4S0MA

Crystal structure of nucleoside diphosphate kinase at 1.92 a resolution from acinetobacter baumannii
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of nucleoside diphosphate kinase at 1.92 A resolution from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 45
structure length 143
sequence length 143
chains with identical sequence B, C, D, F, G, H, I
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4s0mA00
2AZ1A 3EM1A 3G2XA 3PJ9A 1NSKL 3VGUA 3PRVA 1NLKL 4F4AA 3JS9A 3EVOA 4DUTA 1XQIA 1B99A 1NCLA 3FBCA 1HIYA 1JXVA 3R9LA 1NDPA 5C7PA 3ZTRA 1HHQA 4EK2A 1ZS6A 1W7WA 3VVTA 2BEFA 4UOHA 4F36A 1S5ZA 1NB2A 3DKDA 1BHNA 4ANCA 2B8QA 4ENOA 3BBBA 3VGVA 1LEOA 4KPCA 2DYAA 3Q86A 3ZTPA 1S59A 3EJMA 5IOLA 3BBFA 3BBCA 1NDKA 3ZTQA 3EVWA 1B4SA 2B8PA 2DXFA 4DI6A 3WX8A 5BXIA 1WKKA 3ETMA 3Q8YA 4O0NA 2BX6A 3DDIA 1NHKL 3NGTA 1HLWA 1F6TA 1NSQA 3Q8VA 3FBBA 1KDNA 1MN9A 2AZ3A 3GP9A 2CWKA 3L7UA 3BH6B 1UCNA 3BH7B 3NGSA 1VYAA 1XIQA 3ELHA 4DZ6A 3VVUA 1NPKA 1WKJA 2VU5A 3B6BA 3VGTA 3Q89A 2ZUAA 5CABA 2DY9A 3Q83A 4ANDA 3FCWA 3ZTOA 4CP5A 1NDLA 2DXEA 2HURA 4S0MA 4UOGA 1WKLA 2NCKL 1U8WA 1BE4A 1LWXA 3GPAA 1MN7A 3ZTSA 3ENAA 2DXDA 3VGSA 3FC9A 1EHWA 3NGRA 3FBEA 4C6AA 3FKBA 3FCVA 1PKUA 4FKXA 1NDCA 3NGUA 4UOFA 1S57A 1BUXA 4ANEA 4HR2A 3EE3A 1NSPA 3EVMA 5CAAA 4WBFA 4W98A 3EMTA 2HVEA 3MPDA 1PAEX 3EICA 2HVDA 4FKYA 3B54A 1F3FA 3Q8UA 1K44A 3FBFA 1NUEA
chains in the Genus database with same CATH superfamily
4Y2KA 3QRQA 2HHPA 3J7A1 4P6QA 3AD7C 4LSNB 3BB5A 1F3VA 1KFDA 4HHUA 4ZK7M 1FKPA 2F3JA 5GADI 1LW0A 2X7IA 2V9WA 4DV0J 2AYEA 1JLAA 1H6KX 3DFEA 1ZZFA 2W01A 3PRVA 4OI6A 5C5JA 1IKXA 4DV2J 2DNZA 5HMZA 1KOHA 5L9NA 2QL9B 1RB0A 3AAWB 5EWGA 3P3DA 2P6SA 1HI1A 2ATCB 2V2KA 3ZO7A 1CQNA 4G1QA 3UNGC 1G7CB 4C97A 1YWXA 1HHQA 3MTJA 3C14A 1P9QC 4EK2A 2FJVA 3CD6S 1AUSL 1DLOB 2IBOA 1VCTA 2W2QP 4AQYJ 3DKDA 1RXOB 2PE8A 3VV2B 3Q2TC 4CTAB 3KOAA 1HNIB 1C0UA 1RABB 4OI2A 1Z1ZA 3LP1B 3RG6A 4DFMA 2G0IA 2ZVSA 3MR5A 2GJIA 2R7UA 3NCPA 4YDDB 1UETA 1VJQA 2EC2A 2C3OA 3LPYA 3ZTPA 4WP3A 2ADCA 4C8LA 3EZ5A 1KS2A 3W8PA 2UVVA 1CJKA 4NYOA 4ZVPB 1VDHA 5I3QA 3T3FA 1SQFA 3KJNB 4PG7A 1PCAA 2DNRA 2Q1LA 3NY0A 3OFGA 2W9CA 3TANA 3RAXA 1U1RA 3PM9A 4WIIA 2KXFA 1HBMA 5I3UA 2ASLA 2FJBB 3UDLA 4X4SA 2WRMA 2E66A 5I42A 4QU7A 2MKYA 1RWKB 3E01A 3JSBA 1VC6A 3ET6B 1IQTA 1X60A 5AJ3J 4ECWA 1QTNB 3BQ2A 1AZSB 3MEGA 2A0FB 4CLFA 2R8HA 3GONA 1HD1A 1XEZA 3SSQA 4ELUA 4NXNJ 4NLGA 1P8GA 1HWUA 8RUCA 2VC1A 3IG1A 2VJVA 2AZ3A 2W1BA 3CNQP 4OIXA 2ILYA 4F0MA 1ZAVA 6AT1B 2Z2MA 3M9MB 4WFAQ 1WTBA 1RT5B 2J9CA 4DX6A 4XPEA 2NXNA 3VAJA 5H1SV 5DG8A 3IO1A 4JI5J 2XNQA 4Q0BA 4HYKA 3MR7A 3FMBA 3W2WB 2LCWA 4LR8A 1UL3A 1R8AA 1OSCA 1R31A 2YKAA 4DBQA 4C4WA 1KVIA 4RW9B 2QGFB 3M1VA 3J7ZT 4LF9F 3DXSX 3H59A 3NGKA 4PYDA 1FEEA 4N77A 5KFAA 3TWZA 2GHPA 2H5EA 2OH2A 4PUOB 1TP7A 3BGOP 1FT8A 1Y00A 3I56S 1QAJA 4IFVA 3BDPA 2B7CB 4OLOA 4PXEA 3CCES 1Y4ZB 3R2CJ 2VG7A 4YHHF 2RS8A 1UFKA 5E3CA 3ZNUA 1EJ7L 2CDRB 3QAEA 3MFIA 2HHQA 2NXCA 4KFBB 4YEAA 1PILA 4C11A 1CQMA 4LFAF 2X3GA 1REGX 1FRHA 2FB0A 1PBUA 3CJ4A 2K1RA 2YBVA 5K8PA 5BJRA 5JVHQ 1CEZA 1VHFA 2HS3A 4B3RJ 1O0PA 1TQLA 2HBZB 1VGYA 2F1FA 3ENQA 1VBYA 2JEFA 2VOOA 3PW4A 2HLTA 1FRIA 4F50A 2BJ1A 1I3OB 1Q5VA 2JX2A 4O4RA 5DQGA 1RA6A 1WEYA 1G6BA 3E3XA 3FCVA 2CJKA 1S4FA 1Y9OA 2WOMB 3C15A 4OV6A 1NPRA 1EKSA 2Y0SD 2YTCA 3CJ2A 4QW8A 2B0GA 3VTIA 3FZBA 4YQWA 1NSPA 1IBMF 2FJXA 3NL0A 4KHPF 4JI2J 1GXLA 2HVEA 2PO4A 4ZJOA 3MR6A 4U96A 3C6TB 1J5EJ 2YWGA 4OZJA 2CQ0A 1VMBA 4CLTA 7FDRA 1TV6A 2QLXA 4W90B 3S6EA 3KYLA 2AZ1A 2B6AB 4USTA 3IWNC 4P2MA 5HK4A 2JLFA 4KPYA 3UCUP 3GJRB 1G3OA 3PW5A 1T03B 2RU9A 2A18A 2IVYA 1NPPA 2DIVA 3TP2A 3GV7B 2RIJA 2HAFA 5HQLA 2NS1B 1HQEA 3MM5A 1TUVA 1NLKL 2OSQA 3HHLC 4RUAA 2BABA 2MQPA 4ZP9A 3KLFA 2GZOA 1QVGR 2I5JB 4X62J 2X3DA 2Z57B 2I8EA 2KL8A 1HPZA 4Y0FA 2J7KA 1T03A 1RSCA 2IDLA 1ZOTA 5JVGQ 3GWCA 5HP1A 3N6NA 5LMUF 1B99A 3NNHA 2HWIA 2F40A 2WVCA 3MAHA 4WPAA 2CJ9A 2QSWA 3VHQA 3EDQB 3ZZUA 1QAYA 2ZZTA 4DSEA 2FHKA 3V81A 4U8VA 1YLXA 5KFYA 4PG6A 2BJ3A 1FE0A 2HNZA 3VVTA 4UOHA 1SH0A 3NWRA 4DU7A 3HM9A 2HRYA 1YJ7A 4ICLA 3DU6A 4ED7A 5LXRA 4O4GB 9ATCB 3M05A 5KT3A 1CBKA 3Q86A 3W5ZA 2AJQA 1VQPS 1B3TA 2Q6BA 2LFVA 2XI3A 5MLCV 2IPOB 3EJMA 3IM8A 4DSJA 3G82A 1UMJA 4KE5A 2RHSB 5E0OA 3HSGA 4TY9A 6FD1A 1N33J 1R8PA 4FVCA 1ICEB 3DRXA 4XDDA 3NGDA 4ITSA 2OJ3A 1ZM3A 4JI6F 4DL6A 4KFBA 2AJ2A 5G4DA 1X4DA 4O0IA 2UUCJ 5HVHA 3KLIB 3PHEA 4PAAA 2CQ4A 1T9WA 2ZDPA 2VG6A 4IH6A 4H4MA 2GVZB 3TYTA 4YR2A 1DRZA 1U1OA 4PQUB 2IM2A 1IJFB 1H7XA 2YNFA 4OZ1A 4U8YA 2D3O1 1M1KT 4DFKA 2ZH3A 2MQ8A 3R5DA 5GADU 4JI1J 5KFHA 3M8RA 4CYUA 1SV5A 3K0JA 1C4CA 2O66A 2GV1A 2ILZA 2QL5B 3TUZC 1EARA 1FWKA 1WC6A 3OHAA 3CDBA 3B78A 4Y2MA 3ULHA 3W2WA 2DNQA 3KXDA 5J2PA 2W25A 8ATCB 3ZZOA 4K2XA 5HQMA 1SV5B 3HULA 1NPKA 1L3VA 3DLHA 2CJQA 1JLQB 3MAAB 2VODA 3T5JA 3G87A 1WWHA 2IC3A 3HSZA 5EWEA 1HNZJ 3H98A 1N5SA 1ELOA 2B56A 4NI2A 1JLCB 2KYZA 3AJ2A 3GCWP 4FPRA 3UFCX 3FFIB 2RU3A 3DOMA 1U09A 4I64A 4ZOSA 1LOUA 4NA1A 2EFNA 3B4DA 1RTDB 3MUTP 2W24A 2B3TB 4CQ1A 3MDFA 2LYVA 3AXKA 3LF0A 3J7YI 2QYCA 1LWEA 5JUMA 3MOJB 2PEBA 2DRDA 4HDGA 2W4CA 3SCLE 1U6FA 2XLIA 2ACYA 5DDOC 2AP6A 5IC4B 4JV0A 1S49A 4J9NA 4ID5B 3GSIA 2DNMA 1NZ8A 2E1AA 2VFVA 2GQQA 2H4WB 4FYVB 4AT1B 3Q2SC 1Q7LB 3PG9A 4C3LA 2XGPA 1KNZA 3IN5A 4C6AA 3GFHA 2QMWA 2FGOA 2OD4A 2DKOB 2H65B 4P72A 4C7QA 3Q24A 3G71S 2BV3A 1X4AA 2GVDB 3HFZB 4HR2A 1WORA 2IIHA 3MTKA 4LVNP 4CM0A 5HO4A 1IBLJ 1CJVA 2KYXA 4W98A 4DSKA 3EXCX 4OZNA 3GMGA 2N82B 4DDFA 4QWBA 1U45A 5HLFA 3BSCA 1XERA 2IM1A 2EG1A 1GTHA 3Q8UA 2LDYA 1VQKS 2RILA 3FBFA 2BW7A 4G1QB 2K06A 4LBHA 2XM3A 1RWMB 3ENWA 3DGPA 1VQOS 1YTYA 2QLBB 5KFFA 4K4WA 1H74A 2ZKUA 1C1BB 3T9NA 3MR2A 3I5BA 1HPZB 2DNGA 5KG4A 4MT1A 3ITHB 4JI8F 3OL8A 1I6JA 2JC0A 2I5JA 4ZN3A 3NOCA 1C4AA 1X5SA 2GW8A 2MLXA 1DTTA 2GIRA 2XYPB 3MM5B 2R8JA 3RR8A 1IKXB 3PO5A 2KFYA 3HCXA 3SYZA 2OPPA 4TYBA 2EPIA 5FLXU 4AE5A 5KFRA 3D54A 2K8GA 1LW0B 3MMBA 4J9KA 5G0RB 5F3ZA 1Y3KA 2OAUA 3HHKA 2ZH5A 5EWFA 3AD9C 2HNYB 2QMUB 4DV4F 2Y1JA 1Q4RA 4KSEB 4LREA 3MURP 3G9CA 4QU6A 1VJWA 5E41A 2R42A 3M6VA 1EAYC 1SC1B 3C6TA 3BZQA 3Q8SB 2OKQA 3IBCB 4ZIVA 4DL2A 3TZXA 4ZS6A 2DIUA 1GMWA 3HT0A 1ACMB 4ECSA 2M4MA 1HMVA 2XMWA 3OFEA 4UF4A 1RJJA 1PJ6A 1J2VA 1RT4B 1T9YA 2B8QA 3C15B 3DN9A 3MAQA 2ZH8A 1RBAA 2ZOGA 1RTJB 3NMRA 2KM8C 4X65F 5L38A 2E5IA 1FK9B 4B08A 2V5HG 4NLSA 4DL3A 2OPRA 5CXTA 2ZZMA 2E5GA 3LTOA 4PXDA 4UQTA 3V5RA 1FRLA 1FWLA 3HSDA 3BBCA 2HG4A 5HVFA 5C42A 1VC0A 4ZVUB 4DR4J 1FD2A 1RA7A 3I96A 3S01A 5MAOA 3PKYA 1U0HA 1UVJA 2YKNB 5T7LA 4RWXA 5CQGA 1R0BG 3W62A 4BLGA 1KONA 4C11B 3B82A 3BSOA 4B3OB 3EZOA 2BR0A 3UR0A 2IRXA 4DL5A 1S99A 2JSXA 4TYAA 5GAHI 5KFCA 4FVMA 4X4QA 3UD5A 4K4VA 2ZM6J 2MLZA 3OLAA 2PEHA 2KXHA 2LQ9A 3CSKA 4TXSA 2FYXA 5BYQA 5IS2A 2FJWA 3J81U 4C8NA 3M2VA 2V50A 1RI7A 4RW9A 2NUUG 4CLWA 4WKRA 4MKAA 1QJHA 4MIAA 3L7OA 4DXLA 2CVEA 4NLPA 5LSRA 2MKKA 4JV2A 1NH8A 3VQSA 3EX7B 2CQIA 2Y9HA 2ZC3A 2HKEA 3QO9A 1W25A 3MPWA 4KH0B 5L9XA 5KG5A 4XO0A 3G8TA 3CPWR 3OSPA 3A8IA 3W65A 3UWTA 5L1LA 3LA0A 3IRWP 2OPQA 5DM7Q 3ZFVA 4DV1F 3CJRA 5JMNA 3I4HX 2I6WA 2CPDA 2QEXS 3N6MA 3PXGa 4CT9A 2HZVA 1UJ4A 4IOBA 3RUBL 3NRBA 5IT9U 2QA4G 1RAFB 3M8YA 4WXWA 3CF5Q 4EBEA 3BYPA 4QIFA 5ETRA 1QLNA 4DUZJ 1ZM4A 5EX3A 4JI0J 3OUYB 3VAKA 1HR0F 2V6AA 3NKYA 1RTHB 1CJKB 2XB2D 1CLFA 4WKYA 1Y5IB 3RYLA 3CC4S 2XG8A 2HQDA 5KFXA 3GIKA 1S48A 3SMZA 2RHQB 4BWJA 1D9DA 1MNEA 4J37A 1C0UB 2M7SA 4DFPA 3FQKA 1TL3A 3P45B 2XY5A 5KFMA 2KJVA 1FX2A 1SIZA 4ETZA 1NK8A 3JTNA 2GHWA 1GT8A 3RBDA 3MD3A 2IJRA 3IR5B 2VIHA 2YKOA 3QSIA 2FQQB 2AJ4A 3HDSA 1HA1A 4F4ZA 1BD6A 2UU9F 1XBWA 1RWNB 1S1UA 2CNKB 1W2BR 3EM1A 1QAIA 2LA6A 1GEHA 3D1QA 1N34F 3WZ0A 2EFVA 2VFRA 3U1MA 1VQ7S 3DYAA 1R0AB 2VICA 1N0UA 5HANA 2Y1RI 2MGZB 1OYEA 2AQ4A 1YX2A 2V69A 2FY8A 2E9TA 3ZC4A 4NCBA 4RNHA 4DCPB 4FXVA 2H5IB 1Q86T 5IQ6A 2WSCC 4TLRA 2BE2B 2R8KA 1ZA2B 4NWBA 3R3TA 3T6JA 3F73A 1SKSA 2GJFA 1BQMB 2W2MP 3MHYA 4PABA 5KG3A 2ZUGA 4ZIWA 4EI2A 3ZTRA 1T9VA 1NM2A 3HVTA 5LSOA 3BO3A 2MQLA 1QE1B 1UVLA 2GO8A 1UJ5A 2CKWA 1I51B 4WTYA 3D6HB 3QLHA 1SIWB 2RAQA 5IV3A 2LEPA 4FNHA 2NREA 2AU0A 1ZPVA 4NCAA 3M30A 1OY8A 3T5HA 1T9UA 2Q6CA 4U67Q 3KK2A 4J9RA 4DL0C 1APSA 2XNRA 5E2QA 4J90A 2V4RA 2XY6A 1U4BA 2VQFJ 4DR7J 2XMVA 4WWSA 1NK4A 1K8AT 4X4OA 1J5EF 5F3TA 3PZPA 4F25A 1WD6A 3KDOA 2VUGA 2AYGA 2DHAA 2DNKA 2U1AA 4ECZA 2HHXA 2QA1A 1Q53A 1HW8A 1WSVA 3HHDA 3V2UC 4YB6A 1WG4A 1AA1B 3HO1A 1TKXA 1IUJA 2XSJB 3PYFA 1LXNA 4A8FA 1HLWA 2HQIA 2OGUA 4TLQA 3DRRA 4F7VA 3CJ5A 1KDNA 3FBBA 1MLAA 4K59A 3GG0A 3DM2A 3LALA 2XY7A 1K9MT 2BKOA 4KO0A 4CH1A 1H2UX 4LT6A 3TOQA 3NLCA 4FDFA 2D1CA 3W64A 1UA1A 1NJYA 1X9MA 1TAUA 1QE1A 3UR3C 3VAFA 1F2HA 1C0TB 1YJRA 2GFFA 3DLEB 3NGSA 3V6DB 4DCJB 4BS2A 2BBEA 2NYHA 4KY3A 4TQRA 2DTJA 4M5MA 4GC7A 3B6BA 4KGXB 3PVXA 1FXDA 1UEUA 2FTRA 3TR5A 4IG0B 3J81Y 3OW2R 3GIJA 1WNEA 3FCWA 1RYRA 1FTCA 2B4PA 2MMYA 3CJQA 3DI6B 5L8RC 3LP2A 3WHIA 1MWZA 3KLEA 2R9LA 4A8QA 4F26A 4YB1P 1WTFA 4K7QA 2XLJA 2DR8A 2ABYA 2VG5B 4Y2CA 1RQ0A 1FHTA 2VJUA 3OPKA 2HQCA 3QIDA 4F4XA 2ZEJA 2XZDB 1LWXA 1BE4A 4MJKA 2V8VA 5KFZA 1FVQA 3CCQS 4H4OA 1C1CB 4QYZK 1HHTP 1ZPWX 1NJXA 4TVAB 5J1PA 4WFBQ 4HTJA 3V4IB 1RAIB 3Q8PB 2R2SA 2WBRA 4JI8J 2H3EB 2F9DA 2HHWA 2J6TA 5GVQA 2C3PA 3MECA 1U2CA 1V5IB 1VI7A 2JFDA 3QGIA 4KQZA 5A6PA 5J2QB 1YBTA 3VZIA 5J2QA 4DR1J 3JTPA 4IH7A 2YKQA 2ZBQA 3D6MB 4ZN1A 4PG5A 3SV3A 1JNRB 4ZA1A 4CO2A 1FD8A 4MTPA 3UW1A 1YSJA 2ZKTA 3QGHA 4USMA 2YNGB 4N8OA 1FJEB 3OXLA 1G2EA 1OWXA 5E3QA 4WZMA 4LQ9A 3G6XA 4DG1B 2CQBA 5EX0A 1NUEA 3R2DJ 2UV8G 2CPJA 3NG8A 2EFGA 3PDNA 4ERDA 4M5LA 4ZHRA 1X4FA 4ZVRB 4ZPAA 3MUMP 4NXMJ 1IKWB 1DAXA 4KKOA 4Q2LA 2HGNA 2CQ2A 3T41A 3MCNA 5SUHA 1EQMA 3CCJS 4JI0F 2HPUA 4ZMMA 4K4TA 4L74A 4QCLA 4AUKA 5C25A 2DGWA 2SXLA 3JS9A 3JXOA 1JWWA 3A3NB 4IG0A 2DBBA 4DR7F 2OEJA 2FVSA 4GKKJ 2FGCA 3MR3A 2NZCA 2Q3PA 3BN7A 3FZ2A 4GO5X 5DDQC 5CCMA 3CCSS 1TL7A 1XJWB 1BY9A 2MQNA 3QQCD 2FD2A 4NASA 4PG4A 4O3PA 5F8GA 1QD1A 3FBCA 4Z2XA 2ADBA 3PJXA 3C16A 1C0TA 5CA5A 2F9JA 2UUTA 1KC8T 3CWJA 3CVKA 4M8LA 4DV2F 2HHTA 2F5GA 1ZS6A 4DUYJ 5B09A 1NKEA 4KB7A 2MDAA 4ZVOB 3DM2B 3W9IA 5L39A 3PIPQ 2E5LJ 4V1Ak 5J2NB 1N0VC 2QX0A 5M2UA 3CJ0A 3UVJA 4URQU 4PG8A 1FWPA 5F8MA 2FHMA 3DLJA 2A2DA 3AOCA 2K7JA 5A2QU 4DPYA 1Q8BA 2GIQA 4HACB 1PJ5A 4GO7X 3HHEA 3KUHA 1HWIA 2XYGB 3MM9A 4G1IA 5E3PA 1NO8A 3BV8A 3PX4A 1U0HB 3TVYA 3LW5C 3ONQA 5BXIA 2ZBCA 2EBEA 2OO4A 4FYXB 2WBMA 3OQ2A 3S7RA 3FJ2A 2KVQE 3DGVA 1H98A 5H9EK 2MTLA 2RUGA 3NGTA 4IDKA 2UXCF 3VF0B 3D0IE 3ZZPA 1S1XB 1RBLA 1P9YA 1WELA 1WEZA 4OX8A 1NK7A 2EKNA 3BM7A 1VQ5S 3M8ZA 4FF4A 1O5JA 3LPEA 2QG9B 3D1HA 3MEEA 3QLHB 4N47A 3G4SS 2OTLS 1HNWJ 2EFPA 1SUQA 3H2LA 1H73A 2MSTA 2OD6A 2VBYA 3P5BP 3LH2S 5A6WA 1T95A 5A0YA 4Y34A 1XC9A 1RAOA 3BH7B 3AODA 2XMTA 3I5CA 5F0UA 4EWTA 4J9PA 4X64F 2HFNA 4JBCA 3EWGA 5KTQA 2VPWB 1F60B 1PYTA 3MUVP 1N48A 1NHUA 1SBRA 2KDOA 2B43A 3D67A 1LWFB 3GU0A 4LSLB 4ED4A 5CCLA 1X4CA 1N5YA 2NSCA 2PN6A 2AJ0A 2DY9A 2FHJA 4DR5J 4YOEA 1WACA 2WB1D 4PWDA 4CCHA 2NXUA 3IS9A 2M0GB 4AYBD 1HNWF 1PG5B 1REVB 5KFDA 3KMSA 3ITHA 2RUSA 4ZCLA 3LQVA 3BR9A 4CWBA 3RAQA 2XI2A 1C1BA 4X62F 2R2UA 2FZGB 1YJ9S 4MFBA 5ETTA 3ENAA 2N4DA 2CJAA 3FSYA 3GLJA 4DU8A 3RW6A 5A8KB 2CNOB 2ZDOA 3FVYA 1SL2A 4NOHA 5EDWA 3GQCA 1YHQS 2DJWA 3I0RB 3I0SB 4FYWB 4G6VB 3CJ8A 1CJVB 3FKBA 3N5FA 1TL3B 4ANEA 2GMHA 1D09B 1FDAA 5DG9A 4ECUA 3MM8A 2VD3A 1OSDA 1QY7A 2CQHA 2O01C 2XWYA 3JSRA 2ZHAA 1NKCA 1W26A 5D0GA 2QLWA 4O3QA 4DV7F 3FGVA 1RUSA 3QJPA 3JQKA 3RGIA 5A8WB 1F5CA 3DOLA 5ETLA 2MXYA 2CRLA 4I0WA 1TK5A 3OTOJ 2JOQA 4HTIA 5A8WA 2FVQA 1RTIB 2JDJA 1WC3A 1LV5A 3G2XA 1FX4A 3X3UA 2DHGA 1MMLA 3IR6B 4OYXA 5ADZA 4ZJQA 2D69A 4IG3B 2R8IA 4WK1A 3CCRS 1D9FA 2HLUA 5ITHA 5DDRC 4RZRA 1Q7YT 3K8VA 5FDLB 1RP5A 5LJ3Y 5D4PA 2CQ1A 1CJUB 4P2SA 4J9LA 3ZXWA 3DOMB 2N7CA 2EK6A 3BGFA 3DLGA 2RH3A 4MAKA 5J1EA 3HLUA 3K2YA 3RU0A 1D9AA 1YI2S 2V94A 1NK5A 2IC3B 4Q7AA 2AJ1A 5CYQB 4A48A 4BBYA 1U6BA 1YBAA 2DNHA 4USUA 5ETSA 1XMQF 2BYCA 3QRPA 1M1HA 1REVA 3DLLQ 1WHXA 1RT1A 3TEGA 3TJAA 2J76E 3LAKA 5F41A 2ZH4A 2XEXA 2RS2A 2VA3A 2NYIA 1Z4UA 2R4FA 1Y5LB 4LIRA 4CO1A 2GCFA 1NB2A 2CAJA 1J27A 1GXUA 2FHOB 3QGGA 5KFBA 1K1SA 3TAPA 3THVA 2IBKA 2C2EA 2YNFB 4LSLA 1L3UA 4IRCA 4PQUA 1I1GA 1HD0A 1WHWA 4CNYA 3POTB 2MJUA 4DR4F 2CFXA 1IWGA 5CYMB 2B7BB 4ED1A 2CUYA 4GRSA 4UT4A 4YR3A 2F4FA 4OLPA 3KJVA 1T9TA 3T5LA 3M8WA 3HF5A 3WX8A 3OVSA 4WIQA 5F8IA 2IRUA 1YJWS 4A4JA 5B0BA 3EPIA 2ZBRA 4IDKB 4OX9J 5KOXA 1D8ZA 1EX8A 4X4VA 1RT2A 1F6TA 5LMNF 2VH7A 5FD1A 3JSMB 1N36F 1RAGB 1JKHB 3NS5A 3V4MA 5D4NA 4LUBA 4DFJA 4JI2F 1Q81T 2M5YA 4ILRA 4LR9A 4H4KC 1CC8A 1RHRB 1VISA 1AROP 3NAIA 1SC6A 3THTA 1UCNA 1VQLS 2IVMA 4ED2A 1U1PA 2V68A 4E2FB 1GX5A 2GQCA 4M5KA 1UZDA 4A8XA 4IH5A 2C2RA 3HMJG 5D0EA 3SEOA 4CDIA 7FD1A 1AFJA 1IKVA 4RUHA 3BKUA 5M2PA 1SB6A 2HRTA 3MMBB 2YWWA 3W60A 5IWAJ 2LVWA 3CC7S 1S77D 2FC8A 2VL1A 4KT0C 4OYWA 1I5OB 1YRTA 3T6BA 3ZZTA 4X84A 4NLYA 1F5BA 2RRNA 2NUHA 2I2YA 1T3OA 5KFEA 3BS9A 3L09A 4DF4A 2QLJB 2Z2LA 1SJQA 2HMIB 2PI5A 4PYAA 4RUBA 1W2IA 3L95X 2UXCJ 3U7JA 2UUAF 2CADA 3ZTSA 2DXDA 1RHUB 3FC9A 3RBXA 2JEGA 2Z4PA 1D8YA 3W1YC 3AB2B 3K5PA 4DN9A 1BQNB 1RWPB 3DDNA 4P7TA 3RBZA 3TO8A 1CPZA 1WHVA 1EP4A 1PBAA 4Q45A 1U26A 1HI8A 1BUXA 2IFXA 1S57A 1U24A 1BWVA 2OP5A 4I2PA 4X64J 4WBFA 2BA9A 4OZ0A 5KG1A 3D0GE 3T1AA 3VAIA 4DG1A 3R5BA 2CZVC 4DL7A 2XQCA 1X9SA 2B5JB 1A9NB 4MKBA 1KTVA 5HI7A 3V6HA 3UNYA 1KQSR 5AJ3F 2BQRA 3ZNJ1 4DV1J 3KJQB 1LWEB 3OXGA 4WYWA 4F2RA 2VFTA 4QOTA 2LU1A 2Z2ZA 3ADAC 2PA3A 2EG2A 3I9V9 1VLOA 3FFIA 1IM6A 1RAEB 1OPZA 3EGVA 1OYDA 4QR1A 1NK6A 2HEKA 2U2FA 3W9JA 3V4IA 2BQ3A 1JLBA 1KFSA 2YXLA 4B9SA 4H4OB 4USVA 2AV5A 1TR0A 4XDCA 4DSFA 3M1VB 2L9WA 1S72S 1X4EA 2HS4A 4J9QA 1NDPA 4Y28C 2E1RA 2CG8A 3DOKA 4O3SA 2AD9A 5CZXA 4IRDA 1HYSB 1HL6A 3DI6A 5I3PA 1BQXA 5KT2A 4HL9A 2KJWA 3NS6A 1VQNS 4KTQA 4L3NA 1Q78A 4RW6A 1HARA 4I6YA 4L75A 1RAAB 4ANCA 2BQUA 1S76D 4OZ5A 4JP8A 4KAIA 1JLEB 3KLIA 2YH0A 2DVIA 1P1TA 1RCXB 5DQHA 3PEJA 3ET6A 4USKA 5FDLA 4DQSA 3HHLB 2WSEC 4ZLPA 3KK3B 4M1KA 1JIHA 4FBUA 1U1QA 4WE1A 2DNNA 4CLLA 4X4PA 3MMCA 3A3OB 1S0VA 4DLEA 4Y2AA 4KIAA 2EVZA 4WYLA 3EXYA 2HFSA 4L76A 2CQGA 3HP6A 2BX6A 3HI9A 1U02A 2RRAA 3JSYA 2ZZNA 2DR6A 2ZJQQ 4B3SF 1IJEB 3CCVS 1GH8A 1S1VA 1MG7A 2DGUA 3LP1A 3MEDA 2Y8WA 3N79A 2O67A 4CTAA 4Q2MA 1PC5A 2YKMB 3MD1A 2AJFE 3U1NA 4LF7J 2HNZB 1LKZA 4WFYA 3AA8A 2C28A 2FJEB 3OR1B 5KFKA 4R5PB 4OYIA 1XIQA 2IAJB 3Q0AA 1PC4A 2AX1A 1ZTTA 2DK2A 2QV6A 2EEYA 4KR0B 2GMLA 5DJBA 4OYOA 3KNAA 1FJ7A 3OVAA 1FVSA 2RDIA 4BDPA 4C8OA 1UVIA 5B0CA 2W7PA 2IDEA 3QMQA 2W2NP 4IRKA 2KTQA 2IJFA 3PYGA 1Q5YA 3ZTOA 1MSWD 3DRPB 4DR6F 1OS5A 4TU8A 3SQOP 1FDBA 2QMXA 2BANA 1Q16B 1E6YB 3EGZA 2P9GA 1PJ7A 1LWFA 2AEJA 4N41A 3J7Z5 3TAQA 1VQ9S 4KJIA 2ZNZA 1AXQA 1TV6B 4M5GA 4HDHA 1K1QA 3VCDA 2W9BA 4ECVA 1MN7A 2HBYB 1FESA 5L46A 2FVRA 2LDIA 3A12A 4K4ZA 5DRKA 4HHHA 1RZMA 2DGTA 4ECXA 1TVRB 2XLKA 1WOSA 1OQ6A 2MGZA 3R5JB 1SUQB 3DRPA 1QSSA 4LF4J 1PKUA 1N32J 3H42A 2V4JB 3NGUA 2HBRB 1UEKA 3RRKA 2Y1IA 1JLGA 3CTRA 4ES1A 3T1YJ 2ZE2A 3SFUA 2RB7A 4KV8A 4F3OA 1XTZA 1UVNA 2GAGC 4Q44A 1KLNA 1PAEX 2V2ZA 1TL5A 3P8BB 5D0RA 3ICLA 3O8WA 3B54A 4TNOA 3SIPB 3N01A 2ZD1B 2H54B 2X1GA 3AQPA 3ISNC 3IA0A 2ROEA 1KD1T 4C9DA 2YQ0A 3NNAA 2C42A 4R25A 5E33A 2HVZA 3THPA 3UN5A 3I87A 1LW2B 4I7FB 3AA9A 4P9SA 4Y3CA 2YWFA 2O1PA 4I67A 5DETA 5DDPC 1TK8A 1KTQA 2EBGA 2HAIA 4RBUA 1LNQA 3Q23A 4JV5J 3OTOF 4L73A 2QT7A 2YNIB 3UVJB 4QYRA 1UZHA 2CPXA 2R2TA 2N3OA 5HVGA 3R5CA 1GTEA 1M5HA 5KT5A 4LF7F 1Q0NA 1IXKA 2L48A 2MZTA 3P4UB 4LRBA 3C46A 4JI3J 4PUOA 3QIPA 2BJ8A 3CJ3A 2J0SD 3MMCB 1BGXT 2CPIA 2VQEF 4WE1B 1EZZB 4O44A 4D3GA 4AQYF 4Q0BB 3GJQB 2JWNA 1YKWA 2ZJPQ 1RT5A 4YY3F 4JI6J 3CO0P 4M5IA 1OIAA 3EDRB 1R89A 3OTCA 4LRCA 4F04B 4Z37A 1HWKA 4DPOA 2UP1A 3UDCA 2KVIA 2XZWA 2B4OA 5C25B 2DYAA 2JRSA 1TK0A 1AB8A 2V8GA 1U0SA 1Z2LA 2BE9B 4NE9C 2CQPA 2KKHA 1IKWA 1FNMA 1AUDA 4PXCA 1IBLF 1U8SA 1PIEA 1HBMB 4XK8C 4ID8A 2QA2A 3A13A 1B4SA 3N5BA 4JV5F 2W9CB 5CYJA 2J9EA 3QIPB 2H4YB 4CYUB 3QRRA 1Y10A 1SJRA 4GMKA 2DNYA 5AE2A 1JLBB 1TL4A 2L08A 4JI4J 1HQ2A 3VR1A 2BVZA 4B9VA 3A8EA 2FLNA 1YZ6A 2VBXA 3MMJA 3K58A 3TQ1A 1S6OA 3NNCA 4DV3F 2VKZG 4KHRA 1ZAXA 2ZBPA 1X4HA 2J9DA 4NRTA 4OQJA 3CUNA 3DC2A 5LMUJ 1QDUB 3CW2C 1X5TA 4OI1A 2IVFB 1DLOA 3D7SB 1HQUB 2PMWA 1DHMA 1OJ4A 2RT3A 2M70A 3NBPB 4UTGA 3M8SA 2QE5A 1JQGA 1YJVA 2VPZB 3KJFB 2NQPA 5D4LA 5HJYA 2VBWA 4ZJLA 4DV0F 4RNMA 3UI3A 1JLGB 2W8KA 5K20B 2J0WA 3Q89A 2AEMA 2PMHA 2F8MA 4I2PB 2MEWA 4OYMA 1RT4A 5E3RA 3Q83A 1OQ3A 1P6TA 1JMTA 3CJTA 4KH1B 3RAMA 4CP5A 1BQNA 5IZHA 3KLEB 4DR3J 2JVOA 3PY8A 4QYZJ 1XN9A 2XBPA 4OV1A 4DR3F 2XO6A 5H9EJ 1UFLA 2O5DA 4YUDA 1NJZA 2UVUA 1RWVB 3BKFA 3CJSA 4NLOA 1XMBA 2AIRB 1CS4B 2YWEA 3FQLA 1UW4A 4OYPA 4OL8A 4X4UA 5T41A 4LFBF 2ZH1A 2W7OA 3EZUA 1EHWA 3NCRA 1IBCB 4QW9A 1HBOA 2AX0A 2D74B 2OPPB 3QFHA 1R27B 1RHQB 3T9ZA 2COLA 4RW7A 3WQPA 5DS7A 5F9LA 4P7VA 3D6FB 4KO0B 3BEGB 3HZEA 3H25A 4AL5A 3H7HB 2ZNYA 3CT9A 3HXMA 2BRKA 1VC5A 3DRRB 3HJFA 2FPHX 5FIIA 3DHWC 2J8SA 1R0CB 2FJDB 4ZPBA 5D6GA 4P75A 1WC1A 2XHCA 4A8OA 1JXLA 3X1LB 1G1XA 3C6UA 3EMTA 2CZ4A 4DQQA 4X66F 4EU0A 2HVDA 2N7YA 2KG0A 5D3GB 1TZ0A 3E8OA 4DR5F 5IM0A 4TQSA 2J5AA 2MJNA 2POKA 1T94A 1FKAF 2C2DA 4KC5A 2OMOA 2C1EB 5RUBA 2YKMA 4EEYA 4YDXA 1YJNS 3MEDB 4RW4A 5DLFA 3JSMA 5EHHA 4DSIA 3IXQA 1R3NA 4DPXA 3SXLA 1SQGA 3IGVA 2CPEA 3LOUA 4NYPA 2WW8A 3RTVA 2BDPA 4ECYA 1CSJA 1H7WA 1NBEB 1NRKA 2CXEA 3R1HA 2V2VA 4JI7F 4ID5A 4K8RA 1LQ9A 4JV1A 3TX0A 4OX9F 1L3TA 4F4KA 3KJVB 1NCLA 1N5TA 2IRYA 2ALYB 2V8PA 5C2GA 4NPOA 1JXVA 3CCMS 2V8HA 4RW8B 1FJGF 3BREA 3KLGB 2QC3A 3H40A 1RTDA 1BQMA 1UEVA 4K0KJ 5CYMA 2IHR1 4WU3A 1K0VA 2WVFA 4JB8B 2BW2A 3CJKA 4RU9A 2DRAA 3POTA 2W4PA 3KKFA 3PEHA 1BHNA 4NI2B 2QZ8A 4I4BA 3US5A 4ED5A 4BWMA 1ZTWA 2XMJA 2KT2A 1UA0A 5K14A 1OPIA 3TJ8A 2MZJA 3UD4P 1L5UA 2IYIA 1RWUA 1TMMA 1WDTA 3JQJA 1X4GA 2V2QA 1NKBA 3TUPA 3VZHA 2F4VF 3PJWA 2LQ8A 3VQTA 1U1MA 2P6TA 1SC4B 2DR9A 1YK9A 2Z8QA 2YQ1A 3H8YA 1YJTA 4CLKA 4AL6A 2Z2YB 1S1UB 5CYQA 2I9SA 5GAGI 5KFQA 5KFOA 3CCUS 4IOCQ 1N8RT 3LANA 4XPCA 4DV3J 2ZH2A 4J9UE 4F4YA 2WAQD 3OL9A 2FIUA 1X8DA 2JLEA 3P96A 4OMFG 1DTQA 4RLEA 3MI7X 3W5YA 2YVSA 4E8UA 5BR8F 1CJTB 1GMUA 2DR5A 3OVBA 1GMWD 2GS8A 4ER8A 5IT9Y 3AT1B 2HQFA 4GKJJ 4F0HA 1FI4A 4IG3A 4USHA 3WDOA 2VBZA 3KG1A 5CD4A 4YHHJ 3PKMA 1S1WB 4RNFA 2QTWA 3AOBA 3LGMA 3C3LA 1LXJA 3GJSB 5HMXA 2D41A 1RTHA 4NXMF 1A6LA 1NNDA 2K2PA 1LWCA 2GC8A 4PXBA 2UV8A 3UD3P 2ROPA 1KN6A 2HWTA 2ZUAA 4M95A 1NZAA 1EP4B 1URRA 4USWA 2NXEA 3W8GA 4ANDA 2EFOA 1VHIA 4B3TF 2GGPB 4P74A 1K47A 3UO0A 1UTAA 3I0RA 1L3KA 1M5SA 2MY8A 3MM6B 2HURA 3SCKE 1VS3A 1BLUA 3KUGA 4CT8A 4S0MA 4UZCA 1TKTB 1M5KC 5DLGA 1F9HA 4J9SA 4DR1F 2HVHA 3W66A 2APOA 1IR2A 2R7XA 1X31C 4MFBB 3M32B 2PMZD 2ROGA 4M94A 1VRTB 5F8HA 2XMMA 2ZWPA 2RDJA 5EUHA 1FKOB 2EW9A 2C2NA 1VQ6S 4QQBA 2B4UA 4FF2A 3M6XA 3PACA 3KLFB 3T19A 3BGLA 3M2VB 3SV4A 4NYZA 3PYEA 5D15A 2VFUA 3ZZZA 2X1FA 2E5LF 4LFBJ 4G65A 4FKXA 2FC9A 4ZVEA 3H5UA 1X5PA 3R5GA 4YP3A 1FXLA 3EE3A 1DARA 1N5YB 3TJ9A 5CAAA 3NXZA 1HBUB 2YX4A 3RR7A 2DHXA 4YB5A 4IR9A 4DJBA 3MPDA 2HFVA 4LBIA 4KGMA 5U47A 3EICA 2BMBA 2KG1A 2HHHJ 2DGQA 5F0WA 1F3FA 4Y65A 3H2VE 3ILJA 5L1KA 4A8WA 3OLBA 2LKZA 4U6PA 2KZZA 4B9NA 2WW4A 4HH1A 2FVPA 4AFFA 5HL7Q 1BWEA 4AD6A 3HFVA 4OX6A 1JKHA 3PTWA 4ZP6A 3G96A 2W9AA 2UVRA 3UDEA 5K8MA 4N56A 3HHLD 5HBMB 4M5DB 4JI7J 2FVCA 4UUXA 1FK9A 2OI2A 3OT9A 4OFZA 4QBUA 4LF6F 4O3NA 4M5DA 1FFGB 5KFVA 2F8EX 1RAHB 2LXIA 2Z56B 3H20A 4FP9A 4DV5J 5D8HB 5HJXA 3TX8A 2CYYA 3HSJA 3J81j 4F0KA 1XQIA 4OHZA 1S6PB 2K1RB 1N88A 1YDLA 4N7TA 3SCJE 5C7PA 1Y7PA 4KRWA 1VBXA 3HHNB 4N8NA 1TKDA 4LFCF 4NRUA 3W5XA 3TVZA 3R1LA 4C8KA 3AB4B 3QWPA 4RU2A 1IKYA 4JI4F 3BN4A 3M8PA 4F36A 2M88A 2Y1LB 2KU7A 2CPZA 4GVLA 4IFVB 5G0RA 4DX5A 4LSZB 4Y6IA 2LECA 1VQMS 1XNQF 1FRKA 1HNXF 4NZ7A 1RHKB 3Q8RB 2MSSA 2MKHA 2A6MA 3C2PA 2CQ3A 1DTTB 4B9MA 2YH1A 1FKOA 3EGWB 4IUFA 1V5VA 2G1HA 4QWAA 4RJVA 1NDKA 2CJBA 2JJ4D 4BCAA 2E5JA 3AOAA 3D0HE 2MLYA 3MWBA 3W3SA 3DGPB 2IM0A 3CXCR 3IBWA 5FLXY 2EKYA 2LP4A 4ZLLA 1RWWB 2BOPA 2DRBA 4JYAJ 1MWYA 4WP9A 1H38A 1ULRA 4HLBA 1U48A 2B51A 4WP8A 1NHKL 1P1LA 1PSDA 2BKPA 2UVWA 2QJ3A 4MK9A 3I9ZA 4E98A 1XMOJ 3WC2A 4B3RF 4V19J 1HW9A 3NEKA 2R7VA 4DS5A 3OSNA 2GVDA 2JVRA 3LGHA 1NSQA 4DV6F 1ZZNA 2E9ZA 4GKKF 5B0FA 1FEHA 5HMYA 1J5OA 3L7UA 4GVBB 4LF2A 5KOWA 4UZBA 3G8SA 4JI3F 5HAOA 1RISA 1RTIA 1FNXH 1WC4A 1ROFA 2YNHB 2MKSA 3PX0A 1R6YA 2OLWA 2JC1A 3V6KA 1AFIA 1SQEA 4FF1A 2W7AA 3GFXA 2C3UA 1SPBP 5A2QY 1X7VA 1J5OB 3QAUA 2RRBA 4DUYF 3MM8B 5T14A 1D1UA 1KQGB 4XTTA 4ZCIA 2ZHBA 4X4RA 1KQFB 3CCTA 3MECB 4LR7A 4OHVA 3SSRA 1CJTA 2ZWOA 2VC0A 4FN5A 4D3HA 3LWLA 2VFSA 1NDLA 3CCLS 2UXDJ 2G4BA 3K7RA 2DXEA 3C14B 4O23A 1SJ1A 2R7RA 1N6QB 1RDRA 3GTYX 2G2YA 4ZVTB 5F8JA 4EGLA 1QSLA 1C1CA 2G0JA 2G0CA 1S1TA 3NAHA 2J0QD 2M8DB 5HSPA 2BM0A 1VQ8S 5A8RB 4NZ0A 3BR8A 1CULA 3MFHA 1YG0A 3GIRA 5H9FJ 1D0EA 3VGSA 1WOPA 2A2CA 2LA4A 1SI9A 5K5MA 4NLQA 1X5OA 5J2PB 3IS9B 3PIOQ 4HI1A 2VG5A 4WFNQ 3PW7A 1BMQB 1YQHA 2PGCA 3PRBA 1RT6A 5DGBA 3PR5B 4RKUC 3T5KA 3TI0A 3JQMA 2GJ2A 3CC2S 4A8SA 4W92B 2RKIA 3TA0A 3D9BA 3NP5A 3CMAS 1IR0A 1MROB 1R43A 1KQKA 2Z0GA 1VBZA 4EZ9A 4H4MB 3FSXA 3A3PB 2XC9A 2E1MC 2HIQA 2KT3A 2OEMA 4QR0A 2HS0A 4C2MA 4FKYA 3FRYA 3BGRA 2R7WA 5BYSA 4I2QB 1VRUA 4LRFA 4CLZA 5F9NA 1RT7B 2H9ZA 4DN0A 3QZ7A 4DLGA 1NK0A 4LF6J 2W4DA 2GNKA 2LXFA 2VASA 3TEHB 3MEEB 4WXOA 3HPOA 4P73A 1UW9A 4K0KF 2W2PP 4QIWD 2L41A 1S6QB 2M8HA 3G82B 4B3MJ 2DD8S 2G1DA 4QIGA 2LMIA 2HZCA 4CH0S 4ECTA 1S97A 4NLTA 4K50A 5HBMA 2OTJS 1TKXB 2XSJA 5EN1A 3EVOA 2I38A 3GZ7A 4W4MA 3OJSA 3GV8B 4K4YA 2F4VJ 4F4WA 5CZVA 3PO4A 1LFWA 3MM9B 4DPTA 1FE4A 4P2FA 4A8YA 3BPSP 4HACA 3IFEA 4NLDA 3CGIA 3G8QA 5KFWA 4F02A 1UP1A 5HP1B 4C48A 3KK2B 5A76A 4JUZA 2AHOB 4MKYA 4RUCA 2F8HA 2NLWA 4OZ3A 3GIIA 2D9OA 3BBBA 4RBVA 3GCXP 2UU9J 4Q5VA 4C8YA 3CIMA 2DH9A 1HQEB 2EWHA 4QZVB 3G86A 3BQ1A 4I56A 3WBZA 4IO1A 1HBOB 3IMQJ 4ZLJA 4K4UA 2DGSA 1U7LA 2CPYA 2HW3A 1WG1A 2CNNB 2XYHB 4ED6A 3ZTQA 1T0TV 1DURA 3EVWA 3R97A 2DO0A 4B3TJ 2BM1A 3DU5A 4NL5A 1KHWA 1K0TA 4HKQA 2A10A 2MY7A 1WG5A 3Q8QB 3MPVA 3V6JA 5CHCB 2FHJD 3OBIA 2H48B 4J91A 4WTOB 1IVZA 4EYHB 4KHMA 4ED0A 4WFXA 1DQ9A 4H4KA 5J2MB 5AXLA 1A0OB 4USJC 3NOGA 3TRGA 2Y8YA 2UZAA 4NCGB 3HVRA 2CWXA 3HVAA 2MHNA 1TFWA 3M4XA 1NH7A 3D5MA 4OZ2A 5LJ5Y 5C24B 3LO3A 1NJIT 2KT5A 2KM8B 2XZTB 2L9DA 2UXDF 3HT3A 1R8BA 2CPHA 1VR6A 1WKJA 3EGNA 1VIXA 1S6UA 4MKVA 5E7OB 2DEIA 3K5OA 4ZVQB 1I94F 2Q79A 5I4MA 3T1HJ 4ZPWR 2HMIA 2N3LA 2V8DA 1JJCB 5HQ8A 1DQAA 1SJ4P 4DQIA 4TU9A 4KYZA 4I69A 8AT1B 3CO9A 1Y3JA 3M2UA 3DNCA 4DX8H 1Z2ZA 3CMES 2FDNA 4X4TA 2V0NA 2RE1A 3IAM9 5HROB 4L6V3 4ILLA 3G6ES 1P27B 1S9GB 2RF2B 3J7YU 3M6WA 4FS2A 4UQGA 1M90T 2AWZA 3QPIA 4B3SJ 1Q1KA 4RL1A 1V3RA 5AXKA 5BYRA 3UE2A 2KFNA 4J9OA 3TA1A 1Y5NB 3QGPA 2Y3YA 1T11A 4ZPDA 3TZZA 2OUGA 3AJ1A 3ETOA 3SFGA 2ZC4A 3QNWB 1KKHA 1UWAA 5K14B 2UUCF 2JNJA 1OO0B 2X51A 3R7NB 5KG0A 1AYEA 4P71A 4DUZF 3R7SB 5ETOA 3UN3A 1MU2B 2BJEA 4U7UK 3R27A 3W2VB 3D3CJ 4X66J 4ALZA 2OPQB 1HHSA 3KG0A 4HT7A 2HRUA 1ITPA 4XIUA 2KHDA 4HHJA 2DR7A 4HI2A 2VF3A 5KG7A 3QO9B 4RW8A 2Z58B 4OYBA 1VQYA 2PFDA 2QYGA 4CLSA 4F2SA 4TU7A 2C3YA 4O44B 5KFTA 2NZ4A 4YR0A 2UXBJ 4OJ3A 3AY0A 1H0HB 1S0MA 4CO0A 2YWHA 2LEAA 1NSKL 5E5NA 3U27A 1URNA 2R7SA 4AXJA 1TU0B 5LL6d 4OI4A 2X1BA 3A8KA 3FEXB 4DPWA 2YNIA 3S8SA 1M5OC 2F63A 2XWXA 5ETKA 2HHVA 3D68A 3M6UA 1F0XA 2PIIA 2RQ4A 4PCQA 1E6VB 4NEZA 4ZVSB 2V63A 2YKPA 3N9UC 4P10A 1X9WA 4V19X 1LW2A 3CCWA 1R8CA 2KO1A 2QN6B 5LOQA 5T7LB 1B64A 3DCAA 3ILLA 2YKNA 3MF5A 4BC7A 2AW0A 1QUVA 4QIVA 4EFAC 5IM0B 1XMOF 5C42B 2P9EA 4ILMA 1HIYA 5LMNJ 3CB4A 1EKRA 1RU1A 3K8WA 5LM7E 3OV7A 3H4BA 1HKAA 5KFGA 4K4XA 1TL1A 4I6AA 1RYSA 3MGJA 3C6UB 4QR2A 3VAHA 2DNLA 1JK9B 2UUAJ 2YQ3A 4FPIA 4NLUA 3T1HF 4X4NA 1S5ZA 4B02A 1RTJA 2ZE2B 1VOMA 4OJ1A 1O6XA 3R8YA 5IT0A 2LQBA 2E1CA 5GAEI 2XMAA 4IR1A 5D78A 1QAXA 2R3VA 1HMVB 4XAKA 4RW7B 2ERRA 1U1KA 1KOOA 4DR2J 2NR0A 1T05B 2G9OA 1F2GA 1S59A 2OELA 1FKPB 5B0EA 5LSLA 4CM2A 4U9RA 1FJCA 2XMKA 4L3KA 2A6OA 2W9BB 4ZP8A 4DI6A 2BE2A 1QUPA 2VZ9A 5AXMA 3QJJA 2HNYA 2ZBIA 4B9TA 3GYXB 1F1BB 2OPSA 2WSFC 4K5RA 3W63A 5GAGU 1E6YA 4R0JA 5D3GA 1SCJB 5IFMA 4C8ZA 3FSIA 1T3NA 1NJWA 2YX1A 3HK2A 1NK9A 3I4PA 1RCOB 3GFZA 4ECRA 1ZH5A 3QT5A 4Q8EA 3DXBA 5ETVA 4J9MA 1VFJA 3ILIA 4PR6A 4C98A 2HFZA 2DY1A 1UPPA 2CWKA 2J7WA 4H54A 1UPMB 5IQQA 3AH6A 3KHGA 3I6PA 1RTZA 2QSFA 3F41A 5ETQA 1V6HA 1R7IA 3ISND 1HBNB 4PPZA 3MMAA 3GR1A 2IAJA 4FNIA 3BO2A 4KBIA 3ZZ0A 3NBPA 4Q43A 5HLFB 4ZPCA 1XNRF 2VU5A 2CQCA 2QFJA 3QT7A 1JJHA 4F67A 5AE3A 3P5TL 3VGTA 1RGVA 4DCOB 2EK1A 2HNDA 2DNOA 3DRSB 2MKJA 1WF0A 3WIVA 4YMEA 1S0OA 4DZDA 4E0DA 1S1VB 4TN2A 1I94J 2BUNA 5DM6Q 3H4DA 1S0NA 4WK3A 1KSPA 4RWWA 5H9FK 4DS4A 4HVZA 1PO6A 2VPXB 4PZVA 1WKLA 1IBMJ 3B4MA 1V9OA 2CZ9A 2Q43A 1IN0A 1N5QA 1RHMB 2CNLB 3MM7A 1FFWB 1F5AA 3QFWA 2J0XA 2DHHA 1DJ0A 3KLVA 1EETA 3CDAA 2EI5A 2PT0A 5B0AA 2BKNA 2KRBA 3DLKB 1ZM9A 3NGRA 2F65A 5BR8J 1HWJA 1N34J 2IYGA 3LAMA 1Q82T 1NAQA 2DPJA 1EIYB 4OI0A 2XS7A 4NZ6A 3AD8C 2JEIA 1JLEA 1M5VC 2K3IA 1TFYA 4UOCA 1HWLA 1AW0A 3OTBA 2D9PA 2QIFA 3W2VA 2PC6A 3EUNA 3CDUA 3GYGA 1KBRA 4RW6B 1H72C 3MAAA 4YB7A 3TAMB 6FDRA 2J7UA 1D3WA 3OHBA 3DOKB 3K5NA 4IO9Q 1GMVA 4N5SA 1FF2A 4CIOA 2KH9A 1JJ4A 4IQMA 3PFEA 5F8LA 2ZH9A 4WF9Q 1WHYA 1U2FA 3O44A 4NEYA 5GMKa 2NSBA 2NPFA 4U7UD 5KT4A 3BYRA 2XO7A 3PJ9A 2P5VA 3CD5A 4URSA 3H5YA 3K5MA 2PD1A 1YITS 4LMZA 3J80Y 3VGUA 1WJ9A 3E51A 2PA8D 4X2BA 2GVZA 4ZP7A 3AQOA 1XMQJ 2HGMA 2AGQA 3FUYA 3M2RB 1FJGJ 3G6VA 2HNDB 3DRSA 1OY9A 3KDNA 1T7PA 4O3RA 1UVMA 1VIOA 2R8GA 2EXUA 4ETXA 3BSNA 1U2RA 2P8IA 4FS1A 1JX4A 4LQ3A 2Y0BB 1Q95G 4WFZA 4FZVA 1S7HA 2ZD1A 1ZYQA 4CO5A 2B9WA 4MYUA 3K57A 1RLCL 3NCQA 4ZVGA 1RT3B 1PYSB 2GMJA 3H2UB 4KV8B 4P2XA 1YRUA 2DT9A 4C0OC 4CZCA 3TZYA 2BEFA 2P9CA 1CC7A 5DZ7A 1S7IA 5K9FA 3WX4A 3H5XA 3GFYA 3KUEA 1GXTA 4NCGA 3W9HA 1RWXB 4ENOA 5IT4A 4ICLB 1KRPA 3AFGA 1MWQA 2WONA 5K8OA 4R0EA 1LEOA 4Z7CA 3K59A 5FJ4A 3RZAA 1VLYA 4AL7A 2CPFA 2AKWB 2E5HA 1TVRA 3BSAA 3CD0A 1Q8KA 3CDWA 5B08A 2NXJA 3V81B 4N76A 1TKZA 4ZPVR 2VDHA 1HNXJ 2G2ZA 3FCHA 3RB6A 2UUBJ 4DOZA 3RBEA 4URGA 1XNQJ 4P52A 2B8PA 4RR5A 2DXFA 4Q8FA 3GILA 4F3QA 4CO4A 5D0HA 5AT1B 4B17A 2BANB 3TZWA 4O0NA 2HWHA 2DPIA 1NEEA 1RK8A 1DY3A 5AE1A 4CRJA 3J80U 3MXHP 3ISZA 3GJTB 4JYAF 2JH3A 1U25A 2DITA 3M8QA 1RKIA 4HEA9 4MYTA 4PKDB 4LVOP 1UJ6A 2E29A 1G4CA 2HFOA 3GG1A 1NU4A 1HNVA 3OTEA 1BXNA 1SH2A 2AF6A 1IKVB 1U1NA 4OYZA 5IC6B 4ZKAA 5JJBA 3JB9k 2V67A 2OMLA 4OX7A 2YWKA 2CVIA 2OFHX 3UCZP 4IQXA 2XCAA 2L3MA 3IGNA 4LJMA 2BJDA 4LRAA 3SSSA 4R5PA 3LWMA 1JJ2R 1IBKF 2KZMA 4JI5F 4I6WA 3OR1A 1WC0A 1V3ZA 1UKUA 2V34A 3KHHA 1A7GE 1IM4A 1VQSA 2IM3A 4A8KA 1E6VA 3KMQA 4FXWA 4Z7YA 3SQGB 2WOMA 3D4JA 1RT2B 1YVFA 5C2CA 3J7AN 4QPTA 2M3DA 1WUUA 4EZ6A 2E1PA 5L1IA 2DB1A 1Q8IA 5M2RA 3UPFA 4EBCA 4ZCMA 1S6QA 2ZVIA 4NMXA 2XCPA 1FXRA 2F7VA 2ZHOA 3H0PA 3BPDA 3FRZA 4ZVHA 2H5JB 4JOUA 3HX9A 4OI3A 3R6GB 1NMEB 4NMLA 4PWUA 2RQKA 4QWEA 2VHGA 3P6YC 1LFPA 3KK3A 1NXIA 5DO2A 3HHLA 5HN0A 1N52B 4AXIA 3OFHA 2IMOA 2KN4A 2YX7A 9RUBA 2GQ2A 3FBEA 2VG7B 3M9NB 3R6LB 4ATNA 2RJZA 3D6TB 1JLCA 2JZ5A 1RKJA 1NDCA 2RKIB 3WIUA 2C2KB 2HQGA 2WZ1A 2YY3A 5B7WA 1YJUA 3D3BJ 4M5NA 1F9EB 4RX6A 1JLQA 4EMDA 1B70B 1SKWA 1HYSA 1KVJA 1KLMA 3D2WA 2VONA 2RMLA 1KLMB 2C2MB 1CULB 4RO0A 2CJYB 2E7VA 2JFKA 1S9GA 2RF2A 1H2TZ 2BOAA 1SH3A 4I1TA 3VAGA 2CJXB 2CDQA 2JHEA 2VPYB 4EUVA 2AGPA 5GMDA 2HFUA 4QIEA 2BZ2A 3IG1B 3N28A 2OFGX 4LF1A 4EO8A 5EGYA 5J1EB 3KHLA 3RRGA 4O3OA 1N6QA 2DGXA 2BJ7A 2NPIA 1AZSA 2VG6B 3MEGB 3ENVA 1CJUA 5DG7A 3KWMA 2RQCA 2ASJA 4F4AA 5LT5A 3BJYA 1S79A 4FYYB 3M9OB 4GKJF 1Q8LA 3E01B 3CEDA 4DUTA 2CA9A 3O2IA 2HHSA 1U49A 4UY85 5GAEU 3CMQA 3KG4A 2B5JA 1PGZA 3UQSA 1QVFR 4NA3A 2FUG9 2M9KA 4PPDA 4DQRA 2RNEA 1FNOA 1AT1B 1XR5A 2YNHA 4UW2A 4EBDA 2LXUA 2VKRA 2ZOMA 3QYYA 3SI8A 2XULA 3IM9A 1VRQC 1R6VA 3DMJB 4GVBA 4O4GA 4LF5F 3I32A 2MKCA 1SL1A 4LF9J 3SQGA 2VB6A 4CLPA 3HKWA 2A3JA 3K17A 3MZIA 3P49B 1KP6A 4C0HA 4OHYA 4DV4J 3L9ZA 3I55S 3L3CA 3I0SA 4HT5A 3PV8A 5ETPA 2WTFA 4JI1F 3PYDA 4R8UA 2WVDA 2P2CB 2XTJP 3FK4A 5A8KA 3Q22A 2HSEB 1R8HA 3BF4A 1YIJS 4ECQA 5KFNA 3TUIC 3U02A 3PRDA 1B0VA 1N56A 4B3MF 3AJDA 4PRFA 2DEJA 3D1OA 2XMUA 4KGVB 4F8RA 1SVDA 1TUWA 3DDIA 3S1TA 3M8QB 1SXLA 2BXJA 3IR7B 2DNPA 2D3ZA 2DHSA 2ZITA 3MCOA 4USIA 2FLOA 2AYBA 3CE8A 2DCUB 3Q8VA 3IWXA 2I1RA 3VAMA 1SC3B 1CG2A 1MN9A 3TNVA 2HHHF 3GP9A 4GC6A 3E2EA 1GX6A 2WHOA 3HKZD 2B6AA 1IKYB 3A4TA 3M8PB 3N4WA 4ZITA 4RPFA 4DL4A 1SJ3P 4K4SA 1FRJA 1GQEA 1TMJA 3SDEA 1DZ5A 3H5SA 1XWLA 1TKZB 4YFUA 1VBKA 2C3MA 5A0YB 3ZZYA 3BO4A 1S12A 2B4VA 1S6PA 1JLFA 3D28A 4OJGA 3GV5B 3I82A 2EFQA 3QATA 2M52A 2IA6A 2FLPA 4Y2IA 5ETNA 3FEZA 4LFCJ 2ACMA 5KFJA 2B9EA 1GAOA 4LBPA 3BDEA 2ALZA 1M1GA 1N5VA 1S1XA 1M0SA 2RDDA 3MPUB 4G1PA 4J5OA 4MIWA 3RJMB 1X0FA 4MK8A 3IAS9 3JTOA 2GA7A 5KFIA 2HBQB 3CIZA 1KVKA 3NS7B 2DH7A 4UOGA 3N0VA 2PFFB 3N6LA 1WF2A 3C66A 4C8MA 1JLFB 4IFYB 1SKUB 4MK7A 1B7YB 4I2QA 2J9DE 5D4OA 1M5PC 1N4LA 1OY6A 3W7BA 1WF1A 2W2OP 5SZTA 4B9LA 3SDEB 3O3LA 5IV4A 4FXDA 1F9FA 4NX9A 5HATA 4M63A 2Z30B 4IOAQ 1HBUA 1MROA 2BRLA 3A8JA 4BC9A 4WZQA 4RBTA 1RHJB 3RB3A 2MB0B 2UUBF 3QSYB 1XNRJ 1RT6B 3HJVA 1S9EB 5ETMA 3TARA 2WVEA 1JNZB 1B0TA 1YZ7A 3ZZRA 3RW7A 2VQFF 2ZFHA 1U1LA 4DV6J 1RT1B 4DR2F 2A1BA 3OL7A 1T02A 3I5AA 3M7VA 3R5AA 3WC0A 1K44A 1S9FA 1KR4A 4DMZA 3TAMA 1MMDA 1VRTA 2AMCB 5A8RA 3M32A 4CLUA 3IRXB 2K3KA 2FZKB 1S1TB 3MOZA 4F3MA 3KHRA 2PI4A 4LF8J 1O51A 1Y0HA 3O6QA 4NA2A 1TKTA 4ZPTR 4RNNA 1HNZF 4ES3A 4R8UB 4TY8A 2H1YA 1WI6A 3DLGB 1WDDA 1U47A 3MM6A 3KNGA 4ED8A 3QJLA 5KFLA 2G13A 3HFKA 2J8AA 2GAHC 2GGPA 3AHPA 4HH0A 5B0GA 5KG6A 3DDKA 4WU2A 4QWCA 1XR7A 3DLKA 1V3SA 3U1LA 3JYTB 3F56A 5I42B 1SKRA 2IY5B 4M5JA 5L1JA 1EETB 3FEYB 4CH7A 1FO1A 3DMJA 5I3UB 4ELTA 1FERA 1IQZA 3RB4A 3O1LA 2E7WA 2I0XA 3RRHA 1S10A 2ZM6F 2HZAA 2ZJRQ 2AEFA 2KXNB 3DOLB 1PAUB 2HIYA 3VWSA 2JLGA 1S1WA 4DQPA 1LK5A 1IR1A 1T9XA 2LQ5A 1NHVA 1QM9A 1W7WA 1RAJA 1ZAWA 2C2OB 2N4CA 4QJVA 1HR0J 3KTQA 3KFWX 3OXFA 4EO6A 1IBKJ 1HNIA 3PHTA 5GAHU 4IKAA 1TELA 4ZVFA 4KPCA 1HFEL 1DTQB 3OL6A 3QWUA 2IA0A 3NWGA 5THWA 2R7OA 5LXYA 5IOLA 1CVJA 4TKTA 2CG4A 1HBNA 2WCXA 3LUYA 1WI8A 5E3AA 4ZCKA 4QPXA 2DO4A 2X1AA 3DRYA 1FDDA 2OIHA 4DPUA 2HGLA 1WKKA 3ETMA 1N54B 5CD4H 4U7CA 3DLBA 2UXBF 2WK4A 1K73T 4PWDB 2KHCA 2KI2A 3MCMA 2QA4S 1JLAB 2VQEJ 2DH8A 5KFSA 1Q79A 2HHUA 2QL7B 2RSQA 4LSNA 2EC0A 3TUJC 4KHPJ 3PR4A 4BHQA 2G2OA 3TQEA 3EPGA 4ED3A 3SZ2A 2JL9A 4DV5F 3DLEA 3TW0A 3VALA 5IXUA 3ELHA 2QRRA 3V6DA 2ZH7A 3QT6A 4LIWA 4DZ6A 3B8HA 3PFOA 1RBOB 1T05A 3H90A 5AXNA 1FFSB 4LF8F 1IWAA 1U6ZA 1RU2A 2K7KA 2R7TA 5B0DA 2MZ1A 5KAKA 5CABA 5KG2A 3OR2A 3KLHB 2M2BA 4UY8T 2WB4A 2J6SA 4Y00A 1TL1B 4OHXA 1L3SA 1VQ4S 3IP0A 4RW4B 2NCKL 3GYNA 3HD2A 2LEBA 1N32F 1U8WA 1B0PA 1RLDA 2C2ZB 1VK8A 3SBMA 4I68A 4LF5J 4MIBA 3PNIA 2R2RA 2GO9A 4CO3A 2V4QA 3QZ8A 2DGVA 4FBTA 1TUGB 1YGYA 4CI0B 5DQIA 4L72B 4OHWA 2DISA 4DF8A 2AT1B 1FCAA 2HK2A 1HNVB 3IC1A 1YRXA 3FNNA 5D77A 7AT1B 2MQQA 3KLHA 2OSRA 5J2NA 2MPUA 4LRDA 1RADB 2QFIA 3OFFA 2PDAA 3FMWA 1ZA1B 2BE7D 3PX6A 4LFAJ 4X65J 1ZM2A 2MZQA 1ZBTA 4C3KA 2L9NA 2VDIA 5JXSA 2DCLA 3C16B 5KFUA 3CD7A 2DGOA 2YPYA 3LGNA 3QT8A 3EYZA 4FYDA 4YN3B 2HQ3A 2IMWP 1DBDA 1TL7B 4A47A 2ZOFA 4PQAA 4LF4F 3OTDA 3FDSA 1KHVA 1XR6A 2H51B 3GIMA 2Q66A 1NSAA 5J1NA 1MU2A 3LP0B 3F0NA 3UDVA 4ELVA 2HK3A 3C19A 2LU2A 3IWLA 1KWMA 5KT7A 2XHWA 2VA2A 3TVKA 2E9RX 4PWWA 2MYFA 4KKOB 1UVKA 2GX8A 2WONB 3D66A 4PEOA 1C2PA 1OMSA 1X0PA 2LLZA 2RVJA 3DYAB 4EYIB 1R0AA 4MH8A 2AYMA 4ZHRB 4OJHA 1RWOB 4DHVA 5K8NA 4UUWA 1N36J 1LWCB 1SJFA 4OZLA 1RT3A 2IJNA 5HROA 3R9LA 4NXNF 3UCGA 3SCIE 2YNGA 4RNOA 3CULA 5KFPA 1EB0A 1H2VZ 3M2UB 5CH7B 4NLWA 1T8EA 2FLLA 1HQUA 2ASYA 3NMAA 2J6UA 1UWBB 3KK1B 1FTRA 4U95A 2QLFB 1O8BA 3PW0A 4J7CA 1DQ8A 1UWBA 3KK1A 3M2RA 3VGVA 4C3MA 3HD1A 2ZH6A 2D3OR 2HYIB 2WVBA 1GK8A 1PYOB 2UUWA 1UAWA 2RQMA 3O5TB 2MQOA 3A1YG 3GE9A 1H3DA 1MW7A 1FRMA 2LQJA 1X4BA 4G3IA 5C24A 3BBFA 2O3DA 3HZGA 4CLYA 2FJAB 4DV7J 2MQMA 3JAMY 3OUYA 3DHXA 3OD2A 2AGOA 3RB0A 2MZSA 4IYQA 3UN2A 3C8YA 4ZLNA 1GNKA 3Q8YA 3CDEA 2C22A 3JYTA 3R7BB 3G6YA 4KGZB 3BQ0A 1RACB 2KRRA 3LP2B 4C0BA 5J2MA 1QSYA 3IBFB 2MHEA 5DGAA 1KEKA 4QWDA 4TY8B 3LP0A 2ATLA 5DZ6A 1SL0A 2VOPA 4K5SA 3AXMA 3CJKB 3K89A 3MEKA 1Y11A 3W61A 2MKIA 3BH6B 4DEZA 3BKTA 3IRXA 1JXEA 3I31A 3KLGA 4DWIA 2GHVC 3JAMU 1RE1B 3GSDA 3PCOB 4CNZA 4ES2A 2VV5A 1VYAA 1GFWB 2BACA 2GIFA 2CQDA 3VVUA 2MZRA 2XSFA 1UFWA 1WC5A 3MM7B 2XGQA 4M5HA 1S9EA 1WOOA 4YY3J 2JEJA 3L7PA 3GB0A 1QTMA 1TTHB 1EQ0A 1WSRA 3MCSA 3TA2A 1N33F 3ILOA 1LK7A 2YPZA 1TAQA 2D3UA 2XS5A 4DSLA 5HMWA 3PW2A 4B9UA 2E7XA 2BJ9A 3CCZA 4MMOA 4NLVA 1MMNA 2FZCB 4K2JA 1HI0P 2KB2A 2OHDA 1FA0A 4B3OA 1XK8A 2V9KA 4A8MP 4I7FA 3K5LA 1B7FA 2R7QA 4DR6J 4NLRA 3L4BC 2W8LA 4FF3A 1JB0C 4IFYA 3GPAA 2D7SA 4ZDNA 2B9YA 4WCEQ 3MPYA 4A46A 2HVIA 5F8NA 3MMAB 3F44A 4WJBA 1FRXA 2RD5C 2OPRB 3GR0A 3QBCA 3OJUA 5GMEA 4KGKA 2CIMA 3OR2B 3M30B 5KT6A 2XS2A 2OEKA 4OYAA 1VK3A 4UOFA 2V4JA 2KFZA 4NLXA 1S4EA 1BC6A 3EVMA 3BGUA 2ASDA 1NB7A 1RT7A 1WEXA 4DX7A 1VRUB 2PSZA 3HVTB 4J9VA 1DFDA 2QO3A 1ZETA 3T1YF 1YBUA 3BGRB 4YS2A 2E44A 5IWAF 2OPSB 2FY1A 1CS4A 1FDNA 3HVWA 2B9XA
chains in the Genus database with same CATH topology
2AZ1A 3EM1A 3G2XA 3PJ9A 1NSKL 3VGUA 3PRVA 1NLKL 4F4AA 3JS9A 3EVOA 4DUTA 1XQIA 1B99A 1NCLA 3FBCA 1HIYA 1JXVA 3R9LA 1NDPA 5C7PA 3ZTRA 1HHQA 4EK2A 1ZS6A 1W7WA 3VVTA 2BEFA 4UOHA 4F36A 1S5ZA 1NB2A 3DKDA 1BHNA 4ANCA 2B8QA 4ENOA 3BBBA 3VGVA 1LEOA 4KPCA 2DYAA 3Q86A 3ZTPA 1S59A 3EJMA 5IOLA 3BBFA 3BBCA 1NDKA 3ZTQA 3EVWA 1B4SA 2B8PA 2DXFA 4DI6A 3WX8A 5BXIA 1WKKA 3ETMA 3Q8YA 4O0NA 2BX6A 3DDIA 1NHKL 3NGTA 1HLWA 1F6TA 1NSQA 3Q8VA 3FBBA 1KDNA 1MN9A 2AZ3A 3GP9A 2CWKA 3L7UA 3BH6B 1UCNA 3BH7B 3NGSA 1VYAA 1XIQA 3ELHA 4DZ6A 3VVUA 1NPKA 1WKJA 2VU5A 3B6BA 3VGTA 3Q89A 2ZUAA 5CABA 2DY9A 3Q83A 4ANDA 3FCWA 3ZTOA 4CP5A 1NDLA 2DXEA 2HURA 4S0MA 4UOGA 1WKLA 2NCKL 1U8WA 1BE4A 1LWXA 3GPAA 1MN7A 3ZTSA 3ENAA 2DXDA 3VGSA 3FC9A 1EHWA 3NGRA 3FBEA 4C6AA 3FKBA 3FCVA 1PKUA 4FKXA 1NDCA 3NGUA 4UOFA 1S57A 1BUXA 4ANEA 4HR2A 3EE3A 1NSPA 3EVMA 5CAAA 4WBFA 4W98A 3EMTA 2HVEA 3MPDA 1PAEX 3EICA 2HVDA 4FKYA 3B54A 1F3FA 3Q8UA 1K44A 3FBFA 1NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ1 A;  3EM1 A;  3G2X A;  3PJ9 A;  1NSK L;  3VGU A;  3PRV A;  1NLK L;  4F4A A;  3JS9 A;  3EVO A;  4DUT A;  1XQI A;  1B99 A;  1NCL A;  3FBC A;  1HIY A;  1JXV A;  3R9L A;  1NDP A;  5C7P A;  3ZTR A;  1HHQ A;  4EK2 A;  1ZS6 A;  1W7W A;  3VVT A;  2BEF A;  4UOH A;  4F36 A;  1S5Z A;  1NB2 A;  3DKD A;  1BHN A;  4ANC A;  2B8Q A;  4ENO A;  3BBB A;  3VGV A;  1LEO A;  4KPC A;  2DYA A;  3Q86 A;  3ZTP A;  1S59 A;  3EJM A;  5IOL A;  3BBF A;  3BBC A;  1NDK A;  3ZTQ A;  3EVW A;  1B4S A;  2B8P A;  2DXF A;  4DI6 A;  3WX8 A;  5BXI A;  1WKK A;  3ETM A;  3Q8Y A;  4O0N A;  2BX6 A;  3DDI A;  1NHK L;  3NGT A;  1HLW A;  1F6T A;  1NSQ A;  3Q8V A;  3FBB A;  1KDN A;  1MN9 A;  2AZ3 A;  3GP9 A;  2CWK A;  3L7U A;  3BH6 B;  1UCN A;  3BH7 B;  3NGS A;  1VYA A;  1XIQ A;  3ELH A;  4DZ6 A;  3VVU A;  1NPK A;  1WKJ A;  2VU5 A;  3B6B A;  3VGT A;  3Q89 A;  2ZUA A;  5CAB A;  2DY9 A;  3Q83 A;  4AND A;  3FCW A;  3ZTO A;  4CP5 A;  1NDL A;  2DXE A;  2HUR A;  4S0M A;  4UOG A;  1WKL A;  2NCK L;  1U8W A;  1BE4 A;  1LWX A;  3GPA A;  1MN7 A;  3ZTS A;  3ENA A;  2DXD A;  3VGS A;  3FC9 A;  1EHW A;  3NGR A;  3FBE A;  4C6A A;  3FKB A;  3FCV A;  1PKU A;  4FKX A;  1NDC A;  3NGU A;  4UOF A;  1S57 A;  1BUX A;  4ANE A;  4HR2 A;  3EE3 A;  1NSP A;  3EVM A;  5CAA A;  4WBF A;  4W98 A;  3EMT A;  2HVE A;  3MPD A;  1PAE X;  3EIC A;  2HVD A;  4FKY A;  3B54 A;  1F3F A;  3Q8U A;  1K44 A;  3FBF A;  1NUE A; 
#chains in the Genus database with same CATH topology
 4Y2K A;  3QRQ A;  2HHP A;  3J7A 1;  4P6Q A;  3AD7 C;  4LSN B;  3BB5 A;  1F3V A;  1KFD A;  4HHU A;  4ZK7 M;  1FKP A;  2F3J A;  5GAD I;  1LW0 A;  2X7I A;  2V9W A;  4DV0 J;  2AYE A;  1JLA A;  1H6K X;  3DFE A;  1ZZF A;  2W01 A;  3PRV A;  4OI6 A;  5C5J A;  1IKX A;  4DV2 J;  2DNZ A;  5HMZ A;  1KOH A;  5L9N A;  2QL9 B;  1RB0 A;  3AAW B;  5EWG A;  3P3D A;  2P6S A;  1HI1 A;  2ATC B;  2V2K A;  3ZO7 A;  1CQN A;  4G1Q A;  3UNG C;  1G7C B;  4C97 A;  1YWX A;  1HHQ A;  3MTJ A;  3C14 A;  1P9Q C;  4EK2 A;  2FJV A;  3CD6 S;  1AUS L;  1DLO B;  2IBO A;  1VCT A;  2W2Q P;  4AQY J;  3DKD A;  1RXO B;  2PE8 A;  3VV2 B;  3Q2T C;  4CTA B;  3KOA A;  1HNI B;  1C0U A;  1RAB B;  4OI2 A;  1Z1Z A;  3LP1 B;  3RG6 A;  4DFM A;  2G0I A;  2ZVS A;  3MR5 A;  2GJI A;  2R7U A;  3NCP A;  4YDD B;  1UET A;  1VJQ A;  2EC2 A;  2C3O A;  3LPY A;  3ZTP A;  4WP3 A;  2ADC A;  4C8L A;  3EZ5 A;  1KS2 A;  3W8P A;  2UVV A;  1CJK A;  4NYO A;  4ZVP B;  1VDH A;  5I3Q A;  3T3F A;  1SQF A;  3KJN B;  4PG7 A;  1PCA A;  2DNR A;  2Q1L A;  3NY0 A;  3OFG A;  2W9C A;  3TAN A;  3RAX A;  1U1R A;  3PM9 A;  4WII A;  2KXF A;  1HBM A;  5I3U A;  2ASL A;  2FJB B;  3UDL A;  4X4S A;  2WRM A;  2E66 A;  5I42 A;  4QU7 A;  2MKY A;  1RWK B;  3E01 A;  3JSB A;  1VC6 A;  3ET6 B;  1IQT A;  1X60 A;  5AJ3 J;  4ECW A;  1QTN B;  3BQ2 A;  1AZS B;  3MEG A;  2A0F B;  4CLF A;  2R8H A;  3GON A;  1HD1 A;  1XEZ A;  3SSQ A;  4ELU A;  4NXN J;  4NLG A;  1P8G A;  1HWU A;  8RUC A;  2VC1 A;  3IG1 A;  2VJV A;  2AZ3 A;  2W1B A;  3CNQ P;  4OIX A;  2ILY A;  4F0M A;  1ZAV A;  6AT1 B;  2Z2M A;  3M9M B;  4WFA Q;  1WTB A;  1RT5 B;  2J9C A;  4DX6 A;  4XPE A;  2NXN A;  3VAJ A;  5H1S V;  5DG8 A;  3IO1 A;  4JI5 J;  2XNQ A;  4Q0B A;  4HYK A;  3MR7 A;  3FMB A;  3W2W B;  2LCW A;  4LR8 A;  1UL3 A;  1R8A A;  1OSC A;  1R31 A;  2YKA A;  4DBQ A;  4C4W A;  1KVI A;  4RW9 B;  2QGF B;  3M1V A;  3J7Z T;  4LF9 F;  3DXS X;  3H59 A;  3NGK A;  4PYD A;  1FEE A;  4N77 A;  5KFA A;  3TWZ A;  2GHP A;  2H5E A;  2OH2 A;  4PUO B;  1TP7 A;  3BGO P;  1FT8 A;  1Y00 A;  3I56 S;  1QAJ A;  4IFV A;  3BDP A;  2B7C B;  4OLO A;  4PXE A;  3CCE S;  1Y4Z B;  3R2C J;  2VG7 A;  4YHH F;  2RS8 A;  1UFK A;  5E3C A;  3ZNU A;  1EJ7 L;  2CDR B;  3QAE A;  3MFI A;  2HHQ A;  2NXC A;  4KFB B;  4YEA A;  1PIL A;  4C11 A;  1CQM A;  4LFA F;  2X3G A;  1REG X;  1FRH A;  2FB0 A;  1PBU A;  3CJ4 A;  2K1R A;  2YBV A;  5K8P A;  5BJR A;  5JVH Q;  1CEZ A;  1VHF A;  2HS3 A;  4B3R J;  1O0P A;  1TQL A;  2HBZ B;  1VGY A;  2F1F A;  3ENQ A;  1VBY A;  2JEF A;  2VOO A;  3PW4 A;  2HLT A;  1FRI A;  4F50 A;  2BJ1 A;  1I3O B;  1Q5V A;  2JX2 A;  4O4R A;  5DQG A;  1RA6 A;  1WEY A;  1G6B A;  3E3X A;  3FCV A;  2CJK A;  1S4F A;  1Y9O A;  2WOM B;  3C15 A;  4OV6 A;  1NPR A;  1EKS A;  2Y0S D;  2YTC A;  3CJ2 A;  4QW8 A;  2B0G A;  3VTI A;  3FZB A;  4YQW A;  1NSP A;  1IBM F;  2FJX A;  3NL0 A;  4KHP F;  4JI2 J;  1GXL A;  2HVE A;  2PO4 A;  4ZJO A;  3MR6 A;  4U96 A;  3C6T B;  1J5E J;  2YWG A;  4OZJ A;  2CQ0 A;  1VMB A;  4CLT A;  7FDR A;  1TV6 A;  2QLX A;  4W90 B;  3S6E A;  3KYL A;  2AZ1 A;  2B6A B;  4UST A;  3IWN C;  4P2M A;  5HK4 A;  2JLF A;  4KPY A;  3UCU P;  3GJR B;  1G3O A;  3PW5 A;  1T03 B;  2RU9 A;  2A18 A;  2IVY A;  1NPP A;  2DIV A;  3TP2 A;  3GV7 B;  2RIJ A;  2HAF A;  5HQL A;  2NS1 B;  1HQE A;  3MM5 A;  1TUV A;  1NLK L;  2OSQ A;  3HHL C;  4RUA A;  2BAB A;  2MQP A;  4ZP9 A;  3KLF A;  2GZO A;  1QVG R;  2I5J B;  4X62 J;  2X3D A;  2Z57 B;  2I8E A;  2KL8 A;  1HPZ A;  4Y0F A;  2J7K A;  1T03 A;  1RSC A;  2IDL A;  1ZOT A;  5JVG Q;  3GWC A;  5HP1 A;  3N6N A;  5LMU F;  1B99 A;  3NNH A;  2HWI A;  2F40 A;  2WVC A;  3MAH A;  4WPA A;  2CJ9 A;  2QSW A;  3VHQ A;  3EDQ B;  3ZZU A;  1QAY A;  2ZZT A;  4DSE A;  2FHK A;  3V81 A;  4U8V A;  1YLX A;  5KFY A;  4PG6 A;  2BJ3 A;  1FE0 A;  2HNZ A;  3VVT A;  4UOH A;  1SH0 A;  3NWR A;  4DU7 A;  3HM9 A;  2HRY A;  1YJ7 A;  4ICL A;  3DU6 A;  4ED7 A;  5LXR A;  4O4G B;  9ATC B;  3M05 A;  5KT3 A;  1CBK A;  3Q86 A;  3W5Z A;  2AJQ A;  1VQP S;  1B3T A;  2Q6B A;  2LFV A;  2XI3 A;  5MLC V;  2IPO B;  3EJM A;  3IM8 A;  4DSJ A;  3G82 A;  1UMJ A;  4KE5 A;  2RHS B;  5E0O A;  3HSG A;  4TY9 A;  6FD1 A;  1N33 J;  1R8P A;  4FVC A;  1ICE B;  3DRX A;  4XDD A;  3NGD A;  4ITS A;  2OJ3 A;  1ZM3 A;  4JI6 F;  4DL6 A;  4KFB A;  2AJ2 A;  5G4D A;  1X4D A;  4O0I A;  2UUC J;  5HVH A;  3KLI B;  3PHE A;  4PAA A;  2CQ4 A;  1T9W A;  2ZDP A;  2VG6 A;  4IH6 A;  4H4M A;  2GVZ B;  3TYT A;  4YR2 A;  1DRZ A;  1U1O A;  4PQU B;  2IM2 A;  1IJF B;  1H7X A;  2YNF A;  4OZ1 A;  4U8Y A;  2D3O 1;  1M1K T;  4DFK A;  2ZH3 A;  2MQ8 A;  3R5D A;  5GAD U;  4JI1 J;  5KFH A;  3M8R A;  4CYU A;  1SV5 A;  3K0J A;  1C4C A;  2O66 A;  2GV1 A;  2ILZ A;  2QL5 B;  3TUZ C;  1EAR A;  1FWK A;  1WC6 A;  3OHA A;  3CDB A;  3B78 A;  4Y2M A;  3ULH A;  3W2W A;  2DNQ A;  3KXD A;  5J2P A;  2W25 A;  8ATC B;  3ZZO A;  4K2X A;  5HQM A;  1SV5 B;  3HUL A;  1NPK A;  1L3V A;  3DLH A;  2CJQ A;  1JLQ B;  3MAA B;  2VOD A;  3T5J A;  3G87 A;  1WWH A;  2IC3 A;  3HSZ A;  5EWE A;  1HNZ J;  3H98 A;  1N5S A;  1ELO A;  2B56 A;  4NI2 A;  1JLC B;  2KYZ A;  3AJ2 A;  3GCW P;  4FPR A;  3UFC X;  3FFI B;  2RU3 A;  3DOM A;  1U09 A;  4I64 A;  4ZOS A;  1LOU A;  4NA1 A;  2EFN A;  3B4D A;  1RTD B;  3MUT P;  2W24 A;  2B3T B;  4CQ1 A;  3MDF A;  2LYV A;  3AXK A;  3LF0 A;  3J7Y I;  2QYC A;  1LWE A;  5JUM A;  3MOJ B;  2PEB A;  2DRD A;  4HDG A;  2W4C A;  3SCL E;  1U6F A;  2XLI A;  2ACY A;  5DDO C;  2AP6 A;  5IC4 B;  4JV0 A;  1S49 A;  4J9N A;  4ID5 B;  3GSI A;  2DNM A;  1NZ8 A;  2E1A A;  2VFV A;  2GQQ A;  2H4W B;  4FYV B;  4AT1 B;  3Q2S C;  1Q7L B;  3PG9 A;  4C3L A;  2XGP A;  1KNZ A;  3IN5 A;  4C6A A;  3GFH A;  2QMW A;  2FGO A;  2OD4 A;  2DKO B;  2H65 B;  4P72 A;  4C7Q A;  3Q24 A;  3G71 S;  2BV3 A;  1X4A A;  2GVD B;  3HFZ B;  4HR2 A;  1WOR A;  2IIH A;  3MTK A;  4LVN P;  4CM0 A;  5HO4 A;  1IBL J;  1CJV A;  2KYX A;  4W98 A;  4DSK A;  3EXC X;  4OZN A;  3GMG A;  2N82 B;  4DDF A;  4QWB A;  1U45 A;  5HLF A;  3BSC A;  1XER A;  2IM1 A;  2EG1 A;  1GTH A;  3Q8U A;  2LDY A;  1VQK S;  2RIL A;  3FBF A;  2BW7 A;  4G1Q B;  2K06 A;  4LBH A;  2XM3 A;  1RWM B;  3ENW A;  3DGP A;  1VQO S;  1YTY A;  2QLB B;  5KFF A;  4K4W A;  1H74 A;  2ZKU A;  1C1B B;  3T9N A;  3MR2 A;  3I5B A;  1HPZ B;  2DNG A;  5KG4 A;  4MT1 A;  3ITH B;  4JI8 F;  3OL8 A;  1I6J A;  2JC0 A;  2I5J A;  4ZN3 A;  3NOC A;  1C4A A;  1X5S A;  2GW8 A;  2MLX A;  1DTT A;  2GIR A;  2XYP B;  3MM5 B;  2R8J A;  3RR8 A;  1IKX B;  3PO5 A;  2KFY A;  3HCX A;  3SYZ A;  2OPP A;  4TYB A;  2EPI A;  5FLX U;  4AE5 A;  5KFR A;  3D54 A;  2K8G A;  1LW0 B;  3MMB A;  4J9K A;  5G0R B;  5F3Z A;  1Y3K A;  2OAU A;  3HHK A;  2ZH5 A;  5EWF A;  3AD9 C;  2HNY B;  2QMU B;  4DV4 F;  2Y1J A;  1Q4R A;  4KSE B;  4LRE A;  3MUR P;  3G9C A;  4QU6 A;  1VJW A;  5E41 A;  2R42 A;  3M6V A;  1EAY C;  1SC1 B;  3C6T A;  3BZQ A;  3Q8S B;  2OKQ A;  3IBC B;  4ZIV A;  4DL2 A;  3TZX A;  4ZS6 A;  2DIU A;  1GMW A;  3HT0 A;  1ACM B;  4ECS A;  2M4M A;  1HMV A;  2XMW A;  3OFE A;  4UF4 A;  1RJJ A;  1PJ6 A;  1J2V A;  1RT4 B;  1T9Y A;  2B8Q A;  3C15 B;  3DN9 A;  3MAQ A;  2ZH8 A;  1RBA A;  2ZOG A;  1RTJ B;  3NMR A;  2KM8 C;  4X65 F;  5L38 A;  2E5I A;  1FK9 B;  4B08 A;  2V5H G;  4NLS A;  4DL3 A;  2OPR A;  5CXT A;  2ZZM A;  2E5G A;  3LTO A;  4PXD A;  4UQT A;  3V5R A;  1FRL A;  1FWL A;  3HSD A;  3BBC A;  2HG4 A;  5HVF A;  5C42 A;  1VC0 A;  4ZVU B;  4DR4 J;  1FD2 A;  1RA7 A;  3I96 A;  3S01 A;  5MAO A;  3PKY A;  1U0H A;  1UVJ A;  2YKN B;  5T7L A;  4RWX A;  5CQG A;  1R0B G;  3W62 A;  4BLG A;  1KON A;  4C11 B;  3B82 A;  3BSO A;  4B3O B;  3EZO A;  2BR0 A;  3UR0 A;  2IRX A;  4DL5 A;  1S99 A;  2JSX A;  4TYA A;  5GAH I;  5KFC A;  4FVM A;  4X4Q A;  3UD5 A;  4K4V A;  2ZM6 J;  2MLZ A;  3OLA A;  2PEH A;  2KXH A;  2LQ9 A;  3CSK A;  4TXS A;  2FYX A;  5BYQ A;  5IS2 A;  2FJW A;  3J81 U;  4C8N A;  3M2V A;  2V50 A;  1RI7 A;  4RW9 A;  2NUU G;  4CLW A;  4WKR A;  4MKA A;  1QJH A;  4MIA A;  3L7O A;  4DXL A;  2CVE A;  4NLP A;  5LSR A;  2MKK A;  4JV2 A;  1NH8 A;  3VQS A;  3EX7 B;  2CQI A;  2Y9H A;  2ZC3 A;  2HKE A;  3QO9 A;  1W25 A;  3MPW A;  4KH0 B;  5L9X A;  5KG5 A;  4XO0 A;  3G8T A;  3CPW R;  3OSP A;  3A8I A;  3W65 A;  3UWT A;  5L1L A;  3LA0 A;  3IRW P;  2OPQ A;  5DM7 Q;  3ZFV A;  4DV1 F;  3CJR A;  5JMN A;  3I4H X;  2I6W A;  2CPD A;  2QEX S;  3N6M A;  3PXG a;  4CT9 A;  2HZV A;  1UJ4 A;  4IOB A;  3RUB L;  3NRB A;  5IT9 U;  2QA4 G;  1RAF B;  3M8Y A;  4WXW A;  3CF5 Q;  4EBE A;  3BYP A;  4QIF A;  5ETR A;  1QLN A;  4DUZ J;  1ZM4 A;  5EX3 A;  4JI0 J;  3OUY B;  3VAK A;  1HR0 F;  2V6A A;  3NKY A;  1RTH B;  1CJK B;  2XB2 D;  1CLF A;  4WKY A;  1Y5I B;  3RYL A;  3CC4 S;  2XG8 A;  2HQD A;  5KFX A;  3GIK A;  1S48 A;  3SMZ A;  2RHQ B;  4BWJ A;  1D9D A;  1MNE A;  4J37 A;  1C0U B;  2M7S A;  4DFP A;  3FQK A;  1TL3 A;  3P45 B;  2XY5 A;  5KFM A;  2KJV A;  1FX2 A;  1SIZ A;  4ETZ A;  1NK8 A;  3JTN A;  2GHW A;  1GT8 A;  3RBD A;  3MD3 A;  2IJR A;  3IR5 B;  2VIH A;  2YKO A;  3QSI A;  2FQQ B;  2AJ4 A;  3HDS A;  1HA1 A;  4F4Z A;  1BD6 A;  2UU9 F;  1XBW A;  1RWN B;  1S1U A;  2CNK B;  1W2B R;  3EM1 A;  1QAI A;  2LA6 A;  1GEH A;  3D1Q A;  1N34 F;  3WZ0 A;  2EFV A;  2VFR A;  3U1M A;  1VQ7 S;  3DYA A;  1R0A B;  2VIC A;  1N0U A;  5HAN A;  2Y1R I;  2MGZ B;  1OYE A;  2AQ4 A;  1YX2 A;  2V69 A;  2FY8 A;  2E9T A;  3ZC4 A;  4NCB A;  4RNH A;  4DCP B;  4FXV A;  2H5I B;  1Q86 T;  5IQ6 A;  2WSC C;  4TLR A;  2BE2 B;  2R8K A;  1ZA2 B;  4NWB A;  3R3T A;  3T6J A;  3F73 A;  1SKS A;  2GJF A;  1BQM B;  2W2M P;  3MHY A;  4PAB A;  5KG3 A;  2ZUG A;  4ZIW A;  4EI2 A;  3ZTR A;  1T9V A;  1NM2 A;  3HVT A;  5LSO A;  3BO3 A;  2MQL A;  1QE1 B;  1UVL A;  2GO8 A;  1UJ5 A;  2CKW A;  1I51 B;  4WTY A;  3D6H B;  3QLH A;  1SIW B;  2RAQ A;  5IV3 A;  2LEP A;  4FNH A;  2NRE A;  2AU0 A;  1ZPV A;  4NCA A;  3M30 A;  1OY8 A;  3T5H A;  1T9U A;  2Q6C A;  4U67 Q;  3KK2 A;  4J9R A;  4DL0 C;  1APS A;  2XNR A;  5E2Q A;  4J90 A;  2V4R A;  2XY6 A;  1U4B A;  2VQF J;  4DR7 J;  2XMV A;  4WWS A;  1NK4 A;  1K8A T;  4X4O A;  1J5E F;  5F3T A;  3PZP A;  4F25 A;  1WD6 A;  3KDO A;  2VUG A;  2AYG A;  2DHA A;  2DNK A;  2U1A A;  4ECZ A;  2HHX A;  2QA1 A;  1Q53 A;  1HW8 A;  1WSV A;  3HHD A;  3V2U C;  4YB6 A;  1WG4 A;  1AA1 B;  3HO1 A;  1TKX A;  1IUJ A;  2XSJ B;  3PYF A;  1LXN A;  4A8F A;  1HLW A;  2HQI A;  2OGU A;  4TLQ A;  3DRR A;  4F7V A;  3CJ5 A;  1KDN A;  3FBB A;  1MLA A;  4K59 A;  3GG0 A;  3DM2 A;  3LAL A;  2XY7 A;  1K9M T;  2BKO A;  4KO0 A;  4CH1 A;  1H2U X;  4LT6 A;  3TOQ A;  3NLC A;  4FDF A;  2D1C A;  3W64 A;  1UA1 A;  1NJY A;  1X9M A;  1TAU A;  1QE1 A;  3UR3 C;  3VAF A;  1F2H A;  1C0T B;  1YJR A;  2GFF A;  3DLE B;  3NGS A;  3V6D B;  4DCJ B;  4BS2 A;  2BBE A;  2NYH A;  4KY3 A;  4TQR A;  2DTJ A;  4M5M A;  4GC7 A;  3B6B A;  4KGX B;  3PVX A;  1FXD A;  1UEU A;  2FTR A;  3TR5 A;  4IG0 B;  3J81 Y;  3OW2 R;  3GIJ A;  1WNE A;  3FCW A;  1RYR A;  1FTC A;  2B4P A;  2MMY A;  3CJQ A;  3DI6 B;  5L8R C;  3LP2 A;  3WHI A;  1MWZ A;  3KLE A;  2R9L A;  4A8Q A;  4F26 A;  4YB1 P;  1WTF A;  4K7Q A;  2XLJ A;  2DR8 A;  2ABY A;  2VG5 B;  4Y2C A;  1RQ0 A;  1FHT A;  2VJU A;  3OPK A;  2HQC A;  3QID A;  4F4X A;  2ZEJ A;  2XZD B;  1LWX A;  1BE4 A;  4MJK A;  2V8V A;  5KFZ A;  1FVQ A;  3CCQ S;  4H4O A;  1C1C B;  4QYZ K;  1HHT P;  1ZPW X;  1NJX A;  4TVA B;  5J1P A;  4WFB Q;  4HTJ A;  3V4I B;  1RAI B;  3Q8P B;  2R2S A;  2WBR A;  4JI8 J;  2H3E B;  2F9D A;  2HHW A;  2J6T A;  5GVQ A;  2C3P A;  3MEC A;  1U2C A;  1V5I B;  1VI7 A;  2JFD A;  3QGI A;  4KQZ A;  5A6P A;  5J2Q B;  1YBT A;  3VZI A;  5J2Q A;  4DR1 J;  3JTP A;  4IH7 A;  2YKQ A;  2ZBQ A;  3D6M B;  4ZN1 A;  4PG5 A;  3SV3 A;  1JNR B;  4ZA1 A;  4CO2 A;  1FD8 A;  4MTP A;  3UW1 A;  1YSJ A;  2ZKT A;  3QGH A;  4USM A;  2YNG B;  4N8O A;  1FJE B;  3OXL A;  1G2E A;  1OWX A;  5E3Q A;  4WZM A;  4LQ9 A;  3G6X A;  4DG1 B;  2CQB A;  5EX0 A;  1NUE A;  3R2D J;  2UV8 G;  2CPJ A;  3NG8 A;  2EFG A;  3PDN A;  4ERD A;  4M5L A;  4ZHR A;  1X4F A;  4ZVR B;  4ZPA A;  3MUM P;  4NXM J;  1IKW B;  1DAX A;  4KKO A;  4Q2L A;  2HGN A;  2CQ2 A;  3T41 A;  3MCN A;  5SUH A;  1EQM A;  3CCJ S;  4JI0 F;  2HPU A;  4ZMM A;  4K4T A;  4L74 A;  4QCL A;  4AUK A;  5C25 A;  2DGW A;  2SXL A;  3JS9 A;  3JXO A;  1JWW A;  3A3N B;  4IG0 A;  2DBB A;  4DR7 F;  2OEJ A;  2FVS A;  4GKK J;  2FGC A;  3MR3 A;  2NZC A;  2Q3P A;  3BN7 A;  3FZ2 A;  4GO5 X;  5DDQ C;  5CCM A;  3CCS S;  1TL7 A;  1XJW B;  1BY9 A;  2MQN A;  3QQC D;  2FD2 A;  4NAS A;  4PG4 A;  4O3P A;  5F8G A;  1QD1 A;  3FBC A;  4Z2X A;  2ADB A;  3PJX A;  3C16 A;  1C0T A;  5CA5 A;  2F9J A;  2UUT A;  1KC8 T;  3CWJ A;  3CVK A;  4M8L A;  4DV2 F;  2HHT A;  2F5G A;  1ZS6 A;  4DUY J;  5B09 A;  1NKE A;  4KB7 A;  2MDA A;  4ZVO B;  3DM2 B;  3W9I A;  5L39 A;  3PIP Q;  2E5L J;  4V1A k;  5J2N B;  1N0V C;  2QX0 A;  5M2U A;  3CJ0 A;  3UVJ A;  4URQ U;  4PG8 A;  1FWP A;  5F8M A;  2FHM A;  3DLJ A;  2A2D A;  3AOC A;  2K7J A;  5A2Q U;  4DPY A;  1Q8B A;  2GIQ A;  4HAC B;  1PJ5 A;  4GO7 X;  3HHE A;  3KUH A;  1HWI A;  2XYG B;  3MM9 A;  4G1I A;  5E3P A;  1NO8 A;  3BV8 A;  3PX4 A;  1U0H B;  3TVY A;  3LW5 C;  3ONQ A;  5BXI A;  2ZBC A;  2EBE A;  2OO4 A;  4FYX B;  2WBM A;  3OQ2 A;  3S7R A;  3FJ2 A;  2KVQ E;  3DGV A;  1H98 A;  5H9E K;  2MTL A;  2RUG A;  3NGT A;  4IDK A;  2UXC F;  3VF0 B;  3D0I E;  3ZZP A;  1S1X B;  1RBL A;  1P9Y A;  1WEL A;  1WEZ A;  4OX8 A;  1NK7 A;  2EKN A;  3BM7 A;  1VQ5 S;  3M8Z A;  4FF4 A;  1O5J A;  3LPE A;  2QG9 B;  3D1H A;  3MEE A;  3QLH B;  4N47 A;  3G4S S;  2OTL S;  1HNW J;  2EFP A;  1SUQ A;  3H2L A;  1H73 A;  2MST A;  2OD6 A;  2VBY A;  3P5B P;  3LH2 S;  5A6W A;  1T95 A;  5A0Y A;  4Y34 A;  1XC9 A;  1RAO A;  3BH7 B;  3AOD A;  2XMT A;  3I5C A;  5F0U A;  4EWT A;  4J9P A;  4X64 F;  2HFN A;  4JBC A;  3EWG A;  5KTQ A;  2VPW B;  1F60 B;  1PYT A;  3MUV P;  1N48 A;  1NHU A;  1SBR A;  2KDO A;  2B43 A;  3D67 A;  1LWF B;  3GU0 A;  4LSL B;  4ED4 A;  5CCL A;  1X4C A;  1N5Y A;  2NSC A;  2PN6 A;  2AJ0 A;  2DY9 A;  2FHJ A;  4DR5 J;  4YOE A;  1WAC A;  2WB1 D;  4PWD A;  4CCH A;  2NXU A;  3IS9 A;  2M0G B;  4AYB D;  1HNW F;  1PG5 B;  1REV B;  5KFD A;  3KMS A;  3ITH A;  2RUS A;  4ZCL A;  3LQV A;  3BR9 A;  4CWB A;  3RAQ A;  2XI2 A;  1C1B A;  4X62 F;  2R2U A;  2FZG B;  1YJ9 S;  4MFB A;  5ETT A;  3ENA A;  2N4D A;  2CJA A;  3FSY A;  3GLJ A;  4DU8 A;  3RW6 A;  5A8K B;  2CNO B;  2ZDO A;  3FVY A;  1SL2 A;  4NOH A;  5EDW A;  3GQC A;  1YHQ S;  2DJW A;  3I0R B;  3I0S B;  4FYW B;  4G6V B;  3CJ8 A;  1CJV B;  3FKB A;  3N5F A;  1TL3 B;  4ANE A;  2GMH A;  1D09 B;  1FDA A;  5DG9 A;  4ECU A;  3MM8 A;  2VD3 A;  1OSD A;  1QY7 A;  2CQH A;  2O01 C;  2XWY A;  3JSR A;  2ZHA A;  1NKC A;  1W26 A;  5D0G A;  2QLW A;  4O3Q A;  4DV7 F;  3FGV A;  1RUS A;  3QJP A;  3JQK A;  3RGI A;  5A8W B;  1F5C A;  3DOL A;  5ETL A;  2MXY A;  2CRL A;  4I0W A;  1TK5 A;  3OTO J;  2JOQ A;  4HTI A;  5A8W A;  2FVQ A;  1RTI B;  2JDJ A;  1WC3 A;  1LV5 A;  3G2X A;  1FX4 A;  3X3U A;  2DHG A;  1MML A;  3IR6 B;  4OYX A;  5ADZ A;  4ZJQ A;  2D69 A;  4IG3 B;  2R8I A;  4WK1 A;  3CCR S;  1D9F A;  2HLU A;  5ITH A;  5DDR C;  4RZR A;  1Q7Y T;  3K8V A;  5FDL B;  1RP5 A;  5LJ3 Y;  5D4P A;  2CQ1 A;  1CJU B;  4P2S A;  4J9L A;  3ZXW A;  3DOM B;  2N7C A;  2EK6 A;  3BGF A;  3DLG A;  2RH3 A;  4MAK A;  5J1E A;  3HLU A;  3K2Y A;  3RU0 A;  1D9A A;  1YI2 S;  2V94 A;  1NK5 A;  2IC3 B;  4Q7A A;  2AJ1 A;  5CYQ B;  4A48 A;  4BBY A;  1U6B A;  1YBA A;  2DNH A;  4USU A;  5ETS A;  1XMQ F;  2BYC A;  3QRP A;  1M1H A;  1REV A;  3DLL Q;  1WHX A;  1RT1 A;  3TEG A;  3TJA A;  2J76 E;  3LAK A;  5F41 A;  2ZH4 A;  2XEX A;  2RS2 A;  2VA3 A;  2NYI A;  1Z4U A;  2R4F A;  1Y5L B;  4LIR A;  4CO1 A;  2GCF A;  1NB2 A;  2CAJ A;  1J27 A;  1GXU A;  2FHO B;  3QGG A;  5KFB A;  1K1S A;  3TAP A;  3THV A;  2IBK A;  2C2E A;  2YNF B;  4LSL A;  1L3U A;  4IRC A;  4PQU A;  1I1G A;  1HD0 A;  1WHW A;  4CNY A;  3POT B;  2MJU A;  4DR4 F;  2CFX A;  1IWG A;  5CYM B;  2B7B B;  4ED1 A;  2CUY A;  4GRS A;  4UT4 A;  4YR3 A;  2F4F A;  4OLP A;  3KJV A;  1T9T A;  3T5L A;  3M8W A;  3HF5 A;  3WX8 A;  3OVS A;  4WIQ A;  5F8I A;  2IRU A;  1YJW S;  4A4J A;  5B0B A;  3EPI A;  2ZBR A;  4IDK B;  4OX9 J;  5KOX A;  1D8Z A;  1EX8 A;  4X4V A;  1RT2 A;  1F6T A;  5LMN F;  2VH7 A;  5FD1 A;  3JSM B;  1N36 F;  1RAG B;  1JKH B;  3NS5 A;  3V4M A;  5D4N A;  4LUB A;  4DFJ A;  4JI2 F;  1Q81 T;  2M5Y A;  4ILR A;  4LR9 A;  4H4K C;  1CC8 A;  1RHR B;  1VIS A;  1ARO P;  3NAI A;  1SC6 A;  3THT A;  1UCN A;  1VQL S;  2IVM A;  4ED2 A;  1U1P A;  2V68 A;  4E2F B;  1GX5 A;  2GQC A;  4M5K A;  1UZD A;  4A8X A;  4IH5 A;  2C2R A;  3HMJ G;  5D0E A;  3SEO A;  4CDI A;  7FD1 A;  1AFJ A;  1IKV A;  4RUH A;  3BKU A;  5M2P A;  1SB6 A;  2HRT A;  3MMB B;  2YWW A;  3W60 A;  5IWA J;  2LVW A;  3CC7 S;  1S77 D;  2FC8 A;  2VL1 A;  4KT0 C;  4OYW A;  1I5O B;  1YRT A;  3T6B A;  3ZZT A;  4X84 A;  4NLY A;  1F5B A;  2RRN A;  2NUH A;  2I2Y A;  1T3O A;  5KFE A;  3BS9 A;  3L09 A;  4DF4 A;  2QLJ B;  2Z2L A;  1SJQ A;  2HMI B;  2PI5 A;  4PYA A;  4RUB A;  1W2I A;  3L95 X;  2UXC J;  3U7J A;  2UUA F;  2CAD A;  3ZTS A;  2DXD A;  1RHU B;  3FC9 A;  3RBX A;  2JEG A;  2Z4P A;  1D8Y A;  3W1Y C;  3AB2 B;  3K5P A;  4DN9 A;  1BQN B;  1RWP B;  3DDN A;  4P7T A;  3RBZ A;  3TO8 A;  1CPZ A;  1WHV A;  1EP4 A;  1PBA A;  4Q45 A;  1U26 A;  1HI8 A;  1BUX A;  2IFX A;  1S57 A;  1U24 A;  1BWV A;  2OP5 A;  4I2P A;  4X64 J;  4WBF A;  2BA9 A;  4OZ0 A;  5KG1 A;  3D0G E;  3T1A A;  3VAI A;  4DG1 A;  3R5B A;  2CZV C;  4DL7 A;  2XQC A;  1X9S A;  2B5J B;  1A9N B;  4MKB A;  1KTV A;  5HI7 A;  3V6H A;  3UNY A;  1KQS R;  5AJ3 F;  2BQR A;  3ZNJ 1;  4DV1 J;  3KJQ B;  1LWE B;  3OXG A;  4WYW A;  4F2R A;  2VFT A;  4QOT A;  2LU1 A;  2Z2Z A;  3ADA C;  2PA3 A;  2EG2 A;  3I9V 9;  1VLO A;  3FFI A;  1IM6 A;  1RAE B;  1OPZ A;  3EGV A;  1OYD A;  4QR1 A;  1NK6 A;  2HEK A;  2U2F A;  3W9J A;  3V4I A;  2BQ3 A;  1JLB A;  1KFS A;  2YXL A;  4B9S A;  4H4O B;  4USV A;  2AV5 A;  1TR0 A;  4XDC A;  4DSF A;  3M1V B;  2L9W A;  1S72 S;  1X4E A;  2HS4 A;  4J9Q A;  1NDP A;  4Y28 C;  2E1R A;  2CG8 A;  3DOK A;  4O3S A;  2AD9 A;  5CZX A;  4IRD A;  1HYS B;  1HL6 A;  3DI6 A;  5I3P A;  1BQX A;  5KT2 A;  4HL9 A;  2KJW A;  3NS6 A;  1VQN S;  4KTQ A;  4L3N A;  1Q78 A;  4RW6 A;  1HAR A;  4I6Y A;  4L75 A;  1RAA B;  4ANC A;  2BQU A;  1S76 D;  4OZ5 A;  4JP8 A;  4KAI A;  1JLE B;  3KLI A;  2YH0 A;  2DVI A;  1P1T A;  1RCX B;  5DQH A;  3PEJ A;  3ET6 A;  4USK A;  5FDL A;  4DQS A;  3HHL B;  2WSE C;  4ZLP A;  3KK3 B;  4M1K A;  1JIH A;  4FBU A;  1U1Q A;  4WE1 A;  2DNN A;  4CLL A;  4X4P A;  3MMC A;  3A3O B;  1S0V A;  4DLE A;  4Y2A A;  4KIA A;  2EVZ A;  4WYL A;  3EXY A;  2HFS A;  4L76 A;  2CQG A;  3HP6 A;  2BX6 A;  3HI9 A;  1U02 A;  2RRA A;  3JSY A;  2ZZN A;  2DR6 A;  2ZJQ Q;  4B3S F;  1IJE B;  3CCV S;  1GH8 A;  1S1V A;  1MG7 A;  2DGU A;  3LP1 A;  3MED A;  2Y8W A;  3N79 A;  2O67 A;  4CTA A;  4Q2M A;  1PC5 A;  2YKM B;  3MD1 A;  2AJF E;  3U1N A;  4LF7 J;  2HNZ B;  1LKZ A;  4WFY A;  3AA8 A;  2C28 A;  2FJE B;  3OR1 B;  5KFK A;  4R5P B;  4OYI A;  1XIQ A;  2IAJ B;  3Q0A A;  1PC4 A;  2AX1 A;  1ZTT A;  2DK2 A;  2QV6 A;  2EEY A;  4KR0 B;  2GML A;  5DJB A;  4OYO A;  3KNA A;  1FJ7 A;  3OVA A;  1FVS A;  2RDI A;  4BDP A;  4C8O A;  1UVI A;  5B0C A;  2W7P A;  2IDE A;  3QMQ A;  2W2N P;  4IRK A;  2KTQ A;  2IJF A;  3PYG A;  1Q5Y A;  3ZTO A;  1MSW D;  3DRP B;  4DR6 F;  1OS5 A;  4TU8 A;  3SQO P;  1FDB A;  2QMX A;  2BAN A;  1Q16 B;  1E6Y B;  3EGZ A;  2P9G A;  1PJ7 A;  1LWF A;  2AEJ A;  4N41 A;  3J7Z 5;  3TAQ A;  1VQ9 S;  4KJI A;  2ZNZ A;  1AXQ A;  1TV6 B;  4M5G A;  4HDH A;  1K1Q A;  3VCD A;  2W9B A;  4ECV A;  1MN7 A;  2HBY B;  1FES A;  5L46 A;  2FVR A;  2LDI A;  3A12 A;  4K4Z A;  5DRK A;  4HHH A;  1RZM A;  2DGT A;  4ECX A;  1TVR B;  2XLK A;  1WOS A;  1OQ6 A;  2MGZ A;  3R5J B;  1SUQ B;  3DRP A;  1QSS A;  4LF4 J;  1PKU A;  1N32 J;  3H42 A;  2V4J B;  3NGU A;  2HBR B;  1UEK A;  3RRK A;  2Y1I A;  1JLG A;  3CTR A;  4ES1 A;  3T1Y J;  2ZE2 A;  3SFU A;  2RB7 A;  4KV8 A;  4F3O A;  1XTZ A;  1UVN A;  2GAG C;  4Q44 A;  1KLN A;  1PAE X;  2V2Z A;  1TL5 A;  3P8B B;  5D0R A;  3ICL A;  3O8W A;  3B54 A;  4TNO A;  3SIP B;  3N01 A;  2ZD1 B;  2H54 B;  2X1G A;  3AQP A;  3ISN C;  3IA0 A;  2ROE A;  1KD1 T;  4C9D A;  2YQ0 A;  3NNA A;  2C42 A;  4R25 A;  5E33 A;  2HVZ A;  3THP A;  3UN5 A;  3I87 A;  1LW2 B;  4I7F B;  3AA9 A;  4P9S A;  4Y3C A;  2YWF A;  2O1P A;  4I67 A;  5DET A;  5DDP C;  1TK8 A;  1KTQ A;  2EBG A;  2HAI A;  4RBU A;  1LNQ A;  3Q23 A;  4JV5 J;  3OTO F;  4L73 A;  2QT7 A;  2YNI B;  3UVJ B;  4QYR A;  1UZH A;  2CPX A;  2R2T A;  2N3O A;  5HVG A;  3R5C A;  1GTE A;  1M5H A;  5KT5 A;  4LF7 F;  1Q0N A;  1IXK A;  2L48 A;  2MZT A;  3P4U B;  4LRB A;  3C46 A;  4JI3 J;  4PUO A;  3QIP A;  2BJ8 A;  3CJ3 A;  2J0S D;  3MMC B;  1BGX T;  2CPI A;  2VQE F;  4WE1 B;  1EZZ B;  4O44 A;  4D3G A;  4AQY F;  4Q0B B;  3GJQ B;  2JWN A;  1YKW A;  2ZJP Q;  1RT5 A;  4YY3 F;  4JI6 J;  3CO0 P;  4M5I A;  1OIA A;  3EDR B;  1R89 A;  3OTC A;  4LRC A;  4F04 B;  4Z37 A;  1HWK A;  4DPO A;  2UP1 A;  3UDC A;  2KVI A;  2XZW A;  2B4O A;  5C25 B;  2DYA A;  2JRS A;  1TK0 A;  1AB8 A;  2V8G A;  1U0S A;  1Z2L A;  2BE9 B;  4NE9 C;  2CQP A;  2KKH A;  1IKW A;  1FNM A;  1AUD A;  4PXC A;  1IBL F;  1U8S A;  1PIE A;  1HBM B;  4XK8 C;  4ID8 A;  2QA2 A;  3A13 A;  1B4S A;  3N5B A;  4JV5 F;  2W9C B;  5CYJ A;  2J9E A;  3QIP B;  2H4Y B;  4CYU B;  3QRR A;  1Y10 A;  1SJR A;  4GMK A;  2DNY A;  5AE2 A;  1JLB B;  1TL4 A;  2L08 A;  4JI4 J;  1HQ2 A;  3VR1 A;  2BVZ A;  4B9V A;  3A8E A;  2FLN A;  1YZ6 A;  2VBX A;  3MMJ A;  3K58 A;  3TQ1 A;  1S6O A;  3NNC A;  4DV3 F;  2VKZ G;  4KHR A;  1ZAX A;  2ZBP A;  1X4H A;  2J9D A;  4NRT A;  4OQJ A;  3CUN A;  3DC2 A;  5LMU J;  1QDU B;  3CW2 C;  1X5T A;  4OI1 A;  2IVF B;  1DLO A;  3D7S B;  1HQU B;  2PMW A;  1DHM A;  1OJ4 A;  2RT3 A;  2M70 A;  3NBP B;  4UTG A;  3M8S A;  2QE5 A;  1JQG A;  1YJV A;  2VPZ B;  3KJF B;  2NQP A;  5D4L A;  5HJY A;  2VBW A;  4ZJL A;  4DV0 F;  4RNM A;  3UI3 A;  1JLG B;  2W8K A;  5K20 B;  2J0W A;  3Q89 A;  2AEM A;  2PMH A;  2F8M A;  4I2P B;  2MEW A;  4OYM A;  1RT4 A;  5E3R A;  3Q83 A;  1OQ3 A;  1P6T A;  1JMT A;  3CJT A;  4KH1 B;  3RAM A;  4CP5 A;  1BQN A;  5IZH A;  3KLE B;  4DR3 J;  2JVO A;  3PY8 A;  4QYZ J;  1XN9 A;  2XBP A;  4OV1 A;  4DR3 F;  2XO6 A;  5H9E J;  1UFL A;  2O5D A;  4YUD A;  1NJZ A;  2UVU A;  1RWV B;  3BKF A;  3CJS A;  4NLO A;  1XMB A;  2AIR B;  1CS4 B;  2YWE A;  3FQL A;  1UW4 A;  4OYP A;  4OL8 A;  4X4U A;  5T41 A;  4LFB F;  2ZH1 A;  2W7O A;  3EZU A;  1EHW A;  3NCR A;  1IBC B;  4QW9 A;  1HBO A;  2AX0 A;  2D74 B;  2OPP B;  3QFH A;  1R27 B;  1RHQ B;  3T9Z A;  2COL A;  4RW7 A;  3WQP A;  5DS7 A;  5F9L A;  4P7V A;  3D6F B;  4KO0 B;  3BEG B;  3HZE A;  3H25 A;  4AL5 A;  3H7H B;  2ZNY A;  3CT9 A;  3HXM A;  2BRK A;  1VC5 A;  3DRR B;  3HJF A;  2FPH X;  5FII A;  3DHW C;  2J8S A;  1R0C B;  2FJD B;  4ZPB A;  5D6G A;  4P75 A;  1WC1 A;  2XHC A;  4A8O A;  1JXL A;  3X1L B;  1G1X A;  3C6U A;  3EMT A;  2CZ4 A;  4DQQ A;  4X66 F;  4EU0 A;  2HVD A;  2N7Y A;  2KG0 A;  5D3G B;  1TZ0 A;  3E8O A;  4DR5 F;  5IM0 A;  4TQS A;  2J5A A;  2MJN A;  2POK A;  1T94 A;  1FKA F;  2C2D A;  4KC5 A;  2OMO A;  2C1E B;  5RUB A;  2YKM A;  4EEY A;  4YDX A;  1YJN S;  3MED B;  4RW4 A;  5DLF A;  3JSM A;  5EHH A;  4DSI A;  3IXQ A;  1R3N A;  4DPX A;  3SXL A;  1SQG A;  3IGV A;  2CPE A;  3LOU A;  4NYP A;  2WW8 A;  3RTV A;  2BDP A;  4ECY A;  1CSJ A;  1H7W A;  1NBE B;  1NRK A;  2CXE A;  3R1H A;  2V2V A;  4JI7 F;  4ID5 A;  4K8R A;  1LQ9 A;  4JV1 A;  3TX0 A;  4OX9 F;  1L3T A;  4F4K A;  3KJV B;  1NCL A;  1N5T A;  2IRY A;  2ALY B;  2V8P A;  5C2G A;  4NPO A;  1JXV A;  3CCM S;  2V8H A;  4RW8 B;  1FJG F;  3BRE A;  3KLG B;  2QC3 A;  3H40 A;  1RTD A;  1BQM A;  1UEV A;  4K0K J;  5CYM A;  2IHR 1;  4WU3 A;  1K0V A;  2WVF A;  4JB8 B;  2BW2 A;  3CJK A;  4RU9 A;  2DRA A;  3POT A;  2W4P A;  3KKF A;  3PEH A;  1BHN A;  4NI2 B;  2QZ8 A;  4I4B A;  3US5 A;  4ED5 A;  4BWM A;  1ZTW A;  2XMJ A;  2KT2 A;  1UA0 A;  5K14 A;  1OPI A;  3TJ8 A;  2MZJ A;  3UD4 P;  1L5U A;  2IYI A;  1RWU A;  1TMM A;  1WDT A;  3JQJ A;  1X4G A;  2V2Q A;  1NKB A;  3TUP A;  3VZH A;  2F4V F;  3PJW A;  2LQ8 A;  3VQT A;  1U1M A;  2P6T A;  1SC4 B;  2DR9 A;  1YK9 A;  2Z8Q A;  2YQ1 A;  3H8Y A;  1YJT A;  4CLK A;  4AL6 A;  2Z2Y B;  1S1U B;  5CYQ A;  2I9S A;  5GAG I;  5KFQ A;  5KFO A;  3CCU S;  4IOC Q;  1N8R T;  3LAN A;  4XPC A;  4DV3 J;  2ZH2 A;  4J9U E;  4F4Y A;  2WAQ D;  3OL9 A;  2FIU A;  1X8D A;  2JLE A;  3P96 A;  4OMF G;  1DTQ A;  4RLE A;  3MI7 X;  3W5Y A;  2YVS A;  4E8U A;  5BR8 F;  1CJT B;  1GMU A;  2DR5 A;  3OVB A;  1GMW D;  2GS8 A;  4ER8 A;  5IT9 Y;  3AT1 B;  2HQF A;  4GKJ J;  4F0H A;  1FI4 A;  4IG3 A;  4USH A;  3WDO A;  2VBZ A;  3KG1 A;  5CD4 A;  4YHH J;  3PKM A;  1S1W B;  4RNF A;  2QTW A;  3AOB A;  3LGM A;  3C3L A;  1LXJ A;  3GJS B;  5HMX A;  2D41 A;  1RTH A;  4NXM F;  1A6L A;  1NND A;  2K2P A;  1LWC A;  2GC8 A;  4PXB A;  2UV8 A;  3UD3 P;  2ROP A;  1KN6 A;  2HWT A;  2ZUA A;  4M95 A;  1NZA A;  1EP4 B;  1URR A;  4USW A;  2NXE A;  3W8G A;  4AND A;  2EFO A;  1VHI A;  4B3T F;  2GGP B;  4P74 A;  1K47 A;  3UO0 A;  1UTA A;  3I0R A;  1L3K A;  1M5S A;  2MY8 A;  3MM6 B;  2HUR A;  3SCK E;  1VS3 A;  1BLU A;  3KUG A;  4CT8 A;  4S0M A;  4UZC A;  1TKT B;  1M5K C;  5DLG A;  1F9H A;  4J9S A;  4DR1 F;  2HVH A;  3W66 A;  2APO A;  1IR2 A;  2R7X A;  1X31 C;  4MFB B;  3M32 B;  2PMZ D;  2ROG A;  4M94 A;  1VRT B;  5F8H A;  2XMM A;  2ZWP A;  2RDJ A;  5EUH A;  1FKO B;  2EW9 A;  2C2N A;  1VQ6 S;  4QQB A;  2B4U A;  4FF2 A;  3M6X A;  3PAC A;  3KLF B;  3T19 A;  3BGL A;  3M2V B;  3SV4 A;  4NYZ A;  3PYE A;  5D15 A;  2VFU A;  3ZZZ A;  2X1F A;  2E5L F;  4LFB J;  4G65 A;  4FKX A;  2FC9 A;  4ZVE A;  3H5U A;  1X5P A;  3R5G A;  4YP3 A;  1FXL A;  3EE3 A;  1DAR A;  1N5Y B;  3TJ9 A;  5CAA A;  3NXZ A;  1HBU B;  2YX4 A;  3RR7 A;  2DHX A;  4YB5 A;  4IR9 A;  4DJB A;  3MPD A;  2HFV A;  4LBI A;  4KGM A;  5U47 A;  3EIC A;  2BMB A;  2KG1 A;  2HHH J;  2DGQ A;  5F0W A;  1F3F A;  4Y65 A;  3H2V E;  3ILJ A;  5L1K A;  4A8W A;  3OLB A;  2LKZ A;  4U6P A;  2KZZ A;  4B9N A;  2WW4 A;  4HH1 A;  2FVP A;  4AFF A;  5HL7 Q;  1BWE A;  4AD6 A;  3HFV A;  4OX6 A;  1JKH A;  3PTW A;  4ZP6 A;  3G96 A;  2W9A A;  2UVR A;  3UDE A;  5K8M A;  4N56 A;  3HHL D;  5HBM B;  4M5D B;  4JI7 J;  2FVC A;  4UUX A;  1FK9 A;  2OI2 A;  3OT9 A;  4OFZ A;  4QBU A;  4LF6 F;  4O3N A;  4M5D A;  1FFG B;  5KFV A;  2F8E X;  1RAH B;  2LXI A;  2Z56 B;  3H20 A;  4FP9 A;  4DV5 J;  5D8H B;  5HJX A;  3TX8 A;  2CYY A;  3HSJ A;  3J81 j;  4F0K A;  1XQI A;  4OHZ A;  1S6P B;  2K1R B;  1N88 A;  1YDL A;  4N7T A;  3SCJ E;  5C7P A;  1Y7P A;  4KRW A;  1VBX A;  3HHN B;  4N8N A;  1TKD A;  4LFC F;  4NRU A;  3W5X A;  3TVZ A;  3R1L A;  4C8K A;  3AB4 B;  3QWP A;  4RU2 A;  1IKY A;  4JI4 F;  3BN4 A;  3M8P A;  4F36 A;  2M88 A;  2Y1L B;  2KU7 A;  2CPZ A;  4GVL A;  4IFV B;  5G0R A;  4DX5 A;  4LSZ B;  4Y6I A;  2LEC A;  1VQM S;  1XNQ F;  1FRK A;  1HNX F;  4NZ7 A;  1RHK B;  3Q8R B;  2MSS A;  2MKH A;  2A6M A;  3C2P A;  2CQ3 A;  1DTT B;  4B9M A;  2YH1 A;  1FKO A;  3EGW B;  4IUF A;  1V5V A;  2G1H A;  4QWA A;  4RJV A;  1NDK A;  2CJB A;  2JJ4 D;  4BCA A;  2E5J A;  3AOA A;  3D0H E;  2MLY A;  3MWB A;  3W3S A;  3DGP B;  2IM0 A;  3CXC R;  3IBW A;  5FLX Y;  2EKY A;  2LP4 A;  4ZLL A;  1RWW B;  2BOP A;  2DRB A;  4JYA J;  1MWY A;  4WP9 A;  1H38 A;  1ULR A;  4HLB A;  1U48 A;  2B51 A;  4WP8 A;  1NHK L;  1P1L A;  1PSD A;  2BKP A;  2UVW A;  2QJ3 A;  4MK9 A;  3I9Z A;  4E98 A;  1XMO J;  3WC2 A;  4B3R F;  4V19 J;  1HW9 A;  3NEK A;  2R7V A;  4DS5 A;  3OSN A;  2GVD A;  2JVR A;  3LGH A;  1NSQ A;  4DV6 F;  1ZZN A;  2E9Z A;  4GKK F;  5B0F A;  1FEH A;  5HMY A;  1J5O A;  3L7U A;  4GVB B;  4LF2 A;  5KOW A;  4UZB A;  3G8S A;  4JI3 F;  5HAO A;  1RIS A;  1RTI A;  1FNX H;  1WC4 A;  1ROF A;  2YNH B;  2MKS A;  3PX0 A;  1R6Y A;  2OLW A;  2JC1 A;  3V6K A;  1AFI A;  1SQE A;  4FF1 A;  2W7A A;  3GFX A;  2C3U A;  1SPB P;  5A2Q Y;  1X7V A;  1J5O B;  3QAU A;  2RRB A;  4DUY F;  3MM8 B;  5T14 A;  1D1U A;  1KQG B;  4XTT A;  4ZCI A;  2ZHB A;  4X4R A;  1KQF B;  3CCT A;  3MEC B;  4LR7 A;  4OHV A;  3SSR A;  1CJT A;  2ZWO A;  2VC0 A;  4FN5 A;  4D3H A;  3LWL A;  2VFS A;  1NDL A;  3CCL S;  2UXD J;  2G4B A;  3K7R A;  2DXE A;  3C14 B;  4O23 A;  1SJ1 A;  2R7R A;  1N6Q B;  1RDR A;  3GTY X;  2G2Y A;  4ZVT B;  5F8J A;  4EGL A;  1QSL A;  1C1C A;  2G0J A;  2G0C A;  1S1T A;  3NAH A;  2J0Q D;  2M8D B;  5HSP A;  2BM0 A;  1VQ8 S;  5A8R B;  4NZ0 A;  3BR8 A;  1CUL A;  3MFH A;  1YG0 A;  3GIR A;  5H9F J;  1D0E A;  3VGS A;  1WOP A;  2A2C A;  2LA4 A;  1SI9 A;  5K5M A;  4NLQ A;  1X5O A;  5J2P B;  3IS9 B;  3PIO Q;  4HI1 A;  2VG5 A;  4WFN Q;  3PW7 A;  1BMQ B;  1YQH A;  2PGC A;  3PRB A;  1RT6 A;  5DGB A;  3PR5 B;  4RKU C;  3T5K A;  3TI0 A;  3JQM A;  2GJ2 A;  3CC2 S;  4A8S A;  4W92 B;  2RKI A;  3TA0 A;  3D9B A;  3NP5 A;  3CMA S;  1IR0 A;  1MRO B;  1R43 A;  1KQK A;  2Z0G A;  1VBZ A;  4EZ9 A;  4H4M B;  3FSX A;  3A3P B;  2XC9 A;  2E1M C;  2HIQ A;  2KT3 A;  2OEM A;  4QR0 A;  2HS0 A;  4C2M A;  4FKY A;  3FRY A;  3BGR A;  2R7W A;  5BYS A;  4I2Q B;  1VRU A;  4LRF A;  4CLZ A;  5F9N A;  1RT7 B;  2H9Z A;  4DN0 A;  3QZ7 A;  4DLG A;  1NK0 A;  4LF6 J;  2W4D A;  2GNK A;  2LXF A;  2VAS A;  3TEH B;  3MEE B;  4WXO A;  3HPO A;  4P73 A;  1UW9 A;  4K0K F;  2W2P P;  4QIW D;  2L41 A;  1S6Q B;  2M8H A;  3G82 B;  4B3M J;  2DD8 S;  2G1D A;  4QIG A;  2LMI A;  2HZC A;  4CH0 S;  4ECT A;  1S97 A;  4NLT A;  4K50 A;  5HBM A;  2OTJ S;  1TKX B;  2XSJ A;  5EN1 A;  3EVO A;  2I38 A;  3GZ7 A;  4W4M A;  3OJS A;  3GV8 B;  4K4Y A;  2F4V J;  4F4W A;  5CZV A;  3PO4 A;  1LFW A;  3MM9 B;  4DPT A;  1FE4 A;  4P2F A;  4A8Y A;  3BPS P;  4HAC A;  3IFE A;  4NLD A;  3CGI A;  3G8Q A;  5KFW A;  4F02 A;  1UP1 A;  5HP1 B;  4C48 A;  3KK2 B;  5A76 A;  4JUZ A;  2AHO B;  4MKY A;  4RUC A;  2F8H A;  2NLW A;  4OZ3 A;  3GII A;  2D9O A;  3BBB A;  4RBV A;  3GCX P;  2UU9 J;  4Q5V A;  4C8Y A;  3CIM A;  2DH9 A;  1HQE B;  2EWH A;  4QZV B;  3G86 A;  3BQ1 A;  4I56 A;  3WBZ A;  4IO1 A;  1HBO B;  3IMQ J;  4ZLJ A;  4K4U A;  2DGS A;  1U7L A;  2CPY A;  2HW3 A;  1WG1 A;  2CNN B;  2XYH B;  4ED6 A;  3ZTQ A;  1T0T V;  1DUR A;  3EVW A;  3R97 A;  2DO0 A;  4B3T J;  2BM1 A;  3DU5 A;  4NL5 A;  1KHW A;  1K0T A;  4HKQ A;  2A10 A;  2MY7 A;  1WG5 A;  3Q8Q B;  3MPV A;  3V6J A;  5CHC B;  2FHJ D;  3OBI A;  2H48 B;  4J91 A;  4WTO B;  1IVZ A;  4EYH B;  4KHM A;  4ED0 A;  4WFX A;  1DQ9 A;  4H4K A;  5J2M B;  5AXL A;  1A0O B;  4USJ C;  3NOG A;  3TRG A;  2Y8Y A;  2UZA A;  4NCG B;  3HVR A;  2CWX A;  3HVA A;  2MHN A;  1TFW A;  3M4X A;  1NH7 A;  3D5M A;  4OZ2 A;  5LJ5 Y;  5C24 B;  3LO3 A;  1NJI T;  2KT5 A;  2KM8 B;  2XZT B;  2L9D A;  2UXD F;  3HT3 A;  1R8B A;  2CPH A;  1VR6 A;  1WKJ A;  3EGN A;  1VIX A;  1S6U A;  4MKV A;  5E7O B;  2DEI A;  3K5O A;  4ZVQ B;  1I94 F;  2Q79 A;  5I4M A;  3T1H J;  4ZPW R;  2HMI A;  2N3L A;  2V8D A;  1JJC B;  5HQ8 A;  1DQA A;  1SJ4 P;  4DQI A;  4TU9 A;  4KYZ A;  4I69 A;  8AT1 B;  3CO9 A;  1Y3J A;  3M2U A;  3DNC A;  4DX8 H;  1Z2Z A;  3CME S;  2FDN A;  4X4T A;  2V0N A;  2RE1 A;  3IAM 9;  5HRO B;  4L6V 3;  4ILL A;  3G6E S;  1P27 B;  1S9G B;  2RF2 B;  3J7Y U;  3M6W A;  4FS2 A;  4UQG A;  1M90 T;  2AWZ A;  3QPI A;  4B3S J;  1Q1K A;  4RL1 A;  1V3R A;  5AXK A;  5BYR A;  3UE2 A;  2KFN A;  4J9O A;  3TA1 A;  1Y5N B;  3QGP A;  2Y3Y A;  1T11 A;  4ZPD A;  3TZZ A;  2OUG A;  3AJ1 A;  3ETO A;  3SFG A;  2ZC4 A;  3QNW B;  1KKH A;  1UWA A;  5K14 B;  2UUC F;  2JNJ A;  1OO0 B;  2X51 A;  3R7N B;  5KG0 A;  1AYE A;  4P71 A;  4DUZ F;  3R7S B;  5ETO A;  3UN3 A;  1MU2 B;  2BJE A;  4U7U K;  3R27 A;  3W2V B;  3D3C J;  4X66 J;  4ALZ A;  2OPQ B;  1HHS A;  3KG0 A;  4HT7 A;  2HRU A;  1ITP A;  4XIU A;  2KHD A;  4HHJ A;  2DR7 A;  4HI2 A;  2VF3 A;  5KG7 A;  3QO9 B;  4RW8 A;  2Z58 B;  4OYB A;  1VQY A;  2PFD A;  2QYG A;  4CLS A;  4F2S A;  4TU7 A;  2C3Y A;  4O44 B;  5KFT A;  2NZ4 A;  4YR0 A;  2UXB J;  4OJ3 A;  3AY0 A;  1H0H B;  1S0M A;  4CO0 A;  2YWH A;  2LEA A;  1NSK L;  5E5N A;  3U27 A;  1URN A;  2R7S A;  4AXJ A;  1TU0 B;  5LL6 d;  4OI4 A;  2X1B A;  3A8K A;  3FEX B;  4DPW A;  2YNI A;  3S8S A;  1M5O C;  2F63 A;  2XWX A;  5ETK A;  2HHV A;  3D68 A;  3M6U A;  1F0X A;  2PII A;  2RQ4 A;  4PCQ A;  1E6V B;  4NEZ A;  4ZVS B;  2V63 A;  2YKP A;  3N9U C;  4P10 A;  1X9W A;  4V19 X;  1LW2 A;  3CCW A;  1R8C A;  2KO1 A;  2QN6 B;  5LOQ A;  5T7L B;  1B64 A;  3DCA A;  3ILL A;  2YKN A;  3MF5 A;  4BC7 A;  2AW0 A;  1QUV A;  4QIV A;  4EFA C;  5IM0 B;  1XMO F;  5C42 B;  2P9E A;  4ILM A;  1HIY A;  5LMN J;  3CB4 A;  1EKR A;  1RU1 A;  3K8W A;  5LM7 E;  3OV7 A;  3H4B A;  1HKA A;  5KFG A;  4K4X A;  1TL1 A;  4I6A A;  1RYS A;  3MGJ A;  3C6U B;  4QR2 A;  3VAH A;  2DNL A;  1JK9 B;  2UUA J;  2YQ3 A;  4FPI A;  4NLU A;  3T1H F;  4X4N A;  1S5Z A;  4B02 A;  1RTJ A;  2ZE2 B;  1VOM A;  4OJ1 A;  1O6X A;  3R8Y A;  5IT0 A;  2LQB A;  2E1C A;  5GAE I;  2XMA A;  4IR1 A;  5D78 A;  1QAX A;  2R3V A;  1HMV B;  4XAK A;  4RW7 B;  2ERR A;  1U1K A;  1KOO A;  4DR2 J;  2NR0 A;  1T05 B;  2G9O A;  1F2G A;  1S59 A;  2OEL A;  1FKP B;  5B0E A;  5LSL A;  4CM2 A;  4U9R A;  1FJC A;  2XMK A;  4L3K A;  2A6O A;  2W9B B;  4ZP8 A;  4DI6 A;  2BE2 A;  1QUP A;  2VZ9 A;  5AXM A;  3QJJ A;  2HNY A;  2ZBI A;  4B9T A;  3GYX B;  1F1B B;  2OPS A;  2WSF C;  4K5R A;  3W63 A;  5GAG U;  1E6Y A;  4R0J A;  5D3G A;  1SCJ B;  5IFM A;  4C8Z A;  3FSI A;  1T3N A;  1NJW A;  2YX1 A;  3HK2 A;  1NK9 A;  3I4P A;  1RCO B;  3GFZ A;  4ECR A;  1ZH5 A;  3QT5 A;  4Q8E A;  3DXB A;  5ETV A;  4J9M A;  1VFJ A;  3ILI A;  4PR6 A;  4C98 A;  2HFZ A;  2DY1 A;  1UPP A;  2CWK A;  2J7W A;  4H54 A;  1UPM B;  5IQQ A;  3AH6 A;  3KHG A;  3I6P A;  1RTZ A;  2QSF A;  3F41 A;  5ETQ A;  1V6H A;  1R7I A;  3ISN D;  1HBN B;  4PPZ A;  3MMA A;  3GR1 A;  2IAJ A;  4FNI A;  3BO2 A;  4KBI A;  3ZZ0 A;  3NBP A;  4Q43 A;  5HLF B;  4ZPC A;  1XNR F;  2VU5 A;  2CQC A;  2QFJ A;  3QT7 A;  1JJH A;  4F67 A;  5AE3 A;  3P5T L;  3VGT A;  1RGV A;  4DCO B;  2EK1 A;  2HND A;  2DNO A;  3DRS B;  2MKJ A;  1WF0 A;  3WIV A;  4YME A;  1S0O A;  4DZD A;  4E0D A;  1S1V B;  4TN2 A;  1I94 J;  2BUN A;  5DM6 Q;  3H4D A;  1S0N A;  4WK3 A;  1KSP A;  4RWW A;  5H9F K;  4DS4 A;  4HVZ A;  1PO6 A;  2VPX B;  4PZV A;  1WKL A;  1IBM J;  3B4M A;  1V9O A;  2CZ9 A;  2Q43 A;  1IN0 A;  1N5Q A;  1RHM B;  2CNL B;  3MM7 A;  1FFW B;  1F5A A;  3QFW A;  2J0X A;  2DHH A;  1DJ0 A;  3KLV A;  1EET A;  3CDA A;  2EI5 A;  2PT0 A;  5B0A A;  2BKN A;  2KRB A;  3DLK B;  1ZM9 A;  3NGR A;  2F65 A;  5BR8 J;  1HWJ A;  1N34 J;  2IYG A;  3LAM A;  1Q82 T;  1NAQ A;  2DPJ A;  1EIY B;  4OI0 A;  2XS7 A;  4NZ6 A;  3AD8 C;  2JEI A;  1JLE A;  1M5V C;  2K3I A;  1TFY A;  4UOC A;  1HWL A;  1AW0 A;  3OTB A;  2D9P A;  2QIF A;  3W2V A;  2PC6 A;  3EUN A;  3CDU A;  3GYG A;  1KBR A;  4RW6 B;  1H72 C;  3MAA A;  4YB7 A;  3TAM B;  6FDR A;  2J7U A;  1D3W A;  3OHB A;  3DOK B;  3K5N A;  4IO9 Q;  1GMV A;  4N5S A;  1FF2 A;  4CIO A;  2KH9 A;  1JJ4 A;  4IQM A;  3PFE A;  5F8L A;  2ZH9 A;  4WF9 Q;  1WHY A;  1U2F A;  3O44 A;  4NEY A;  5GMK a;  2NSB A;  2NPF A;  4U7U D;  5KT4 A;  3BYR A;  2XO7 A;  3PJ9 A;  2P5V A;  3CD5 A;  4URS A;  3H5Y A;  3K5M A;  2PD1 A;  1YIT S;  4LMZ A;  3J80 Y;  3VGU A;  1WJ9 A;  3E51 A;  2PA8 D;  4X2B A;  2GVZ A;  4ZP7 A;  3AQO A;  1XMQ J;  2HGM A;  2AGQ A;  3FUY A;  3M2R B;  1FJG J;  3G6V A;  2HND B;  3DRS A;  1OY9 A;  3KDN A;  1T7P A;  4O3R A;  1UVM A;  1VIO A;  2R8G A;  2EXU A;  4ETX A;  3BSN A;  1U2R A;  2P8I A;  4FS1 A;  1JX4 A;  4LQ3 A;  2Y0B B;  1Q95 G;  4WFZ A;  4FZV A;  1S7H A;  2ZD1 A;  1ZYQ A;  4CO5 A;  2B9W A;  4MYU A;  3K57 A;  1RLC L;  3NCQ A;  4ZVG A;  1RT3 B;  1PYS B;  2GMJ A;  3H2U B;  4KV8 B;  4P2X A;  1YRU A;  2DT9 A;  4C0O C;  4CZC A;  3TZY A;  2BEF A;  2P9C A;  1CC7 A;  5DZ7 A;  1S7I A;  5K9F A;  3WX4 A;  3H5X A;  3GFY A;  3KUE A;  1GXT A;  4NCG A;  3W9H A;  1RWX B;  4ENO A;  5IT4 A;  4ICL B;  1KRP A;  3AFG A;  1MWQ A;  2WON A;  5K8O A;  4R0E A;  1LEO A;  4Z7C A;  3K59 A;  5FJ4 A;  3RZA A;  1VLY A;  4AL7 A;  2CPF A;  2AKW B;  2E5H A;  1TVR A;  3BSA A;  3CD0 A;  1Q8K A;  3CDW A;  5B08 A;  2NXJ A;  3V81 B;  4N76 A;  1TKZ A;  4ZPV R;  2VDH A;  1HNX J;  2G2Z A;  3FCH A;  3RB6 A;  2UUB J;  4DOZ A;  3RBE A;  4URG A;  1XNQ J;  4P52 A;  2B8P A;  4RR5 A;  2DXF A;  4Q8F A;  3GIL A;  4F3Q A;  4CO4 A;  5D0H A;  5AT1 B;  4B17 A;  2BAN B;  3TZW A;  4O0N A;  2HWH A;  2DPI A;  1NEE A;  1RK8 A;  1DY3 A;  5AE1 A;  4CRJ A;  3J80 U;  3MXH P;  3ISZ A;  3GJT B;  4JYA F;  2JH3 A;  1U25 A;  2DIT A;  3M8Q A;  1RKI A;  4HEA 9;  4MYT A;  4PKD B;  4LVO P;  1UJ6 A;  2E29 A;  1G4C A;  2HFO A;  3GG1 A;  1NU4 A;  1HNV A;  3OTE A;  1BXN A;  1SH2 A;  2AF6 A;  1IKV B;  1U1N A;  4OYZ A;  5IC6 B;  4ZKA A;  5JJB A;  3JB9 k;  2V67 A;  2OML A;  4OX7 A;  2YWK A;  2CVI A;  2OFH X;  3UCZ P;  4IQX A;  2XCA A;  2L3M A;  3IGN A;  4LJM A;  2BJD A;  4LRA A;  3SSS A;  4R5P A;  3LWM A;  1JJ2 R;  1IBK F;  2KZM A;  4JI5 F;  4I6W A;  3OR1 A;  1WC0 A;  1V3Z A;  1UKU A;  2V34 A;  3KHH A;  1A7G E;  1IM4 A;  1VQS A;  2IM3 A;  4A8K A;  1E6V A;  3KMQ A;  4FXW A;  4Z7Y A;  3SQG B;  2WOM A;  3D4J A;  1RT2 B;  1YVF A;  5C2C A;  3J7A N;  4QPT A;  2M3D A;  1WUU A;  4EZ6 A;  2E1P A;  5L1I A;  2DB1 A;  1Q8I A;  5M2R A;  3UPF A;  4EBC A;  4ZCM A;  1S6Q A;  2ZVI A;  4NMX A;  2XCP A;  1FXR A;  2F7V A;  2ZHO A;  3H0P A;  3BPD A;  3FRZ A;  4ZVH A;  2H5J B;  4JOU A;  3HX9 A;  4OI3 A;  3R6G B;  1NME B;  4NML A;  4PWU A;  2RQK A;  4QWE A;  2VHG A;  3P6Y C;  1LFP A;  3KK3 A;  1NXI A;  5DO2 A;  3HHL A;  5HN0 A;  1N52 B;  4AXI A;  3OFH A;  2IMO A;  2KN4 A;  2YX7 A;  9RUB A;  2GQ2 A;  3FBE A;  2VG7 B;  3M9N B;  3R6L B;  4ATN A;  2RJZ A;  3D6T B;  1JLC A;  2JZ5 A;  1RKJ A;  1NDC A;  2RKI B;  3WIU A;  2C2K B;  2HQG A;  2WZ1 A;  2YY3 A;  5B7W A;  1YJU A;  3D3B J;  4M5N A;  1F9E B;  4RX6 A;  1JLQ A;  4EMD A;  1B70 B;  1SKW A;  1HYS A;  1KVJ A;  1KLM A;  3D2W A;  2VON A;  2RML A;  1KLM B;  2C2M B;  1CUL B;  4RO0 A;  2CJY B;  2E7V A;  2JFK A;  1S9G A;  2RF2 A;  1H2T Z;  2BOA A;  1SH3 A;  4I1T A;  3VAG A;  2CJX B;  2CDQ A;  2JHE A;  2VPY B;  4EUV A;  2AGP A;  5GMD A;  2HFU A;  4QIE A;  2BZ2 A;  3IG1 B;  3N28 A;  2OFG X;  4LF1 A;  4EO8 A;  5EGY A;  5J1E B;  3KHL A;  3RRG A;  4O3O A;  1N6Q A;  2DGX A;  2BJ7 A;  2NPI A;  1AZS A;  2VG6 B;  3MEG B;  3ENV A;  1CJU A;  5DG7 A;  3KWM A;  2RQC A;  2ASJ A;  4F4A A;  5LT5 A;  3BJY A;  1S79 A;  4FYY B;  3M9O B;  4GKJ F;  1Q8L A;  3E01 B;  3CED A;  4DUT A;  2CA9 A;  3O2I A;  2HHS A;  1U49 A;  4UY8 5;  5GAE U;  3CMQ A;  3KG4 A;  2B5J A;  1PGZ A;  3UQS A;  1QVF R;  4NA3 A;  2FUG 9;  2M9K A;  4PPD A;  4DQR A;  2RNE A;  1FNO A;  1AT1 B;  1XR5 A;  2YNH A;  4UW2 A;  4EBD A;  2LXU A;  2VKR A;  2ZOM A;  3QYY A;  3SI8 A;  2XUL A;  3IM9 A;  1VRQ C;  1R6V A;  3DMJ B;  4GVB A;  4O4G A;  4LF5 F;  3I32 A;  2MKC A;  1SL1 A;  4LF9 J;  3SQG A;  2VB6 A;  4CLP A;  3HKW A;  2A3J A;  3K17 A;  3MZI A;  3P49 B;  1KP6 A;  4C0H A;  4OHY A;  4DV4 J;  3L9Z A;  3I55 S;  3L3C A;  3I0S A;  4HT5 A;  3PV8 A;  5ETP A;  2WTF A;  4JI1 F;  3PYD A;  4R8U A;  2WVD A;  2P2C B;  2XTJ P;  3FK4 A;  5A8K A;  3Q22 A;  2HSE B;  1R8H A;  3BF4 A;  1YIJ S;  4ECQ A;  5KFN A;  3TUI C;  3U02 A;  3PRD A;  1B0V A;  1N56 A;  4B3M F;  3AJD A;  4PRF A;  2DEJ A;  3D1O A;  2XMU A;  4KGV B;  4F8R A;  1SVD A;  1TUW A;  3DDI A;  3S1T A;  3M8Q B;  1SXL A;  2BXJ A;  3IR7 B;  2DNP A;  2D3Z A;  2DHS A;  2ZIT A;  3MCO A;  4USI A;  2FLO A;  2AYB A;  3CE8 A;  2DCU B;  3Q8V A;  3IWX A;  2I1R A;  3VAM A;  1SC3 B;  1CG2 A;  1MN9 A;  3TNV A;  2HHH F;  3GP9 A;  4GC6 A;  3E2E A;  1GX6 A;  2WHO A;  3HKZ D;  2B6A A;  1IKY B;  3A4T A;  3M8P B;  3N4W A;  4ZIT A;  4RPF A;  4DL4 A;  1SJ3 P;  4K4S A;  1FRJ A;  1GQE A;  1TMJ A;  3SDE A;  1DZ5 A;  3H5S A;  1XWL A;  1TKZ B;  4YFU A;  1VBK A;  2C3M A;  5A0Y B;  3ZZY A;  3BO4 A;  1S12 A;  2B4V A;  1S6P A;  1JLF A;  3D28 A;  4OJG A;  3GV5 B;  3I82 A;  2EFQ A;  3QAT A;  2M52 A;  2IA6 A;  2FLP A;  4Y2I A;  5ETN A;  3FEZ A;  4LFC J;  2ACM A;  5KFJ A;  2B9E A;  1GAO A;  4LBP A;  3BDE A;  2ALZ A;  1M1G A;  1N5V A;  1S1X A;  1M0S A;  2RDD A;  3MPU B;  4G1P A;  4J5O A;  4MIW A;  3RJM B;  1X0F A;  4MK8 A;  3IAS 9;  3JTO A;  2GA7 A;  5KFI A;  2HBQ B;  3CIZ A;  1KVK A;  3NS7 B;  2DH7 A;  4UOG A;  3N0V A;  2PFF B;  3N6L A;  1WF2 A;  3C66 A;  4C8M A;  1JLF B;  4IFY B;  1SKU B;  4MK7 A;  1B7Y B;  4I2Q A;  2J9D E;  5D4O A;  1M5P C;  1N4L A;  1OY6 A;  3W7B A;  1WF1 A;  2W2O P;  5SZT A;  4B9L A;  3SDE B;  3O3L A;  5IV4 A;  4FXD A;  1F9F A;  4NX9 A;  5HAT A;  4M63 A;  2Z30 B;  4IOA Q;  1HBU A;  1MRO A;  2BRL A;  3A8J A;  4BC9 A;  4WZQ A;  4RBT A;  1RHJ B;  3RB3 A;  2MB0 B;  2UUB F;  3QSY B;  1XNR J;  1RT6 B;  3HJV A;  1S9E B;  5ETM A;  3TAR A;  2WVE A;  1JNZ B;  1B0T A;  1YZ7 A;  3ZZR A;  3RW7 A;  2VQF F;  2ZFH A;  1U1L A;  4DV6 J;  1RT1 B;  4DR2 F;  2A1B A;  3OL7 A;  1T02 A;  3I5A A;  3M7V A;  3R5A A;  3WC0 A;  1K44 A;  1S9F A;  1KR4 A;  4DMZ A;  3TAM A;  1MMD A;  1VRT A;  2AMC B;  5A8R A;  3M32 A;  4CLU A;  3IRX B;  2K3K A;  2FZK B;  1S1T B;  3MOZ A;  4F3M A;  3KHR A;  2PI4 A;  4LF8 J;  1O51 A;  1Y0H A;  3O6Q A;  4NA2 A;  1TKT A;  4ZPT R;  4RNN A;  1HNZ F;  4ES3 A;  4R8U B;  4TY8 A;  2H1Y A;  1WI6 A;  3DLG B;  1WDD A;  1U47 A;  3MM6 A;  3KNG A;  4ED8 A;  3QJL A;  5KFL A;  2G13 A;  3HFK A;  2J8A A;  2GAH C;  2GGP A;  3AHP A;  4HH0 A;  5B0G A;  5KG6 A;  3DDK A;  4WU2 A;  4QWC A;  1XR7 A;  3DLK A;  1V3S A;  3U1L A;  3JYT B;  3F56 A;  5I42 B;  1SKR A;  2IY5 B;  4M5J A;  5L1J A;  1EET B;  3FEY B;  4CH7 A;  1FO1 A;  3DMJ A;  5I3U B;  4ELT A;  1FER A;  1IQZ A;  3RB4 A;  3O1L A;  2E7W A;  2I0X A;  3RRH A;  1S10 A;  2ZM6 F;  2HZA A;  2ZJR Q;  2AEF A;  2KXN B;  3DOL B;  1PAU B;  2HIY A;  3VWS A;  2JLG A;  1S1W A;  4DQP A;  1LK5 A;  1IR1 A;  1T9X A;  2LQ5 A;  1NHV A;  1QM9 A;  1W7W A;  1RAJ A;  1ZAW A;  2C2O B;  2N4C A;  4QJV A;  1HR0 J;  3KTQ A;  3KFW X;  3OXF A;  4EO6 A;  1IBK J;  1HNI A;  3PHT A;  5GAH U;  4IKA A;  1TEL A;  4ZVF A;  4KPC A;  1HFE L;  1DTQ B;  3OL6 A;  3QWU A;  2IA0 A;  3NWG A;  5THW A;  2R7O A;  5LXY A;  5IOL A;  1CVJ A;  4TKT A;  2CG4 A;  1HBN A;  2WCX A;  3LUY A;  1WI8 A;  5E3A A;  4ZCK A;  4QPX A;  2DO4 A;  2X1A A;  3DRY A;  1FDD A;  2OIH A;  4DPU A;  2HGL A;  1WKK A;  3ETM A;  1N54 B;  5CD4 H;  4U7C A;  3DLB A;  2UXB F;  2WK4 A;  1K73 T;  4PWD B;  2KHC A;  2KI2 A;  3MCM A;  2QA4 S;  1JLA B;  2VQE J;  2DH8 A;  5KFS A;  1Q79 A;  2HHU A;  2QL7 B;  2RSQ A;  4LSN A;  2EC0 A;  3TUJ C;  4KHP J;  3PR4 A;  4BHQ A;  2G2O A;  3TQE A;  3EPG A;  4ED3 A;  3SZ2 A;  2JL9 A;  4DV5 F;  3DLE A;  3TW0 A;  3VAL A;  5IXU A;  3ELH A;  2QRR A;  3V6D A;  2ZH7 A;  3QT6 A;  4LIW A;  4DZ6 A;  3B8H A;  3PFO A;  1RBO B;  1T05 A;  3H90 A;  5AXN A;  1FFS B;  4LF8 F;  1IWA A;  1U6Z A;  1RU2 A;  2K7K A;  2R7T A;  5B0D A;  2MZ1 A;  5KAK A;  5CAB A;  5KG2 A;  3OR2 A;  3KLH B;  2M2B A;  4UY8 T;  2WB4 A;  2J6S A;  4Y00 A;  1TL1 B;  4OHX A;  1L3S A;  1VQ4 S;  3IP0 A;  4RW4 B;  2NCK L;  3GYN A;  3HD2 A;  2LEB A;  1N32 F;  1U8W A;  1B0P A;  1RLD A;  2C2Z B;  1VK8 A;  3SBM A;  4I68 A;  4LF5 J;  4MIB A;  3PNI A;  2R2R A;  2GO9 A;  4CO3 A;  2V4Q A;  3QZ8 A;  2DGV A;  4FBT A;  1TUG B;  1YGY A;  4CI0 B;  5DQI A;  4L72 B;  4OHW A;  2DIS A;  4DF8 A;  2AT1 B;  1FCA A;  2HK2 A;  1HNV B;  3IC1 A;  1YRX A;  3FNN A;  5D77 A;  7AT1 B;  2MQQ A;  3KLH A;  2OSR A;  5J2N A;  2MPU A;  4LRD A;  1RAD B;  2QFI A;  3OFF A;  2PDA A;  3FMW A;  1ZA1 B;  2BE7 D;  3PX6 A;  4LFA J;  4X65 J;  1ZM2 A;  2MZQ A;  1ZBT A;  4C3K A;  2L9N A;  2VDI A;  5JXS A;  2DCL A;  3C16 B;  5KFU A;  3CD7 A;  2DGO A;  2YPY A;  3LGN A;  3QT8 A;  3EYZ A;  4FYD A;  4YN3 B;  2HQ3 A;  2IMW P;  1DBD A;  1TL7 B;  4A47 A;  2ZOF A;  4PQA A;  4LF4 F;  3OTD A;  3FDS A;  1KHV A;  1XR6 A;  2H51 B;  3GIM A;  2Q66 A;  1NSA A;  5J1N A;  1MU2 A;  3LP0 B;  3F0N A;  3UDV A;  4ELV A;  2HK3 A;  3C19 A;  2LU2 A;  3IWL A;  1KWM A;  5KT7 A;  2XHW A;  2VA2 A;  3TVK A;  2E9R X;  4PWW A;  2MYF A;  4KKO B;  1UVK A;  2GX8 A;  2WON B;  3D66 A;  4PEO A;  1C2P A;  1OMS A;  1X0P A;  2LLZ A;  2RVJ A;  3DYA B;  4EYI B;  1R0A A;  4MH8 A;  2AYM A;  4ZHR B;  4OJH A;  1RWO B;  4DHV A;  5K8N A;  4UUW A;  1N36 J;  1LWC B;  1SJF A;  4OZL A;  1RT3 A;  2IJN A;  5HRO A;  3R9L A;  4NXN F;  3UCG A;  3SCI E;  2YNG A;  4RNO A;  3CUL A;  5KFP A;  1EB0 A;  1H2V Z;  3M2U B;  5CH7 B;  4NLW A;  1T8E A;  2FLL A;  1HQU A;  2ASY A;  3NMA A;  2J6U A;  1UWB B;  3KK1 B;  1FTR A;  4U95 A;  2QLF B;  1O8B A;  3PW0 A;  4J7C A;  1DQ8 A;  1UWB A;  3KK1 A;  3M2R A;  3VGV A;  4C3M A;  3HD1 A;  2ZH6 A;  2D3O R;  2HYI B;  2WVB A;  1GK8 A;  1PYO B;  2UUW A;  1UAW A;  2RQM A;  3O5T B;  2MQO A;  3A1Y G;  3GE9 A;  1H3D A;  1MW7 A;  1FRM A;  2LQJ A;  1X4B A;  4G3I A;  5C24 A;  3BBF A;  2O3D A;  3HZG A;  4CLY A;  2FJA B;  4DV7 J;  2MQM A;  3JAM Y;  3OUY A;  3DHX A;  3OD2 A;  2AGO A;  3RB0 A;  2MZS A;  4IYQ A;  3UN2 A;  3C8Y A;  4ZLN A;  1GNK A;  3Q8Y A;  3CDE A;  2C22 A;  3JYT A;  3R7B B;  3G6Y A;  4KGZ B;  3BQ0 A;  1RAC B;  2KRR A;  3LP2 B;  4C0B A;  5J2M A;  1QSY A;  3IBF B;  2MHE A;  5DGA A;  1KEK A;  4QWD A;  4TY8 B;  3LP0 A;  2ATL A;  5DZ6 A;  1SL0 A;  2VOP A;  4K5S A;  3AXM A;  3CJK B;  3K89 A;  3MEK A;  1Y11 A;  3W61 A;  2MKI A;  3BH6 B;  4DEZ A;  3BKT A;  3IRX A;  1JXE A;  3I31 A;  3KLG A;  4DWI A;  2GHV C;  3JAM U;  1RE1 B;  3GSD A;  3PCO B;  4CNZ A;  4ES2 A;  2VV5 A;  1VYA A;  1GFW B;  2BAC A;  2GIF A;  2CQD A;  3VVU A;  2MZR A;  2XSF A;  1UFW A;  1WC5 A;  3MM7 B;  2XGQ A;  4M5H A;  1S9E A;  1WOO A;  4YY3 J;  2JEJ A;  3L7P A;  3GB0 A;  1QTM A;  1TTH B;  1EQ0 A;  1WSR A;  3MCS A;  3TA2 A;  1N33 F;  3ILO A;  1LK7 A;  2YPZ A;  1TAQ A;  2D3U A;  2XS5 A;  4DSL A;  5HMW A;  3PW2 A;  4B9U A;  2E7X A;  2BJ9 A;  3CCZ A;  4MMO A;  4NLV A;  1MMN A;  2FZC B;  4K2J A;  1HI0 P;  2KB2 A;  2OHD A;  1FA0 A;  4B3O A;  1XK8 A;  2V9K A;  4A8M P;  4I7F A;  3K5L A;  1B7F A;  2R7Q A;  4DR6 J;  4NLR A;  3L4B C;  2W8L A;  4FF3 A;  1JB0 C;  4IFY A;  3GPA A;  2D7S A;  4ZDN A;  2B9Y A;  4WCE Q;  3MPY A;  4A46 A;  2HVI A;  5F8N A;  3MMA B;  3F44 A;  4WJB A;  1FRX A;  2RD5 C;  2OPR B;  3GR0 A;  3QBC A;  3OJU A;  5GME A;  4KGK A;  2CIM A;  3OR2 B;  3M30 B;  5KT6 A;  2XS2 A;  2OEK A;  4OYA A;  1VK3 A;  4UOF A;  2V4J A;  2KFZ A;  4NLX A;  1S4E A;  1BC6 A;  3EVM A;  3BGU A;  2ASD A;  1NB7 A;  1RT7 A;  1WEX A;  4DX7 A;  1VRU B;  2PSZ A;  3HVT B;  4J9V A;  1DFD A;  2QO3 A;  1ZET A;  3T1Y F;  1YBU A;  3BGR B;  4YS2 A;  2E44 A;  5IWA F;  2OPS B;  2FY1 A;  1CS4 A;  1FDN A;  3HVW A;  2B9X A; 
#chains in the Genus database with same CATH homology
 2AZ1 A;  3EM1 A;  3G2X A;  3PJ9 A;  1NSK L;  3VGU A;  3PRV A;  1NLK L;  4F4A A;  3JS9 A;  3EVO A;  4DUT A;  1XQI A;  1B99 A;  1NCL A;  3FBC A;  1HIY A;  1JXV A;  3R9L A;  1NDP A;  5C7P A;  3ZTR A;  1HHQ A;  4EK2 A;  1ZS6 A;  1W7W A;  3VVT A;  2BEF A;  4UOH A;  4F36 A;  1S5Z A;  1NB2 A;  3DKD A;  1BHN A;  4ANC A;  2B8Q A;  4ENO A;  3BBB A;  3VGV A;  1LEO A;  4KPC A;  2DYA A;  3Q86 A;  3ZTP A;  1S59 A;  3EJM A;  5IOL A;  3BBF A;  3BBC A;  1NDK A;  3ZTQ A;  3EVW A;  1B4S A;  2B8P A;  2DXF A;  4DI6 A;  3WX8 A;  5BXI A;  1WKK A;  3ETM A;  3Q8Y A;  4O0N A;  2BX6 A;  3DDI A;  1NHK L;  3NGT A;  1HLW A;  1F6T A;  1NSQ A;  3Q8V A;  3FBB A;  1KDN A;  1MN9 A;  2AZ3 A;  3GP9 A;  2CWK A;  3L7U A;  3BH6 B;  1UCN A;  3BH7 B;  3NGS A;  1VYA A;  1XIQ A;  3ELH A;  4DZ6 A;  3VVU A;  1NPK A;  1WKJ A;  2VU5 A;  3B6B A;  3VGT A;  3Q89 A;  2ZUA A;  5CAB A;  2DY9 A;  3Q83 A;  4AND A;  3FCW A;  3ZTO A;  4CP5 A;  1NDL A;  2DXE A;  2HUR A;  4S0M A;  4UOG A;  1WKL A;  2NCK L;  1U8W A;  1BE4 A;  1LWX A;  3GPA A;  1MN7 A;  3ZTS A;  3ENA A;  2DXD A;  3VGS A;  3FC9 A;  1EHW A;  3NGR A;  3FBE A;  4C6A A;  3FKB A;  3FCV A;  1PKU A;  4FKX A;  1NDC A;  3NGU A;  4UOF A;  1S57 A;  1BUX A;  4ANE A;  4HR2 A;  3EE3 A;  1NSP A;  3EVM A;  5CAA A;  4WBF A;  4W98 A;  3EMT A;  2HVE A;  3MPD A;  1PAE X;  3EIC A;  2HVD A;  4FKY A;  3B54 A;  1F3F A;  3Q8U A;  1K44 A;  3FBF A;  1NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...