA 2H0AA 4O5AA 4Q6WA 1FZPB 3FWEA 1SD6A 4P55A 3A0UA 2RDMA 1IXSB 1SMYF 4GPAA 2JK1A 2Z5UA 3K2ZA 4BHBA 5D2CA 3O75A 3C1DA 1PEYA 2A6EF 4U7BA 3TX6A 3HUTA 3L00A 4MR9A 2LBPA 2GXBA 5EWJA 3DPLC 3E97A 1W7PA 4HF1A 3GX4X 2E4ZA 3R6SA 1GUDA 1A2OA 1BM9A 4OIQF 3GLXA 4PGGA 5KQMA 3MYYA 3IC7A 4KUMA 2ZBKA 2K27A 3F22A 5FFXA 1RIOH 2BGCA 2M1BA 2JVJA 4YFXF 4L18B 3LKVA 4EYOA 1XD7A 2F5FA 5DUKA 4O1HA 3KP3A 4GCVA 3F6CA 2P6SA 3LSTA 2F8TA 4YS6A 2H27A 2MYTA 3DPTA 1U2QA 1SXHA 2Q0OA 2JSCA 2OENG 1UHMA 1KU7A 3KS9A 3F8CA 2R7FA 3NNSA 1QP4A 4RK5A 4W5QA 4RAYA 5HLIA 2WB4A 4I01A 2YX4A 3F6PA 5HLHA 5D8KB 3I0TA 3H1FA 2CSOA 3S2WA 5IC5A 4L9TA 1RZRA 3KYIB 4FE4A 3SZPA 5CVIA 1WI9A 3U1DA 4UXNA 2GA1A 4AIKA 3H5VA 2DQLA 3WODF 1T38A 1B9NA 3R61A 3MZYA 3ZMTA 1P6UA 3CG0A 2MLGA 1TLFA 1T98A 5BQ3A 1VTNC 2HJ9A 1F4VA 5B3JC 3HRMA 4YIFA 4LLGF 4HA8A 2FN9A 3BROA 2KIUA 4YWHA 2DU9A 4LLLA 4QYWA 3R0AA 3E5QA 1R1VA 5HDNA 2V79A 1DJMA 5K5RA 4EJUA 1NXWA 5HKOA 4AIJA 4WUTA 3G3ZA 1PDNC 1ZG5A 4TMYA 2IA0A 2G7HA 3ROFA 1ON2A 3KP4A 2QBYA 3NQOA 1KA8A 2MBFA 4BXUA 1RPJA 4EMSA 1PP8F 4JA2A 4H60A 1GVJA 2HQBA 1U6GA 6PAXA 1JL3A 1NHAA 1MIHA 2W25A 2JTVA 2RJNA 1Z16A 1BA2A 2D2WA 2G9WA 3GV0A 5JNUA 3L49A 3GFIA 3E5UA 3EODA 1ODDA 3I59B 2HQOA 2KYRA 3W9SA 4F06A 5IBQA 4I0BA 3T5XA 3WGIA 2D1VA 1XCBA 2PEXA 5H6RA 4O6JA 2EV6A 2XVCA 4N0BA 3O1JC 4WCGA 1J59A 1S29A 3MMNA 4A2UA 1NXXA 4MEXF 3QX8A 2HWVA 5IX8A 2Y0MA 2VODA 1IW7F 1HKQA 2X7XA 2WRZA 4IHSA 3QX9A 2JZYA 2RDPA 1L3LA 5TQ2B 1QZZA 3HYIA 4GYGA 1XGMA 2FRHA 4Z99A 4N0QA 4N0PA 2HFHA 5KC9A 5CYVA 4EUKA 4MNUA 2PMHA 1S7OA 3QLUC 5CVVA 1VKRA 4YIIA 3K9CA 4Z0NA 2O03A 1JHFA 3DKWA 4RAZA 2FKAA 1EH8A 2DBBA 4HZFA 2FQXA 1G3YA 4A0YA 2B4AA 1MJAA 3QAHA 4RDCA 4YG2F 2DPDA 2LNBA 3LUCA 4H3HB 3BRQA 4A12A 3GF2A 1ZLJA 3H5IA 4OTZA 4D74A 2AS5F 1W9HA 3TO9A 3E6DA 2V1UA 4PCQA 3MA0A 1D1PA 4YCSA 3LKBA 3N4MA 2VYCA 1RI7A 2HQNA 2XAGA 4JAVC 1Y1LA 3N8IA 2FQYA 2LPMA 5TQ0A 4I09A 1J56A 3H5WA 2MSLA 5DCMB 4L0ZB 3ECHA 1YQAA 2ZMEB 2JB9A 1YS6A 1LEBA 3FXUA 4CXFA 3HUUA 2Z3YA 3S99A 2DO7A 1U0SY 3QRFF 2OU2A 2QLZA 3NRVA 4MQEA 1LEAA 1IZ1A 3CTPA 3RVKA 3RIRA 2PMUA 4P1ZA 1SFEA 3P9IA 1D8KA 4MEYF 4ESJA 4CBVA 2CGPA 4EJWA 2K7LA 4RGRA 1PHRA 2XDYA 1W7PD 2VBZA 4EVRA 3JTGA 2GQQA 4EYQA 3WTTC 2PMCA 2PAFA 4NB5A 1HXDA 5BRAA 2VE8A 5CVUA 4UHKA 5L3BA 4MR9B 2OQRA 3C3WA 4Q6BA 2XAHA 2ID9A 1XHEA 3ZPLA 3J80K 1ABEA 4M9XA 4IVNA 2K02A 4RK7A 2VK2A 1MAVA 3ELKA 1Z15A 4KREA 2IRFG 3HS3A 2GKGA 3SXYA 3Q9VA 3QLVC 1TNTA 2P6TA 5HM6A 4L9JA 3NHZA 2BYVE 3E6MA 5J6XA 3I54A 4CICA 1Z17A 2P5VA 1BN5A 1M2EA 4FB4A 2X0LA 1A04A 1U04A 2HKXA 3CG4A 2X4HA 1HEYA 2HPHA 1JH9A 1KQ0A 4GNRA 2XAQA 1NY5A 3LUKA 3B02A 3ZMZA 3HM9A 4LB6B 2FOKA 1ZG3A 4RSMA 2ETHA 3WE2A 1U2PA 4Z4FA 3CO7C 2HSGA 4BNCA 1XGSA 3BILA 3RKWA 1CYEA 1FFGA 3HSRA 1FSEA 3P7NA 4KRFA 3EDPA 1HW2A 3V8LA 2ZO4A 3KP5A 1R5GA 1ZHFA 2V1DA 4OATA 1BI1A 4ETMA 2PUFA 2M5WA 2QU7A 3MAJA 1XB4A 3CUQB 4IJAA 5LGNA 3ABTA 1KYWA 2VT3A 3DEUA 1B1BA 3E3MA 2FA5A 2TDXA 1K6OA 2P7CB 3O1HB 2VE9A 5FLXK 1DUXC 2ZKZA 4LLNA 3WTWC 2V0NA 4UHJA 2CO5A 1IIBA 3LUFA 3TOAA 1U5TA 5IUJC 2R47A 2EK5A 4HDUA 4ZZDA 1FOKA 1UHWA 5E8IA 1DRKA 3CKMA 4ML3A 4M72A 2A9PA 1H9CA 3KLNA 3CUOA 2FXAA 1ZLKA 1MDMA 2J48A 3GZ5A 3OO1A 2L54A 3REOA 4ZYHA 1DP4A 3IWZA 4PE5B 4N47A 2KIFA 1TTYA 3VFZA 1HQCA 2FBIA 1QPZA 4YFKF 2HTSA 1KRWA 4G0MA 1TQMA 4U0WA 2STTA 4LK1F 1K66A 1TMYA 1O57A 1D5WA 4ZYEA 2ID7A 4Z9BA 5D5UB 1ISRA 4HQMA 3ZN1A 3AAFA 3BOQA 3IRRA 4F11A 3KZYA 4HX4A 1F51E 3H1EA 4WX9A 1BVHA 3C6QA 1K79A 3GA5A 4WWHA 3EYYA 1SMTA 1GXPA 4TV7A 3H3UA 4EYGA 2VOPA 2QZJA 4IRGA 3V7RA 3BPVA 4A5NA 1WETA 2V1XA 4HOBA 3I5UA 5KVRA 2CD7A 2MLKA 5IT3A 4U0VA 1YK1A 3F8FA 3M1EA 2ADUA 4MPTA 4LZLA 3LA7A 4RU1A 1F9NA 2QWWA 5LEJA 2RC4A 4MS3A 4WK8F 4S05A 3GZ6A 5FWYA 3CO6C 1STZA 3HEBA 1ZGGA 5DLEA 5J8CA 1SXIA 2ZWMA 3I5AA 1Z2EA 2WC2A 5FBKA 3ML6A 3I09A 5K1YA 1JFSA 3IHUA 1AB5A 3TKYA 1FSHA 5JNTA 4GYIA 2EB7A 1OPCA 1XCVA 3Q15C 4CDGA 3J81Z 2IA2A 2XAFA 4RGSA 5E17F 2W42A 1E2BA 3KG2A 1T0FA 2FQWA 1AOYA 1O3RA 3KCNA 3GWGA 5C5EA 2Q5CA 2EV0A 5L3EA 3CUQA 4F3TA 2OA4A 1SRRA 4KIFA 2F2EA 1C0WA 2WWYA 1YS7A 5BPIA 3GBVA 3M8FA 2XAJA 3FF5A 5F1RA 1LBIA 1ZRFA 3RVQA 1DPRA 3LTEA 4Q5SF 1ZH5A 3KZZA 3DLBA 1GCAA 4OIPF 3DLHA 1JX6A 1RZ4A 2D45A 3VOEA 1LJ9A 1CF7A 3CTAA 4RB3C 1RZRD 4KN7X 3KYJB 3RYPA 1DC7A 1EWVA 3KEOA 1R00A 1GXQA 4MQFA 5LHHA 4KZKA 2B0LA 2JT1A 2CG4A 2STWA 4R79A 3C3KA 4M88A 1FNNA 2GZWA 1YMUA 1Z6TA 3HHGA 1EWTA 1JF8A 4WF2A 4IPAA 4PZ0A 1PP7U 1YIOA 2QW1A 2CHFA 2FMLA 2P8TA 1OXBB 3QEMB 4XSXF 4FX4A 5FWXA 4LE2A 4XLNF 3N75A 4IXAA 1ISSA 4JB2A 2EFNA 2FNAA 2XRNA 3LUDA 4XARA 2FN8A 4OLAA 3TOBA 1W5TA 2FMFA 4RB1A 3TO7A 2W84A 1RUNA 3E6CC 1SD4A 4N41A 2FMHA 3F6OA 5DGCA 2KJBA 5JFRA 3HSFA 1P4AA 3QPHA 1LB2A 4KQCA 4MRMB 4EYKA 2KRFA 3QP6A 4NHJA 2L18A 1IN5A 5DV5A 4G9YA 1O3QA 1IXCA 3I42A 2GA2A 4LFUA 2CW0F 5BR1A 4E70A 5D4RA 1FFSA 1QKKA 4O5VA 5F6FA 1D3YA 3FFTA 3L09A 2VOOA 2PUGA 8ABPA 3JSOA 2F8SA 5FBHA 2COMA 1NXTA 2QENA 4M71A 2NAZA 2E4VA 4ZJPA 4WXDA 2FF4A 3L2CA 3QEMA 4U7DA 3JVDA 1PNTA 2LSOA 4MRMA 2H94A 4KVFA 5DCFA 4N76A 2VBWA 4FE7A 5TPZA 5DEQA 2L17A 3O3KA 1O7FA 3O6BB 5IUKC 2V6CA 3H6GA 3HIFA 4AD9A 4HLXA 5JS1A 5CHYA 1Y0UA 4ENJA 3E61A 3C97A 1CF7B 1ZESA 1PUXA 2O6GE 4RB2C 4PDKA 3TB6A 3LOPA 3RVSA 5EWMB 4MYRA 5FD5A 3K1MA 2R25B 2RV8A 3D5LA 1T34A 2Q8KA 4W5OA 4XXHA 5L3GA 2CFXA 2E1CA 2CWEA 1JFTA 1HSJA 2VC0A 4Y9TA 4EGZA 1I27A 1Z7UA 3LAPA 4Q7EA 3VNAA 3HK2A 1R22A 1C0EA 4KMRA 3JS5A 4KIGA 3KKEA 2VUHB 1SD7A 1FX7A 1EH6A 3KP6A 3OO0A 4MHGA 3ZP5A 2PLYA 2Z9OA 4H3KB 2P4WA 2HDCA 4I02A 3ZMUA 2A9QA 1YLFA 3WGGA 5I4CA 5E18F 3O2PE 2QZ8A 1SFUA 4Z4HA 2QM3A 3RVJA 5D4SA 2WMYA 3FHZA 3RVOA 4EV0A 2IPQX 3OLYA 1B4AA 2PE5A 5LBQA 3TDZC 3LWFA 2YX7A 5ICEA 3HDVA 2IDMA 5E3JA 1BC7C 3RJPA 1MD0A 1DG9A 1USKA 3EQZA 4A6EA 5FD6A 3IRQA 1J75A 1ZN2A 4KMFA 3N0XA 5T3YA 5IT9Z 3E6BA 2MH2A 4O3MA 2LF7A 2W85A 2FSWA 1R1UA 2F5DA 4LJZF 1Z18A 5JNWA 3BJAA 1XSXA 3RQIA 3CRNA 1TBXA 2HYGD 4IRXA 3ILYA 4Z9AA 4A6DA 1F1ZA 2QUFA 3OQMA 3K9TA 2DW4A 4P98A 2EA4A 1WWXA 1BIAA 1Z25A 1IRGA 4RS3A 3I58A 4L9NA 4RK0A 3VB2A 4TLMB 2E7XA 3CUQC 5LLQA 2G7UA 1TW2A 1LK0A 2FU4A 3FM5A 3QK7A 4EM2A 2UXNA 4U88A 3KSMA 2NZVG 5DYMA 1DZ3A 4PYRA 4ZH4F 3MQ4A 5BMZA 1NXOA 3T38A 1USTA 1VPWA 1F5TA 4HQEA 3EYIA 3V7CA 4CZZA 1Z13A 5AONA 2FXIA 4YRZA 4ZYGA 1S3JA 1D5VA 3KP7A 5PNTA 4MTDA 2BGGA 1H9GA 4IF4A 3J7AO 2XUBA 1X3UA 2F5CA 5D5XB 3I59A 3WTYC 5H20A 1R23A 3HOSA 2CWDA 4XFKA 2B1JA 9ABPA 3L9FA 1UCRA 1M2FA 3T6KA 1IN4A 2DI3A 4XAQA 4EVSA 4YV7A 4YP9A 2Y48A 3DQVC 3SHFA 1E2XA 1R1TA 4XASA 3FM3A 4G0PA 2YR2A 1ZAYA 5FWYB 1TVMA 4I0AA 4MS4B 5DCLA 3DZDA 4OG2A 3BZ6A 5BQTA 3QU6A 4EQQA 4MGRA 3HRUA 1G6NA 1W4MA 1YW8A 2DTRA 2FNPA 3N0RA 2E4XA 4M74A 5ERIA 2NNYA 4RZSA 4EM0B 3HCWA 2UZKA 2FEKA 4Q4ZF 2FMIA 3T1BA 1O7LA 3EAFA 5DKFA 4ZYLA 5D5VB 4RXUA 4BQAA 3PFIA 3BJ6A 3R4KA 1D2AA 2DFIA 3IDOA 4GGGA 2HS5A 2EWNA 2PJPA 3FX3A 3GFMA 1DBWA 4BAYA 1H9TA 2R7DA 3TMYA 4N9HA 4G6DA 2PKXA 3CFYA 1TW3A 2MD5A 4WXMA 1FY7A 2E7WA 1ZYRF 2FLKA 4G0QA 4HX7A 4KQ9A 4L9VA 4M6XA 1TQIA 2MC3A 2Z33A 4W5TA 2FEZA 4G94A 2RN7A 1KU2A 4JB0A 1ZARA 3RVRA 4KA4A 3WTZA 1ZREA 3F23A 4HX8A 1DP7P 4MQ9F 4Q47A 2AXLA 2ZAYA 2A61A 4JK1X 1FYKA 3GYBA 2LDUA 3QLUA 2FTKE 1FFWA 2IOYA 5D5WB 4G6QA 4KYWA 2EA2A 3WE3A 3OLXA 4JP1A 2JVKA 2EFOA 5DDGA 5E1ZB 5CNMA 6ABPA 5CVJA 2N9UA 1RXIA 1R8JA 3CZCA 4NICA 1XMAA 2FBKA 1L0OC 3NNDA 2WJWA 3M8EA 2FBHA 5FO5A 3IP5A 3WTUC 1YFHA 1KQ9A 2DRIA 4ETIA 4DADA 2K86A 3EJWA 1YTUA 4FT8A 4Y13A 1XHFA 3CZ5A 4P9UA 1L5YA 4EVIA 1QP0A 3GL9A 3U9GA 1T2KA 3COAC 2CHEA 1TJYA 3TQNA 4B09A 3FZVA 4PZJA 2EFWA 3VEPA 4QLCU 2AYXA 6CHYA 5HVQC 1URPA 2VXZA 1B00A 3DP7A 1QMPA 5L3DA 4MTEA 2DAOA 2K4JA 1AB6A 3CU5A 4O1IA 3FMQA 2QR3A 1U8RA 5CNIA 3TO5A 4NV3A 3QEKA 1S7AA 2P4UA 1XSDA 3TDUC 3E3VA 4HNSA 4EGSA 3HTUA 2RGVA 1LNWA 3LQRA 1JYEA 2FMKA 3FXRA 1E6LA 3P9YA 1Z12A 2L19A 2A07F 4OIOF 1K68A 1ZGJA 3RDIA 3MFKA 2L02A 1FP2A 1P2FA 3QLTA 2OQGA 3W6JB 2RJOA 5JNRA 2LP4Y 1DBQA 5KWSA 4JASB 2IP2A 3F8BA 2FW0A 3RVPA 2UWMA 5KQLA 2IVMA 1IN7A 3K1PA 1G3SA 1ABFA 2P7VB 3KJXA 1D4ZA 3K0LA 3JY6A 5JI6A 5IULC 1E17A 2NZUG 5HS9A 2IPMA 1OYYA 5TRDA 3WG9A 3MZHA 1U5TB 4A5MA 4N03A 1B6AA 1K78B 2H6BA 5CVRA 3FMSA 3WU1B 1DCKA 1JHZA 1MDMB 1GHCA 3LUAA 3WTXC 1RNLA 2OAZA 3IP9A 4OMZA 4Q48A 1EWKA 1E6MA 3BREA 1IN8A 4EJTA 4LB5A 2EFPA 2IPLA 2YU3A 3QOPA 2WY2D 2M98A 5EWJB 2J5PA 1Z05A 3BWGA 4GO1A 1NXPA 4OMYA 4YLEA 4PGHA 3KP2A 3LUHA 3H6HA 1P6QA 3UUGA 3D8UA 1O3SA 1YO5C 5IT9K 3K4HA 4UVAA 2DQRA 5ICGA 3FMVA 4CGZA 2QYOA 1XWWA 3ILHA 2KKOA 3RPUA 4HW0A 2R4QA 4HV6A 2P5KA 4G0YA 1OYIA 5ILSA 3F3XA 5TPZD 5LHIA 4OBBA 3LMKA 2ISZA 3Q9SA 3T8RA 4IILA 4KK3A 2ISYA 5KQGA 3NHMA 3ZMSA 3Q7RA 2H3HA 4IRIA 2PJUA 3IP7A 1ZH4A 3KHTA 1U2WA 1OXKB 2ACJA 2FEPA 2A5YB 3H5OA 2QBYB 1BI0A 5EWLB 1FYLA 2BE5F 1ZRCA 1CHNA 5IEJA 1L5ZA 3ERED 3C18A 2E4UA 1VRVA 4DQ2A 4KV7A 3M9AA 5DD8A 4LG0B 4G0ZA 3LQQA 4ON0A 4EM1A 1QBJA 2IT0A 4G86A 3ISPA 4D6XA 4LGWA 3KTOA 4Z4IA 1P6RA 1R58A 5DUIA 4KPYA 4WWCA 3RKYA 2GI4A 3QLVA 4AVPA 4PEVA 2HYFA 1SAXA 2WJAA 5LGTA 4U0YA 3L7WA 2JCGA 4HNQA 3GO5A 2VBXA 4JQFA 4L5JA 4OOIA 1SXGA 4Y17A 4L4UA 2JPCA 2VC1A 3N53A 2Y75A 3GYHX 3ECOA 3ZN0A 2JBAA 4ETNA 3SFZA 4E7PA 1EV7A 3GFLA 4IRHA 3HSEA 4MGEA 2XHKA 2F5EA 3O2QB 2EFQA 4RB0A 1ZH2A 1FBSA 4W5NA 3T8TA 1EHCA 2W24A 4TN5A 2A9RA 3NEUA 4P5OA 1LJUA 5BPDA 3G85A 3FMRA 3CHYA 3Q41A 1YTYA 1DBPA 2L3DA 2A9OA 2VBYA 4OINF 1ON1A 1KYZA 1FBUA 2NNNA 1JFVA 3N6VA 2NS0A 4BH9A 4NCAA 3JW4A 3M7GA 2MYPA 3VODA 5E1XA 2A69F 1QZYA 5AIQA 1R7JA 2ZJ2A 3E5XA 3T8YA 2C6YA 4MS1A 2PUDA 2PLNA 1PNRA 5JS2A 1GCGA 3LFKA 5J8FA 2PL1A 3QP5A 2FEWB 3HJFA 1DRJA 4HV5A 3SAJA 3D02A 4R8HA 4Z2YA 1ZVVA 3V7SA 4UUVA 1WSUA 1D8JA 1J2XA 3ZMDA 3R60A 1ZGZA 3KCCA 4KIBA 2CQKA 3DGFC 4LG0A 1QQIA 4M9ZA 4IMJB 3RVLA 3BRSA 2HKOA 3WTVC 4L5IA 3BY6A 3EQ2A 2DPUA 2MSWA 3F7NA 3C7JA 3V8KA 2LIVA 4L85A 5JNVA 1LDDA 1M5TA 3J81K 2A3SA 3O1IC 4G8XA 3D0SA 4EJVA 1ONVA 1XN7A 1XSVA 3DGEC 3FXQA 3LA2A 4P9FA 2O20A 4HBLA 3A10A 1CEYA 3HXMA 3P9CA 1SFXA 1ULYA 1VLZA 1JLKA 2AYZA 3UKJA 2O61A 1Z26A 4QPJC 4YGXB 4W5RA 4HAMA 2ZNZA 4ENNA 4EJOA 4OLBA 2M45A 1IF1A 3G73A 2BV6A 2WWVD 1EH7A 2W57A 4MR7B 3CS3A 3SQNA 3O74A 5BOXA 3GEZA 1G3TA 1WRJA 1U8TA 4G0OA 2XROA 2MH9A 2EV5A 2VONA 1TLHB 3EULA 5A2QK 1O3TA 3ULQB 4RWEA 1V4RA 1IAWA 2RVCA 3I53A 4HF2A 3JPWA 1BOAA 4JBAA 3JAMK 4UVBA 4RV5A 3KEQA 1W7PB 2BBYA 5TQ0B 1LBHA 1A0OA 2QSJA 2L01A 4M9SA 4YR7A 4DQDA 4Y15A 3CJNA 4RGUA 1MJ9A 1MB3A 5EWMA 2E1NA 1J7KA 3MQ0A 3TO6A 2PBIA 5ED4A 4KDPA 5CLSA 4MAAA 4RK1A 1FPQA 3RPQA 4TLLB 4MQEB 2JRTA 2M87A 1P4XA 1LVAA 3OMXA 4ZZLA 2PN6A 2LUOA 4GXOA 3RKXA 1BDIA 1Z2DA 1RXEA 5HDGA 4UNOA 4KMUX 4F7ZA 5JVTA 3JAMZ 3V8JA 5JHUA 1R36A 4RY0A 3QELB 4HDVA 5FB2A 3MEXA 1NTRA 1PEAA 2RGYA 2KIMA 4DNCA 1YYVA 1QPMA 1Q1HA 3HV2A 1S6LA 2E4WA 2M30A 5B3JA 2MYUA 1TM2A 4AIHA 1I5ZA 5CNKA 1BIBA 1I3CA 1XDUA 4KT5C 1W5SA 1J0RA 4ZMRA 2R3SA 2OZUA 4LX8A 4G0XA 1BI3A 5F64A 2YPRA 3URMA 2V9VA 5FLXZ 3EDCA 2WV0A 3H5TA 4Z4GA 1M5UA 4XBFA 5TE9A 5DD4A 5BS6A 3HVRA 1IUYA 2JVIA 1FT9A 4FHTA 4XRFA 1Z91A 5C5CA 2IW5A 3OLZA 3Q7SA 2D1HA 2PUCA 3IL2A 1HKSA 2OD5A 2HZTA 4LDAA 2HOEA 1QQBA 4LMYA 4EVQA 1QO0D 1USSA 3HZHA 1IRFA 4UV8A 1J9IA 3SZTA 1E6KA 2WTEA 4HLYA 2PUBA 4OU0A 3PQJA 4RK6A 1EFAA 5L3CA 2VT2A 1FYMA 3CNBA 3OV8A 1KU9A 3G1WA 4RY9A 4G97A 4A0ZA 3GXOA 1BDHA 4XLPF 5KC8A 3M9WA 2Q2EA 1T6SA 1QNLA 2FE3A 4WZZA 1NXVA 5K5OA 2CYYA 2FLWA 2EJRA 5TPWB 3GW2A 1U5TC 3H75A 1DC8A 2GIVA 1HSTA 3LA3A 1IXRC 1QP7A 1MGTA 3P9KA 3V4GA 3SY8A 1KRXA 4WXCA 2HEOA 5EEGA 3GFJA 1ZAOA 2PG4A 2L2QA 1HBXG 4MLDA 2BEOA 1LQ1A 5T7BA 2K4BA 2ZXJA 3A0RB 3EGCA 2JRLA 5LRSA 3DFGA 3EETA 3I71A 3EQLF 1XMKA 4F12A 1P8AA 1K78A 5DCMA 1TNSA 3MWMA 4AWXB 2QQBA 4K2EA 1RUOA 1MKMA 1R5HA 1GUBA 1IN6A 3ZQ7A 3CDHA 2XIGA 3F73A 5JR3A 3C3MA 2KJCA 3VNBA 1P92A 2I6FA 2JPBA 2L4AA 1UFMA 2PUAA 2QVOA 4FX0A 3LAJA 5HSGA 2R48A 3A3KA 3GT7A 4MS3B 3OMWA 2QXYA 2M8EA 4BHCA 1YG2A 2DLLA 3OQNA 3FFWA 3BJOA 3IKVA 4RKQA 5E8GA 4KNYA 1JHHA 3WGHA 1JBEA 3IPCA 2IKSA 3LUJA 3ABUA 3DF8A 2YSRA 3B2NA 4Z4EA 4H0EA 5ICCA 4LDZA 3I45A 2IYNA 1QQAA 5AIPA 2NT3A 2HGCA 1DCMA 3FGZA 3RVMA 2O3FA 3BBLA 4G7ZF 3IP6A 5HOOA 3O21A 2O0YA 4IMIB 3NBMA
chains in the Genus database with same CATH superfamily
1EGMB 2CUTA 5FYDA 3HVJA 2C9ZA 5CD1A 5AHKA 3MF4A 2BBTA 2MTBA 1QC5B 5TX7A 3ILVA 2GPBA 5CXUA 1YVUA 1NN0A 2H0QA 3R7SA 4JP5A 2IEKA 1AK2A 4IHJF 4U1RA 2REBA 4MS1B 4Z1MA 3RWOA 4BJ1A 4XLCA 3JWIA 2XB2A 2XASA 1JHYA 1KC1A 3ABIA 3GEEA 3L7LA 4NAVA 1P4GA 1WA5A 2PKQO 4XKVA 5KPDA 5D8LB 1YZKA 3IESA 3SBXA 1FP1D 1QYVA 2IXDA 3SZRA 3OECA 5L3FA 2VP4A 4H0FA 3P4YA 4WXPA 4EKGA 4EYGA 3DBLB 5EJEA 5LZ4A 1TM5E 1BTOA 1L7EA 4XFDA 5ALQA 2AG6A 1XMPA 3ACBA 3IP3A 4NC6A 2ZROA 3Q1LA 1GM5A 2NYXA 1L6IA 4K6FA 1R4MB 1LLDA 3I6BA 2VJDA 4F52A 3DE4X 2J9XB 2ZLBA 2I91A 1T9BA 2CQXA 2DHQA 1QX4A 3LUGA 2DY1A 3NIBA 4N8SA 4PICA 4ZMSA 1NA5A 2ZUEA 1LW6E 3T9CA 1CKEA 1SBCA 3SU8A 1G8XA 3TQRA 4I7HA 4D98A 3GC6A 1W35A 3JRFA 5JLAA 3DZ8A 3OZIA 5ALFA 4DY6A 2ONZA 1KOFA 4OAQA 4BLVA 3S28A 2NQ2C 4LFBB 3KQOA 2FVYA 3FDIA 3UJBA 4OFWA 1PG0A 1P91A 1DEKA 1P31A 2K9MA 3PF8A 1OBHA 4L9RA 5AI5A 1ZM9A 3DOEA 5A3VA 4PAWA 3NTQA 3OPYI 4G5XA 4NMHA 4ESBA 4NOLA 2HRQA 5BN5B 1A9SA 5H4GA 3QUAA 1RPAA 3HXOA 4BRSA 3VZQA 3CEJA 3H99A 1ZJWA 1NE2A 4BXFA 1EM6A 3AONB 2O1SA 2CNKA 2VUMJ 1DV2A 3GLUA 3WYBA 1AXGA 2ESNA 1Z7LA 1O97C 4MLCA 1J8DA 1Q1QA 3Q3HA 3VH3A 1LWOA 1NRXA 3C14C 3UXYA 1R88A 2GN8A 3UANA 5ABPA 2H4WA 4QZVA 2PBLA 4G7HF 4TN1A 1DKMA 4AF7A 4D5EA 2PUDA 1R6UA 5H80A 2FW6A 3RT9A 5BMOA 3ETJA 5F27A 2AUNA 3IJ5A 1K3FA 3B78A 1W2GA 3GRCA 2PTGA 3J80Z 3K0CA 5HDKA 1BS2A 1H8HA 1X1SA 2G9UA 3IPAA 2EFYA 2QNBA 1TOAA 3RTRA 2IYRA 4YELA 2P9QA 1E2QA 3JRNA 1DARA 4AYBA 4OJTA 4W6ZA 1TA4A 1UBRS 3VZSA 5CURA 2O8EA 2XDAA 2G3YA 2X8JB 2RI1A 3N2KB 2EATA 3R3UA 4FYPA 3DDHA 1ATZA 3OYJA 1QIDA 2XV4S 1A96A 1PW7A 3C16C 2LCQA 2FSHA 6REQA 2XQFA 3F6VA 4AAYA 1UQRA 4FWBA 1PUFA 4KPGA 1DAOA 3ABKH 3NFYA 4QUEA 1K4TA 2HZ7A 1DVRA 3Q5FA 1T08B 2EW1A 1C9NA 3JALA 5A4FS 2DJNA 4LRQA 2F3RA 4ZYZA 1R5OA 2DWQA 2OCCH 2MHCA 2QW8A 3FE2A 2A9VA 4GPBA 4HBGA 4B33A 4ODIA 4RABA 1FW6A 4Y8VA 2KBFA 4CM7A 2YL2A 2B7LA 1MMNA 3KJIA 4GE3A 3RARA 2WIAA 3A1DA 4D3ZA 5LMCA 1M6YA 1VE6A 2W5UA 5EZQA 5JSKA 2ZRNA 1BJAA 4FDLA 1OYWA 1YIAA 3D6FA 3KSBC 1APLC 4NR0A 2ICWG 1KDRA 1P5HA 4YCBA 2BTQB 1F3OA 1UKEA 2O0LA 3I4NJ 4IGAA 4P81A 2I4RA 1TU0A 3IBYA 2XF8A 1JR6A 1IATA 4IIJA 4LXTA 3PTAA 3BGWA 3I2FA 3SZLA 3O8QA 1NTOA 2XB0X 1Q1NA 4HFNA 3ZDEA 4EQZA 2BFDA 1WHUA 3MMXA 1PT8A 4M1TA 4ZOEA 3WQSB 3UBTA 3IEMA 2VRNA 2NZXA 3Q8XB 1J5EB 4HLNA 1DJPA 4AMUA 4HWOA 4JC5A 2HTFA 3SM9A 5JCZA 1XU7A 2C7VA 2VJMA 4C76A 1NF9A 3WMRA 1A9TA 3U56A 4POAA 4R5MA 3HUGB 4WZAE 4NCHA 1RQLA 4ZTFA 4YFYA 1UFOA 4BJ3A 3U2RA 5HLGA 4QWQA 2IPNA 2J6IA 2O3UA 4MI1A 4RHFA 5EGSA 2KMUA 3ROTA 2DERA 1BS9A 1Q3TA 4EL5A 1RCUA 1PUEE 3LCRA 4E1BA 1GR0A 1V48A 2WVHA 3VR4H 5IUNC 3ZJYA 3OM1A 1H05A 2WWHA 5IKOA 1BMFD 3BXXA 4M0PA 4NEHB 2F43A 3RFVA 3SIPA 4WOCA 5E1BA 2FFRA 5AXDA 3C6XA 2XKPA 1M73E 4BLPA 2AR0A 4BO2A 2ONKA 3I4CA 3OQJA 4PJ0C 1GGJA 2DF8A 4LE1A 4PRLA 4QYMA 2WVGA 3JQAD 4P4NA 1DQYA 2JJ1A 4KLNA 3CC7I 5FOWA 5LDGA 5KSPA 5FFZA 2QV0A 1GT6A 4LZWA 2AI3A 4IPTA 5TPWA 3TD9A 1PZFA 3H1GA 1WVMA 3WTSC 1DQPA 2YHAA 3TI9A 3ZCVA 4AUNA 2VOEA 3DZFA 3H18A 3P9RA 4V02A 3UW1A 3VPGA 5BOSA 1VSQA 1KY5A 1YBFA 3S1LA 4NMWA 4FNAA 1TZJA 3TIXB 4A2QA 1P29A 1QAQA 3AEYA 2NO4A 2YCBA 3U7EB 4YT4A 2D0OB 2FJUA 5IYZF 2XOXA 1KBQA 2C42A 1BI2A 3KKKA 5A5FA 3FR8A 2AEJA 2IS4A 2V6FA 3AG5A 3AEKA 2CL6X 3PQFA 1EB8A 3GLHE 4GSYA 2CJFA 2FPIB 4QNRA 5DNEA 5K0NA 4EF5A 2AI2A 2RSLA 3LXMA 1IHUA 4HYEA 2GPTA 5IWCA 2Q5IA 3FYSA 2L2OA 4FSXA 2J9FB 2V03A 5FOXA 4BWVA 2Y69H 3CBQA 3PRJA 3QNUA 5AUNB 2RAUA 2IFTA 4XWGA 5FNVF 5LKRA 5JC8A 4HH1A 1U78A 2GFHA 3QM1A 3MMSA 2PI0A 4MQBA 3QU4A 2X19A 1ZITA 2R8XA 2GCOA 2CNWD 2A5JA 3FVRA 4YALA 3K1ZA 3TDMA 2BR3A 1KK3A 1N0UA 1U5AA 3EUHA 1G8JA 3VH4A 1T0FC 4GZLA 4PC2A 3VA7A 3OF2A 2LLKA 2FSPA 1E7QA 3VDNB 2O8XA 3GTPJ 4KYIB 4NQZA 1IVSA 1HWYA 1EZ1A 1L5MA 1ND6A 5EWLA 5BR8B 1Y7HA 4S1OA 1NJGA 4KO8A 5DX8A 4DB4A 2PX9A 2I67A 3MK31 1RESA 3RUPA 5A7HA 3TI7A 4BVAA 5LYJA 4CMGA 3IAEA 3PYLA 1QUEA 3FNHA 4C4TA 4ID9A 4A0XA 1UPXA 1L7PA 1OA1A 2F1OA 3CGWA 3GJSA 1MH3A 3QKTA 2DA3A 2JIOA 4QGAA 4R1PA 4V24A 2FPSA 3KZIC 2P0WA 3TCXB 4PQRA 3I2HA 8ADHA 1YONA 1BC8C 1VP9A 3R1IA 4Y2UA 4DUYB 5GJWC 2BMWA 4MB6A 3UWMA 4PY2A 2A57A 4MWSA 5H68A 3QUTA 1KSGA 2Y0PA 4QGSA 2JFFA 3G3EA 3QPTA 4JK3A 2GYYA 5IHPA 3OPMA 4UU1A 4MW4A 7AT1A 1BRTA 4NCNA 5CDYA 2KQUA 4NJOA 4GRAA 4CYDA 1I1SA 1BO6A 2JFGA 4C7XA 5JOQA 2WLTA 3KFVA 1P4WA 1S8NA 2YXEA 5E4JA 4MR8A 4ENKA 4M7RA 2PTHA 2BFDB 4ASUA 1JZSA 3HOXJ 3WQBA 3D7NA 3DYIA 3K9WA 4PSWA 3RI4A 3DV2A 2R7QA 4A3BJ 1B3RA 2CHQA 1B8IA 4NC9A 4I81A 4N40A 5AIAA 3ZCXA 4A7PA 5JO0A 1FC3A 3ZKWB 3LCUA 3K1NA 4ZYDA 1ONBA 2R7MA 2VJBA 3PRHA 1XTZA 4M6WA 1J5YA 2XCOA 3DKVA 4KAFA 4ZDJA 3I5MA 2JBAB 3BG5A 2W4IA 2R6DA 4ZEXA 5JJIA 1VZ0A 2B30A 3QVUA 3R44A 4ARUA 2BVLA 4EKIA 3GJRA 2DFDA 3BMQB 1P45A 1T6YA 3P2EA 4LVCA 4E11A 1KU3A 5C7OO 4MPDA 5YASA 3E0QA 1C1YA 3K69A 4CKEB 4RXTA 1GLGA 3VZBA 3EIFA 1XTTA 3RC1A 4XIYA 1AU9A 4JI3B 3ER9A 2VYQA 4EGJA 2VPLA 1BGWA 2O0HA 1CJSA 1FX0A 1CT9A 3FYUA 1KNXA 4X6AJ 1NBHA 1YDGA 2BKXA 1UIMA 4D0LB 4DSZA 4MQVA 3VVBA 1C0IA 5CAEA 1K7FB 1OGJA 2UYOA 3FTPA 2Q5JA 5BSMA 4BVJA 4EAQA 4H16A 1XDSA 1OKRA 1UPFA 3KDAA 1DXHA 5JHGB 2J7PD 3E9YA 3OLVA 4MV1A 1QUFA 2QMHA 3U16A 5IPFA 1UOOA 2VUIB 1NVKA 5KMGB 1O94A 2ZAOA 1H1LB 4C2BA 4PRKA 1QG6A 1RT9A 4E7LA 2FW1A 3FBNB 5KDLA 1NVGA 2HVSA 1W85B 1XRNA 3HL4A 2PR7A 1R15A 2QYTA 1T5BA 2CVFA 2PYDA 1ULTA 5LEKA 3ESRA 3H5LA 5IAGA 3LU1A 3WB2A 4ZC1A 1JXOA 2DBYA 1BE6A 2F4IA 2ROQA 4XGIA 1ZGWA 3UK2A 5IYZA 1A76A 4TZKA 3VVMA 2YUTA 2NV6A 2H65A 4GYKA 4L76A 4XLLA 3LSKA 3KR9A 2VTBB 2XADA 4HTFA 4CHTA 2FE1A 2Y1XA 1USIA 1DPUA 2Z2IA 3NNNA 3K96A 5FLEX 4JT4A 3OF5A 3P0FA 5AW7A 3WYCA 2H2FA 1TYAE 3BDVA 5KOYA 3FF1A 4W4TA 3DH0A 3R5TA 5ITVA 3BWDD 3GW8A 4OB6A 3HUGA 1SC9A 2NAPA 1GD1O 3E2PA 4ZPJA 1NBME 4R1HA 1GPDG 1SIWA 4ZK2A 1BE8A 3M4JA 2QD5A 1G8KA 3HABA 1Y6ZA 2FUG1 3G1OA 2L82A 3UTCA 1ILEA 1FZPB 1AZLA 3AY6A 3NHLA 4R7GA 5F2EA 3BSSA 3VU8A 1KSJA 4WZBA 2ECBA 1SAYA 3RUHA 4GPAA 2XMPA 2MR5A 3GP3A 2AG1A 2AYYA 1DAKA 1NMSA 3K2ZA 4ZEOA 1IG0A 3O75A 4HAUA 3GH1A 4FFVA 1JFRA 4OHVA 1E3IA 1GDDA 2A6EF 1M1YB 1W73A 2ZUUA 3EIEA 4PUSA 3LP5A 3HUTA 5K0GA 4KQKA 1XDWA 3A9SA 1XC5A 4MR9A 1GG8A 1TXGA 1BMFA 5BW8A 2XKKA 2E4ZA 3GRKA 1U0GA 1GUDA 1B8IB 3TOCA 3ZHCA 2CE7A 3RQ4A 3GZNB 3AEZA 4MQLA 3W2GA 4NG4A 3KQPA 1BM9A 2GK6A 5AWFC 3ZTTA 3OYMA 3PNOA 4U6SA 3R74A 4QU0A 4RHTA 5KQMA 5FBQB 1Q0ZA 1VFCA 2MMCA 4YUYA 5K9ZA 1T4MA 4QEKA 2HRBA 4KUMA 2BXYA 4A3KJ 1KJJA 3KWFA 2EJUA 4K0RA 3K7AJ 3KUKA 3S3TA 2XCIA 1T5IA 1QPBA 2IGBA 4HDQB 5FFXA 3KYDA 2XJ4A 4BNGA 4ON9A 4B7UA 2M1BA 1E2LA 2X7JA 4J7CA 2GRAA 4Q3KA 3ZXXA 3LKVA 1VMAA 2AG5A 1HDPA 4B79A 1E3WB 5KU7A 5DHUA 4X6XA 1C9DB 2E7ZA 3TXYA 1DADA 4O1HA 3V1KA 1TQ4A 1UPTA 2RCYA 2GN2A 2Z2XA 3V5NA 4JYCA 4QSMA 4J16C 5CT5A 2DSTA 1UG0A 3FRIA 4RGBA 4XPIB 2JLUA 5IKEA 2F8TA 1ZN8A 2AOWA 2MYTA 4ZCPA 3BQ9A 4KWHA 1U2QA 2HRCA 2KL4A 2NXNB 4IHAA 3QYAA 3LGAA 3AG2H 4V0RA 2ZBVA 4XCQA 5JDIC 1YOVB 3EXEB 3KS9A 4FDAA 1W34A 1Z82A 2FZCA 4GOKA 4WADA 4DPLA 2QTBA 2VCEA 1PK8A 1D09A 2O8DB 1BX3A 2WM9B 3CLTD 5CVEA 2FW7A 4ZAGA 5EJ8A 1TCUA 4YRGA 4EHHA 4W5QA 4XLEA 1ZONA 1ESZA 2V7BA 3HJRA 5H3HA 2AK2A 1TECE 3UAZA 3U39A 1CUHA 2YX4A 1JLHA 2IYLD 1DINA 3F6PA 3K6GA 4RFVA 2R7ZJ 4PLGA 5HLHA 1UDCA 5A4MS 1ZK3A 4YJKA 1RXUA 1CR6A 1NQAO 2DECA 2NZJA 2QUHA 3QY9A 5IC5A 3HYSA 2KDZA 1I7NA 1YB6A 4MVJF 4TS1A 5I9SA 1BW6A 3SBEA 3PXAA 4P08A 4YMVA 3F4BA 5J58A 1KAQA 3ILSA 3OESA 1ZJ4A 4ITVA 4XN3A 4XICA 1HCRA 2PD3A 3QXCA 4RD2A 4ZC8A 3RWBA 3L0BA 3DHNA 3R5SA 4EI9A 4XA8A 1YE8A 2GJ8A 3AI3A 5BSVA 1CRPA 4IQFA 5EC8A 1CS0A 1SXJE 3H2YA 4KYTA 3OZUA 3D5SC 3U1DA 3PZRA 2Y93A 5DDIP 4UXNA 1JAIA 4YJ2A 2QYHA 3KYDB 1VSBA 1VJDA 2AQFA 1E1QD 1FB5A 2PUWA 1IY1A 2Q0XA 1KO1A 1SM4A 1B9NA 2YS6A 3PHHA 5IAAA 3MC1A 2XX3A 2CLMB 3K15A 4KTTE 2JLVA 4ZV9A 4DWWA 4KFSA 1TLFA 4L6CA 4B3BA 4OK3A 1CR4A 2HJ9A 3UHOA 2WA2A 2HPVA 4L2IA 2ZJ3A 3CVOA 5TEWA 1U7XA 1NV8A 3CM0A 2IXEA 3NKLA 2BKAA 1GCIA 4NG5A 3GEBA 1XPOA 4DMUB 4LLGF 4XONA 5IOYA 1BKYA 3MXTA 4BJ5A 3PHLA 3WHCA 1O7JA 3TDNA 4ZVKA 1WHSA 4I50A 3ZDRA 4QOGA 1IZZA 1VG8A 2OQ2A 3W4JA 1Z2AA 3HB1A 1B1CA 1FMJA 3A2NA 3NKVA 5ALWA 3H5AA 2V79A 1D4AA 2XXJA 2H1RA 4MKGA 3NHYA 4NZZA 5HNKA 5K5RA 1MB9A 4EJUA 2CLIB 3REGA 2H1CA 1OZ0A 3FROA 3SC3A 2ORVA 2NSYA 3T5MA 1YDEA 1BNCA 1JUSA 3KQVA 2GVDC 4DMCA 5I48A 4AIJA 1P81A 1SQ0A 2WF6A 2LKXA 5DEOA 4UB6C 2LVBA 3E05A 5JJKA 1Y7IA 4BBZA 3Q87B 1ZG5A 2VAWA 4R2HA 4DEVA 3CDLA 3EXG2 3KOUA 1K83J 1OWPA 1ON2A 1D7OA 1OCZH 2B37A 2X23A 3DCJA 4HGPA 4M0CA 4E12A 3F5FA 4K46A 5BMVA 3IMEA 1ZKGA 4JOSA 1RPJA 2VP3A 4B43A 3AJEA 4L8FA 1JUDA 2G36A 3BB4A 3UHAA 1E32A 2BY1A 4UUSB 1U8CB 5DGDA 2QRVB 4DDKA 3E1GA 2CXOA 2PPVA 2GD1O 1U2DA 1GVJA 2RGXA 2HMAA 1Z0KA 2HQBA 4H60A 4JLPA 4MO9A 1X80A 1BCRA 2ZTVA 4ZJZA 2A9JA 1CQJB 4DV4B 1VL2A 3MTBA 3NAMA 4DBLE 2R5WA 3V1UA 2H59A 2W25A 2HXGA 3GFTA 1QVZA 3H0KA 3A04A 1Z16A 2FOXA 3DNMA 1IRXA 1QO9A 2PZMA 2GEDA 3GV0A 3PLRA 4XW2A 3VPSA 4BNNA 1AHNA 5JCXA 3L49A 1PFKA 3QPWA 3ZHOA 3ND8A 3QMWA 3I9V2 1HYGA 5CEFA 4HK4A 1SCKA 3HMQA 4IXMA 3V9AA 3I59B 1JKPC 3ESAA 2RNGA 3W9SA 5C3UA 1A7UA 5KBYA 3L6CA 5FPPA 2CLLB 4BFSA 4DLWA 2AFRA 3PCXA 1YTLA 3D7SA 1J7JA 3FBGA 3SBOA 4O4HF 3E22B 1UXJA 3QYJA 3SD7A 5B58T 1EAMA 3T5XA 2B2XA 2J3IA 2VQGA 4WLOA 1FOXA 1VQPI 3W4KA 3WGIA 2QORA 2RHMA 4WECA 2PEXA 2FPGA 4BZQA 3O73A 2GBYA 4CM6A 1RZVA 1ST3A 4DL9A 4CCLA 3JQAB 3BCRA 3CLUD 4UZEA 5K6TA 4YRVA 3OE7A 4N3CA 3BR1A 1TUBB 3OJEA 1ODLA 4BX2A 4XDHA 2OAEA 3P7MA 1I1NA 2ZIGA 1S29A 1ZR4A 4IX9A 4KXMA 2H8KA 3DWEX 4LQDA 2XF6A 1MMAA 4RJJA 4WXYB 1NG7A 4IJ6A 4MEXF 2NU6B 3H0CA 4X45A 2H52A 4J8PA 1L5WA 4OH1A 1QOQB 3NP9A 4RJLA 1T3SA 2DYSH 3KSRA 2MSEB 4MPJA 1IW7F 4RJKA 5FL3A 1HKQA 2X7XA 2WKRA 4HTAA 2D0PB 4IXDA 4LOKA 4RQUA 1KHHA 4UAVA 1YBVA 2F1JA 4EPXA 3M70A 4PZYA 5KZMB 2JZYA 2RDPA 1FTYA 1I6MA 4GKBA 2UV1A 4AXBA 1QM5A 2GLUA 1XGMA 3R3JA 4MZDA 4N0QA 4TLAA 4HQ6A 5A06A 1PL6A 4CV3A 2HFHA 2ACWA 5E7QA 2GIZA 1QYRA 2WY8Q 1AS2A 1CSEE 1K3UB 3CEPB 4UM5A 1NK3P 2GHIA 2OY0A 2D06A 5IT4A 1OZGA 1XXHE 2EP7A 1H8EA 4KDFA 4W9NA 1OH5A 5HTOA 2QDXA 4GPTA 1QSGA 3OKAA 1JZTA 3O7MA 1P62B 3FPGA 2JFOA 4YR9A 1L4BA 1UODA 3EXFB 4YMUA 1VKRA 2JZOA 4GP7A 3FD8A 2XYGA 3D64A 3GY0A 4QXAA 3K9CA 4XJVA 5HKAA 5GAJA 3LBAA 5IT9A 4AKGA 2PZLA 2CBZA 3ZQGA 2DT8A 3HUFA 1MOSA 3NLLA 4Z0NA 5H59A 1JHFA 1QRUA 4HC4A 1P74A 2Q6OA 3WIBA 2B6HA 1XJCA 1EH8A 4HG2A 3CCQI 1ISHA 1KYVA 2CN1A 4K2HA 4MV8A 2DBBA 3QVMA 4R8KA 4ZVLA 5BSUA 3L04A 4Z3OA 5AXAA 2HA7A 4GYWA 4QHTA 5IVHA 2IEIA 2UKDA 4DYQA 1MJAA 5CTAA 1O94C 3VNQA 2BV3A 4Y6GB 4YG2F 2DPDA 4ND6A 5J5VA 2LNBA 1KAMA 2EDCA 1CZKA 1MV5A 2FPOA 3ES9A 3SEAA 1LBSA 2ZRDA 4A12A 4MJLA 3L0IB 3GF2A 2DHEA 2ZUDA 3H1TA 4KMMA 3FDJA 3H5IA 4BPRA 5BORA 3R8CA 2VTVA 4XTCS 5C8YB 1CY2A 1WF6A 4OMCA 3ZU6A 1UM9A 3MA0A 2IH4A 1D1PA 3IUNA 3L2QA 5AI6A 2WG0A 3DHWC 3RV3A 2HYIC 1EDEA 3FKSD 4K9SA 1R8XA 4MINA 2DMUA 1XDDA 2GHTA 3A4NA 2XAGA 1NDHA 5AQ1A 1HF3A 1D1AA 3OYKA 1Z7EA 2PD4A 2PKRA 3N8IA 4W8HA 3Q3VA 4YIKA 4TYQA 4EJSC 3FTQA 3H05A 4HWRA 5EQDA 3WR5A 3X2FA 5AVTA 1OBCA 2WUFA 3EHEA 3FZQA 3ESWB 4DRYA 1EBFA 3DZBA 4XWWA 2GHRA 5IJ9B 4UKDA 4UBJA 1X2EA 5FI0B 1DJOA 2IY7A 2YFQA 1VQMI 4DIFA 3ECHA 4YBRA 2ZT5A 4KQWA 2BI4A 1IOZA 1SCBA 2QN6A 3FXUA 1IJKA 4CXFA 2AB0A 1W4BA 3F7MA 2HYJA 1PZMA 3A9CA 3P9QA 2Z3YA 1KEUA 4KN9S 1IV8A 1DQUA 3CRZA 4ZVQA 3TLJA 1CE8A 3VOAA 1QRTA 1U0SY 4LVNA 1TP4A 1RWPA 2OU2A 3FMOB 2QTNA 2BFEA 1VGRA 2QLZA 1I2DA 2GARA 4WFQA 3UYKA 3WDSA 1WKVA 4MQEA 1LEAA 3CTPA 2MINA 2QGUA 1VJCA 2CV0A 2PMUA 2GF2A 1E5TA 3ANTA 3Q9UA 4GXQA 4TMWA 5IM5A 4MWCA 2C4HA 3C3CA 1F17A 1PQYA 2CGPA 4CBVA 4A3MJ 1FMFA 1JUMA 1PL8A 2JIZA 2BSQA 2Y05A 2VBZA 1ZAKA 5AJWA 3HOVJ 2ZTSA 1XZDA 1L8XA 3UM9A 2OXEA 2NXEA 1XT6A 3GHYA 3LO5A 4QGBA 1JSCA 4GBGA 3NGXA 2POCA 3KVRA 1WJBA 4PQFA 1KEKA 2VE8A 1NG9A 5CVUA 3GT0A 1NNSA 2CDBA 2ORWA 1IQRA 3HACA 4TT8A 4YRLA 3C3WA 3T3GA 3TXXA 3UK6A 5B4UA 5J4LA 2ID9A 1M1NB 3IB6A 5AVYA 1XZPA 2FG5A 5JRZA 1E4EA 4KSBA 1N6HA 1ICEA 1KY3A 1L6RA 4UUNA 2WY7Q 1NM5C 4IVNA 1YE5A 2I4NA 2W83A 2VK2A 2NO0A 3K2BA 4MLZA 4Q82A 2ZITA 4X8LA 5E6SA 3W3AD 5IDQA 3DFKA 3ZLTA 2OZPA 2IRFG 2V4UA 1U3TA 3Q11A 3SXYA 1JJBA 4XCVA 3Q9VA 2HIHA 3NKFA 1P9QC 3AUKA 4Q93A 4DLXA 2ZSIB 1XZAA 3J81k 1C8VB 4GF5A 3RJTA 4EENA 3MKLA 1H8AC 5BWMA 1WSDA 2PZKA 5CX1B 3RFCA 1FVFA 2WAEA 2PKQP 1VSTA 5J6XA 4FETA 3DAYA 3DZIA 3PWTA 1U9JA 2OZLA 2OSBA 2XW6A 4NS1A 5FTJA 3N2NA 1MAHA 3HCEA 3GB9A 1G5HA 2X4HA 3CG4A 4Q00A 3V2GA 4YHHB 1RQNA 3EX7C 2YR0A 1PJLA 3U7QA 3HZOA 1ID1A 3GJTA 2XUAA 3RYIA 3PFYA 1OPRA 2WT9A 3I9V1 3L8DA 4LOIA 2AOUA 2C1EA 4ZT2A 3U44B 3B02A 2CEAA 2OESA 4CCOA 2ZJ4A 4M0KA 4LB6B 4KPUB 4O4LB 1ZG3A 4YFVA 4RSMA 5BURA 4QNMA 3GVCA 1RZ3A 3A1TA 4N7JA 4U0JA 1V4BA 1V55H 4KAXA 3MWEB 5TNXA 2BHNA 3ZK7A 2VXBA 3CO7C 1UL1X 3ZNQA 2QMEA 1B72A 2HSGA 3E7LA 1KDPA 3CLSC 2M32A 4JVOA 2W58A 1IPFA 3JALB 3T12A 4DOMA 4KFUA 4ZC3A 4B3CA 3BILA 8MHTA 2DT6A 3WLNA 5D86A 5DMHA 1YNSA 2GUWA 3S27A 4DZTA 5FBRB 3LQ1A 2YC4C 9LDBA 4QVGA 3CE6A 4M4SA 3TTSA 2GZHA 4DYHA 3EDPA 2I9PA 1HW2A 3V8LA 1JJVA 2ZO4A 2VH5R 4F3RA 4GR9A 4QGFA 3KXLA 4ZTUB 2GT1A 2QU7A 3PFBA 1YQQA 1ETVA 3D6UA 4ZZIA 1IJBA 3G9ZA 3I8OA 3KQNA 1FSZA 5LGNA 1E9AA 4ZDWA 4JDUA 2V5UA 4BVFA 1Z38A 4ZYTA 1A72A 4KISA 5EHIA 4C89A 4CW7A 1A5JA 4ZT4A 3OSUA 3K0EA 2QM8A 1P1RA 2A33A 3E3MA 4HDMB 5L45A 4KQIA 2BHSA 4C6TB 1NUAA 1C7ZA 1WQ3A 1TUBA 1QX3A 3WLMA 5TVKA 5AOCA 4M49A 3UJCA 5LZ5A 3KVYA 2ZUBA 3G88A 1BN7A 2A78A 3TEDA 1J8FA 4IDCA 2XC7A 3IAFA 3I6ZA 1BN6A 2A94A 1DDGA 1JR4A 3UB3A 3JASB 5K3AA 4HUJA 4AYBN 3OFKA 4YJ3B 3ZHBA 2Q3HA 1UR5A 2B8NA 1FP6A 2BE7A 3ZY6A 2XQVA 4BO4A 1PR9A 1Z6AA 4Q4JA 2YJNA 4ZI5A 3GZTB 1E9SA 2I3BA 3P9ZA 5EESA 4B81A 1QTQA 1TQHA 2CLKB 5L4SA 1H9CA 2WAQN 1X1TA 3RYIB 1J2EA 3OY7A 5L4LA 2F1IA 1HE3A 3SSNA 4DT1B 1PKEA 3UHJA 3D6NB 3CYFA 5EPOA 3REOA 3EC1A 5DP1A 4CMIA 1E9CA 4A0HA 2H4HA 3SIXA 1OYVA 1F1BA 3AHHA 4M8KA 4DNXA 4XM3A 3ZK8A 1YQ9A 4G2TA 4QQKA 3RFXA 4CF6A 1Y7LA 3F67A 5KTMA 1M8PA 1V95A 1O08A 1SA0A 3PCRB 1SU8A 2J9YB 4LOHA 5FPYA 4ZYUA 3NETA 1DO2A 4RTMA 4V0MA 4HMPA 5K6AC 1KRWA 2HJWA 5EF6A 3SZGA 1YB7A 5JCPA 3CPEA 2J5QA 5C4IA 4U0WA 2STTA 2PZGA 3DM9B 4N6OA 2FSSA 4LJRA 3RVBA 3S2HJ 2XRLA 1O57A 1YQDA 1AY0A 5TRTA 1VLQA 4L73A 4II3A 1MO3A 1P60A 4G89A 3RHZA 4BFUA 3RYHA 3G2JA 1ZWKA 4KH0A 3W78A 8AT1A 3EPKA 3DT9A 3R8XA 4Z9BA 2IXBA 4WKOA 1QLJA 3ZGVA 3AB8A 3TRDA 1SOUA 2DTEA 3HKDA 5FFMA 3IRRA 3PNMA 1E8DA 3KZYA 4OXRA 3C6ZA 5GVRA 1A4RA 1VQ6I 4TKUA 3H1EA 3ESQA 3L8CA 2VHYA 2WD7B 3PEWA 3EGDB 4F93B 3GDFA 1E3TA 4XLZA 5BSHA 5ECGC 1GXPA 3G7SA 3AVYA 4XB6B 4TV7A 5CG2A 3E9ZA 3GDHA 1OOEA 1TI7A 5CT8A 2X0NA 3CVXA 2QMZA 3BPVA 1L4FA 1P1IA 3R9WA 1B42A 1Z8HA 1PI3A 3NYIA 2OG2A 1WETA 1MJNA 1XZBA 2BVNA 5CUQA 4BV2A 2IHJA 1SFOJ 3JXEA 3CVYA 1QH1A 3LC0A 5LLSA 4ZRDA 3F8FA 2VDUE 1EE1A 2ADUA 2LREA 3NVKI 5TGZA 2O8FA 4PFKA 3GAMA 4LZLA 1QAOA 3JV7A 3V7UA 4C6RA 3O90A 3IEUA 4R1OA 4RU1A 1RM4A 2GCOB 2QWWA 1NSTA 1UDWA 2I1WA 3G8YA 4BMOB 3DKXA 1CRZA 3QLJA 3VV3A 4F5WA 5LLTA 5DBFA 3TQQA 5K0BA 1H4VB 3IE1A 1JDZA 4QYIB 3PHIA 3TKAA 2NU9A 3IAXA 5IBCA 4XR6A 5CYPA 3HEBA 4GI3A 4Q9AA 1RRMA 3LKZA 3HOWJ 1NOIA 3SQDA 2XLBA 4MFEA 4OXQA 4ESOA 2WU3A 2ZTHA 2WT4A 4B44A 3LNQA 1FFXB 1WHTA 4HUQB 5A3SA 5TQVA 3WLSA 4D0GA 4PRYA 1SXIA 3OA2A 1NHWA 4R7ZA 1Z2EA 4D9HA 1JS1X 5IANA 2BEVA 5FBKA 1E94E 4JR0A 3EGIA 1ML3A 2PMKA 4DQKA 4P0PB 5TISC 1AB5A 3DLHA 4YCJA 1PZHA 4BQPA 1SVMA 2BFMA 4N8DA 4MVJM 4WVLA 5D3QA 5JNTA 3D8RA 2E4AA 1EQ2A 1I2ZA 3CR8A 3LWZA 3OPNA 4PGMA 4PSCA 1OCPA 1KH3A 3Q15C 4CDGA 5KHOC 4JJ7A 4RGSA 3AIOA 3OA0A 4WLUA 1IBMB 1OY1A 1OAOC 3B9QA 4FZVA 4TUYF 6PFKA 1CERA 1E2BA 2XNJA 2HLNA 3KG2A 2VSOA 4UUMA 1Q0QA 1A6QA 3DEFA 1N5OX 3QPLA 1K86A 2HWUA 2RG7A 4LZAA 2VEDA 3A3YA 1O3RA 4FB5A 3GUHA 3ZCPA 3EEYA 3HA3A 5ALJA 3GWGA 4DLRA 5C5EA 1Y5RA 5JVDB 1SUIA 3HGYA 1NFRA 3NB0A 1HF0A 1Q1GA 2OCLA 4FVTA 1SRRA 2O7QA 2W6CX 5TVGA 1BC5A 4KIFA 5CDTA 3SQWA 3T5CA 1C0WA 3H9GA 2WWYA 1G17A 1KI9A 2QDKA 1XAIA 1ZS9A 2IZOA 4C43A 3BUSA 2PKYX 5FOTA 4JVLA 1A5ZA 3WK5A 4ND5A 5BWNA 3SF0A 1LFPA 1WUYA 2J46A 2VC2B 1ZRFA 4PZCA 3RVQA 3SP1A 2ZB9A 1ZD3A 2LGJA 4DJ5X 4KXYA 1QKIA 3VDQA 4KLRA 1T6NA 2BLLA 3N2ZB 3KZZA 2FEMA 2JLBA 3DPIA 3S2SA 5DK6A 5KWJA 5HBRA 3CUSA 3DLBA 1WXWA 1EK1A 2EFGA 1NXQA 2ZAIA 2PGXA 4GXTA 1DI0A 2D45A 3OTOB 3VOEA 2XVZA 3DWGA 3V1LA 5EI5A 5BXYA 2WJIA 4JR1A 3VJLA 4Q4LA 3O8LA 2WF9A 4NHEA 4KR7A 1FTSA 4KIWA 1RYDA 3GZNA 4XGQA 5E9AA 2OCKA 5L7WA 1X1DA 2XWJI 5DULA 4L6IA 3EWAA 4F4FA 1CR1A 4KN7X 3KYJB 1ZNQO 1MDFA 1OREA 1K61A 2VO1A 1R0SA 3DB1A 3FSRA 3G9QA 3CX4A 2QVYX 1ZIXA 1CUFA 4LI3X 5HX7A 4L6AA 3AR5A 1AQLA 1U7ZA 1BFDA 3N8KA 3DV9A 1NYRA 1QYWA 2E37A 4LX0A 3JX9A 1GXQA 1AZSC 3DEZA 4MQFA 5LA6F 1I3KA 2V7PA 2WTUA 2OGWA 4NFSA 2I6UA 5E1MA 1HEUA 2RAEA 1F2VA 4R1UA 3OIVA 4I9GA 2CG4A 1HYBA 3MWGA 2Q4OA 1L5LA 1XZFA 2V0GA 5J4VA 1R8SA 2HMVA 1XEXB 4ZDPA 1C9JA 2QTLA 1BHO1 3KKQA 2VI5A 4L07A 1NYTA 4M88A 4MUFA 5G4LA 1FFYA 1EWTA 1JF8A 2IF2A 3EUFA 4ZT5A 1GXSA 1TIPA 1JLSA 2ACKA 1B93A 4TZTA 5M5BA 3RSGA 1Q20A 2GVZC 2H63A 1EXWA 4DGWB 4LGCA 3ND5A 2QUKA 2DMTA 4KE7A 2R7NA 2EOAA 3RSQA 4MEJA 1YU6A 4WNAB 3L2RA 1U6KA 5JLWA 5M2QA 3PQDA 4QU5A 2FMLA 2JUCA 3EFOA 3I9MA 1LDEA 4NOKA 2P2SA 1I6WA 3P4UA 2BIFA 5DIZA 5KS2A 3UJAA 1WH7A 2X8JA 4LE2A 5DYWA 3BA6A 3JQ8B 4HJRA 1F38A 4Q24A 3MB5A 3DVAB 3PM1A 4B3AA 5J2TF 3KT0A 2QNIA 5A5VA 4XARA 1OLUA 3MSXA 1C3OA 1LW7A 3DYVA 2FN8A 2O1EA 2P78A 3LNCA 4FW8A 5EIBC 1GKLA 4QPCA 1ODFA 4KRXA 2FMFA 4RUKA 5EUBA 3TO7A 2W84A 2UZ1B 1G41A 4O4IF 3UAGA 5CDHA 1UK6A 2VA8A 3AP1A 3ZQFA 1OPXA 1OC4A 1ZGHA 4AJIA 3LXRA 1O58A 1MENA 3ZY2A 4N41A 3H8JA 4PF1A 3HSFA 4DKJA 1P4AA 3WSVA 3X1YA 1G3RA 1VIMA 3VC3A 1GPYA 3K32A 1TT5B 3R40A 1MEJA 3QP6A 4KQCA 4MRMB 5IDVA 3QPUA 1ZSNA 3ZYCA 5KHAA 2G1JA 1KDZA 4E6KG 1ZD2P 3HA2A 4UHDA 5ALSA 5JAPA 2Y92A 1HYEA 5IJ9A 3MBIA 1K6JA 3PGJA 1JSXA 1O3QA 3GI1A 4IDBA 3NWJA 1VSUA 1P75A 4OAPA 2DMQA 2I34A 1IXCA 1WJEA 4TQUS 3I42A 3KXIA 4MWZA 4UREA 3I83A 2R84A 3GLKA 1PFGA 3OUUA 4R31A 4UMEA 3NR2A 3A9WA 2C5SA 1T33A 3G8BA 3SMQA 4A0RA 1NUSA 5JRJA 1W4LA 2HA0A 1UBNA 4G56A 3A1WA 4NH4A 2C84A 1J20A 3N7UA 2EQRA 4IDEA 4TMVA 5A4DA 1LBTA 4C7VA 2DJ5A 1KQGA 2R1UA 2PUGA 3ZV5A 2DA2A 1Y8RB 1ICIA 2NSHA 2VNAA 1T9CA 3NBQA 4FONA 4G07A 1T0PA 4ANJA 4XD2A 5P8WA 1CIVA 1BDBA 2Q6IA 4L27A 4ZJPA 5B36A 5KQRA 4HLQB 1PD1A 2PLRA 2A0KA 3E9DA 3AG6A 2X4GA 3SR4A 1E2FA 2X8AA 3R9IA 3LSPA 1PLKA 2P4QA 4AK9A 2NQ8A 1PNTA 3IHLA 5FLMJ 2QX4A 3IEVA 1UBUS 2LSOA 2WSSD 4KVFA 2H1IA 3HOZJ 2VBWA 3QJYA 4PHCA 3WZMA 1JQ3A 2V5VA 2XOEA 5FJ8J 4RD3A 5DEQA 2L17A 3MS2A 5AHXA 1G3QA 3V4PB 4WEOA 4I1PA 3O3KA 3KC2A 1O7FA 1NNI1 5H81A 3O6BB 1N5IA 2SNIE 4CEJA 3RD5A 3QFHA 4JXXA 2HI0A 2R7SA 1I4TD 1H5NA 3COPA 2SKEA 2K2QB 4AD9A 3BJMA 2XA2A 5CHYA 5DT9A 3II6X 5BWBA 2O2ZA 7YASA 3E61A 1M2JA 3N5KA 4KR6A 3HSSA 2GNPA 1ZESA 3E7FA 4YY3B 4WZBB 3VOBA 3A3NA 4ZZ3A 1M2OB 1CF9A 8ABPA 4FHGA 4C08A 1A9QA 1MU0A 3PNSA 4DAEA 2EINH 2M6RA 4L4ZA 3U7RA 4MYCA 3JQBA 3RVSA 4Q9JA 3AR2A 3GFGA 2BT4A 1XMIA 4NNOA 4QPPA 4C7MA 1PVEA 2RV8A 2XMDA 4W5OA 4XWYA 2FDRA 1KAOA 1FZTA 4YYZA 5E9QA 2E1CA 2CWEA 4Y7CA 2ZZKA 5KTSA 4LF4B 5DHFA 2VF2A 3JWEA 3LAPA 4Q7EA 2IGMA 2ZTUA 4D79A 2OO5A 1BEEA 3PD7A 3WFZA 3U9SA 1S89A 3JS5A 3O3NB 5DYIA 2JI8A 4BO0A 4YDSA 4BBRJ 4WE3A 1DNPA 2RAFA 4AURA 1HXHA 1OROA 4M0LA 1SD7A 2VNKA 1FX7A 1X3SA 2RG1A 1EH6A 5ADVA 2EZLA 3KP6A 3OO0A 4NP6A 4ANFA 4BO8A 2Q6TA 2HDCA 4HATA 3DBHA 4I02A 3L40A 4HXEB 2A9QA 2V26A 4DQ0A 1X42A 4CH7A 5E18F 2C4WA 1Z0JA 2QZ8A 1SFUA 2EZUA 2GMWA 2VTEA 4MIMA 2WEKA 3INNA 3KB6A 4M7WA 4OMUA 4B71A 5B6JA 4CFSA 4D9MA 4M1EA 2HADA 4PNHA 2YCLA 3JASA 3IVGA 3OOUA 4EV0A 2ME6A 3OLYA 4FQ8A 2WICA 1YHQI 1ITZA 3TL4X 5IFLA 1V5GA 3U3JA 3C3AA 2P9TA 4ZGWA 2IYQA 1FXUA 3NT4A 5KTRA 1GSAA 1YR3A 4FFRA 1GITA 1M2VA 1JDVA 4JB3A 4X1KB 4D56A 1NIPA 1RJEA 2OHFA 3C98A 1R50A 2K5UA 4Q1VA 1QJCA 3INRA 4IIDA 3OOEA 5D5HA 5H9VA 1JHDA 3BMCB 2IDMA 3BK2A 2WVJA 3BD7A 1EX7A 1DG9A 4I66A 4WKPA 5HMMA 5JDCC 1DTWA 1USKA 5ELLA 1AGPA 5FD6A 1YX3A 1DUSA 4IY1A 2GBCA 3DZJA 3F90A 2QRVA 1MUUA 2OXIA 1QIKA 4YX9A 4DMFA 3FWKA 1J75A 1RHUA 4OWRB 3K72B 1FBTA 1J90A 2WOOA 1T95A 3CF5F 4NSNA 2C82A 4X3PA 4EF6A 4KMFA 4DA6A 5LWQA 5ITZB 1OLXB 2FE4A 3N0XA 1CY0A 2EERA 1HYQA 4NABA 4U8HA 3AL0C 2OXCA 2W93A 3M4YA 1OFUX 1WPGA 4NULA 3BWMA 4AKSA 5L6MB 4BMCA 4QREA 2TYSB 2CW7A 3V33A 2MH2A 4O3MA 2WIBA 2RBEA 4JVMA 3TR5A 3ZUGA 5KYWB 3HGMA 3WTBA 3MGCA 4OCZA 2H9AA 3BT7A 2W85A 4OB8A 5DGHA 3BHIA 5LZ9A 1XMVA 4M36A 1EG7A 3HKEA 4B2PA 3DC2A 1RBZA 3VZCA 5KDOA 2ZRGA 2RJ3A 1DGRM 4MR7A 2GCGA 3NC1C 2B5OA 4H77A 4L3VA 2EEZA 4P86A 4UXHA 4PG8A 2H2GA 4MKRA 2XB4A 1N9KA 4HCJA 3PC4A 1G5QA 4U6QA 2WKSA 3RROA 3F9RA 3UV6A 3MVEA 5HJ7A 4B4KA 4UOEA 3AFGA 1TYDE 3NHSA 2DULA 2OZKA 3CH4B 3L1PA 4A3CJ 1ESNA 2VPTA 3BX1A 3FYUC 5BSRA 1F2UA 4JUBA 5FOQA 5M04A 3FPHA 4Y3UA 2PD6A 4ZQGA 4S2UA 1A7AA 1Z8NA 1P80A 3PFGA 4F2HA 4P0QB 1R0LA 1IQPA 2AN5A 4L9NA 3ST7A 2QRNA 4JB8A 2L5QA 2FJPA 4PBTA 2WWFA 5LLQA 1IEXA 1B23P 1HT1E 2ZAMA 3TZ6A 1U0BB 2QZSA 1NASA 3FM5A 1EVKA 5A02A 3KEGA 4EFKA 5B1BH 2P9EA 4XPZA 2L0KA 3DBHB 3VAYA 4AO7A 3L84A 2V7VA 4U88A 2YHSA 5FPHA 4YAJA 2C31A 2R60A 4QG7A 4PYRA 2Z04A 5FNZA 1KJQA 4A3EJ 4DILA 1KI7A 3TWOA 4IOCF 5BMZA 1DUVG 1NXOA 4KL8S 1C0PA 4NYJR 4AJNA 621PA 2J9RA 3NASA 3RADC 2AXQA 3DWIA 2PS3A 3G6WA 4G81A 1GVHA 3DCNA 2ZJ6A 2O0KA 3EYIA 1FS6A 1RYHA 1K6MA 2ZYDA 5EE5B 1G1AA 2EKQA 5AONA 4Q4CA 5LQDA 2WHEA 5A4AA 2FXVA 1P3JA 1TADA 2ZKIA 3FPBA 2HMYB 4A8HA 1D5VA 1XTRA 3KP7A 1YOVA 4YK7A 4XQCA 4ZVVA 3O0TA 1QFYA 4J0FA 1P77A 4NARA 3TL3A 3U4HA 3W2FA 3QWIA 3QE3A 2BBSA 3OYCA 2IU0A 3J7AO 3L18A 4K8RB 3SCZA 4MVJA 3MJCA 5D1HA 5DI9A 1NVWQ 3RRZA 1X3UA 4HDCA 3RNOA 1V4NA 1KTIA 2FUNB 1NG1A 5H20A 5AXBA 4DXHA 2CHGA 1R23A 3FLEA 4REMA 3I9FA 2E2JJ 5EEAA 4XFKA 3B5IA 2E5NA 3N7AA 1ADCA 5LP6C 2OC6A 3PX7A 3L9FA 1DX9A 1N5LA 2PX0A 3K05A 1ZOLA 2XNDA 3M4ZA 2DI3A 1XDGA 2QN9A 4UMDA 5H0IA 5HYVA 4M3GA 1X1QA 3DOIA 1NP6A 2Q27A 3FYCA 4RPGA 2AMLA 2NO6A 2ZSUA 2Z57A 4U7TB 1E2XA 2YU9J 1SANA 2CDCA 3UT6A 4IQ8A 3INGA 3L07A 3EXG1 1FRVA 2ZBDA 4P3OA 4QBGB 4UVEA 2HNBA 4ENUA 1KSFX 3BXGA 4LCBA 1T9GS 1TVMA 1OIXA 4I0AA 3S1MJ 1F0NA 2A9FA 2HIGA 3RC7A 3VZRA 1OLOA 5T4HA 4BMNA 3ZD7A 4GVPA 1GT0C 3QU6A 3GTGJ 1CFJA 1JIKA 3CXRA 8LDHA 3AHCA 3FW1A 3LHSA 1POWA 1G6NA 1W4MA 2OPTA 2BZSA 3Q40A 5B3LA 5HNHA 4HADA 4F2DA 4M74A 5ERIA 1J6UA 2NNYA 1WEHA 2BR5A 1ZC3A 5I3ZA 1VRWA 3S0JA 3V4RA 5SYNA 4HB2A 3PIOF 5DNUA 3I6YA 2QY9A 3LMMA 1MW7A 1F8GA 1A27A 2VHTA 1O7LA 2FR8A 4N54A 3A05A 5DTQA 1TTTA 3QE0A 3IOBA 1JVSA 4ZYLA 4CG0A 4CMEA 5DLDA 1HTTA 1PLLA 1VCMA 3PFIA 4BQAA 2XBMA 1S8FA 5CA1F 1FTQA 4F4JA 3CCUI 4B9AA 3DU6A 3WDLA 3OCYA 2HBZA 2LV8A 3L0DA 2KPMA 3GFMA 2GUGA 2P90A 1DBWA 1V3VA 3UV3A 4BAYA 3LHDA 2R7DA 3TMYA 5HEKA 4AWXA 3A9TA 3PEFA 3LT1A 4HAYA 3DULA 4KJZA 1O0BA 5HZKA 3IVRA 4QXQA 4D9IA 1OE0A 2C94A 4CF3A 3HBAA 3VKUA 1T2VA 4DR7B 2DPLA 2HJRA 4UNRA 1UEXC 3SZOA 2VQCA 3FCYA 1CUXA 4IIUA 3KYLA 2ZVJA 3A32A 4G94A 4D8YA 5DSXA 3EYAA 3MYRA 4BUPA 4JB0A 4TL7A 1ZARA 1Y6JA 3QOFA 5I01A 3WMXA 2G77B 2YVQA 3ZV3A 5BSFA 2X2FA 2DWOA 1UPBA 2Y0SA 4A93J 3PUIA 3OR1C 1RXSA 3DC7A 4L02A 2W6QA 4R2XA 2WLSA 2KP6A 4EW6A 3DE7X 3GVIA 2F4MB 1E63A 2FHSA 4ZI3A 2AXLA 2ZAYA 1NI5A 4JK1X 4L5YA 4EX7A 4NPAA 9GPBA 1C2YA 1QANA 3KKMA 4KP7A 5KNDA 1LNZA 1QKJA 4J7UA 4RA9A 1G64A 3M3HA 4DDTA 1M2VB 3K20A 4RAQA 4X1KA 4BDTA 1UWVA 3NUZA 1X86B 4Q7LA 2IOQA 4V2UA 1BQ3A 1XU4A 2GZDA 4U3JA 1CEXA 1LX7A 4JLUA 4KKXB 3K4MA 3SX4A 4EP1A 2ZZNA 3OLXA 4XLFA 2D7JA 2FP4A 2REXB 2BFAA 1HDIA 3QU2A 4MGZR 1SK8A 2QX7A 1EQAA 2KRHA 3GG2A 1IUFA 4TV8B 5CNMA 2YWEA 4MROA 5DO9A 4OHZA 4TKMA 3PC3A 1VGVA 1W7AA 3F9KA 3ZQ4A 2PX4A 2EQ5A 1IPHA 1RM5A 2QT0A 3CZCA 2ZTMA 1QHHD 3GA7A 4MQMA 2YQ4A 1XMAA 5FA8A 5JASA 1ENHA 3BE6A 4IVPA 3ZGXA 2HRRA 4W1RA 3ZI7A 5M7EA 4IIVA 4D26A 1AU7A 4LCEA 2WJWA 2JFBA 1OWLA 5DRTA 4F9GA 5JO9A 3M8EA 1Z6GA 3GVXA 1RI4A 5BVHA 1CQXA 3OURA 3RTCA 3D2BA 1Q7GA 1MC4A 3WTUC 4QU9A 3JQBC 1BU8A 3MT7A 4DSTA 2F6RA 3YASA 4BNYA 4QDTA 3EJWA 4UXJA 4W5HA 3FDZA 5FLYA 5L3ZA 4FT8A 3HWSA 3K0SA 3CZ5A 5F3RA 4KHPB 1LTHR 1NNUA 5JQGB 4LISA 2RHTA 3PSFA 4EVIA 3HKBA 5HZHA 4LTDA 2FHPA 3N3BC 1T2KA 3COAC 4F6LA 2WIJA 5LZ8A 3FXAA 1M2WA 3EMBA 3GLSA 4YXWA 3GLIE 4C4PA 3PC8C 2HF8A 3BH6A 3TQNA 2O8CB 4LSZA 4HGZA 4EY3A 1CZNA 2BD0A 2BY3A 4PZJA 3DAOA 1MQ9A 2YZ2A 4FD2A 3VEPA 2WUWE 4C0SA 1ZLXA 1YFJA 2R6R1 4B8YA 4P5PA 5HVQC 1DTSA 1E2PA 1M0TA 2ACEA 3H35A 6CHYA 2FK8A 2QXUA 3F0TA 4I8DA 4URUR 4PHHA 4YPVA 1URPA 4IINA 1X7XA 3LHKA 4JC0A 4M8SA 1F2TA 4LDJA 4B31A 5JAZA 5KU1A 2QKLB 4CGYA 1IDOA 1FYWA 4PX2A 4JWKA 4MTEA 4L1KA 4KNVA 2DAOA 3GAZA 3L8EA 3HZJA 3B6JA 3UH0A 121PA 3M6WA 1G20E 1AB6A 5HBGA 4DJDC 3SLRA 3S7TA 2RH4A 3VJKA 3TBFA 3I9NA 1KI3A 3I3SR 2DFLA 2GNOA 1FFEA 1FYFA 3DTVA 1R0ZA 2WSLA 4RBOA 3TDUC 4J6FA 3MVPA 2YRXA 5IP5A 1ZCAA 4CUKA 2OD9A 1F9EA 2VPXA 4NJEB 3MNFA 4WVFA 2V8OA 3WV4A 2XNKA 4IHKA 1JR3A 1YR7A 3LQRA 5JDCA 4PG4A 2AA3A 3TW8B 3BD6A 3HBLA 3P9YA 3P8ZA 3DDNA 3LBNA 4LYFA 1IWBB 5CBPA 2I87A 4XX0A 1BXKA 2E35A 1NRIA 4OIOF 1V1JA 2V58A 3KPUA 1US8A 1JN0A 4MO2A 4D0SA 1U11A 1FP2A 5EMKA 1AKUA 3SJAA 4HAOA 2I22A 1Z2NX 2DDAA 3CKKA 3UVEA 3RR2A 2C2HA 4IH9A 2X1HA 3R7WA 5KUTA 1G5FA 3JARA 5EHZA 4WKGA 1VXRA 4EHKA 2A14A 5EAIA 3GGCA 3RGGA 4AUEA 3F8BA 3FI9A 2I8AA 1W2HA 3LQYA 4L7QA 3MRXA 4ZPXA 3RVPA 1SIOA 2XA9A 1FDWA 4CMBA 3CEHA 3K1PA 3GRPA 4TRMA 3OD1A 4UCQA 3UTDA 3AERB 3U09A 2FRVA 4WZAA 5A9RA 3KJXA 2J0QA 2P7VB 1DWPA 3I30X 3Q6MA 3EJ6A 4B4OA 4TZ6A 3JY6A 5JI6A 1P3DA 1Z28A 4C87A 1YIJI 1H4TA 2O14A 2RQQA 2C5EA 2NZUG 3WLFA 3SS8A 4LVUA 2IPMA 3M0EA 4D9FA 5TRDA 2P67A 3FMFA 1PNQA 4B6FA 2OMEA 7MDHA 4BFCA 1QB8A 4N03A 1B6AA 1K78B 3NEAA 5BY2A 1V11A 2GILA 4TLEA 3H2SA 2VDWA 3UOGA 3GFRA 2PGDA 2QRLA 2GN1A 4CM9D 3BCHA 3UJ7A 1Q0LA 3L6EA 1MDMB 4O8CA 1GHCA 1WJ5A 3WL8A 2I3DA 5CFLA 3HRHA 3CB4A 4B6PA 4Q48A 2ZI4A 1SEUA 3KP1A 3BREA 2XF7A 1Z2OX 3P2MA 4GP9A 1SC7A 3BWBA 4JKYA 3QOPA 5CGQB 2M98A 2XNCA 4AMBA 2QN1A 4Y9SA 2RH9B 3WKDA 3CNEA 4ZJYA 2CV1A 1JZQA 1FTWA