4S0MA

Crystal structure of nucleoside diphosphate kinase at 1.92 a resolution from acinetobacter baumannii
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal Structure of nucleoside diphosphate kinase at 1.92 A resolution from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 45
structure length 143
sequence length 143
chains with identical sequence B, C, D, F, G, H, I
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4s0mA00
4O0NA 1NSPA 2B8PA 2DYAA 3DKDA 3G2XA 2B8QA 1B99A 1JXVA 2DXDA 3VGSA 3EVMA 5BXIA 2DXEA 4FKXA 1F3FA 2HVEA 4DZ6A 3EMTA 1LWXA 3PRVA 1BE4A 1XQIA 2HVDA 4DUTA 4FKYA 3EVWA 2AZ1A 1WKKA 3EE3A 3ENAA 3NGTA 4UOFA 1K44A 4ANDA 3FCWA 3VGTA 5CABA 1NDPA 1PAEX 3B6BA 2VU5A 3GPAA 3PJ9A 1NDCA 5IOLA 1XIQA 2AZ3A 3EICA 4CP5A 2NCKL 1VYAA 4UOHA 1W7WA 3B54A 1WKLA 3FC9A 1EHWA 3FBCA 3ZTPA 4EK2A 4S0MA 1PKUA 3EM1A 1NB2A 1NCLA 3FBBA 3NGRA 2BEFA 2CWKA 3BBBA 3ETMA 3MPDA 3VGUA 5CAAA 4HR2A 1BUXA 1NDKA 3Q83A 2BX6A 1F6TA 1S5ZA 3BBFA 3VVTA 3GP9A 4ENOA 1BHNA 3DDIA 1LEOA 3NGSA 3Q8UA 3BH7B 3Q89A 3FBFA 1NPKA 1S59A 3L7UA 3R9LA 4DI6A 2DXFA 1WKJA 3WX8A 1NDLA 3BBCA 3JS9A 1HIYA 3ELHA 2HURA 3NGUA 3Q86A 1NHKL 4ANCA 1NSQA 3VVUA 4ANEA 1HHQA 2DY9A 4WBFA 1B4SA 4F4AA 3BH6B 3EVOA 3FKBA 3Q8VA 1NUEA 3ZTRA 4UOGA 1NSKL 3VGVA 4C6AA 4W98A 4F36A 1ZS6A 3ZTSA 1U8WA 5C7PA 3Q8YA 3FBEA 3ZTQA 4KPCA 1MN7A 1KDNA 1UCNA 1S57A 3EJMA 2ZUAA 1NLKL 1HLWA 1MN9A 3ZTOA 3FCVA
chains in the Genus database with same CATH superfamily
3Q8SB 3CDWA 2B7BB 3BSOA 4DPOA 1DHMA 2DNNA 1EZZB 4GC6A 2HVDA 2QYGA 5CA5A 3CW2C 4UQTA 5KG2A 3SMZA 1BLUA 2AEMA 4HVZA 3OFHA 1JIHA 2BJEA 2WBMA 5ETQA 1DTQA 4YDDB 3M6WA 5IQQA 5KFNA 2BBEA 1IBKJ 1Q8IA 5KT5A 2LEPA 1S1VB 3H2LA 2IJRA 2RF2B 3AA9A 3D9BA 4J9QA 4J90A 3BBFA 5H1SV 4OYOA 7AT1B 4FNIA 1L3SA 4JI2J 4JI4F 4M8LA 4WK3A 3D6HB 4IUFA 1GX5A 4LBPA 1QUPA 1YJNS 5C24B 4UY85 5ETNA 5LMNJ 4EBCA 2Y9HA 3T5JA 3GJTB 3PYGA 2W8LA 2JJ4D 4C0OC 3CT9A 3KK3A 5GAEI 1SCJB 2R7VA 3DKDA 3UD3P 4LF6J 1K9MT 4HHUA 2JFKA 5KFXA 4HI1A 2ASDA 3R5GA 2HHXA 4RO0A 4H4OA 4NLYA 2M3DA 2G0IA 2CUYA 2ZD1B 1HR0F 4LFAF 2K1RA 3I4PA 3R5BA 1RYSA 2P9CA 4CM0A 2ZE2A 4M5DB 3DDNA 5ETOA 3MEDA 1IKWA 3QLHB 2LXFA 4CNYA 1QSSA 4UTGA 4M5LA 5A8RB 4N47A 4LUBA 3DXSX 4XAKA 4KH1B 3KK2A 5L1IA 5A0YB 1FEEA 4WU3A 4X2BA 2EXUA 2HIYA 3IBWA 3KTQA 4PUOA 2UXBJ 4WBFA 4JI0J 2JVRA 3ZZRA 4YR0A 2E7XA 2D9PA 5F8HA 2DNMA 5KT2A 2ZH7A 1Q5VA 1DLOA 2PMZD 4DBQA 5C25B 4ETZA 1RTHB 4ZITA 4Z2XA 1NSPA 3HI9A 4P7TA 4EO6A 3A4TA 3TJAA 3BSNA 4ZVQB 4DL4A 1LWXA 3CB4A 4J37A 2DR8A 1YI2S 4DSLA 4F26A 4IFVA 1SQGA 1JLBB 4KO0A 2CG4A 2IFXA 2JEFA 4O3PA 3BGRA 4ZHRB 5L46A 4LBHA 2W9BB 2KXHA 4Y3CA 2FVQA 3DLKA 4NI2B 4S0MA 4BWJA 1SKSA 1RACB 2GO8A 2G1DA 3A3NB 3R2DJ 1NKBA 5IZHA 2HZAA 4LF1A 3TANA 2HWHA 3M1VA 2ZC3A 2LFVA 2B9WA 2IA6A 1YX2A 2DY9A 1MMNA 4AT1B 4G3IA 2ZH1A 4R0EA 2GHVC 2C2DA 1OPIA 3GFYA 5D3GB 5LT5A 4FXDA 1EARA 3ET6B 4UT4A 2NYIA 4CO3A 1Q7LB 4QIWD 2VJVA 3SFUA 2QZ8A 2MLYA 1CULB 3DRRB 2E9ZA 4USKA 3POTA 5K8OA 4CCHA 3K8VA 3HHLC 1L3KA 2FZCB 4ID5B 4DN9A 9RUBA 4TLQA 1LXJA 3DHWC 3C14A 2AZ3A 3DM2A 2Z4PA 3UR0A 4CQ1A 3VQSA 1FKPA 4E2FB 2QA1A 3IFEA 3I82A 2DT9A 3PACA 3PKMA 3UFCX 4MAKA 4G1QB 2R7TA 3T1HJ 3N6NA 2YX1A 4KAIA 1TAQA 5K14A 4A8WA 2KH9A 2R7XA 2HNYA 3ZZUA 4W98A 3T41A 1RAFB 2BUNA 3MAAA 2XMUA 3AJ1A 2RE1A 1T9TA 1C1CA 2MHNA 2GA7A 2XQCA 4MMOA 4FBTA 3M9OB 1C4CA 1SJFA 2WK4A 5HMYA 3KJVB 3H5UA 3P3DA 4X4VA 1TUWA 1RT2A 1WDTA 2EWHA 1X4CA 4KQZA 2EFVA 3I9ZA 1ZAVA 2FIUA 4O3NA 1HPZA 5AE2A 3MGJA 2NREA 1PJ5A 4ZLPA 3K59A 1YSJA 3DRPA 1SC3B 2F65A 4CI0B 3L7PA 3CULA 1MWYA 3CUNA 3GIJA 1JJCB 2WVEA 4B9VA 1DTQB 4X64F 1HNVA 3VGUA 4WFBQ 1R31A 2GVDB 2FGOA 1S5ZA 4DEZA 3JSBA 2XYPB 1TUVA 3Q2TC 2VFSA 1VCTA 3OVAA 3CJTA 2FY1A 2V8DA 4K4WA 3OTCA 2L48A 4CIOA 4UF4A 4ZJQA 2Z2LA 5K9FA 1S9FA 3SIPB 4MJKA 5F9LA 3KJFB 4OI6A 4KHPJ 1XNQJ 2MPUA 2W9AA 2DYAA 2EFOA 5KFEA 2KL8A 2ZZNA 2I2YA 4JI1F 4Z7CA 4OYZA 2KT5A 1WHVA 3EZOA 2LVWA 4AUKA 3KK3B 3QJJA 5A76A 4WYWA 4V1Ak 4DL3A 2NYHA 4H4OB 3IA0A 3P5BP 5AT1B 1QVGR 3PFEA 1TELA 1PBAA 1UTAA 2K1RB 3KYLA 2RHQB 2FLPA 3S8SA 5ETLA 3WDOA 3OV7A 1G4CA 1NDKA 3TQEA 1K8AT 1KN6A 4XTTA 5L1LA 2V8GA 2E66A 4YEAA 1WC4A 4B17A 1I3OB 5KFLA 2CKWA 2DGWA 2AD9A 1FESA 1SJQA 1X5PA 4OYXA 3AH6A 3KK2B 1A7GE 3E8OA 3I5CA 3SI8A 4OMFG 1NU4A 5L9XA 4PUOB 2G2ZA 5KT6A 1OY9A 2XEXA 5DM6Q 2EC2A 4YN3B 4O0NA 3QGHA 1HQUA 2GC8A 1DLOB 1UVKA 4BCAA 1HWLA 5IT9Y 3G8SA 4JI7J 2RS2A 4DR5J 1DTTA 5KFQA 3KLHA 5L9NA 3QRRA 1WOSA 2N4DA 2FLOA 5CABA 4CYUB 4IFVB 1ZM2A 3Q8RB 4ED8A 3D2WA 3G82A 2E5LF 3CMQA 1TMJA 3FFIA 3W8GA 1S0OA 3BB5A 4MIAA 2OSRA 1DQAA 1YWXA 3Q83A 2GW8A 3CDEA 3DLKB 2F9JA 5IC6B 2VBXA 3LF0A 2OO4A 2KZMA 2HGLA 4GVLA 4TY9A 2F4FA 1HHQA 4IYQA 4URSA 4Z37A 1NH8A 2OHDA 3RU0A 3M1VB 3QO9A 1BQNA 1NSKL 3CGIA 3NOCA 1YK9A 4M94A 1X5TA 2AJ4A 4YB7A 1VBZA 3NNCA 1XWLA 4K2JA 4NLGA 4ES3A 1XMQJ 3W1YC 2CG8A 3KHHA 1MNEA 2VODA 4JV5J 1IQZA 2C2EA 2YKMA 4Q45A 1ZM3A 1VC6A 3R5JB 1L3TA 1N32J 2K3IA 2FJBB 4GKJJ 1X0FA 1UA1A 4J9NA 2YWGA 2YQ1A 3LP2A 3GYNA 3PIPQ 2AEFA 4X66J 1LFPA 4DOZA 4CT8A 1T0TV 5IM0A 1RBOB 1AYEA 4ZK7M 5GMEA 4ECQA 1FDDA 1RGVA 3QQCD 3C14B 4ID8A 2IVMA 2NUUG 4RW7A 1U47A 3DM2B 3MPDA 4U6PA 4O23A 3HHLD 1FKPB 2L9WA 3BKTA 4PZVA 4PABA 2O66A 5A8WB 5J1EA 2FY8A 3DGVA 5D15A 2MQLA 3TRGA 3FEZA 1SH3A 3E51A 3NMAA 1AUSL 3T1YF 5K14B 3UDEA 1QAXA 4QYZJ 1P1TA 4L6V3 2LA6A 3I32A 1MN9A 3VCDA 1RU2A 3MAAB 1NKCA 3FMBA 3MUVP 2YWHA 4LFBF 2BACA 2HHPA 2W2OP 2A0FB 1XN9A 4P71A 3WC0A 2GQCA 1WKKA 1S6QA 3IG1A 1SQEA 1RT2B 3CJQA 2A2DA 1U6ZA 2GQQA 2P6TA 1U48A 1S6PB 3EZ5A 3PO4A 3QRPA 2VPYB 9ATCB 4C8MA 2HHWA 2A1BA 2B51A 3RB3A 4Q8FA 4R25A 4DF4A 3BPDA 5DQHA 3M6XA 2V68A 2CQ4A 2AP6A 1R6YA 4DSEA 4BDPA 3BEGB 4FVCA 5HLFA 2CXEA 3HX9A 3T19A 4JYAJ 4DCJB 4QYRA 3AOAA 2XO7A 3WX4A 2F8EX 2YPZA 1XERA 4U7CA 3WQPA 2DR7A 2HQ3A 1U8WA 2IVYA 3DU6A 2R2RA 3IN5A 3PYFA 4A8MP 5AXLA 3L95X 1RTDA 1NK7A 1C0UB 3LO3A 1Q82T 2PFDA 4TKTA 3HK2A 3MDFA 4ZOSA 4N8OA 2XO6A 4B3SJ 1BE4A 2O3DA 4HLBA 3TZZA 1WSRA 5KG1A 1P9YA 1XNRF 1X5SA 3ITHB 3QYYA 1F9FA 2J9DA 1C4AA 4DQQA 4DFJA 1RWOB 1V3RA 4DPYA 2ZM6F 2QEXS 5BR8F 5ITHA 4MIBA 3G87A 4UZBA 1RHUB 3HHKA 2ZOGA 1RA6A 1RWWB 4IG0A 2IRYA 4ES1A 1GXTA 2DGQA 3CF5Q 4QU6A 2YKNB 4ECYA 1X4EA 5DDOC 2CZVC 4DPTA 4K8RA 4OZNA 4RBTA 2XWYA 1RYRA 4Q43A 1SJ3P 1SUQB 1X8DA 5F8GA 3EGNA 1EQ0A 4I7FB 2HPUA 3F56A 2EEYA 3GR1A 2XMAA 1O0PA 1N5YA 3OTOF 2Z58B 4QW9A 1YDLA 1H74A 1RAAB 1NK4A 1EKSA 3CO9A 1T11A 3LGMA 3PX6A 4K4ZA 3K17A 4P74A 1HQUB 3M2VA 3BKFA 1JQGA 4GKKJ 1YBTA 3LAKA 5J2PA 1YGYA 1M5PC 2PIIA 1NPPA 2VOOA 1XIQA 1EETB 2MZQA 2ZH2A 5KG3A 4C9DA 2BZ2A 2YPYA 1VS3A 2EFGA 5F8IA 1OQ3A 2NZ4A 4CNZA 3PW0A 1V9OA 1NXIA 4NA3A 4K5SA 4D3HA 4ICLA 4RL1A 3FFIB 5J2NB 3JSRA 4NLUA 3ZZTA 2CVEA 2AWZA 2HHUA 2XSJA 2ZNZA 1LQ9A 1VK8A 1UJ5A 2IC3A 4UOGA 4USMA 2O1PA 1YZ7A 3ZTSA 5C2CA 3Q0AA 3DFEA 3QBCA 2HQGA 2M7SA 1RTJB 3QO9B 1BQNB 1Q8LA 1T03A 3W8PA 2CIMA 3TOQA 2U2FA 3FCHA 1FA0A 4NZ7A 3OL7A 2OTJS 1HMVA 4NRTA 3H7HB 1IKVA 3OFEA 4DMZA 3W9HA 1UWAA 3CCSS 2UUBF 3PX4A 1IUJA 2CQGA 1YVFA 1R7IA 2QLFB 4HTIA 1HBNB 1IVZA 4DSKA 2J0XA 1RKIA 1UAWA 2B4OA 2RB7A 1SL2A 4PG8A 5IM0B 1LV5A 5AJ3J 2IYIA 4NA1A 1WSVA 1KQKA 1RAGB 1URRA 1MROA 1A9NB 1JLAB 2OP5A 2OPSB 4USVA 4ZPVR 4LF7F 3W63A 3DOKB 1VHFA 3J80U 3D6MB 1KTQA 5J1EB 2DR9A 4WTYA 4CH7A 2MSTA 4LRDA 2KFNA 2BOAA 2A3JA 4XPCA 4CTAA 3TUZC 2XYHB 1R0CB 3EDQB 1HL6A 3B4DA 4LFAJ 2B6AA 4ZA1A 4PPZA 4Y65A 3R6GB 3EMTA 4JV0A 3V6DA 2VOPA 1KTVA 4WKRA 2I5JA 2V0NA 3M8ZA 3NCPA 2KZZA 3H5YA 2EPIA 5D4LA 2QL9B 3IG1B 1S6QB 1HQEA 1XR5A 4TXSA 4EGLA 1VYAA 2J76E 4ZKAA 4A47A 5DETA 4F50A 2HHHF 3HDSA 5LSRA 3PJWA 4DL7A 3HHNB 4WFZA 3SZ2A 3BZQA 3HFKA 3AD7C 4UUWA 1EIYB 3JQJA 3OLAA 1R8PA 4H4KC 3MOZA 1CLFA 4YP3A 1U1PA 5F8JA 5HLFB 2AKWB 4QR0A 2NQPA 2HFUA 2G2OA 1NJYA 2KJWA 3B82A 4FXWA 5KT4A 4DV3F 3GJRB 1R43A 4IR9A 3KG0A 4Y0FA 2P9GA 4DFKA 2DNRA 1SH2A 4BBYA 4RNNA 2DXEA 1U7LA 4DR2F 1OQ6A 3N5BA 2ALZA 1RTDB 2DGVA 4A8YA 3VAIA 3I56S 3BO2A 3MWBA 2MMYA 3G96A 4RUBA 2HQDA 5F8LA 1PAEX 4ZPBA 3D54A 4CP5A 3OTEA 4RNMA 1B7FA 1S6UA 2OSQA 2J0SD 1NK0A 1RDRA 4X4QA 2KM8C 3WIVA 1FWLA 1WEYA 3AB4B 4OYPA 3EZUA 2BJ7A 3OR1A 4O3QA 1S1UA 2B4UA 2RIJA 3DMJA 1KQSR 2DXFA 1JNZB 2Z2YB 3ETOA 1FVQA 4GVBA 2DNPA 3JS9A 4DU7A 3FK4A 4IG0B 2M9KA 2K7JA 2J7UA 2B0GA 4C6AA 4DUZF 4EBDA 1RHRB 4F2RA 1BWEA 4W92B 4DLGA 4WJBA 2XNQA 4PG7A 4DV2F 4PWWA 5A2QU 3OW2R 3DI6A 1H72C 5T7LA 1VQ7S 4F4KA 2KG0A 1HW8A 2BM1A 4J5OA 1FD8A 3O8WA 4QWCA 1N5YB 1RBLA 1KC8T 4OV1A 3SV4A 3HHLA 1RBAA 2HS4A 2VDHA 1TKDA 3GCXP 5ETRA 1S7HA 5SUHA 2R8IA 1Z2ZA 2KXFA 3CIMA 1KSPA 5JVHQ 3M2VB 2V69A 4WFAQ 1HBMB 2RT3A 5J2PB 2DIUA 1WELA 1N4LA 5KT7A 4I6YA 3BKUA 5HP1A 4RX6A 2G0CA 2D3ZA 4KV8B 2WVBA 3OL9A 2WVFA 3AD9C 1FXDA 1PG5B 1CEZA 1SV5A 1VRQC 2AF6A 5GMDA 1D9DA 1C0TA 3LALA 4EEYA 3L09A 3T6JA 1U26A 1VJQA 4A8QA 2KFYA 5CCLA 2VV5A 4CT9A 3V6HA 3QT7A 1JLQA 2ZH5A 3IAM9 2UUAF 3ISNC 4J9LA 2XTJP 2MKCA 2GJFA 3C6UB 3R1HA 1ELOA 1GEHA 2DCUB 2JNJA 3C16B 4DHVA 3IBCB 3CCRS 4QU7A 2V67A 2YTCA 4QPTA 2IIHA 2VG6B 1T05A 1U6BA 4DR6F 1RUSA 2UU9F 4O3RA 5E3PA 4X64J 4ZCKA 1WI8A 3U7JA 1YZ6A 1NJZA 3PJ9A 1UZDA 3CDAA 1IKVB 3RW7A 1HBUA 3TA1A 2HAIA 1QLNA 4KB7A 4IRDA 3OLBA 4RUAA 4M95A 1SKUB 3CCLS 3G8QA 2MKSA 2OEJA 3K5LA 1UFWA 1XC9A 1P9QC 3D3CJ 3N28A 3RAMA 2WSEC 2DGSA 3KLFB 2DNZA 4LIRA 4URQU 2ZDOA 1N56A 4ZMMA 3D1OA 1GT8A 1S1WA 4JI1J 2VASA 2ERRA 4B9SA 3I0SA 3ZTQA 2KO1A 4J9UE 1RE1B 2HNDA 2LXIA 1S57A 2M52A 2GAHC 2FUG9 4ZLNA 5JVGQ 2XMJA 1T9UA 5DQIA 1RHKB 2V8VA 3TUIC 3L4BC 1IKXB 4W4MA 1KD1T 2B6AB 4USUA 3NBPA 3VF0B 3MD3A 3V6DB 3W60A 2I5JB 2UVVA 3KFWX 5KFOA 1PJ6A 2K3KA 3O6QA 2AYMA 4DDFA 3LGHA 2MZTA 3CC7S 4F25A 3PKYA 3IRWP 1HQEB 3HT3A 2MZ1A 2CPXA 2KYXA 4KY3A 5KFMA 4OX7A 2HFZA 2ZBPA 5J2QA 1RAJA 1B7YB 2B9YA 5FLXU 1JK9B 3R2CJ 4MK8A 3CVKA 5KFCA 2AIRB 1FE0A 5L39A 2PA8D 3EVOA 3KUHA 2WB1D 4IG3A 4UQGA 1FRXA 2UVWA 4FF3A 1N34F 3LUYA 1X4AA 4DR1F 1FWKA 5I42B 2ASLA 4MH8A 4OLPA 6FD1A 1Q78A 3MPUB 4FBUA 2LYVA 4IR1A 1V3ZA 3T1AA 3N4WA 2A10A 3M30A 2E5LJ 4HDHA 2X1FA 1TKTA 4LFCF 3M32A 1VQ4S 4C8KA 2ZBRA 2Y1RI 4G1PA 4PG6A 1NK9A 4C11B 3W65A 4YUDA 3IWXA 3UVJA 1AA1B 3OR2A 2MZSA 2BKNA 5D77A 2HFNA 3EDRB 1D09B 4TNOA 1Q4RA 3EUNA 3M7VA 4ZPDA 3OL6A 1C1BA 2EW9A 4C8ZA 5F8MA 1R6VA 4DV7F 5JUMA 3TEHB 4F4ZA 3K89A 5JXSA 2B56A 3NP5A 5DRKA 1S1UB 3GE9A 3DMJB 2J0WA 4YR2A 1JKHB 4E0DA 1Z2LA 3OTBA 1ZPVA 4NXMJ 2CADA 3OD2A 3KJQB 4R8UA 1FRKA 2D41A 3HZGA 3R1LA 2VUGA 4H4MA 2VF3A 2AQ4A 1YJVA 3D68A 2ADBA 5T7LB 2OPQA 1H2UX 4LF4F 2ZKUA 4ECWA 3OT9A 3G8TA 4DG1A 2OH2A 2VQFJ 3HSDA 5C5JA 5IXUA 2XS2A 1VBYA 5D8HB 1NDCA 3BQ2A 4U67Q 3HHLB 3SSQA 1F0XA 1RT7A 1YJWS 3FBCA 4CLYA 4JBCA 3AJ2A 3TX8A 1UJ4A 1T3NA 5B0AA 3K5NA 2H51B 1VRTA 2FJWA 3RBXA 4RNOA 3EYZA 2M8DB 2POKA 1I51B 3MM7A 1FKOA 3FRZA 1I94F 1EQMA 4ANEA 4AD6A 2HAFA 5H9FK 1SVDA 2VQEF 3ZTRA 4K7QA 1OY6A 2WSFC 1UP1A 3HULA 1AFIA 1N6QA 4OYAA 2J0QD 1SV5B 1KVJA 4DZDA 1C0TB 2E1CA 4Q7AA 3UDLA 3MUTP 4USJC 4DV5J 1JLQB 4OI3A 2JC0A 3RB4A 4JV2A 2V4JA 4C2MA 3Q2SC 2Q6CA 2MQMA 1KKHA 3TJ8A 1IJEB 4O4RA 2E9TA 4EZ9A 4ZJOA 2AHOB 4B9MA 3FSXA 4Y28C 3ISND 1H7WA 3P5TL 4C8LA 1TFWA 1L3UA 1LWEB 1T05B 2ZUGA 2YX4A 3RBDA 5CYQA 5GADU 1TKXA 3OVBA 5CXTA 2X7IA 3MXHP 3U27A 4JI5F 2KT2A 2PA3A 3C46A 5CHCB 2R9LA 3TA0A 1OYDA 2DRDA 4Q5VA 2W2QP 4B3MF 1KQGB 5D4PA 4DI6A 3CCZA 3W5ZA 3PZPA 5AE3A 4CLUA 3NGUA 2XCAA 2EBGA 2BJ8A 4HT7A 2ZVSA 2B5JA 1Z4UA 1VLOA 3I5AA 1CG2A 3N6LA 3HVWA 3HD1A 2MSSA 3ILIA 2PC6A 5HQ8A 1XNRJ 3GCWP 1S1WB 3I0SB 3DLBA 3NLCA 4OLOA 1CJUA 2QC3A 2XLJA 1L3VA 3HM9A 1TK0A 1S97A 4DV4J 2ZM6J 2XS7A 4A46A 2VKRA 2VL1A 4OJ1A 3MR2A 1HNWF 1WORA 3G6VA 1FE4A 2JLEA 5GAGU 2QV6A 5DJBA 5ETVA 1RJJA 2AYBA 2I9SA 3BQ0A 4RKUC 3FUYA 2H54B 4ALZA 4LT6A 2W7AA 1RWPB 3GP9A 4ENOA 2M5YA 3NGSA 1W2IA 1B70B 2R7UA 2FVRA 1LW0B 2KHDA 2ZITA 4FNHA 4XPEA 2W2NP 2GCFA 5BYSA 4OYMA 4K4UA 3SCLE 4OI4A 1QUVA 4IG3B 2JLGA 5DM7Q 3MPVA 1FK9A 2CJAA 1XMOF 5CD4A 4AL6A 3KG4A 3W3SA 5B08A 1OSDA 2H5JB 1XQIA 3H42A 2DJWA 1UPMB 3SDEB 1SC6A 4DQPA 2Z57B 1GXLA 2B7CB 3M30B 3EX7B 2Y1JA 3NCRA 1TKTB 3M32B 1ICEB 1WC1A 2G13A 2LMIA 1R89A 2FQQB 4J7CA 2OLWA 3UVJB 3OR2B 4ZP8A 3UE2A 5LSLA 2ZKTA 1FJ7A 2BA9A 3OUYB 3LPYA 1S59A 2X51A 1HFEL 4IDKB 1UL3A 5L8RC 1NJWA 1WTBA 4G6VB 1GNKA 4X84A 1UW9A 2M4MA 2QT7A 3QRQA 3GV8B 5KFZA 2J7KA 2XBPA 4RWWA 2PO4A 4NXNF 2DNQA 2DO0A 1FTRA 5DZ6A 2A2CA 1AZSB 3H0PA 1VHIA 1WC5A 4R8UB 1R3NA 3G71S 1KNZA 3M8QA 2UUBJ 2DHHA 3HJFA 3KLVA 5D4NA 2V9KA 5GAHU 2BDPA 3CD0A 2VB6A 2KFZA 5EN1A 4C8NA 4H4MB 2BE7D 3NXZA 3TVYA 4ATNA 2Q1LA 3DGPB 3M8YA 2OPQB 3RG6A 1NBEB 2Q43A 2FVCA 5FLXY 1Y10A 3FRYA 4DG1B 2VFUA 2E44A 4RUHA 1N5TA 1U1QA 1CJVA 2R2UA 3MF5A 1QVFR 4LF7J 2KDOA 1RT7B 1T7PA 1CJKB 3KLIA 3TVZA 4CO5A 1VK3A 1EX8A 4FYXB 2LEAA 3EGWB 4OFZA 1VQLS 1VIOA 3M2RB 4KSEB 1KBRA 3P45B 1VRTB 2XLIA 2P6SA 1VC0A 2W2MP 4KGZB 4NWBA 2OGUA 1NZ8A 1FKOB 2JX2A 3B8HA 3M6VA 2J6TA 3TZXA 3G6YA 1J5EF 1FXRA 2BJ1A 2VPWB 3H25A 3AQPA 2F9DA 3UN5A 4P10A 2RF2A 4C7QA 1UWBB 1NB7A 1W26A 3CD7A 3D3BJ 4DV1F 2XI3A 2UXDF 3VAHA 2HHHJ 4ZP6A 3HSZA 2RRNA 3K58A 4LRCA 2CQDA 5KFFA 2V4JB 3TI0A 3JAMU 5KFSA 4QJVA 4L3NA 4FPIA 4NMXA 3QGGA 1XTZA 3ZTPA 2IM1A 3BF4A 1X9MA 1IBLF 2VPZB 4IOAQ 3TQ1A 1IN0A 1YTYA 4O44A 1U1RA 2CJ9A 2WZ1A 4DV3J 2OMLA 2GHPA 2UUWA 3X3UA 2OELA 2IMWP 1H38A 1JLFA 3OHAA 4I69A 1JXEA 4H4KA 1QE1A 2Y3YA 1U02A 4QR2A 1IKYA 4ECTA 2OTLS 1S9EA 4LQ9A 2RKIA 4FYVB 1YITS 4ILLA 4L3KA 1WF1A 2QA2A 8RUCA 1R8BA 2B5JB 2OPRB 3MM9A 3G6ES 2F5GA 4AFFA 3C3LA 5GVQA 4CO1A 1T02A 1R0BG 3RAXA 1CJUB 1FTCA 5A0YA 5GAEU 3NS6A 1W25A 2KVIA 5ADZA 3H2UB 1RABB 2W2PP 4P2MA 3LPEA 2DR5A 1FX2A 3DYAB 3KNAA 2OI2A 3FNNA 4TYBA 4RJVA 4DS5A 1CVJA 4ZCLA 2C3OA 1UVIA 5C25A 2DGOA 4M63A 4DUZJ 2XCPA 3BYRA 1IBCB 3HVTA 1TFYA 5HJXA 3VZHA 2IM2A 3NL0A 1N5QA 4KTQA 1NSQA 2KHCA 1MWQA 4MFBB 1WOOA 4YB1P 5BJRA 2DBBA 3BN4A 1GQEA 1NKEA 1PC5A 2BJDA 4C0HA 2JEJA 1N36J 2BE2A 4ZVSB 1HARA 2LLZA 3IR7B 3H20A 4DR7F 3ENQA 3MMCB 1TVRB 4NOHA 5CH7B 1SJRA 3MCOA 2AW0A 2YNFA 4ZVUB 1P1LA 1VQ5S 2V63A 1VJWA 3MAHA 2ZJRQ 4XO0A 3BBBA 4NX9A 3I9V9 1TTHB 2YKQA 2R3VA 1U2FA 1X7VA 3DRRA 5IS2A 2X3DA 2F8MA 2MQ8A 2AGPA 1UMJA 3C8YA 1U2CA 3CEDA 3QMQA 3PHTA 3BGOP 2Y8WA 4TQSA 3BR9A 1NSAA 2XMKA 1S72S 2CQIA 3HO1A 3TO8A 3HT0A 1RQ0A 3EPIA 4LR8A 3GR0A 2H1YA 3F73A 3RRKA 3OJSA 2FVPA 3P4UB 4V19X 1WG1A 4P72A 1FX4A 1BQMA 4TY8B 3TEGA 4ZDNA 1RA7A 3PRVA 2KG1A 2HVZA 1P8GA 3J7ZT 2IY5B 3RRHA 3D5MA 1UVNA 2HHSA 2MHEA 4QOTA 2W4CA 3AXKA 2AGQA 1VDHA 1NPRA 2BMBA 4LQ3A 4G1IA 4DSJA 1Q0NA 1YHQS 4DR4J 4ERDA 4KYZA 3K57A 4DU8A 2ZJQQ 1M1HA 1MWZA 5DO2A 4DN0A 3JXOA 3TUPA 3PEHA 1CJVB 1P6TA 2COLA 2PEHA 1YRUA 5CCMA 4A48A 2IRUA 2ZH3A 3KLIB 4DL5A 4OZ2A 1Y5NB 3W66A 1ZH5A 1TK5A 2VBYA 3ZC4A 1VQ8S 1RT3A 5E33A 3HVAA 2HIQA 1IBKF 1AB8A 2LA4A 2A6OA 5KFWA 1KOHA 4ZN3A 1FI4A 3PR4A 1ZA1B 1JJ2R 3U1MA 4KGMA 1PO6A 4RU9A 4Y2IA 4OHVA 3D0HE 3CJ2A 2GVDA 4CLWA 5KG0A 2XHCA 3PDNA 4JI2F 5D6GA 5IT9U 2HBYB 3IM8A 5BYQA 3UN2A 2N3LA 3LQVA 3R3TA 2KTQA 1VQOS 3QSYB 3HP6A 2V34A 3N5FA 2QLBB 4F4XA 3G9CA 5LMNF 2ILZA 2LQJA 4EYHB 2DHSA 4RUCA 2EI5A 4LF6F 2BYCA 5EGYA 3I31A 2W25A 1N34J 1RHJB 2HNZB 4DR1J 1NHKL 1FERA 4CWBA 3QIPB 4O44B 3BH6B 5J2MB 1WHWA 1M1KT 4JI3J 1JLFB 1MN7A 2CNOB 3R27A 1QE1B 5HVFA 5F3TA 2ASJA 1IKYB 3QFWA 1S9EB 1N48A 1SXLA 2SXLA 1RWKB 2RKIB 4K4VA 1OMSA 2GHWA 4F7VA 1JB0C 1F3FA 3MI7X 4TU8A 3MM9B 1I5OB 2Y8YA 4JI0F 4CH0S 2OEMA 3RUBL 3FVYA 3B6BA 3N9UC 2YWEA 4I56A 1SIZA 4DXLA 3G86A 4DV7J 1JLEB 4GC7A 4EK2A 1UJ6A 4PXEA 2EBEA 2D3UA 4KHRA 2N3OA 4FDFA 3O5TB 2MY7A 1HWKA 3MCNA 3NAIA 1FDAA 1N0UA 2ZH9A 5T14A 3CMES 3K5MA 1WUUA 4F0HA 1RWVB 1RK8A 3HVTB 1DZ5A 4Z7YA 1T3OA 2JVOA 2CPZA 1QAYA 1VQKS 2EKNA 4KRWA 2CJQA 4LF4J 2L41A 4CYUA 1J5OA 1VQPS 3CJRA 1NMEB 4PEOA 3JAMY 4O4GA 2MZRA 2DCLA 5CZXA 2EFNA 3T6BA 2MJNA 2WOMA 1HA1A 4X62F 4NE9C 3ZZPA 3PNIA 2NPFA 2BE2B 2EG2A 1NHUA 2WONA 1V5VA 3MEGB 4M5HA 4K50A 3V5RA 1X0PA 2GMLA 2ZVIA 2FHOB 3PW5A 3CJ4A 4HL9A 5M2RA 5A8KB 2HRYA 3SQGA 2YNFB 3AAWB 2G1HA 1APSA 1RT1A 2JOQA 2Z56B 2VQEJ 2J8SA 5B0GA 3MAQA 3O2IA 4B9LA 2ZH4A 1DBDA 3SBMA 4X4OA 4Q2MA 2YY3A 2BW7A 1HQ2A 5DG9A 2VFVA 3BBCA 3KK1A 1TK8A 1FCAA 1X31C 3UCGA 1R27B 2I8EA 3A3PB 1U6FA 3L3CA 1HNZF 1UA0A 5B7WA 4LBIA 4OYWA 1QY7A 5KG6A 1WHXA 4LF2A 1GMVA 1RAOA 1ZAXA 4PKDB 4QPXA 4NYPA 4OV6A 1PAUB 4ECRA 1ZZFA 2ZH6A 3VAKA 4ELTA 3JYTA 4LMZA 4JI5J 3T1HF 1NAQA 5HROA 2QSFA 2OD4A 1AFJA 1BQMB 5A8WA 2NPIA 3DLLQ 2GQ2A 1G6BA 4U7UK 4OL8A 1FRLA 3T5KA 4B3MJ 2ZEJA 5KFBA 2E5JA 3UNGC 2ROPA 1KRPA 2Y1LB 3NGKA 3QWPA 1KQFB 1SL1A 4B9TA 3MM6A 1ZAWA 3CCMS 3NMRA 3DCAA 2NS1B 3V6KA 1VGYA 2J5AA 4Q8EA 2EC0A 3D6FB 4IKAA 4OYBA 2OFGX 3VHQA 5D78A 4ZS6A 3OQ2A 4CZCA 1S1XA 5IWAF 2V4QA 4N8NA 1WDDA 1LK5A 4YY3J 2HK2A 4RW8A 4KIAA 1S6PA 4FP9A 2V6AA 4J9PA 3X1LB 1RT3B 2E7WA 2FJVA 2KI2A 5JMNA 3J81U 2DTJA 1HI0P 3ZXWA 4ZVGA 3MZIA 3TZWA 4KJIA 2CPYA 1RLDA 3NGTA 3NG8A 4QBUA 3GV5B 4P6QA 2VA2A 2XLKA 1VQ6S 4M5GA 2W8KA 1FHTA 2F8HA 3BYPA 2J6SA 3THVA 2RDDA 3NGRA 2HLTA 4FS2A 4KHPF 1IM6A 3OHBA 1EKRA 1TL1A 2FC8A 3IAS9 5AXKA 1LEOA 3Q8UA 4OZ0A 1NM2A 1C0UA 2GJIA 1K1SA 1RT5A 2B9XA 3DRXA 2DPJA 3Q8VA 2ZH8A 1XMOJ 2IVFB 4LF5F 1VRUA 3ITHA 3UW1A 4FF2A 1R8AA 4CLTA 2F1FA 5LMUF 4BLGA 3VZIA 2W24A 1LK7A 2HGMA 4USTA 5FD1A 3GILA 3KHGA 2FC9A 5HBMA 2E5IA 1IQTA 2IPOB 3VQTA 3ADAC 3M6UA 1XBWA 3TAPA 1T9XA 1TL7B 2YKNA 3RB6A 2GVZA 3QIDA 3W64A 2OJ3A 3VGTA 1N33F 3CJ0A 2ALYB 4ECVA 3PYDA 1SJ4P 1EJ7L 1R0AA 1SUQA 4X65F 5EWGA 1X5OA 4KE5A 1GTHA 3GYXB 3CMAS 3UD4P 4I7FA 1JLGA 3W9JA 4DQSA 4IH6A 2MQQA 4CO0A 2BABA 2HGNA 2R4FA 3PTWA 3BH7B 1NPKA 3SCKE 3UR3C 1PCAA 1W2BR 4NXNJ 5L38A 4K0KF 4ZVOB 4C8YA 4LR7A 4AYBD 4I67A 4DS4A 2BJ3A 4LREA 1HNXF 1VLYA 2CPFA 2QIFA 4ED6A 2QMWA 2WAQD 4U96A 1U25A 1BQXA 4NRUA 2OD6A 1UCNA 1NLKL 1EETA 3BJYA 4PQUA 2FJEB 3VTIA 3ENWA 2B8QA 3MMJA 1J5OB 1KP6A 5E3QA 4O4GB 1UKUA 2RU9A 2OIHA 1P27B 2VA3A 5J2NA 4RU2A 2WOMB 2F4VF 1N54B 3GV7B 1OSCA 1VBKA 2VU5A 2H3EB 2WONB 4PWDB 3ILOA 4ZLLA 3T5HA 1TP7A 3IGNA 4J9KA 1XMQF 3BV8A 3MURP 4JV5F 1M5OC 3FDSA 1RTJA 2DEIA 3UPFA 3SQGB 1RAHB 1RHMB 3DOLB 4QR1A 1RT1B 5H9FJ 5I3PA 2KRRA 1N32F 1UFLA 4BS2A 3E3XA 4GKJF 4FYWB 2YKPA 1J5EJ 3LTOA 4RW6A 4U7UD 3VGVA 2H4YB 3LWMA 1NEEA 5E0OA 3KK1B 4X66F 5SZTA 2E5HA 3H5XA 1ZETA 1IR2A 3MOJB 1K73T 3DLEA 4F04B 3G2XA 2XHWA 3IS9B 1HBNA 4AQYJ 2E7VA 1FFGB 3GJSB 4MKBA 3LH2S 3D0IE 5EX0A 2U1AA 4LRFA 5D0HA 1XK8A 3JYTB 1IBLJ 1JLAA 2OPSA 3UD5A 3CTRA 5HROB 3DOKA 3EICA 4ZP9A 1AROP 3B54A 3MR7A 1MG7A 4RLEA 3U1LA 1U2RA 2XGPA 4Y00A 3PY8A 4LRBA 3RTVA 3V81A 3J7Z5 1S48A 1LNQA 4JB8B 1B0PA 1UVJA 3MM6B 3C6TB 3ZZ0A 4UUXA 2XY6A 4ED0A 5KOWA 2VHGA 3PHEA 4NYOA 4NLTA 1JWWA 4AL5A 1FNOA 1Q5YA 4OZ3A 4ITSA 1SB6A 4AL7A 1CJTA 3GFHA 1S79A 4TU7A 1LW2A 2MXYA 1FNMA 1S1XB 2G4BA 3ZO7A 3MCMA 2UVRA 4RBVA 1D9AA 1H6KX 4RWXA 3TNVA 4RW8B 1OIAA 3QPIA 4OIXA 1ROFA 2YQ3A 3KWMA 4DPXA 5M2PA 3M2UB 2DY1A 4FKYA 3EVWA 1F9EB 1X4GA 1RU1A 4WFYA 2ZC4A 1O5JA 4ANDA 2QA4G 2W01A 3V2UC 4RZRA 2MGZA 5F0WA 2HHVA 1U1OA 3CWJA 2IJNA 4WXOA 2MJUA 5IOLA 3M9NB 1RI7A 3GFXA 2IA0A 1D8ZA 1G1XA 2VIHA 2V50A 1ZBTA 4C97A 2YKOA 2LDYA 2Q79A 2QX0A 2LP4A 4NLVA 4ED5A 2XB2D 1F6TA 1BC6A 2HWTA 3R6LB 4QZVB 4DX6A 3L7UA 5KFKA 1H2VZ 4B3SF 2HQIA 2DH7A 1TL1B 2LU1A 3QGIA 4ED7A 2XC9A 2O67A 3OSNA 4F67A 2BANA 3QAUA 3RJMB 3AXMA 3MMBA 4DR7J 1RT5B 4NEZA 3HHEA 4ZCMA 2JEGA 2ZWOA 1VRUB 2BRKA 2BR0A 2CNNB 2HQCA 2HZCA 5IQ6A 2L9NA 2DNYA 4WYLA 2NXEA 2ABYA 5HBMB 4A8SA 1VIXA 3GWCA 3MR3A 3PFOA 4OX8A 1NJIT 4X4SA 2CDQA 3CCUS 3NNHA 2HHQA 4USHA 2GVZB 1TV6B 4IFYA 1OY8A 2UP1A 1Q53A 2VBWA 3HPOA 3CCWA 1R0AB 1BHNA 5EWEA 4XDCA 1S6OA 4FS1A 2C2OB 1JLGB 3J7YU 3R5AA 5KFTA 4TU9A 4HDGA 3BM7A 3J81Y 4QWEA 3RR7A 1ZTTA 2KU7A 4USIA 2NXNA 2EFQA 3PJXA 4OHXA 1O51A 3OSPA 3H40A 4OHYA 4YHHJ 3PXGa 2I1RA 3DDKA 3GYGA 3HMJG 3IWLA 1HBMA 1H98A 1GX6A 1WC6A 4A8FA 1Q7YT 2FZKB 3PG9A 3VAMA 2RQKA 2DK2A 4PQUB 4LR9A 1ULRA 2VJUA 1VQNS 2RH3A 4LIWA 2NSCA 2FD2A 4MIWA 1FDBA 1ZOTA 2WW4A 5K8NA 4KV8A 2ZZMA 2VC0A 4B3OA 4ED2A 1WKLA 2DEJA 3W7BA 4DCOB 2RMLA 2J7WA 4B08A 5KFVA 3C6UA 1S7IA 3QSIA 3QGPA 2C3MA 3O1LA 1FJEB 2D7SA 3C16A 4HEA9 2MTLA 4M5NA 2KKHA 3MFIA 4HYKA 2HG4A 3DU5A 2RQCA 4C98A 2VG6A 3RR8A 1KOOA 3W5YA 2H5IB 3Q8YA 4K4TA 2Q6BA 5LJ5Y 2JRSA 4RW6B 4ZVRB 1LWCB 3CJKB 5I3UA 2UUTA 2XY7A 1EAYC 1QD1A 1PSDA 2FHMA 1GXUA 5AJ3F 2YX7A 3DLEB 2XI2A 4JI4J 2R42A 2RD5C 2MLXA 1RXOB 2YNHA 3KLFA 2DNHA 4KT0C 1K44A 4MYUA 3JB9k 2FHJD 3H4DA 1Y11A 2P8IA 3DLGA 3AOBA 5MLCV 2M70A 3UCUP 4HT5A 4IH5A 4NMLA 2VFRA 2XGQA 4WZQA 1RWNB 1XMBA 2W9CA 4E98A 2AT1B 2D3O1 2Z8QA 2IBOA 4WKYA 5DZ7A 2I38A 1S76D 3V81B 2B4PA 1HR0J 3PCOB 1IKXA 3ZZOA 4PR6A 4LSLA 1ZTWA 1F5CA 4F3QA 4L72B 3Q22A 1F5AA 1ZS6A 3RB0A 1E6VA 3NCQA 4EZ6A 2OPPB 5DDQC 4V19J 1HNIB 4M5IA 2JLFA 2E1AA 5HK4A 1ZM4A 3HHDA 2W4PA 2ACMA 2XSFA 4L73A 5HATA 2W1BA 2VBZA 4L76A 3F0NA 1CJTB 2MKHA 1FO1A 2DXDA 1LW2B 1NRKA 4NEYA 2IDLA 2CQ1A 3MMAA 5K20B 2C3PA 2HFSA 2FGCA 5DG7A 2EVZA 4ZN1A 2HRTA 2KN4A 4K5RA 3DHXA 2HS0A 2WW8A 4W90B 1IWAA 4FZVA 2B43A 5E3CA 2MGZB 3EM1A 2WTFA 2CWKA 4QCLA 3WIUA 3CJSA 4ZJLA 3A13A 5I42A 1KHVA 4HI2A 1MLAA 3WC2A 5KFIA 3H98A 5HVHA 3KHRA 2MZJA 4CO2A 1RCOB 2L08A 2EKYA 5C2GA 1RLCL 4X62J 2ZBIA 4C11A 1Y9OA 4KPCA 2LQ5A 3BS9A 1OS5A 2Y1IA 3IR5B 2QFIA 2BANB 2CQPA 4NA2A 3MMBB 1YRTA 2RILA 1VOMA 3EVMA 4CLZA 5G4DA 5KT3A 1G2EA 3EE3A 4QIFA 2VONA 3FCWA 3LA0A 2VZ9A 5E5NA 3AY0A 2RDIA 1NK5A 1JKHA 2LXUA 2QLXA 4K4XA 3EXYA 1YJUA 3Q23A 4HTJA 1PYOB 1EHWA 4Y34A 2IM0A 4KC5A 2J9DE 4K4YA 2HK3A 2LKZA 2R7OA 1BXNA 5F9NA 2J9CA 3QT5A 1HNZJ 2IHR1 2CZ4A 3MECB 4IFYB 2MKYA 1NZAA 4UZCA 1I6JA 4L75A 2DNKA 2E1PA 4GO7X 4IO1A 4ZCIA 5BYRA 2PMWA 3F44A 1F2GA 4ILRA 3WZ0A 1M5KC 1VBXA 2WVDA 1VQMS 3H8YA 3M8WA 1KEKA 3RBEA 1N52B 4CLSA 4WP9A 4QWAA 1QSLA 1EB0A 5HAOA 1REGX 3MUMP 1B99A 2C2MB 1SH0A 4OI0A 3HVRA 1UVMA 4CH1A 3UI3A 2DPIA 2AX1A 4FKXA 2MQNA 4M5MA 4HHHA 4PXDA 2MYFA 1U1NA 5K8MA 2C3UA 2C22A 2E5GA 4PG4A 3PIOQ 3KJNB 1Q95G 2YNGB 1YJRA 4KPYA 4WFNQ 1M1GA 1XR6A 2IAJA 5ETMA 4WE1A 1UEKA 4OI2A 1CC7A 4YQWA 1PJ7A 1HW9A 1NB2A 2DO4A 4B3OB 5IWAJ 2GFFA 3RAQA 1YIJS 4X4UA 3TW0A 2V94A 2QSWA 4DJBA 2R7RA 1YBAA 1SJ1A 4J9SA 3AA8A 2IM3A 4WPAA 4Y2CA 3CCES 3GG0A 1VMBA 1S4EA 3PW4A 3T3FA 2UUCF 4FYYB 3IRXA 2CYYA 2QA4S 1LWEA 3JTPA 3HKWA 2WB4A 2GV1A 3FCVA 2CNKB 1SC1B 4F0MA 1TMMA 3I0RA 2DHAA 3ZNJ1 5H9EJ 4PXCA 2VG7A 3UNYA 2MQOA 3PW7A 2LQBA 3GJQB 3IMQJ 3PRDA 5I3UB 3CXCR 2V8PA 2DH8A 4DL2A 2E9RX 2BW2A 3K0JA 3TAQA 2N7YA 1NH7A 2ROEA 4PAAA 2H9ZA 1JX4A 1M90T 4YR3A 3IBFB 5JJBA 3KLEA 1HI8A 1SKRA 2YNHB 2XZTB 4UOHA 3THPA 2M8HA 4PQAA 4EO8A 5B0FA 3AD8C 3UCZP 3AFGA 4DR3F 3DLGB 3THTA 2FYXA 4LF5J 4WFXA 5EHHA 2W9CB 2M0GB 5LMUJ 2JHEA 2ZE2B 1TZ0A 2B4VA 2ZBQA 4NLWA 2CQ3A 5DS7A 3MEDB 1IKWB 3GSIA 4R0JA 4OJGA 4MK9A 4LSLB 2HZVA 4IOCQ 2PN6A 3ENVA 1FKAF 4HH0A 2XMTA 3RZAA 2WCXA 1YLXA 3BR8A 1H7XA 3MD1A 4EUVA 1N33J 1E6VB 3CD6S 3LANA 2F7VA 1PGZA 4RBUA 1S4FA 1URNA 2FTRA 3SEOA 4X65J 3DLHA 4X4RA 1Y0HA 3CCTA 3JTOA 2ZFHA 1X4DA 1LW0A 1HWIA 3MMAB 3CCJS 1WHYA 2WRMA 3V6JA 1Y5IB 4K0KJ 1GFWB 5B0BA 1FT8A 1CQMA 1Q8KA 2J8AA 1CBKA 4TN2A 1HNXJ 3FBBA 3NWRA 1FDNA 2I6WA 2Z0GA 1FVSA 2LQ9A 3I55S 4KO0B 2P5VA 1YJ7A 4UOCA 1S99A 5DLFA 4O3SA 3SFGA 3BGRB 5HO4A 2Z30B 3SDEA 4LF8F 3J7A1 1TU0B 5D0GA 4USWA 4FPRA 5LXRA 2R8GA 3AT1B 2L3MA 2F4VJ 3W5XA 2HFOA 3C15A 3CO0P 4XIUA 2UXCF 1S0VA 3OUYA 5HQMA 1RWXB 2Z2MA 4P52A 2GZOA 2ZOMA 1K1QA 2APOA 1SQFA 2L9DA 4IDKA 3P96A 1H3DA 1YJTA 1DJ0A 1NDPA 1X4FA 4NXMF 4HH1A 2X3GA 2V2QA 1MU2A 3P49B 4F8RA 4X4TA 1Y00A 2BEFA 3POTB 2MB0B 4UW2A 1AZSA 4JP8A 2RAQA 3VVTA 1KVKA 2AJFE 4F3MA 1SBRA 4KBIA 4DV6F 1TUGB 3QAEA 1N5VA 1RHQB 3F41A 1MMLA 4QW8A 2VQFF 4F4WA 2V5HG 1KR4A 3DGPA 1RTZA 3FBEA 4N56A 3HZEA 1PBUA 3NS7B 2DGXA 1FEHA 3PRBA 3OL8A 3K8WA 3LP0A 2YXLA 4KGXB 1HHTP 1HLWA 2G0JA 4DFMA 2VPXB 2FHJA 4NZ0A 3FZBA 1MSWD 2LEBA 4E8UA 4PYDA 2ADCA 1G3OA 4TLRA 1CJKA 4DQIA 2HNYB 2YH1A 1D1UA 4UOFA 3M2RA 2DNGA 2GIFA 2CZ9A 5J1NA 3GLJA 1C1CB 3V4MA 3PW2A 3T1YJ 1FD2A 2HHTA 3RBZA 4ILMA 1REVA 3CSKA 1WI6A 1T9WA 2P2CB 3LW5C 3SSSA 1DQ9A 2WSCC 4WWSA 3OXLA 4J9MA 4LFBJ 1Q86T 2IAJB 2HBQB 4WE1B 4KFBA 2EFPA 3QT6A 3RYLA 2QN6B 4DV5F 3C66A 3W61A 2ATLA 1HPZB 1Q81T 1HYSA 3WX8A 1X9WA 1UWBA 2QJ3A 4MK7A 3Q86A 3CPWR 3DRPB 4RNFA 1KVIA 3KUGA 2VC1A 3QZ7A 4FXVA 4WP8A 3H90A 2BOPA 2GJ2A 1AW0A 2HBZB 5M2UA 3HFZB 1DARA 6AT1B 3S7RA 1HNVB 4OI1A 1QJHA 3ULHA 4DL0C 2IDEA 2IMOA 3EWGA 3IRXB 1LOUA 4DLEA 3VWSA 1KLMA 4Q0BA 1CS4A 1WC0A 3I0RB 4WIQA 2AJQA 2VG7B 2N82B 1RAIB 5HMWA 1ACMB 2OEKA 5KFUA 1QSYA 4U95A 2H5EA 3N0VA 3D66A 4C4WA 1UFKA 3H2VE 4J9RA 2F3JA 5I4MA 2B3TB 1JMTA 5CZVA 3CCVS 3KLEB 5THWA 5CAAA 3S1TA 4ECZA 5KOXA 4B9NA 3D67A 2V2VA 4TVAB 2OPRA 3MM5A 4Y2AA 4ED1A 3RGIA 4CM2A 1SKWA 5K5MA 3TJ9A 2E1RA 4DV4F 4F2SA 1TKZA 3VAFA 1WWHA 1RB0A 5ETKA 3FQLA 3NS5A 2C2ZB 1IBMF 3I96A 3NRBA 3TYTA 3HSGA 4KR0B 3R5DA 5BR8J 4DV0F 3DYAA 3D7SB 3QZ8A 3K5OA 2PMHA 1QTNB 1U4BA 2GGPA 3VGSA 5BXIA 1O6XA 7FD1A 4ECXA 4KKOA 2VICA 2BVZA 1YRXA 1CSJA 3PVXA 4WCEQ 2ZHBA 4JI8F 4MFBA 3A12A 3VAJA 2AV5A 3G6XA 3ILLA 4XK8C 2XS5A 3OTOJ 2C2KB 4B3TF 3BGUA 1C2PA 3QFHA 3HCXA 3DC2A 2V2ZA 3OFFA 1DTTB 4Y6IA 4WXWA 3KLHB 1D3WA 1F3VA 5GMKa 1HIYA 3MMCA 1TVRA 1HD1A 1F5BA 2BV3A 2GMJA 3W9IA 3UQSA 3G82B 4ER8A 4LF9F 2RHSB 4I1TA 2ROGA 1KDNA 5EWFA 8AT1B 4O0IA 1FFWB 2C3YA 5HN0A 3NWGA 4IQMA 3BPSP 2CQ0A 1RTIA 5DGBA 2QRRA 4X4PA 2RRAA 2RQMA 1IR1A 1M5HA 3IWNC 1VISA 2HVHA 3C15B 4EU0A 4PRFA 1A0OB 5E3AA 2HRUA 1UVLA 2KVQE 2O01C 2FLLA 2XY5A 2DITA 1HKAA 4A4JA 5KFAA 4NCAA 1U1KA 1B0TA 4J9OA 3NKYA 3W2VA 4EYIB 2YKMB 1F1BB 1CQNA 4OJ3A 1MU2B 4B3RF 3SSRA 5F8NA 1UEUA 2BE9B 4TY8A 3SCIE 4KGKA 4OYIA 1VQYA 3LP2B 2R2TA 3N01A 1S10A 4RW4A 3K2YA 5LXYA 4I0WA 3DN9A 1TL4A 1X9SA 3HD2A 2C2NA 2PSZA 4RW7B 2G9OA 3OFGA 2IRXA 2H48B 2RRBA 4DUYF 1JXVA 4C48A 2VH7A 3LP0B 3FSIA 4KGVB 2HS3A 3CC4S 1GK8A 3GIIA 1QDUB 3NGDA 3OXFA 4PCQA 3D1QA 2QL5B 3S6EA 1S0MA 3EPGA 4NPOA 4YFUA 2CFXA 4HACA 2HYIB 1LWFA 1VFJA 2F63A 1IR0A 1B3TA 1RT4A 3J7AN 2GO9A 1REVB 2K8GA 2CJXB 3ICLA 2PEBA 3LOUA 2MDAA 3D28A 3LAMA 2V8HA 2ZZTA 3O44A 3R5CA 4KFBB 2ASYA 2W4DA 1F60B 2LQ8A 3ILJA 2Y0SD 1HYSB 1PIEA 2E29A 3R8YA 3MHYA 4DL6A 4U9RA 3C2PA 3GQCA 5CYJA 1FJCA 3MPYA 4IH7A 1DQ8A 3BDEA 3TAMA 5D0RA 2Q3PA 1S1TA 3KLGA 2HVEA 4EI2A 2HSEB 2HEKA 2CPHA 2WBRA 4I2PA 2KYZA 3IP0A 4MKVA 4ES2A 3KMSA 2CDRB 2HNZA 1H0HB 3M05A 1KLMB 3ZNUA 4Q0BB 1PYSB 1CS4B 3CDBA 1QM9A 1Y3JA 3TWZA 3QIPA 4RW9A 1U1LA 2MKJA 5F41A 1RZMA 4DPUA 5J2MA 2Y0BB 2AGOA 2ACYA 1S49A 4OZLA 4NCBA 3M8RA 2QE5A 3H5SA 1EP4A 2BX6A 2MLZA 2KXNB 3IC1A 5E7OB 4DR2J 3A1YG 4LSNA 1WG4A 3J7YI 2W7OA 4N5SA 3MM5B 2M2BA 4BC7A 2I0XA 4BHQA 3QJLA 1TKZB 5E3RA 1DRZA 1RISA 2OKQA 5B0EA 4P75A 4CO4A 2FPHX 2YWWA 4FF1A 1JLEA 2CJBA 2AEJA 2LU2A 1T95A 3V4IA 1KLNA 4M5JA 3G4SS 1SIWB 2CQHA 1WNEA 2A18A 1A6LA 4ZVPB 2GGPB 3GG1A 4NZ6A 2K06A 5HL7Q 1PC4A 3MM8A 1GMWD 2D9OA 1JLCA 2DNLA 4KKOB 3H4BA 4C3KA 4BC9A 4DV2J 3K5PA 3FSYA 4DSFA 3CE8A 4CLPA 2CQBA 1N36F 1BUXA 1RADB 1X60A 4RR5A 5HMZA 2BKOA 2XWXA 2AYGA 2QTWA 1NJXA 2JEIA 3TVKA 2ZOFA 1RAEB 1B0VA 2CRLA 3GIKA 1U8SA 5KG7A 1WC3A 1CPZA 2VKZG 2R7QA 4Y2KA 4NYZA 4F36A 3MEGA 2AJ0A 3IO1A 5DQGA 4JI6F 2XULA 3AODA 3R7SB 4F0KA 2ZHOA 4GO5X 2CPEA 2KT3A 4ELVA 5A8KA 4EFAC 2IBKA 5I3QA 1V3SA 2YH0A 1L5UA 4ICLB 3AOCA 1M5SA 3HKZD 1WOPA 2RSQA 2C1EB 2XSJB 4LVOP 1WF2A 1RTIB 5ETPA 3HJVA 3TX0A 4YMEA 2IC3B 1WF0A 5IFMA 2AJ1A 3CDUA 3WHIA 3DNCA 3QT8A 2AYEA 2DIVA 3M8SA 3GPAA 3NOGA 4AXIA 2HMIA 2NXJA 1T03B 2UUAJ 4I6AA 2VD3A 1NCLA 2XMWA 4F3OA 3NY0A 2UV8A 1HMVB 2E1MC 2UUCJ 3W2VB 4P9SA 2ZBCA 4P7VA 1YKWA 2CJKA 4DR6J 1JNRB 2UU9J 5FJ4A 1X4BA 1OWXA 3D4JA 4OX9F 2FZGB 2CQ2A 5T41A 2RUGA 4NCGA 4KH0B 4NLPA 3DXBA 4U8YA 3W62A 3AB2B 1ZA2B 4OQJA 4ZPWR 1BD6A 2GX8A 3HLUA 5KFPA 4RW4B 4CLFA 3EXCX 3CJ8A 1UETA 4DR4F 1HBOA 1FJGF 4DCPB 4ZVFA 4YOEA 1MROB 3ISZA 2KRBA 4H54A 2CPIA 2QLWA 5EUHA 3UWTA 2HVIA 1NO8A 2XYGB 5G0RA 1RCXB 3AQOA 4DR3J 1SL0A 4P2FA 4OZ1A 4EWTA 3D6TB 1Z1ZA 5LOQA 4CTAB 1M5VC 5FDLA 4OHZA 5C42A 2N4CA 3LGNA 4IO9Q 4HACB 1LWFB 1OJ4A 1FRMA 3D0GE 4DFPA 2NZCA 3O3LA 3DDIA 2C28A 1RT4B 3R9LA 4R5PA 2FJXA 4MT1A 2JSXA 3OPKA 2P9EA 2UV8G 2DGTA 1CC8A 3KKFA 2BKPA 3FKBA 3RW6A 1TQLA 3MEKA 4ETXA 3H59A 1YQHA 4CLKA 3OXGA 2GIRA 1FRHA 5H9EK 3MTJA 3BGLA 1TL5A 2Z2ZA 2PD1A 2NUHA 2JWNA 3JTNA 1U0HA 3W2WA 2K2PA 3P8BB 4LSZB 3HXMA 3TAMB 1KWMA 3MFHA 3CJ5A 4ECSA 1S1TB 3KLGB 5KG5A 2GS8A 3U02A 2NSBA 4FYDA 4I2PB 3UDCA 2X1AA 4G65A 1ZYQA 5AE1A 4JI3F 2YQ0A 5KFRA 2NXUA 3EGZA 5DG8A 3MPWA 3ZFVA 3A8JA 4RW9B 1QTMA 2OAUA 5B09A 4LF8J 1KFDA 1IWGA 2JC1A 2RUSA 3RRGA 4LFCJ 4K59A 1EP4B 2HURA 1E6YA 3J80Y 1GTEA 2PDAA 3IXQA 2GIQA 1LKZA 3OTDA 4ZPAA 1Y3KA 1TL7A 4LSNB 4K4SA 3JQMA 5KG4A 2UXCJ 3BGFA 2FJAB 4Y2MA 3PR5B 1QAJA 2PI4A 5E41A 2XMVA 4Q2LA 1YBUA 4QIVA 2MKKA 5A6WA 5IT0A 3OR1B 2ZNYA 2UXBF 2B8PA 5RUBA 3I6PA 1U24A 4GVBB 4DZ6A 1LFWA 2XG8A 1N88A 2EK1A 3S01A 3SQOP 3A8KA 1JXLA 3CD5A 5KFGA 3ENAA 3V4IB 2DNOA 6FDRA 2QYCA 4DSIA 4JUZA 1LXNA 2ZJPQ 2DISA 1MMDA 1YG0A 4OHWA 2V4RA 3EGVA 2KM8B 3E2EA 1NK6A 3DI6B 4LVNP 2CAJA 4YDXA 1VQSA 3KDNA 2PT0A 4DV6J 2RQ4A 2FDNA 2YBVA 3MM8B 2AJ2A 1OO0B 1JJ4A 1JLCB 2FHKA 2BQ3A 3R97A 3GSDA 5KAKA 2HBRB 3QNWB 4L74A 1V5IB 4GMKA 3VVUA 1RP5A 3M4XA 1NK8A 5AXNA 2N7CA 1XJWB 3FMWA 1S12A 2YNIA 3KG1A 4URGA 1OPZA 1RSCA 1KONA 1RKJA 4PXBA 4PWDA 1FRIA 1WEXA 5HP1B 2D3OR 3BQ1A 4CLLA 3P6YC 1KS2A 1Y5LB 1AT1B 3GMGA 2NLWA 4RNHA 2OUGA 4IRKA 2VG5A 1I94J 3DOLA 3R7NB 3HFVA 3IM9A 3TARA 5HVGA 5KFHA 2VFTA 2CNLB 4BWMA 4WU2A 2R8HA 4YB5A 1VI7A 2NXCA 4N7TA 3PV8A 3DRYA 1T94A 1V6HA 4QWDA 4PPDA 4UY8T 5DLGA 2M88A 3TUJC 4NLQA 4NL5A 2HMIB 3ONQA 1JJHA 2DH9A 5HANA 3QJPA 4YB6A 3IS9A 4P73A 2BRLA 3Q24A 1FF2A 1U0SA 2HKEA 1Q16B 1NDLA 4PYAA 5FIIA 3PM9A 4ANCA 2AMCB 3MR5A 4ELUA 4I2QA 3A8IA 1HBUB 2K7KA 2ILYA 4YS2A 5A2QY 2DR6A 3MEEA 4NCGB 1TAUA 1SPBP 4DX8H 3GONA 1VQ9S 4QYZK 3NAHA 4KHMA 2D74B 4NASA 2OFHX 2QL7B 2HLUA 3Q8QB 4AE5A 1HBOB 3GIRA 3LP1A 2R2SA 3BSCA 3C6TA 5DDPC 3VV2B 1HWJA 2HNDB 1TL3A 1S9GA 4DPWA 4HKQA 2DVIA 5G0RB 1PILA 2J9EA 4YY3F 1VC5A 3M8PA 1AUDA 1R8HA 1UPPA 5FDLB 1H2TZ 4DX7A 1ITPA 5C42B 3UDVA 2AX0A 2RVJA 1IBMJ 1B64A 5KFYA 2V9WA 1D9FA 2ATCB 3NBPB 5HJYA 3KUEA 2RS8A 5A6PA 2DHXA 4DV0J 3BDPA 4TYAA 2PE8A 3MTKA 3M2UA 3TP2A 1R8CA 4R5PB 1HNWJ 1BMQB 4AXJA 1NNDA 2PI5A 4J91A 5B0DA 5IC4B 4K2XA 1GMWA 2QGFB 4J9VA 2CPJA 3GU0A 2XMMA 1S0NA 4C3LA 5CYMA 2ZWPA 3BO4A 4JI8J 2O5DA 5J2QB 5CD4H 4QQBA 3NNAA 4ZIWA 2R8KA 4FN5A 3FGVA 2AZ1A 1U0HB 4IRCA 3W2WB 3NEKA 3K7RA 4B3TJ 2XZWA 4QIGA 1XNQF 1RT6A 1HD0A 1DFDA 4ED3A 3JSMA 3IGVA 2NCKL 5F0UA 4MKAA 8ATCB 4QIEA 3HSJA 4A8OA 4I64A 4LRAA 2BJ9A 1Q79A 2FB0A 5EX3A 4ED4A 4LF9J 1U09A 4WIIA 3Q89A 2D1CA 1XEZA 2RDJA 2AU0A 3GZ7A 1WKJA 1WACA 3ELHA 3KMQA 1X4HA 3AJDA 2RJZA 2UZAA 3C19A 2V2KA 2B9EA 2BQUA 1SC4B 1C1BB 2UVUA 2OMOA 3N79A 1E6YB 3TR5A 3DRSA 3DOMA 1FWPA 2CJYB 1HI1A 1N5SA 3KDOA 1M0SA 2CA9A 1NHVA 4PG5A 1TV6A 3CCQS 5LM7E 7FDRA 5DGAA 2KJVA 5ETSA 3Q8PB 2DHGA 3SXLA 4U8VA 2LCWA 3E01A 3FEYB 1U1MA 1U45A 3GB0A 5L1KA 1FFSB 1RWUA 2R7SA 3U1NA 1H73A 2QLJB 4B3RJ 1IJFB 4WP3A 2CVIA 1HWUA 3A8EA 5U47A 4JI7F 4DR5F 4LJMA 1F9HA 4WK1A 2R8JA 1IM4A 1OYEA 4HR2A 2IYGA 1PYTA 3CIZA 1K0TA 5K8PA 5D0EA 3ZZZA 4N41A 4EMDA 3UO0A 3KNGA 1GMUA 1B4SA 2DRBA 5HI7A 1HHSA 1ZM9A 3QATA 4DUYJ 2LDIA 2MY8A 5C7PA 4ECUA 2HW3A 1UZHA 2QG9B 4N77A 3J81j 3EJMA 3I5BA 4ZPTR 2RU3A 1J27A 3PO5A 4B9UA 4EBEA 2DRAA 2QMXA 2YNIB 1DY3A 4NLDA 4FF4A 2FJDB 3BO3A 3MM7B 4ZVEA 4DWIA 4ZVTB 1J2VA 2DD8S 5GADI 4MYTA 4DUTA 3VR1A 3HF5A 5EDWA 2J6UA 5KFJA 1BY9A 2WHOA 5ETTA 2D69A 4NLRA 3OJUA 2PFFB 1S1VA 1S77D 3ZZYA 2CQCA 2JDJA 5IV4A 1RWMB 3BSAA 4F02A 2VG5B 1N6QB 1FXLA 1W7WA 1Y4ZB 3IR6B 3PYEA 2QFJA 2MEWA 1WG5A 4F4YA 3ETMA 2MKIA 1SI9A 1LWCA 3CJKA 4AQYF 1Y7PA 2XM3A 4GRSA 5C24A 4DV1J 5KTQA 2UXDJ 1N0VC 4NLXA 2QO3A 4IQXA 1AXQA 4PWUA 1ZZNA 5CYQB 3VALA 4ZIVA 1TKXB 3B4MA 4I2QB 2BXJA 2JL9A 4MTPA 5AXMA 1G7CB 1WTFA 4X4NA 1GH8A 1KHWA 1Q1KA 3MEEB 5J1PA 1VR6A 3LWLA 5LJ3Y 2ZD1A 1QAIA 3PEJA 5GAGI 3SV3A 4D3GA 2FLNA 4P2SA 2HWIA 4HHJA 1F2HA 4M5DA 1MW7A 5HSPA 5IV3A 2R7WA 5IT4A 4FVMA 2G2YA 3QLHA 4QWBA 1WEZA 4WZMA 3I4HX 4B02A 4OZ5A 4WTOB 4C0BA 3LP1B 5A8RA 2FVSA 1T9VA 2YVSA 4I6WA 4C8OA 3CNQP 3T9ZA 3OVSA 2OPPA 1TL3B 1S9GB 1HNIA 2GAGC 2YWFA 3US5A 4OZJA 3FBFA 3M8PB 1DURA 5F3ZA 5LL6d 4DX5A 3T5LA 4OX6A 4M1KA 1NUEA 3CC2S 1RTHA 1DAXA 2LECA 3DLJA 4JOUA 3BN7A 5B0CA 3TA2A 3MR6A 4M5KA 3KXDA 4A8XA 2PGCA 2ZUAA 1BWVA 1BGXT 2H4WB 4JYAF 2JFDA 3SCJE 3B78A 1FRJA 2GNKA 1T8EA 1JLBA 2YWKA 4CDIA 4JV1A 1K47A 2BM0A 2ZDPA 4ZLJA 4ZPCA 3PX0A 3MCSA 4P2XA 4DQRA 4I4BA 2RNEA 5CYMB 4ZHRA 5E2QA 3FZ2A 2W9BA 2EG1A 2CPDA 5KFDA 5MAOA 4NI2A 3AHPA 4NLSA 3CJ3A 3JQKA 4I68A 4OJHA 2BQRA 3I87A 3FC9A 3GIMA 1RT6B 4IOBA 1FNXH 1IXKA 1FK9B 3FQKA 5HMXA 2X1BA 3JSMB 4CRJA 2HQFA 2YKAA 3L7OA 2WVCA 2JH3A 1KFSA 5CQGA 2QMUB 4JI6J 2H65B 4ZVHA 1D0EA 3GFZA 5D4OA 2F40A 3KOAA 5D3GA 1XR7A 3ET6A 3A3OB 4C3MA 2MQPA 4DF8A 1O8BA 4XDDA 2XNRA 1UW4A 2JZ5A 2DB1A 4NLOA 5GAHI 1CULA 3WBZA 1Q8BA 3FJ2A 3SYZA 2NR0A 1I1GA 1ZPWX 2CWXA 5LSOA 2C42A 2DGUA 2VDIA 3QWUA 3UN3A 3JSYA 3DRSB 3DOMB 2KB2A 2ZHAA 3L9ZA 2EK6A 1WJ9A 4ID5A 4MKYA 3MECA 3T9NA 2C2RA 3N6MA 5DDRC 4N76A 3OBIA 2IJFA 4A8KA 4O3OA 3E01B 3GTYX 1WD6A 2GMHA 1GAOA 4Q44A 2HFVA 1D8YA 1K0VA 3BREA 3R7BB 4YHHF 2X1GA 2A6MA 4G1QA 4OX9J 1PKUA 3M8QB 1T9YA 4WF9Q 4GKKF 1TR0A 1YJ9S 3KHLA 1U49A 4TQRA 3TZYA 5L1JA 2Q66A 2XZDB 4F4AA 2DKOB 4RPFA 3M9MB 1UEVA 1FJGJ 3KJVA 4ZP7A 3D1HA 2W7PA 2YNGA 3FEXB 1N8RT 3ZTOA 5HQLA 3VAGA
chains in the Genus database with same CATH topology
4O0NA 1NSPA 2B8PA 2DYAA 3DKDA 3G2XA 2B8QA 1B99A 1JXVA 2DXDA 3VGSA 3EVMA 5BXIA 2DXEA 4FKXA 1F3FA 2HVEA 4DZ6A 3EMTA 1LWXA 3PRVA 1BE4A 1XQIA 2HVDA 4DUTA 4FKYA 3EVWA 2AZ1A 1WKKA 3EE3A 3ENAA 3NGTA 4UOFA 1K44A 4ANDA 3FCWA 3VGTA 5CABA 1NDPA 1PAEX 3B6BA 2VU5A 3GPAA 3PJ9A 1NDCA 5IOLA 1XIQA 2AZ3A 3EICA 4CP5A 2NCKL 1VYAA 4UOHA 1W7WA 3B54A 1WKLA 3FC9A 1EHWA 3FBCA 3ZTPA 4EK2A 4S0MA 1PKUA 3EM1A 1NB2A 1NCLA 3FBBA 3NGRA 2BEFA 2CWKA 3BBBA 3ETMA 3MPDA 3VGUA 5CAAA 4HR2A 1BUXA 1NDKA 3Q83A 2BX6A 1F6TA 1S5ZA 3BBFA 3VVTA 3GP9A 4ENOA 1BHNA 3DDIA 1LEOA 3NGSA 3Q8UA 3BH7B 3Q89A 3FBFA 1NPKA 1S59A 3L7UA 3R9LA 4DI6A 2DXFA 1WKJA 3WX8A 1NDLA 3BBCA 3JS9A 1HIYA 3ELHA 2HURA 3NGUA 3Q86A 1NHKL 4ANCA 1NSQA 3VVUA 4ANEA 1HHQA 2DY9A 4WBFA 1B4SA 4F4AA 3BH6B 3EVOA 3FKBA 3Q8VA 1NUEA 3ZTRA 4UOGA 1NSKL 3VGVA 4C6AA 4W98A 4F36A 1ZS6A 3ZTSA 1U8WA 5C7PA 3Q8YA 3FBEA 3ZTQA 4KPCA 1MN7A 1KDNA 1UCNA 1S57A 3EJMA 2ZUAA 1NLKL 1HLWA 1MN9A 3ZTOA 3FCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O0N A;  1NSP A;  2B8P A;  2DYA A;  3DKD A;  3G2X A;  2B8Q A;  1B99 A;  1JXV A;  2DXD A;  3VGS A;  3EVM A;  5BXI A;  2DXE A;  4FKX A;  1F3F A;  2HVE A;  4DZ6 A;  3EMT A;  1LWX A;  3PRV A;  1BE4 A;  1XQI A;  2HVD A;  4DUT A;  4FKY A;  3EVW A;  2AZ1 A;  1WKK A;  3EE3 A;  3ENA A;  3NGT A;  4UOF A;  1K44 A;  4AND A;  3FCW A;  3VGT A;  5CAB A;  1NDP A;  1PAE X;  3B6B A;  2VU5 A;  3GPA A;  3PJ9 A;  1NDC A;  5IOL A;  1XIQ A;  2AZ3 A;  3EIC A;  4CP5 A;  2NCK L;  1VYA A;  4UOH A;  1W7W A;  3B54 A;  1WKL A;  3FC9 A;  1EHW A;  3FBC A;  3ZTP A;  4EK2 A;  4S0M A;  1PKU A;  3EM1 A;  1NB2 A;  1NCL A;  3FBB A;  3NGR A;  2BEF A;  2CWK A;  3BBB A;  3ETM A;  3MPD A;  3VGU A;  5CAA A;  4HR2 A;  1BUX A;  1NDK A;  3Q83 A;  2BX6 A;  1F6T A;  1S5Z A;  3BBF A;  3VVT A;  3GP9 A;  4ENO A;  1BHN A;  3DDI A;  1LEO A;  3NGS A;  3Q8U A;  3BH7 B;  3Q89 A;  3FBF A;  1NPK A;  1S59 A;  3L7U A;  3R9L A;  4DI6 A;  2DXF A;  1WKJ A;  3WX8 A;  1NDL A;  3BBC A;  3JS9 A;  1HIY A;  3ELH A;  2HUR A;  3NGU A;  3Q86 A;  1NHK L;  4ANC A;  1NSQ A;  3VVU A;  4ANE A;  1HHQ A;  2DY9 A;  4WBF A;  1B4S A;  4F4A A;  3BH6 B;  3EVO A;  3FKB A;  3Q8V A;  1NUE A;  3ZTR A;  4UOG A;  1NSK L;  3VGV A;  4C6A A;  4W98 A;  4F36 A;  1ZS6 A;  3ZTS A;  1U8W A;  5C7P A;  3Q8Y A;  3FBE A;  3ZTQ A;  4KPC A;  1MN7 A;  1KDN A;  1UCN A;  1S57 A;  3EJM A;  2ZUA A;  1NLK L;  1HLW A;  1MN9 A;  3ZTO A;  3FCV A; 
#chains in the Genus database with same CATH topology
 3Q8S B;  3CDW A;  2B7B B;  3BSO A;  4DPO A;  1DHM A;  2DNN A;  1EZZ B;  4GC6 A;  2HVD A;  2QYG A;  5CA5 A;  3CW2 C;  4UQT A;  5KG2 A;  3SMZ A;  1BLU A;  2AEM A;  4HVZ A;  3OFH A;  1JIH A;  2BJE A;  2WBM A;  5ETQ A;  1DTQ A;  4YDD B;  3M6W A;  5IQQ A;  5KFN A;  2BBE A;  1IBK J;  1Q8I A;  5KT5 A;  2LEP A;  1S1V B;  3H2L A;  2IJR A;  2RF2 B;  3AA9 A;  3D9B A;  4J9Q A;  4J90 A;  3BBF A;  5H1S V;  4OYO A;  7AT1 B;  4FNI A;  1L3S A;  4JI2 J;  4JI4 F;  4M8L A;  4WK3 A;  3D6H B;  4IUF A;  1GX5 A;  4LBP A;  1QUP A;  1YJN S;  5C24 B;  4UY8 5;  5ETN A;  5LMN J;  4EBC A;  2Y9H A;  3T5J A;  3GJT B;  3PYG A;  2W8L A;  2JJ4 D;  4C0O C;  3CT9 A;  3KK3 A;  5GAE I;  1SCJ B;  2R7V A;  3DKD A;  3UD3 P;  4LF6 J;  1K9M T;  4HHU A;  2JFK A;  5KFX A;  4HI1 A;  2ASD A;  3R5G A;  2HHX A;  4RO0 A;  4H4O A;  4NLY A;  2M3D A;  2G0I A;  2CUY A;  2ZD1 B;  1HR0 F;  4LFA F;  2K1R A;  3I4P A;  3R5B A;  1RYS A;  2P9C A;  4CM0 A;  2ZE2 A;  4M5D B;  3DDN A;  5ETO A;  3MED A;  1IKW A;  3QLH B;  2LXF A;  4CNY A;  1QSS A;  4UTG A;  4M5L A;  5A8R B;  4N47 A;  4LUB A;  3DXS X;  4XAK A;  4KH1 B;  3KK2 A;  5L1I A;  5A0Y B;  1FEE A;  4WU3 A;  4X2B A;  2EXU A;  2HIY A;  3IBW A;  3KTQ A;  4PUO A;  2UXB J;  4WBF A;  4JI0 J;  2JVR A;  3ZZR A;  4YR0 A;  2E7X A;  2D9P A;  5F8H A;  2DNM A;  5KT2 A;  2ZH7 A;  1Q5V A;  1DLO A;  2PMZ D;  4DBQ A;  5C25 B;  4ETZ A;  1RTH B;  4ZIT A;  4Z2X A;  1NSP A;  3HI9 A;  4P7T A;  4EO6 A;  3A4T A;  3TJA A;  3BSN A;  4ZVQ B;  4DL4 A;  1LWX A;  3CB4 A;  4J37 A;  2DR8 A;  1YI2 S;  4DSL A;  4F26 A;  4IFV A;  1SQG A;  1JLB B;  4KO0 A;  2CG4 A;  2IFX A;  2JEF A;  4O3P A;  3BGR A;  4ZHR B;  5L46 A;  4LBH A;  2W9B B;  2KXH A;  4Y3C A;  2FVQ A;  3DLK A;  4NI2 B;  4S0M A;  4BWJ A;  1SKS A;  1RAC B;  2GO8 A;  2G1D A;  3A3N B;  3R2D J;  1NKB A;  5IZH A;  2HZA A;  4LF1 A;  3TAN A;  2HWH A;  3M1V A;  2ZC3 A;  2LFV A;  2B9W A;  2IA6 A;  1YX2 A;  2DY9 A;  1MMN A;  4AT1 B;  4G3I A;  2ZH1 A;  4R0E A;  2GHV C;  2C2D A;  1OPI A;  3GFY A;  5D3G B;  5LT5 A;  4FXD A;  1EAR A;  3ET6 B;  4UT4 A;  2NYI A;  4CO3 A;  1Q7L B;  4QIW D;  2VJV A;  3SFU A;  2QZ8 A;  2MLY A;  1CUL B;  3DRR B;  2E9Z A;  4USK A;  3POT A;  5K8O A;  4CCH A;  3K8V A;  3HHL C;  1L3K A;  2FZC B;  4ID5 B;  4DN9 A;  9RUB A;  4TLQ A;  1LXJ A;  3DHW C;  3C14 A;  2AZ3 A;  3DM2 A;  2Z4P A;  3UR0 A;  4CQ1 A;  3VQS A;  1FKP A;  4E2F B;  2QA1 A;  3IFE A;  3I82 A;  2DT9 A;  3PAC A;  3PKM A;  3UFC X;  4MAK A;  4G1Q B;  2R7T A;  3T1H J;  3N6N A;  2YX1 A;  4KAI A;  1TAQ A;  5K14 A;  4A8W A;  2KH9 A;  2R7X A;  2HNY A;  3ZZU A;  4W98 A;  3T41 A;  1RAF B;  2BUN A;  3MAA A;  2XMU A;  3AJ1 A;  2RE1 A;  1T9T A;  1C1C A;  2MHN A;  2GA7 A;  2XQC A;  4MMO A;  4FBT A;  3M9O B;  1C4C A;  1SJF A;  2WK4 A;  5HMY A;  3KJV B;  3H5U A;  3P3D A;  4X4V A;  1TUW A;  1RT2 A;  1WDT A;  2EWH A;  1X4C A;  4KQZ A;  2EFV A;  3I9Z A;  1ZAV A;  2FIU A;  4O3N A;  1HPZ A;  5AE2 A;  3MGJ A;  2NRE A;  1PJ5 A;  4ZLP A;  3K59 A;  1YSJ A;  3DRP A;  1SC3 B;  2F65 A;  4CI0 B;  3L7P A;  3CUL A;  1MWY A;  3CUN A;  3GIJ A;  1JJC B;  2WVE A;  4B9V A;  1DTQ B;  4X64 F;  1HNV A;  3VGU A;  4WFB Q;  1R31 A;  2GVD B;  2FGO A;  1S5Z A;  4DEZ A;  3JSB A;  2XYP B;  1TUV A;  3Q2T C;  2VFS A;  1VCT A;  3OVA A;  3CJT A;  2FY1 A;  2V8D A;  4K4W A;  3OTC A;  2L48 A;  4CIO A;  4UF4 A;  4ZJQ A;  2Z2L A;  5K9F A;  1S9F A;  3SIP B;  4MJK A;  5F9L A;  3KJF B;  4OI6 A;  4KHP J;  1XNQ J;  2MPU A;  2W9A A;  2DYA A;  2EFO A;  5KFE A;  2KL8 A;  2ZZN A;  2I2Y A;  4JI1 F;  4Z7C A;  4OYZ A;  2KT5 A;  1WHV A;  3EZO A;  2LVW A;  4AUK A;  3KK3 B;  3QJJ A;  5A76 A;  4WYW A;  4V1A k;  4DL3 A;  2NYH A;  4H4O B;  3IA0 A;  3P5B P;  5AT1 B;  1QVG R;  3PFE A;  1TEL A;  1PBA A;  1UTA A;  2K1R B;  3KYL A;  2RHQ B;  2FLP A;  3S8S A;  5ETL A;  3WDO A;  3OV7 A;  1G4C A;  1NDK A;  3TQE A;  1K8A T;  1KN6 A;  4XTT A;  5L1L A;  2V8G A;  2E66 A;  4YEA A;  1WC4 A;  4B17 A;  1I3O B;  5KFL A;  2CKW A;  2DGW A;  2AD9 A;  1FES A;  1SJQ A;  1X5P A;  4OYX A;  3AH6 A;  3KK2 B;  1A7G E;  3E8O A;  3I5C A;  3SI8 A;  4OMF G;  1NU4 A;  5L9X A;  4PUO B;  2G2Z A;  5KT6 A;  1OY9 A;  2XEX A;  5DM6 Q;  2EC2 A;  4YN3 B;  4O0N A;  3QGH A;  1HQU A;  2GC8 A;  1DLO B;  1UVK A;  4BCA A;  1HWL A;  5IT9 Y;  3G8S A;  4JI7 J;  2RS2 A;  4DR5 J;  1DTT A;  5KFQ A;  3KLH A;  5L9N A;  3QRR A;  1WOS A;  2N4D A;  2FLO A;  5CAB A;  4CYU B;  4IFV B;  1ZM2 A;  3Q8R B;  4ED8 A;  3D2W A;  3G82 A;  2E5L F;  3CMQ A;  1TMJ A;  3FFI A;  3W8G A;  1S0O A;  3BB5 A;  4MIA A;  2OSR A;  1DQA A;  1YWX A;  3Q83 A;  2GW8 A;  3CDE A;  3DLK B;  2F9J A;  5IC6 B;  2VBX A;  3LF0 A;  2OO4 A;  2KZM A;  2HGL A;  4GVL A;  4TY9 A;  2F4F A;  1HHQ A;  4IYQ A;  4URS A;  4Z37 A;  1NH8 A;  2OHD A;  3RU0 A;  3M1V B;  3QO9 A;  1BQN A;  1NSK L;  3CGI A;  3NOC A;  1YK9 A;  4M94 A;  1X5T A;  2AJ4 A;  4YB7 A;  1VBZ A;  3NNC A;  1XWL A;  4K2J A;  4NLG A;  4ES3 A;  1XMQ J;  3W1Y C;  2CG8 A;  3KHH A;  1MNE A;  2VOD A;  4JV5 J;  1IQZ A;  2C2E A;  2YKM A;  4Q45 A;  1ZM3 A;  1VC6 A;  3R5J B;  1L3T A;  1N32 J;  2K3I A;  2FJB B;  4GKJ J;  1X0F A;  1UA1 A;  4J9N A;  2YWG A;  2YQ1 A;  3LP2 A;  3GYN A;  3PIP Q;  2AEF A;  4X66 J;  1LFP A;  4DOZ A;  4CT8 A;  1T0T V;  5IM0 A;  1RBO B;  1AYE A;  4ZK7 M;  5GME A;  4ECQ A;  1FDD A;  1RGV A;  3QQC D;  3C14 B;  4ID8 A;  2IVM A;  2NUU G;  4RW7 A;  1U47 A;  3DM2 B;  3MPD A;  4U6P A;  4O23 A;  3HHL D;  1FKP B;  2L9W A;  3BKT A;  4PZV A;  4PAB A;  2O66 A;  5A8W B;  5J1E A;  2FY8 A;  3DGV A;  5D15 A;  2MQL A;  3TRG A;  3FEZ A;  1SH3 A;  3E51 A;  3NMA A;  1AUS L;  3T1Y F;  5K14 B;  3UDE A;  1QAX A;  4QYZ J;  1P1T A;  4L6V 3;  2LA6 A;  3I32 A;  1MN9 A;  3VCD A;  1RU2 A;  3MAA B;  1NKC A;  3FMB A;  3MUV P;  2YWH A;  4LFB F;  2BAC A;  2HHP A;  2W2O P;  2A0F B;  1XN9 A;  4P71 A;  3WC0 A;  2GQC A;  1WKK A;  1S6Q A;  3IG1 A;  1SQE A;  1RT2 B;  3CJQ A;  2A2D A;  1U6Z A;  2GQQ A;  2P6T A;  1U48 A;  1S6P B;  3EZ5 A;  3PO4 A;  3QRP A;  2VPY B;  9ATC B;  4C8M A;  2HHW A;  2A1B A;  2B51 A;  3RB3 A;  4Q8F A;  4R25 A;  4DF4 A;  3BPD A;  5DQH A;  3M6X A;  2V68 A;  2CQ4 A;  2AP6 A;  1R6Y A;  4DSE A;  4BDP A;  3BEG B;  4FVC A;  5HLF A;  2CXE A;  3HX9 A;  3T19 A;  4JYA J;  4DCJ B;  4QYR A;  3AOA A;  2XO7 A;  3WX4 A;  2F8E X;  2YPZ A;  1XER A;  4U7C A;  3WQP A;  2DR7 A;  2HQ3 A;  1U8W A;  2IVY A;  3DU6 A;  2R2R A;  3IN5 A;  3PYF A;  4A8M P;  5AXL A;  3L95 X;  1RTD A;  1NK7 A;  1C0U B;  3LO3 A;  1Q82 T;  2PFD A;  4TKT A;  3HK2 A;  3MDF A;  4ZOS A;  4N8O A;  2XO6 A;  4B3S J;  1BE4 A;  2O3D A;  4HLB A;  3TZZ A;  1WSR A;  5KG1 A;  1P9Y A;  1XNR F;  1X5S A;  3ITH B;  3QYY A;  1F9F A;  2J9D A;  1C4A A;  4DQQ A;  4DFJ A;  1RWO B;  1V3R A;  4DPY A;  2ZM6 F;  2QEX S;  5BR8 F;  5ITH A;  4MIB A;  3G87 A;  4UZB A;  1RHU B;  3HHK A;  2ZOG A;  1RA6 A;  1RWW B;  4IG0 A;  2IRY A;  4ES1 A;  1GXT A;  2DGQ A;  3CF5 Q;  4QU6 A;  2YKN B;  4ECY A;  1X4E A;  5DDO C;  2CZV C;  4DPT A;  4K8R A;  4OZN A;  4RBT A;  2XWY A;  1RYR A;  4Q43 A;  1SJ3 P;  1SUQ B;  1X8D A;  5F8G A;  3EGN A;  1EQ0 A;  4I7F B;  2HPU A;  3F56 A;  2EEY A;  3GR1 A;  2XMA A;  1O0P A;  1N5Y A;  3OTO F;  2Z58 B;  4QW9 A;  1YDL A;  1H74 A;  1RAA B;  1NK4 A;  1EKS A;  3CO9 A;  1T11 A;  3LGM A;  3PX6 A;  4K4Z A;  3K17 A;  4P74 A;  1HQU B;  3M2V A;  3BKF A;  1JQG A;  4GKK J;  1YBT A;  3LAK A;  5J2P A;  1YGY A;  1M5P C;  2PII A;  1NPP A;  2VOO A;  1XIQ A;  1EET B;  2MZQ A;  2ZH2 A;  5KG3 A;  4C9D A;  2BZ2 A;  2YPY A;  1VS3 A;  2EFG A;  5F8I A;  1OQ3 A;  2NZ4 A;  4CNZ A;  3PW0 A;  1V9O A;  1NXI A;  4NA3 A;  4K5S A;  4D3H A;  4ICL A;  4RL1 A;  3FFI B;  5J2N B;  3JSR A;  4NLU A;  3ZZT A;  2CVE A;  2AWZ A;  2HHU A;  2XSJ A;  2ZNZ A;  1LQ9 A;  1VK8 A;  1UJ5 A;  2IC3 A;  4UOG A;  4USM A;  2O1P A;  1YZ7 A;  3ZTS A;  5C2C A;  3Q0A A;  3DFE A;  3QBC A;  2HQG A;  2M7S A;  1RTJ B;  3QO9 B;  1BQN B;  1Q8L A;  1T03 A;  3W8P A;  2CIM A;  3TOQ A;  2U2F A;  3FCH A;  1FA0 A;  4NZ7 A;  3OL7 A;  2OTJ S;  1HMV A;  4NRT A;  3H7H B;  1IKV A;  3OFE A;  4DMZ A;  3W9H A;  1UWA A;  3CCS S;  2UUB F;  3PX4 A;  1IUJ A;  2CQG A;  1YVF A;  1R7I A;  2QLF B;  4HTI A;  1HBN B;  1IVZ A;  4DSK A;  2J0X A;  1RKI A;  1UAW A;  2B4O A;  2RB7 A;  1SL2 A;  4PG8 A;  5IM0 B;  1LV5 A;  5AJ3 J;  2IYI A;  4NA1 A;  1WSV A;  1KQK A;  1RAG B;  1URR A;  1MRO A;  1A9N B;  1JLA B;  2OP5 A;  2OPS B;  4USV A;  4ZPV R;  4LF7 F;  3W63 A;  3DOK B;  1VHF A;  3J80 U;  3D6M B;  1KTQ A;  5J1E B;  2DR9 A;  4WTY A;  4CH7 A;  2MST A;  4LRD A;  2KFN A;  2BOA A;  2A3J A;  4XPC A;  4CTA A;  3TUZ C;  2XYH B;  1R0C B;  3EDQ B;  1HL6 A;  3B4D A;  4LFA J;  2B6A A;  4ZA1 A;  4PPZ A;  4Y65 A;  3R6G B;  3EMT A;  4JV0 A;  3V6D A;  2VOP A;  1KTV A;  4WKR A;  2I5J A;  2V0N A;  3M8Z A;  3NCP A;  2KZZ A;  3H5Y A;  2EPI A;  5D4L A;  2QL9 B;  3IG1 B;  1S6Q B;  1HQE A;  1XR5 A;  4TXS A;  4EGL A;  1VYA A;  2J76 E;  4ZKA A;  4A47 A;  5DET A;  4F50 A;  2HHH F;  3HDS A;  5LSR A;  3PJW A;  4DL7 A;  3HHN B;  4WFZ A;  3SZ2 A;  3BZQ A;  3HFK A;  3AD7 C;  4UUW A;  1EIY B;  3JQJ A;  3OLA A;  1R8P A;  4H4K C;  3MOZ A;  1CLF A;  4YP3 A;  1U1P A;  5F8J A;  5HLF B;  2AKW B;  4QR0 A;  2NQP A;  2HFU A;  2G2O A;  1NJY A;  2KJW A;  3B82 A;  4FXW A;  5KT4 A;  4DV3 F;  3GJR B;  1R43 A;  4IR9 A;  3KG0 A;  4Y0F A;  2P9G A;  4DFK A;  2DNR A;  1SH2 A;  4BBY A;  4RNN A;  2DXE A;  1U7L A;  4DR2 F;  1OQ6 A;  3N5B A;  2ALZ A;  1RTD B;  2DGV A;  4A8Y A;  3VAI A;  3I56 S;  3BO2 A;  3MWB A;  2MMY A;  3G96 A;  4RUB A;  2HQD A;  5F8L A;  1PAE X;  4ZPB A;  3D54 A;  4CP5 A;  3OTE A;  4RNM A;  1B7F A;  1S6U A;  2OSQ A;  2J0S D;  1NK0 A;  1RDR A;  4X4Q A;  2KM8 C;  3WIV A;  1FWL A;  1WEY A;  3AB4 B;  4OYP A;  3EZU A;  2BJ7 A;  3OR1 A;  4O3Q A;  1S1U A;  2B4U A;  2RIJ A;  3DMJ A;  1KQS R;  2DXF A;  1JNZ B;  2Z2Y B;  3ETO A;  1FVQ A;  4GVB A;  2DNP A;  3JS9 A;  4DU7 A;  3FK4 A;  4IG0 B;  2M9K A;  2K7J A;  2J7U A;  2B0G A;  4C6A A;  4DUZ F;  4EBD A;  1RHR B;  4F2R A;  1BWE A;  4W92 B;  4DLG A;  4WJB A;  2XNQ A;  4PG7 A;  4DV2 F;  4PWW A;  5A2Q U;  3OW2 R;  3DI6 A;  1H72 C;  5T7L A;  1VQ7 S;  4F4K A;  2KG0 A;  1HW8 A;  2BM1 A;  4J5O A;  1FD8 A;  3O8W A;  4QWC A;  1N5Y B;  1RBL A;  1KC8 T;  4OV1 A;  3SV4 A;  3HHL A;  1RBA A;  2HS4 A;  2VDH A;  1TKD A;  3GCX P;  5ETR A;  1S7H A;  5SUH A;  2R8I A;  1Z2Z A;  2KXF A;  3CIM A;  1KSP A;  5JVH Q;  3M2V B;  2V69 A;  4WFA Q;  1HBM B;  2RT3 A;  5J2P B;  2DIU A;  1WEL A;  1N4L A;  5KT7 A;  4I6Y A;  3BKU A;  5HP1 A;  4RX6 A;  2G0C A;  2D3Z A;  4KV8 B;  2WVB A;  3OL9 A;  2WVF A;  3AD9 C;  1FXD A;  1PG5 B;  1CEZ A;  1SV5 A;  1VRQ C;  2AF6 A;  5GMD A;  1D9D A;  1C0T A;  3LAL A;  4EEY A;  3L09 A;  3T6J A;  1U26 A;  1VJQ A;  4A8Q A;  2KFY A;  5CCL A;  2VV5 A;  4CT9 A;  3V6H A;  3QT7 A;  1JLQ A;  2ZH5 A;  3IAM 9;  2UUA F;  3ISN C;  4J9L A;  2XTJ P;  2MKC A;  2GJF A;  3C6U B;  3R1H A;  1ELO A;  1GEH A;  2DCU B;  2JNJ A;  3C16 B;  4DHV A;  3IBC B;  3CCR S;  4QU7 A;  2V67 A;  2YTC A;  4QPT A;  2IIH A;  2VG6 B;  1T05 A;  1U6B A;  4DR6 F;  1RUS A;  2UU9 F;  4O3R A;  5E3P A;  4X64 J;  4ZCK A;  1WI8 A;  3U7J A;  1YZ6 A;  1NJZ A;  3PJ9 A;  1UZD A;  3CDA A;  1IKV B;  3RW7 A;  1HBU A;  3TA1 A;  2HAI A;  1QLN A;  4KB7 A;  4IRD A;  3OLB A;  4RUA A;  4M95 A;  1SKU B;  3CCL S;  3G8Q A;  2MKS A;  2OEJ A;  3K5L A;  1UFW A;  1XC9 A;  1P9Q C;  3D3C J;  3N28 A;  3RAM A;  2WSE C;  2DGS A;  3KLF B;  2DNZ A;  4LIR A;  4URQ U;  2ZDO A;  1N56 A;  4ZMM A;  3D1O A;  1GT8 A;  1S1W A;  4JI1 J;  2VAS A;  2ERR A;  4B9S A;  3I0S A;  3ZTQ A;  2KO1 A;  4J9U E;  1RE1 B;  2HND A;  2LXI A;  1S57 A;  2M52 A;  2GAH C;  2FUG 9;  4ZLN A;  5JVG Q;  2XMJ A;  1T9U A;  5DQI A;  1RHK B;  2V8V A;  3TUI C;  3L4B C;  1IKX B;  4W4M A;  1KD1 T;  2B6A B;  4USU A;  3NBP A;  3VF0 B;  3MD3 A;  3V6D B;  3W60 A;  2I5J B;  2UVV A;  3KFW X;  5KFO A;  1PJ6 A;  2K3K A;  3O6Q A;  2AYM A;  4DDF A;  3LGH A;  2MZT A;  3CC7 S;  4F25 A;  3PKY A;  3IRW P;  1HQE B;  3HT3 A;  2MZ1 A;  2CPX A;  2KYX A;  4KY3 A;  5KFM A;  4OX7 A;  2HFZ A;  2ZBP A;  5J2Q A;  1RAJ A;  1B7Y B;  2B9Y A;  5FLX U;  1JK9 B;  3R2C J;  4MK8 A;  3CVK A;  5KFC A;  2AIR B;  1FE0 A;  5L39 A;  2PA8 D;  3EVO A;  3KUH A;  2WB1 D;  4IG3 A;  4UQG A;  1FRX A;  2UVW A;  4FF3 A;  1N34 F;  3LUY A;  1X4A A;  4DR1 F;  1FWK A;  5I42 B;  2ASL A;  4MH8 A;  4OLP A;  6FD1 A;  1Q78 A;  3MPU B;  4FBU A;  2LYV A;  4IR1 A;  1V3Z A;  3T1A A;  3N4W A;  2A10 A;  3M30 A;  2E5L J;  4HDH A;  2X1F A;  1TKT A;  4LFC F;  3M32 A;  1VQ4 S;  4C8K A;  2ZBR A;  2Y1R I;  4G1P A;  4PG6 A;  1NK9 A;  4C11 B;  3W65 A;  4YUD A;  3IWX A;  3UVJ A;  1AA1 B;  3OR2 A;  2MZS A;  2BKN A;  5D77 A;  2HFN A;  3EDR B;  1D09 B;  4TNO A;  1Q4R A;  3EUN A;  3M7V A;  4ZPD A;  3OL6 A;  1C1B A;  2EW9 A;  4C8Z A;  5F8M A;  1R6V A;  4DV7 F;  5JUM A;  3TEH B;  4F4Z A;  3K89 A;  5JXS A;  2B56 A;  3NP5 A;  5DRK A;  1S1U B;  3GE9 A;  3DMJ B;  2J0W A;  4YR2 A;  1JKH B;  4E0D A;  1Z2L A;  3OTB A;  1ZPV A;  4NXM J;  2CAD A;  3OD2 A;  3KJQ B;  4R8U A;  1FRK A;  2D41 A;  3HZG A;  3R1L A;  2VUG A;  4H4M A;  2VF3 A;  2AQ4 A;  1YJV A;  3D68 A;  2ADB A;  5T7L B;  2OPQ A;  1H2U X;  4LF4 F;  2ZKU A;  4ECW A;  3OT9 A;  3G8T A;  4DG1 A;  2OH2 A;  2VQF J;  3HSD A;  5C5J A;  5IXU A;  2XS2 A;  1VBY A;  5D8H B;  1NDC A;  3BQ2 A;  4U67 Q;  3HHL B;  3SSQ A;  1F0X A;  1RT7 A;  1YJW S;  3FBC A;  4CLY A;  4JBC A;  3AJ2 A;  3TX8 A;  1UJ4 A;  1T3N A;  5B0A A;  3K5N A;  2H51 B;  1VRT A;  2FJW A;  3RBX A;  4RNO A;  3EYZ A;  2M8D B;  2POK A;  1I51 B;  3MM7 A;  1FKO A;  3FRZ A;  1I94 F;  1EQM A;  4ANE A;  4AD6 A;  2HAF A;  5H9F K;  1SVD A;  2VQE F;  3ZTR A;  4K7Q A;  1OY6 A;  2WSF C;  1UP1 A;  3HUL A;  1AFI A;  1N6Q A;  4OYA A;  2J0Q D;  1SV5 B;  1KVJ A;  4DZD A;  1C0T B;  2E1C A;  4Q7A A;  3UDL A;  3MUT P;  4USJ C;  4DV5 J;  1JLQ B;  4OI3 A;  2JC0 A;  3RB4 A;  4JV2 A;  2V4J A;  4C2M A;  3Q2S C;  2Q6C A;  2MQM A;  1KKH A;  3TJ8 A;  1IJE B;  4O4R A;  2E9T A;  4EZ9 A;  4ZJO A;  2AHO B;  4B9M A;  3FSX A;  4Y28 C;  3ISN D;  1H7W A;  3P5T L;  4C8L A;  1TFW A;  1L3U A;  1LWE B;  1T05 B;  2ZUG A;  2YX4 A;  3RBD A;  5CYQ A;  5GAD U;  1TKX A;  3OVB A;  5CXT A;  2X7I A;  3MXH P;  3U27 A;  4JI5 F;  2KT2 A;  2PA3 A;  3C46 A;  5CHC B;  2R9L A;  3TA0 A;  1OYD A;  2DRD A;  4Q5V A;  2W2Q P;  4B3M F;  1KQG B;  5D4P A;  4DI6 A;  3CCZ A;  3W5Z A;  3PZP A;  5AE3 A;  4CLU A;  3NGU A;  2XCA A;  2EBG A;  2BJ8 A;  4HT7 A;  2ZVS A;  2B5J A;  1Z4U A;  1VLO A;  3I5A A;  1CG2 A;  3N6L A;  3HVW A;  3HD1 A;  2MSS A;  3ILI A;  2PC6 A;  5HQ8 A;  1XNR J;  3GCW P;  1S1W B;  3I0S B;  3DLB A;  3NLC A;  4OLO A;  1CJU A;  2QC3 A;  2XLJ A;  1L3V A;  3HM9 A;  1TK0 A;  1S97 A;  4DV4 J;  2ZM6 J;  2XS7 A;  4A46 A;  2VKR A;  2VL1 A;  4OJ1 A;  3MR2 A;  1HNW F;  1WOR A;  3G6V A;  1FE4 A;  2JLE A;  5GAG U;  2QV6 A;  5DJB A;  5ETV A;  1RJJ A;  2AYB A;  2I9S A;  3BQ0 A;  4RKU C;  3FUY A;  2H54 B;  4ALZ A;  4LT6 A;  2W7A A;  1RWP B;  3GP9 A;  4ENO A;  2M5Y A;  3NGS A;  1W2I A;  1B70 B;  2R7U A;  2FVR A;  1LW0 B;  2KHD A;  2ZIT A;  4FNH A;  4XPE A;  2W2N P;  2GCF A;  5BYS A;  4OYM A;  4K4U A;  3SCL E;  4OI4 A;  1QUV A;  4IG3 B;  2JLG A;  5DM7 Q;  3MPV A;  1FK9 A;  2CJA A;  1XMO F;  5CD4 A;  4AL6 A;  3KG4 A;  3W3S A;  5B08 A;  1OSD A;  2H5J B;  1XQI A;  3H42 A;  2DJW A;  1UPM B;  3SDE B;  1SC6 A;  4DQP A;  2Z57 B;  1GXL A;  2B7C B;  3M30 B;  3EX7 B;  2Y1J A;  3NCR A;  1TKT B;  3M32 B;  1ICE B;  1WC1 A;  2G13 A;  2LMI A;  1R89 A;  2FQQ B;  4J7C A;  2OLW A;  3UVJ B;  3OR2 B;  4ZP8 A;  3UE2 A;  5LSL A;  2ZKT A;  1FJ7 A;  2BA9 A;  3OUY B;  3LPY A;  1S59 A;  2X51 A;  1HFE L;  4IDK B;  1UL3 A;  5L8R C;  1NJW A;  1WTB A;  4G6V B;  1GNK A;  4X84 A;  1UW9 A;  2M4M A;  2QT7 A;  3QRQ A;  3GV8 B;  5KFZ A;  2J7K A;  2XBP A;  4RWW A;  2PO4 A;  4NXN F;  2DNQ A;  2DO0 A;  1FTR A;  5DZ6 A;  2A2C A;  1AZS B;  3H0P A;  1VHI A;  1WC5 A;  4R8U B;  1R3N A;  3G71 S;  1KNZ A;  3M8Q A;  2UUB J;  2DHH A;  3HJF A;  3KLV A;  5D4N A;  2V9K A;  5GAH U;  2BDP A;  3CD0 A;  2VB6 A;  2KFZ A;  5EN1 A;  4C8N A;  4H4M B;  2BE7 D;  3NXZ A;  3TVY A;  4ATN A;  2Q1L A;  3DGP B;  3M8Y A;  2OPQ B;  3RG6 A;  1NBE B;  2Q43 A;  2FVC A;  5FLX Y;  1Y10 A;  3FRY A;  4DG1 B;  2VFU A;  2E44 A;  4RUH A;  1N5T A;  1U1Q A;  1CJV A;  2R2U A;  3MF5 A;  1QVF R;  4LF7 J;  2KDO A;  1RT7 B;  1T7P A;  1CJK B;  3KLI A;  3TVZ A;  4CO5 A;  1VK3 A;  1EX8 A;  4FYX B;  2LEA A;  3EGW B;  4OFZ A;  1VQL S;  1VIO A;  3M2R B;  4KSE B;  1KBR A;  3P45 B;  1VRT B;  2XLI A;  2P6S A;  1VC0 A;  2W2M P;  4KGZ B;  4NWB A;  2OGU A;  1NZ8 A;  1FKO B;  2JX2 A;  3B8H A;  3M6V A;  2J6T A;  3TZX A;  3G6Y A;  1J5E F;  1FXR A;  2BJ1 A;  2VPW B;  3H25 A;  3AQP A;  2F9D A;  3UN5 A;  4P10 A;  2RF2 A;  4C7Q A;  1UWB B;  1NB7 A;  1W26 A;  3CD7 A;  3D3B J;  4DV1 F;  2XI3 A;  2UXD F;  3VAH A;  2HHH J;  4ZP6 A;  3HSZ A;  2RRN A;  3K58 A;  4LRC A;  2CQD A;  5KFF A;  2V4J B;  3TI0 A;  3JAM U;  5KFS A;  4QJV A;  4L3N A;  4FPI A;  4NMX A;  3QGG A;  1XTZ A;  3ZTP A;  2IM1 A;  3BF4 A;  1X9M A;  1IBL F;  2VPZ B;  4IOA Q;  3TQ1 A;  1IN0 A;  1YTY A;  4O44 A;  1U1R A;  2CJ9 A;  2WZ1 A;  4DV3 J;  2OML A;  2GHP A;  2UUW A;  3X3U A;  2OEL A;  2IMW P;  1H38 A;  1JLF A;  3OHA A;  4I69 A;  1JXE A;  4H4K A;  1QE1 A;  2Y3Y A;  1U02 A;  4QR2 A;  1IKY A;  4ECT A;  2OTL S;  1S9E A;  4LQ9 A;  2RKI A;  4FYV B;  1YIT S;  4ILL A;  4L3K A;  1WF1 A;  2QA2 A;  8RUC A;  1R8B A;  2B5J B;  2OPR B;  3MM9 A;  3G6E S;  2F5G A;  4AFF A;  3C3L A;  5GVQ A;  4CO1 A;  1T02 A;  1R0B G;  3RAX A;  1CJU B;  1FTC A;  5A0Y A;  5GAE U;  3NS6 A;  1W25 A;  2KVI A;  5ADZ A;  3H2U B;  1RAB B;  2W2P P;  4P2M A;  3LPE A;  2DR5 A;  1FX2 A;  3DYA B;  3KNA A;  2OI2 A;  3FNN A;  4TYB A;  4RJV A;  4DS5 A;  1CVJ A;  4ZCL A;  2C3O A;  1UVI A;  5C25 A;  2DGO A;  4M63 A;  4DUZ J;  2XCP A;  3BYR A;  1IBC B;  3HVT A;  1TFY A;  5HJX A;  3VZH A;  2IM2 A;  3NL0 A;  1N5Q A;  4KTQ A;  1NSQ A;  2KHC A;  1MWQ A;  4MFB B;  1WOO A;  4YB1 P;  5BJR A;  2DBB A;  3BN4 A;  1GQE A;  1NKE A;  1PC5 A;  2BJD A;  4C0H A;  2JEJ A;  1N36 J;  2BE2 A;  4ZVS B;  1HAR A;  2LLZ A;  3IR7 B;  3H20 A;  4DR7 F;  3ENQ A;  3MMC B;  1TVR B;  4NOH A;  5CH7 B;  1SJR A;  3MCO A;  2AW0 A;  2YNF A;  4ZVU B;  1P1L A;  1VQ5 S;  2V63 A;  1VJW A;  3MAH A;  2ZJR Q;  4XO0 A;  3BBB A;  4NX9 A;  3I9V 9;  1TTH B;  2YKQ A;  2R3V A;  1U2F A;  1X7V A;  3DRR A;  5IS2 A;  2X3D A;  2F8M A;  2MQ8 A;  2AGP A;  1UMJ A;  3C8Y A;  1U2C A;  3CED A;  3QMQ A;  3PHT A;  3BGO P;  2Y8W A;  4TQS A;  3BR9 A;  1NSA A;  2XMK A;  1S72 S;  2CQI A;  3HO1 A;  3TO8 A;  3HT0 A;  1RQ0 A;  3EPI A;  4LR8 A;  3GR0 A;  2H1Y A;  3F73 A;  3RRK A;  3OJS A;  2FVP A;  3P4U B;  4V19 X;  1WG1 A;  4P72 A;  1FX4 A;  1BQM A;  4TY8 B;  3TEG A;  4ZDN A;  1RA7 A;  3PRV A;  2KG1 A;  2HVZ A;  1P8G A;  3J7Z T;  2IY5 B;  3RRH A;  3D5M A;  1UVN A;  2HHS A;  2MHE A;  4QOT A;  2W4C A;  3AXK A;  2AGQ A;  1VDH A;  1NPR A;  2BMB A;  4LQ3 A;  4G1I A;  4DSJ A;  1Q0N A;  1YHQ S;  4DR4 J;  4ERD A;  4KYZ A;  3K57 A;  4DU8 A;  2ZJQ Q;  1M1H A;  1MWZ A;  5DO2 A;  4DN0 A;  3JXO A;  3TUP A;  3PEH A;  1CJV B;  1P6T A;  2COL A;  2PEH A;  1YRU A;  5CCM A;  4A48 A;  2IRU A;  2ZH3 A;  3KLI B;  4DL5 A;  4OZ2 A;  1Y5N B;  3W66 A;  1ZH5 A;  1TK5 A;  2VBY A;  3ZC4 A;  1VQ8 S;  1RT3 A;  5E33 A;  3HVA A;  2HIQ A;  1IBK F;  1AB8 A;  2LA4 A;  2A6O A;  5KFW A;  1KOH A;  4ZN3 A;  1FI4 A;  3PR4 A;  1ZA1 B;  1JJ2 R;  3U1M A;  4KGM A;  1PO6 A;  4RU9 A;  4Y2I A;  4OHV A;  3D0H E;  3CJ2 A;  2GVD A;  4CLW A;  5KG0 A;  2XHC A;  3PDN A;  4JI2 F;  5D6G A;  5IT9 U;  2HBY B;  3IM8 A;  5BYQ A;  3UN2 A;  2N3L A;  3LQV A;  3R3T A;  2KTQ A;  1VQO S;  3QSY B;  3HP6 A;  2V34 A;  3N5F A;  2QLB B;  4F4X A;  3G9C A;  5LMN F;  2ILZ A;  2LQJ A;  4EYH B;  2DHS A;  4RUC A;  2EI5 A;  4LF6 F;  2BYC A;  5EGY A;  3I31 A;  2W25 A;  1N34 J;  1RHJ B;  2HNZ B;  4DR1 J;  1NHK L;  1FER A;  4CWB A;  3QIP B;  4O44 B;  3BH6 B;  5J2M B;  1WHW A;  1M1K T;  4JI3 J;  1JLF B;  1MN7 A;  2CNO B;  3R27 A;  1QE1 B;  5HVF A;  5F3T A;  2ASJ A;  1IKY B;  3QFW A;  1S9E B;  1N48 A;  1SXL A;  2SXL A;  1RWK B;  2RKI B;  4K4V A;  1OMS A;  2GHW A;  4F7V A;  1JB0 C;  1F3F A;  3MI7 X;  4TU8 A;  3MM9 B;  1I5O B;  2Y8Y A;  4JI0 F;  4CH0 S;  2OEM A;  3RUB L;  3FVY A;  3B6B A;  3N9U C;  2YWE A;  4I56 A;  1SIZ A;  4DXL A;  3G86 A;  4DV7 J;  1JLE B;  4GC7 A;  4EK2 A;  1UJ6 A;  4PXE A;  2EBE A;  2D3U A;  4KHR A;  2N3O A;  4FDF A;  3O5T B;  2MY7 A;  1HWK A;  3MCN A;  3NAI A;  1FDA A;  1N0U A;  2ZH9 A;  5T14 A;  3CME S;  3K5M A;  1WUU A;  4F0H A;  1RWV B;  1RK8 A;  3HVT B;  1DZ5 A;  4Z7Y A;  1T3O A;  2JVO A;  2CPZ A;  1QAY A;  1VQK S;  2EKN A;  4KRW A;  2CJQ A;  4LF4 J;  2L41 A;  4CYU A;  1J5O A;  1VQP S;  3CJR A;  1NME B;  4PEO A;  3JAM Y;  4O4G A;  2MZR A;  2DCL A;  5CZX A;  2EFN A;  3T6B A;  2MJN A;  2WOM A;  1HA1 A;  4X62 F;  4NE9 C;  3ZZP A;  3PNI A;  2NPF A;  2BE2 B;  2EG2 A;  1NHU A;  2WON A;  1V5V A;  3MEG B;  4M5H A;  4K50 A;  3V5R A;  1X0P A;  2GML A;  2ZVI A;  2FHO B;  3PW5 A;  3CJ4 A;  4HL9 A;  5M2R A;  5A8K B;  2HRY A;  3SQG A;  2YNF B;  3AAW B;  2G1H A;  1APS A;  1RT1 A;  2JOQ A;  2Z56 B;  2VQE J;  2J8S A;  5B0G A;  3MAQ A;  3O2I A;  4B9L A;  2ZH4 A;  1DBD A;  3SBM A;  4X4O A;  4Q2M A;  2YY3 A;  2BW7 A;  1HQ2 A;  5DG9 A;  2VFV A;  3BBC A;  3KK1 A;  1TK8 A;  1FCA A;  1X31 C;  3UCG A;  1R27 B;  2I8E A;  3A3P B;  1U6F A;  3L3C A;  1HNZ F;  1UA0 A;  5B7W A;  4LBI A;  4OYW A;  1QY7 A;  5KG6 A;  1WHX A;  4LF2 A;  1GMV A;  1RAO A;  1ZAX A;  4PKD B;  4QPX A;  4NYP A;  4OV6 A;  1PAU B;  4ECR A;  1ZZF A;  2ZH6 A;  3VAK A;  4ELT A;  3JYT A;  4LMZ A;  4JI5 J;  3T1H F;  1NAQ A;  5HRO A;  2QSF A;  2OD4 A;  1AFJ A;  1BQM B;  5A8W A;  2NPI A;  3DLL Q;  2GQ2 A;  1G6B A;  4U7U K;  4OL8 A;  1FRL A;  3T5K A;  4B3M J;  2ZEJ A;  5KFB A;  2E5J A;  3UNG C;  2ROP A;  1KRP A;  2Y1L B;  3NGK A;  3QWP A;  1KQF B;  1SL1 A;  4B9T A;  3MM6 A;  1ZAW A;  3CCM S;  3NMR A;  3DCA A;  2NS1 B;  3V6K A;  1VGY A;  2J5A A;  4Q8E A;  2EC0 A;  3D6F B;  4IKA A;  4OYB A;  2OFG X;  3VHQ A;  5D78 A;  4ZS6 A;  3OQ2 A;  4CZC A;  1S1X A;  5IWA F;  2V4Q A;  4N8N A;  1WDD A;  1LK5 A;  4YY3 J;  2HK2 A;  4RW8 A;  4KIA A;  1S6P A;  4FP9 A;  2V6A A;  4J9P A;  3X1L B;  1RT3 B;  2E7W A;  2FJV A;  2KI2 A;  5JMN A;  3J81 U;  2DTJ A;  1HI0 P;  3ZXW A;  4ZVG A;  3MZI A;  3TZW A;  4KJI A;  2CPY A;  1RLD A;  3NGT A;  3NG8 A;  4QBU A;  3GV5 B;  4P6Q A;  2VA2 A;  2XLK A;  1VQ6 S;  4M5G A;  2W8K A;  1FHT A;  2F8H A;  3BYP A;  2J6S A;  3THV A;  2RDD A;  3NGR A;  2HLT A;  4FS2 A;  4KHP F;  1IM6 A;  3OHB A;  1EKR A;  1TL1 A;  2FC8 A;  3IAS 9;  5AXK A;  1LEO A;  3Q8U A;  4OZ0 A;  1NM2 A;  1C0U A;  2GJI A;  1K1S A;  1RT5 A;  2B9X A;  3DRX A;  2DPJ A;  3Q8V A;  2ZH8 A;  1XMO J;  2IVF B;  4LF5 F;  1VRU A;  3ITH A;  3UW1 A;  4FF2 A;  1R8A A;  4CLT A;  2F1F A;  5LMU F;  4BLG A;  3VZI A;  2W24 A;  1LK7 A;  2HGM A;  4UST A;  5FD1 A;  3GIL A;  3KHG A;  2FC9 A;  5HBM A;  2E5I A;  1IQT A;  2IPO B;  3VQT A;  3ADA C;  3M6U A;  1XBW A;  3TAP A;  1T9X A;  1TL7 B;  2YKN A;  3RB6 A;  2GVZ A;  3QID A;  3W64 A;  2OJ3 A;  3VGT A;  1N33 F;  3CJ0 A;  2ALY B;  4ECV A;  3PYD A;  1SJ4 P;  1EJ7 L;  1R0A A;  1SUQ A;  4X65 F;  5EWG A;  1X5O A;  4KE5 A;  1GTH A;  3GYX B;  3CMA S;  3UD4 P;  4I7F A;  1JLG A;  3W9J A;  4DQS A;  4IH6 A;  2MQQ A;  4CO0 A;  2BAB A;  2HGN A;  2R4F A;  3PTW A;  3BH7 B;  1NPK A;  3SCK E;  3UR3 C;  1PCA A;  1W2B R;  4NXN J;  5L38 A;  4K0K F;  4ZVO B;  4C8Y A;  4LR7 A;  4AYB D;  4I67 A;  4DS4 A;  2BJ3 A;  4LRE A;  1HNX F;  1VLY A;  2CPF A;  2QIF A;  4ED6 A;  2QMW A;  2WAQ D;  4U96 A;  1U25 A;  1BQX A;  4NRU A;  2OD6 A;  1UCN A;  1NLK L;  1EET A;  3BJY A;  4PQU A;  2FJE B;  3VTI A;  3ENW A;  2B8Q A;  3MMJ A;  1J5O B;  1KP6 A;  5E3Q A;  4O4G B;  1UKU A;  2RU9 A;  2OIH A;  1P27 B;  2VA3 A;  5J2N A;  4RU2 A;  2WOM B;  2F4V F;  1N54 B;  3GV7 B;  1OSC A;  1VBK A;  2VU5 A;  2H3E B;  2WON B;  4PWD B;  3ILO A;  4ZLL A;  3T5H A;  1TP7 A;  3IGN A;  4J9K A;  1XMQ F;  3BV8 A;  3MUR P;  4JV5 F;  1M5O C;  3FDS A;  1RTJ A;  2DEI A;  3UPF A;  3SQG B;  1RAH B;  1RHM B;  3DOL B;  4QR1 A;  1RT1 B;  5H9F J;  5I3P A;  2KRR A;  1N32 F;  1UFL A;  4BS2 A;  3E3X A;  4GKJ F;  4FYW B;  2YKP A;  1J5E J;  3LTO A;  4RW6 A;  4U7U D;  3VGV A;  2H4Y B;  3LWM A;  1NEE A;  5E0O A;  3KK1 B;  4X66 F;  5SZT A;  2E5H A;  3H5X A;  1ZET A;  1IR2 A;  3MOJ B;  1K73 T;  3DLE A;  4F04 B;  3G2X A;  2XHW A;  3IS9 B;  1HBN A;  4AQY J;  2E7V A;  1FFG B;  3GJS B;  4MKB A;  3LH2 S;  3D0I E;  5EX0 A;  2U1A A;  4LRF A;  5D0H A;  1XK8 A;  3JYT B;  1IBL J;  1JLA A;  2OPS A;  3UD5 A;  3CTR A;  5HRO B;  3DOK A;  3EIC A;  4ZP9 A;  1ARO P;  3B54 A;  3MR7 A;  1MG7 A;  4RLE A;  3U1L A;  1U2R A;  2XGP A;  4Y00 A;  3PY8 A;  4LRB A;  3RTV A;  3V81 A;  3J7Z 5;  1S48 A;  1LNQ A;  4JB8 B;  1B0P A;  1UVJ A;  3MM6 B;  3C6T B;  3ZZ0 A;  4UUX A;  2XY6 A;  4ED0 A;  5KOW A;  2VHG A;  3PHE A;  4NYO A;  4NLT A;  1JWW A;  4AL5 A;  1FNO A;  1Q5Y A;  4OZ3 A;  4ITS A;  1SB6 A;  4AL7 A;  1CJT A;  3GFH A;  1S79 A;  4TU7 A;  1LW2 A;  2MXY A;  1FNM A;  1S1X B;  2G4B A;  3ZO7 A;  3MCM A;  2UVR A;  4RBV A;  1D9A A;  1H6K X;  4RWX A;  3TNV A;  4RW8 B;  1OIA A;  3QPI A;  4OIX A;  1ROF A;  2YQ3 A;  3KWM A;  4DPX A;  5M2P A;  3M2U B;  2DY1 A;  4FKY A;  3EVW A;  1F9E B;  1X4G A;  1RU1 A;  4WFY A;  2ZC4 A;  1O5J A;  4AND A;  2QA4 G;  2W01 A;  3V2U C;  4RZR A;  2MGZ A;  5F0W A;  2HHV A;  1U1O A;  3CWJ A;  2IJN A;  4WXO A;  2MJU A;  5IOL A;  3M9N B;  1RI7 A;  3GFX A;  2IA0 A;  1D8Z A;  1G1X A;  2VIH A;  2V50 A;  1ZBT A;  4C97 A;  2YKO A;  2LDY A;  2Q79 A;  2QX0 A;  2LP4 A;  4NLV A;  4ED5 A;  2XB2 D;  1F6T A;  1BC6 A;  2HWT A;  3R6L B;  4QZV B;  4DX6 A;  3L7U A;  5KFK A;  1H2V Z;  4B3S F;  2HQI A;  2DH7 A;  1TL1 B;  2LU1 A;  3QGI A;  4ED7 A;  2XC9 A;  2O67 A;  3OSN A;  4F67 A;  2BAN A;  3QAU A;  3RJM B;  3AXM A;  3MMB A;  4DR7 J;  1RT5 B;  4NEZ A;  3HHE A;  4ZCM A;  2JEG A;  2ZWO A;  1VRU B;  2BRK A;  2BR0 A;  2CNN B;  2HQC A;  2HZC A;  5IQ6 A;  2L9N A;  2DNY A;  4WYL A;  2NXE A;  2ABY A;  5HBM B;  4A8S A;  1VIX A;  3GWC A;  3MR3 A;  3PFO A;  4OX8 A;  1NJI T;  4X4S A;  2CDQ A;  3CCU S;  3NNH A;  2HHQ A;  4USH A;  2GVZ B;  1TV6 B;  4IFY A;  1OY8 A;  2UP1 A;  1Q53 A;  2VBW A;  3HPO A;  3CCW A;  1R0A B;  1BHN A;  5EWE A;  4XDC A;  1S6O A;  4FS1 A;  2C2O B;  1JLG B;  3J7Y U;  3R5A A;  5KFT A;  4TU9 A;  4HDG A;  3BM7 A;  3J81 Y;  4QWE A;  3RR7 A;  1ZTT A;  2KU7 A;  4USI A;  2NXN A;  2EFQ A;  3PJX A;  4OHX A;  1O51 A;  3OSP A;  3H40 A;  4OHY A;  4YHH J;  3PXG a;  2I1R A;  3DDK A;  3GYG A;  3HMJ G;  3IWL A;  1HBM A;  1H98 A;  1GX6 A;  1WC6 A;  4A8F A;  1Q7Y T;  2FZK B;  3PG9 A;  3VAM A;  2RQK A;  2DK2 A;  4PQU B;  4LR9 A;  1ULR A;  2VJU A;  1VQN S;  2RH3 A;  4LIW A;  2NSC A;  2FD2 A;  4MIW A;  1FDB A;  1ZOT A;  2WW4 A;  5K8N A;  4KV8 A;  2ZZM A;  2VC0 A;  4B3O A;  4ED2 A;  1WKL A;  2DEJ A;  3W7B A;  4DCO B;  2RML A;  2J7W A;  4B08 A;  5KFV A;  3C6U A;  1S7I A;  3QSI A;  3QGP A;  2C3M A;  3O1L A;  1FJE B;  2D7S A;  3C16 A;  4HEA 9;  2MTL A;  4M5N A;  2KKH A;  3MFI A;  4HYK A;  2HG4 A;  3DU5 A;  2RQC A;  4C98 A;  2VG6 A;  3RR8 A;  1KOO A;  3W5Y A;  2H5I B;  3Q8Y A;  4K4T A;  2Q6B A;  5LJ5 Y;  2JRS A;  4RW6 B;  4ZVR B;  1LWC B;  3CJK B;  5I3U A;  2UUT A;  2XY7 A;  1EAY C;  1QD1 A;  1PSD A;  2FHM A;  1GXU A;  5AJ3 F;  2YX7 A;  3DLE B;  2XI2 A;  4JI4 J;  2R42 A;  2RD5 C;  2MLX A;  1RXO B;  2YNH A;  3KLF A;  2DNH A;  4KT0 C;  1K44 A;  4MYU A;  3JB9 k;  2FHJ D;  3H4D A;  1Y11 A;  2P8I A;  3DLG A;  3AOB A;  5MLC V;  2M70 A;  3UCU P;  4HT5 A;  4IH5 A;  4NML A;  2VFR A;  2XGQ A;  4WZQ A;  1RWN B;  1XMB A;  2W9C A;  4E98 A;  2AT1 B;  2D3O 1;  2Z8Q A;  2IBO A;  4WKY A;  5DZ7 A;  2I38 A;  1S76 D;  3V81 B;  2B4P A;  1HR0 J;  3PCO B;  1IKX A;  3ZZO A;  4PR6 A;  4LSL A;  1ZTW A;  1F5C A;  4F3Q A;  4L72 B;  3Q22 A;  1F5A A;  1ZS6 A;  3RB0 A;  1E6V A;  3NCQ A;  4EZ6 A;  2OPP B;  5DDQ C;  4V19 J;  1HNI B;  4M5I A;  2JLF A;  2E1A A;  5HK4 A;  1ZM4 A;  3HHD A;  2W4P A;  2ACM A;  2XSF A;  4L73 A;  5HAT A;  2W1B A;  2VBZ A;  4L76 A;  3F0N A;  1CJT B;  2MKH A;  1FO1 A;  2DXD A;  1LW2 B;  1NRK A;  4NEY A;  2IDL A;  2CQ1 A;  3MMA A;  5K20 B;  2C3P A;  2HFS A;  2FGC A;  5DG7 A;  2EVZ A;  4ZN1 A;  2HRT A;  2KN4 A;  4K5R A;  3DHX A;  2HS0 A;  2WW8 A;  4W90 B;  1IWA A;  4FZV A;  2B43 A;  5E3C A;  2MGZ B;  3EM1 A;  2WTF A;  2CWK A;  4QCL A;  3WIU A;  3CJS A;  4ZJL A;  3A13 A;  5I42 A;  1KHV A;  4HI2 A;  1MLA A;  3WC2 A;  5KFI A;  3H98 A;  5HVH A;  3KHR A;  2MZJ A;  4CO2 A;  1RCO B;  2L08 A;  2EKY A;  5C2G A;  1RLC L;  4X62 J;  2ZBI A;  4C11 A;  1Y9O A;  4KPC A;  2LQ5 A;  3BS9 A;  1OS5 A;  2Y1I A;  3IR5 B;  2QFI A;  2BAN B;  2CQP A;  4NA2 A;  3MMB B;  1YRT A;  2RIL A;  1VOM A;  3EVM A;  4CLZ A;  5G4D A;  5KT3 A;  1G2E A;  3EE3 A;  4QIF A;  2VON A;  3FCW A;  3LA0 A;  2VZ9 A;  5E5N A;  3AY0 A;  2RDI A;  1NK5 A;  1JKH A;  2LXU A;  2QLX A;  4K4X A;  3EXY A;  1YJU A;  3Q23 A;  4HTJ A;  1PYO B;  1EHW A;  4Y34 A;  2IM0 A;  4KC5 A;  2J9D E;  4K4Y A;  2HK3 A;  2LKZ A;  2R7O A;  1BXN A;  5F9N A;  2J9C A;  3QT5 A;  1HNZ J;  2IHR 1;  2CZ4 A;  3MEC B;  4IFY B;  2MKY A;  1NZA A;  4UZC A;  1I6J A;  4L75 A;  2DNK A;  2E1P A;  4GO7 X;  4IO1 A;  4ZCI A;  5BYR A;  2PMW A;  3F44 A;  1F2G A;  4ILR A;  3WZ0 A;  1M5K C;  1VBX A;  2WVD A;  1VQM S;  3H8Y A;  3M8W A;  1KEK A;  3RBE A;  1N52 B;  4CLS A;  4WP9 A;  4QWA A;  1QSL A;  1EB0 A;  5HAO A;  1REG X;  3MUM P;  1B99 A;  2C2M B;  1SH0 A;  4OI0 A;  3HVR A;  1UVM A;  4CH1 A;  3UI3 A;  2DPI A;  2AX1 A;  4FKX A;  2MQN A;  4M5M A;  4HHH A;  4PXD A;  2MYF A;  1U1N A;  5K8M A;  2C3U A;  2C22 A;  2E5G A;  4PG4 A;  3PIO Q;  3KJN B;  1Q95 G;  2YNG B;  1YJR A;  4KPY A;  4WFN Q;  1M1G A;  1XR6 A;  2IAJ A;  5ETM A;  4WE1 A;  1UEK A;  4OI2 A;  1CC7 A;  4YQW A;  1PJ7 A;  1HW9 A;  1NB2 A;  2DO4 A;  4B3O B;  5IWA J;  2GFF A;  3RAQ A;  1YIJ S;  4X4U A;  3TW0 A;  2V94 A;  2QSW A;  4DJB A;  2R7R A;  1YBA A;  1SJ1 A;  4J9S A;  3AA8 A;  2IM3 A;  4WPA A;  4Y2C A;  3CCE S;  3GG0 A;  1VMB A;  1S4E A;  3PW4 A;  3T3F A;  2UUC F;  4FYY B;  3IRX A;  2CYY A;  2QA4 S;  1LWE A;  3JTP A;  3HKW A;  2WB4 A;  2GV1 A;  3FCV A;  2CNK B;  1SC1 B;  4F0M A;  1TMM A;  3I0R A;  2DHA A;  3ZNJ 1;  5H9E J;  4PXC A;  2VG7 A;  3UNY A;  2MQO A;  3PW7 A;  2LQB A;  3GJQ B;  3IMQ J;  3PRD A;  5I3U B;  3CXC R;  2V8P A;  2DH8 A;  4DL2 A;  2E9R X;  2BW2 A;  3K0J A;  3TAQ A;  2N7Y A;  1NH7 A;  2ROE A;  4PAA A;  2H9Z A;  1JX4 A;  1M90 T;  4YR3 A;  3IBF B;  5JJB A;  3KLE A;  1HI8 A;  1SKR A;  2YNH B;  2XZT B;  4UOH A;  3THP A;  2M8H A;  4PQA A;  4EO8 A;  5B0F A;  3AD8 C;  3UCZ P;  3AFG A;  4DR3 F;  3DLG B;  3THT A;  2FYX A;  4LF5 J;  4WFX A;  5EHH A;  2W9C B;  2M0G B;  5LMU J;  2JHE A;  2ZE2 B;  1TZ0 A;  2B4V A;  2ZBQ A;  4NLW A;  2CQ3 A;  5DS7 A;  3MED B;  1IKW B;  3GSI A;  4R0J A;  4OJG A;  4MK9 A;  4LSL B;  2HZV A;  4IOC Q;  2PN6 A;  3ENV A;  1FKA F;  4HH0 A;  2XMT A;  3RZA A;  2WCX A;  1YLX A;  3BR8 A;  1H7X A;  3MD1 A;  4EUV A;  1N33 J;  1E6V B;  3CD6 S;  3LAN A;  2F7V A;  1PGZ A;  4RBU A;  1S4F A;  1URN A;  2FTR A;  3SEO A;  4X65 J;  3DLH A;  4X4R A;  1Y0H A;  3CCT A;  3JTO A;  2ZFH A;  1X4D A;  1LW0 A;  1HWI A;  3MMA B;  3CCJ S;  1WHY A;  2WRM A;  3V6J A;  1Y5I B;  4K0K J;  1GFW B;  5B0B A;  1FT8 A;  1CQM A;  1Q8K A;  2J8A A;  1CBK A;  4TN2 A;  1HNX J;  3FBB A;  3NWR A;  1FDN A;  2I6W A;  2Z0G A;  1FVS A;  2LQ9 A;  3I55 S;  4KO0 B;  2P5V A;  1YJ7 A;  4UOC A;  1S99 A;  5DLF A;  4O3S A;  3SFG A;  3BGR B;  5HO4 A;  2Z30 B;  3SDE A;  4LF8 F;  3J7A 1;  1TU0 B;  5D0G A;  4USW A;  4FPR A;  5LXR A;  2R8G A;  3AT1 B;  2L3M A;  2F4V J;  3W5X A;  2HFO A;  3C15 A;  3CO0 P;  4XIU A;  2UXC F;  1S0V A;  3OUY A;  5HQM A;  1RWX B;  2Z2M A;  4P52 A;  2GZO A;  2ZOM A;  1K1Q A;  2APO A;  1SQF A;  2L9D A;  4IDK A;  3P96 A;  1H3D A;  1YJT A;  1DJ0 A;  1NDP A;  1X4F A;  4NXM F;  4HH1 A;  2X3G A;  2V2Q A;  1MU2 A;  3P49 B;  4F8R A;  4X4T A;  1Y00 A;  2BEF A;  3POT B;  2MB0 B;  4UW2 A;  1AZS A;  4JP8 A;  2RAQ A;  3VVT A;  1KVK A;  2AJF E;  4F3M A;  1SBR A;  4KBI A;  4DV6 F;  1TUG B;  3QAE A;  1N5V A;  1RHQ B;  3F41 A;  1MML A;  4QW8 A;  2VQF F;  4F4W A;  2V5H G;  1KR4 A;  3DGP A;  1RTZ A;  3FBE A;  4N56 A;  3HZE A;  1PBU A;  3NS7 B;  2DGX A;  1FEH A;  3PRB A;  3OL8 A;  3K8W A;  3LP0 A;  2YXL A;  4KGX B;  1HHT P;  1HLW A;  2G0J A;  4DFM A;  2VPX B;  2FHJ A;  4NZ0 A;  3FZB A;  1MSW D;  2LEB A;  4E8U A;  4PYD A;  2ADC A;  1G3O A;  4TLR A;  1CJK A;  4DQI A;  2HNY B;  2YH1 A;  1D1U A;  4UOF A;  3M2R A;  2DNG A;  2GIF A;  2CZ9 A;  5J1N A;  3GLJ A;  1C1C B;  3V4M A;  3PW2 A;  3T1Y J;  1FD2 A;  2HHT A;  3RBZ A;  4ILM A;  1REV A;  3CSK A;  1WI6 A;  1T9W A;  2P2C B;  3LW5 C;  3SSS A;  1DQ9 A;  2WSC C;  4WWS A;  3OXL A;  4J9M A;  4LFB J;  1Q86 T;  2IAJ B;  2HBQ B;  4WE1 B;  4KFB A;  2EFP A;  3QT6 A;  3RYL A;  2QN6 B;  4DV5 F;  3C66 A;  3W61 A;  2ATL A;  1HPZ B;  1Q81 T;  1HYS A;  3WX8 A;  1X9W A;  1UWB A;  2QJ3 A;  4MK7 A;  3Q86 A;  3CPW R;  3DRP B;  4RNF A;  1KVI A;  3KUG A;  2VC1 A;  3QZ7 A;  4FXV A;  4WP8 A;  3H90 A;  2BOP A;  2GJ2 A;  1AW0 A;  2HBZ B;  5M2U A;  3HFZ B;  1DAR A;  6AT1 B;  3S7R A;  1HNV B;  4OI1 A;  1QJH A;  3ULH A;  4DL0 C;  2IDE A;  2IMO A;  3EWG A;  3IRX B;  1LOU A;  4DLE A;  3VWS A;  1KLM A;  4Q0B A;  1CS4 A;  1WC0 A;  3I0R B;  4WIQ A;  2AJQ A;  2VG7 B;  2N82 B;  1RAI B;  5HMW A;  1ACM B;  2OEK A;  5KFU A;  1QSY A;  4U95 A;  2H5E A;  3N0V A;  3D66 A;  4C4W A;  1UFK A;  3H2V E;  4J9R A;  2F3J A;  5I4M A;  2B3T B;  1JMT A;  5CZV A;  3CCV S;  3KLE B;  5THW A;  5CAA A;  3S1T A;  4ECZ A;  5KOX A;  4B9N A;  3D67 A;  2V2V A;  4TVA B;  2OPR A;  3MM5 A;  4Y2A A;  4ED1 A;  3RGI A;  4CM2 A;  1SKW A;  5K5M A;  3TJ9 A;  2E1R A;  4DV4 F;  4F2S A;  1TKZ A;  3VAF A;  1WWH A;  1RB0 A;  5ETK A;  3FQL A;  3NS5 A;  2C2Z B;  1IBM F;  3I96 A;  3NRB A;  3TYT A;  3HSG A;  4KR0 B;  3R5D A;  5BR8 J;  4DV0 F;  3DYA A;  3D7S B;  3QZ8 A;  3K5O A;  2PMH A;  1QTN B;  1U4B A;  2GGP A;  3VGS A;  5BXI A;  1O6X A;  7FD1 A;  4ECX A;  4KKO A;  2VIC A;  2BVZ A;  1YRX A;  1CSJ A;  3PVX A;  4WCE Q;  2ZHB A;  4JI8 F;  4MFB A;  3A12 A;  3VAJ A;  2AV5 A;  3G6X A;  3ILL A;  4XK8 C;  2XS5 A;  3OTO J;  2C2K B;  4B3T F;  3BGU A;  1C2P A;  3QFH A;  3HCX A;  3DC2 A;  2V2Z A;  3OFF A;  1DTT B;  4Y6I A;  4WXW A;  3KLH B;  1D3W A;  1F3V A;  5GMK a;  1HIY A;  3MMC A;  1TVR A;  1HD1 A;  1F5B A;  2BV3 A;  2GMJ A;  3W9I A;  3UQS A;  3G82 B;  4ER8 A;  4LF9 F;  2RHS B;  4I1T A;  2ROG A;  1KDN A;  5EWF A;  8AT1 B;  4O0I A;  1FFW B;  2C3Y A;  5HN0 A;  3NWG A;  4IQM A;  3BPS P;  2CQ0 A;  1RTI A;  5DGB A;  2QRR A;  4X4P A;  2RRA A;  2RQM A;  1IR1 A;  1M5H A;  3IWN C;  1VIS A;  2HVH A;  3C15 B;  4EU0 A;  4PRF A;  1A0O B;  5E3A A;  2HRU A;  1UVL A;  2KVQ E;  2O01 C;  2FLL A;  2XY5 A;  2DIT A;  1HKA A;  4A4J A;  5KFA A;  4NCA A;  1U1K A;  1B0T A;  4J9O A;  3NKY A;  3W2V A;  4EYI B;  2YKM B;  1F1B B;  1CQN A;  4OJ3 A;  1MU2 B;  4B3R F;  3SSR A;  5F8N A;  1UEU A;  2BE9 B;  4TY8 A;  3SCI E;  4KGK A;  4OYI A;  1VQY A;  3LP2 B;  2R2T A;  3N01 A;  1S10 A;  4RW4 A;  3K2Y A;  5LXY A;  4I0W A;  3DN9 A;  1TL4 A;  1X9S A;  3HD2 A;  2C2N A;  2PSZ A;  4RW7 B;  2G9O A;  3OFG A;  2IRX A;  2H48 B;  2RRB A;  4DUY F;  1JXV A;  4C48 A;  2VH7 A;  3LP0 B;  3FSI A;  4KGV B;  2HS3 A;  3CC4 S;  1GK8 A;  3GII A;  1QDU B;  3NGD A;  3OXF A;  4PCQ A;  3D1Q A;  2QL5 B;  3S6E A;  1S0M A;  3EPG A;  4NPO A;  4YFU A;  2CFX A;  4HAC A;  2HYI B;  1LWF A;  1VFJ A;  2F63 A;  1IR0 A;  1B3T A;  1RT4 A;  3J7A N;  2GO9 A;  1REV B;  2K8G A;  2CJX B;  3ICL A;  2PEB A;  3LOU A;  2MDA A;  3D28 A;  3LAM A;  2V8H A;  2ZZT A;  3O44 A;  3R5C A;  4KFB B;  2ASY A;  2W4D A;  1F60 B;  2LQ8 A;  3ILJ A;  2Y0S D;  1HYS B;  1PIE A;  2E29 A;  3R8Y A;  3MHY A;  4DL6 A;  4U9R A;  3C2P A;  3GQC A;  5CYJ A;  1FJC A;  3MPY A;  4IH7 A;  1DQ8 A;  3BDE A;  3TAM A;  5D0R A;  2Q3P A;  1S1T A;  3KLG A;  2HVE A;  4EI2 A;  2HSE B;  2HEK A;  2CPH A;  2WBR A;  4I2P A;  2KYZ A;  3IP0 A;  4MKV A;  4ES2 A;  3KMS A;  2CDR B;  2HNZ A;  1H0H B;  3M05 A;  1KLM B;  3ZNU A;  4Q0B B;  1PYS B;  1CS4 B;  3CDB A;  1QM9 A;  1Y3J A;  3TWZ A;  3QIP A;  4RW9 A;  1U1L A;  2MKJ A;  5F41 A;  1RZM A;  4DPU A;  5J2M A;  2Y0B B;  2AGO A;  2ACY A;  1S49 A;  4OZL A;  4NCB A;  3M8R A;  2QE5 A;  3H5S A;  1EP4 A;  2BX6 A;  2MLZ A;  2KXN B;  3IC1 A;  5E7O B;  4DR2 J;  3A1Y G;  4LSN A;  1WG4 A;  3J7Y I;  2W7O A;  4N5S A;  3MM5 B;  2M2B A;  4BC7 A;  2I0X A;  4BHQ A;  3QJL A;  1TKZ B;  5E3R A;  1DRZ A;  1RIS A;  2OKQ A;  5B0E A;  4P75 A;  4CO4 A;  2FPH X;  2YWW A;  4FF1 A;  1JLE A;  2CJB A;  2AEJ A;  2LU2 A;  1T95 A;  3V4I A;  1KLN A;  4M5J A;  3G4S S;  1SIW B;  2CQH A;  1WNE A;  2A18 A;  1A6L A;  4ZVP B;  2GGP B;  3GG1 A;  4NZ6 A;  2K06 A;  5HL7 Q;  1PC4 A;  3MM8 A;  1GMW D;  2D9O A;  1JLC A;  2DNL A;  4KKO B;  3H4B A;  4C3K A;  4BC9 A;  4DV2 J;  3K5P A;  3FSY A;  4DSF A;  3CE8 A;  4CLP A;  2CQB A;  1N36 F;  1BUX A;  1RAD B;  1X60 A;  4RR5 A;  5HMZ A;  2BKO A;  2XWX A;  2AYG A;  2QTW A;  1NJX A;  2JEI A;  3TVK A;  2ZOF A;  1RAE B;  1B0V A;  2CRL A;  3GIK A;  1U8S A;  5KG7 A;  1WC3 A;  1CPZ A;  2VKZ G;  2R7Q A;  4Y2K A;  4NYZ A;  4F36 A;  3MEG A;  2AJ0 A;  3IO1 A;  5DQG A;  4JI6 F;  2XUL A;  3AOD A;  3R7S B;  4F0K A;  2ZHO A;  4GO5 X;  2CPE A;  2KT3 A;  4ELV A;  5A8K A;  4EFA C;  2IBK A;  5I3Q A;  1V3S A;  2YH0 A;  1L5U A;  4ICL B;  3AOC A;  1M5S A;  3HKZ D;  1WOP A;  2RSQ A;  2C1E B;  2XSJ B;  4LVO P;  1WF2 A;  1RTI B;  5ETP A;  3HJV A;  3TX0 A;  4YME A;  2IC3 B;  1WF0 A;  5IFM A;  2AJ1 A;  3CDU A;  3WHI A;  3DNC A;  3QT8 A;  2AYE A;  2DIV A;  3M8S A;  3GPA A;  3NOG A;  4AXI A;  2HMI A;  2NXJ A;  1T03 B;  2UUA J;  4I6A A;  2VD3 A;  1NCL A;  2XMW A;  4F3O A;  3NY0 A;  2UV8 A;  1HMV B;  2E1M C;  2UUC J;  3W2V B;  4P9S A;  2ZBC A;  4P7V A;  1YKW A;  2CJK A;  4DR6 J;  1JNR B;  2UU9 J;  5FJ4 A;  1X4B A;  1OWX A;  3D4J A;  4OX9 F;  2FZG B;  2CQ2 A;  5T41 A;  2RUG A;  4NCG A;  4KH0 B;  4NLP A;  3DXB A;  4U8Y A;  3W62 A;  3AB2 B;  1ZA2 B;  4OQJ A;  4ZPW R;  1BD6 A;  2GX8 A;  3HLU A;  5KFP A;  4RW4 B;  4CLF A;  3EXC X;  3CJ8 A;  1UET A;  4DR4 F;  1HBO A;  1FJG F;  4DCP B;  4ZVF A;  4YOE A;  1MRO B;  3ISZ A;  2KRB A;  4H54 A;  2CPI A;  2QLW A;  5EUH A;  3UWT A;  2HVI A;  1NO8 A;  2XYG B;  5G0R A;  1RCX B;  3AQO A;  4DR3 J;  1SL0 A;  4P2F A;  4OZ1 A;  4EWT A;  3D6T B;  1Z1Z A;  5LOQ A;  4CTA B;  1M5V C;  5FDL A;  4OHZ A;  5C42 A;  2N4C A;  3LGN A;  4IO9 Q;  4HAC B;  1LWF B;  1OJ4 A;  1FRM A;  3D0G E;  4DFP A;  2NZC A;  3O3L A;  3DDI A;  2C28 A;  1RT4 B;  3R9L A;  4R5P A;  2FJX A;  4MT1 A;  2JSX A;  3OPK A;  2P9E A;  2UV8 G;  2DGT A;  1CC8 A;  3KKF A;  2BKP A;  3FKB A;  3RW6 A;  1TQL A;  3MEK A;  4ETX A;  3H59 A;  1YQH A;  4CLK A;  3OXG A;  2GIR A;  1FRH A;  5H9E K;  3MTJ A;  3BGL A;  1TL5 A;  2Z2Z A;  2PD1 A;  2NUH A;  2JWN A;  3JTN A;  1U0H A;  3W2W A;  2K2P A;  3P8B B;  4LSZ B;  3HXM A;  3TAM B;  1KWM A;  3MFH A;  3CJ5 A;  4ECS A;  1S1T B;  3KLG B;  5KG5 A;  2GS8 A;  3U02 A;  2NSB A;  4FYD A;  4I2P B;  3UDC A;  2X1A A;  4G65 A;  1ZYQ A;  5AE1 A;  4JI3 F;  2YQ0 A;  5KFR A;  2NXU A;  3EGZ A;  5DG8 A;  3MPW A;  3ZFV A;  3A8J A;  4RW9 B;  1QTM A;  2OAU A;  5B09 A;  4LF8 J;  1KFD A;  1IWG A;  2JC1 A;  2RUS A;  3RRG A;  4LFC J;  4K59 A;  1EP4 B;  2HUR A;  1E6Y A;  3J80 Y;  1GTE A;  2PDA A;  3IXQ A;  2GIQ A;  1LKZ A;  3OTD A;  4ZPA A;  1Y3K A;  1TL7 A;  4LSN B;  4K4S A;  3JQM A;  5KG4 A;  2UXC J;  3BGF A;  2FJA B;  4Y2M A;  3PR5 B;  1QAJ A;  2PI4 A;  5E41 A;  2XMV A;  4Q2L A;  1YBU A;  4QIV A;  2MKK A;  5A6W A;  5IT0 A;  3OR1 B;  2ZNY A;  2UXB F;  2B8P A;  5RUB A;  3I6P A;  1U24 A;  4GVB B;  4DZ6 A;  1LFW A;  2XG8 A;  1N88 A;  2EK1 A;  3S01 A;  3SQO P;  3A8K A;  1JXL A;  3CD5 A;  5KFG A;  3ENA A;  3V4I B;  2DNO A;  6FDR A;  2QYC A;  4DSI A;  4JUZ A;  1LXN A;  2ZJP Q;  2DIS A;  1MMD A;  1YG0 A;  4OHW A;  2V4R A;  3EGV A;  2KM8 B;  3E2E A;  1NK6 A;  3DI6 B;  4LVN P;  2CAJ A;  4YDX A;  1VQS A;  3KDN A;  2PT0 A;  4DV6 J;  2RQ4 A;  2FDN A;  2YBV A;  3MM8 B;  2AJ2 A;  1OO0 B;  1JJ4 A;  1JLC B;  2FHK A;  2BQ3 A;  3R97 A;  3GSD A;  5KAK A;  2HBR B;  3QNW B;  4L74 A;  1V5I B;  4GMK A;  3VVU A;  1RP5 A;  3M4X A;  1NK8 A;  5AXN A;  2N7C A;  1XJW B;  3FMW A;  1S12 A;  2YNI A;  3KG1 A;  4URG A;  1OPZ A;  1RSC A;  1KON A;  1RKJ A;  4PXB A;  4PWD A;  1FRI A;  1WEX A;  5HP1 B;  2D3O R;  3BQ1 A;  4CLL A;  3P6Y C;  1KS2 A;  1Y5L B;  1AT1 B;  3GMG A;  2NLW A;  4RNH A;  2OUG A;  4IRK A;  2VG5 A;  1I94 J;  3DOL A;  3R7N B;  3HFV A;  3IM9 A;  3TAR A;  5HVG A;  5KFH A;  2VFT A;  2CNL B;  4BWM A;  4WU2 A;  2R8H A;  4YB5 A;  1VI7 A;  2NXC A;  4N7T A;  3PV8 A;  3DRY A;  1T94 A;  1V6H A;  4QWD A;  4PPD A;  4UY8 T;  5DLG A;  2M88 A;  3TUJ C;  4NLQ A;  4NL5 A;  2HMI B;  3ONQ A;  1JJH A;  2DH9 A;  5HAN A;  3QJP A;  4YB6 A;  3IS9 A;  4P73 A;  2BRL A;  3Q24 A;  1FF2 A;  1U0S A;  2HKE A;  1Q16 B;  1NDL A;  4PYA A;  5FII A;  3PM9 A;  4ANC A;  2AMC B;  3MR5 A;  4ELU A;  4I2Q A;  3A8I A;  1HBU B;  2K7K A;  2ILY A;  4YS2 A;  5A2Q Y;  2DR6 A;  3MEE A;  4NCG B;  1TAU A;  1SPB P;  4DX8 H;  3GON A;  1VQ9 S;  4QYZ K;  3NAH A;  4KHM A;  2D74 B;  4NAS A;  2OFH X;  2QL7 B;  2HLU A;  3Q8Q B;  4AE5 A;  1HBO B;  3GIR A;  3LP1 A;  2R2S A;  3BSC A;  3C6T A;  5DDP C;  3VV2 B;  1HWJ A;  2HND B;  1TL3 A;  1S9G A;  4DPW A;  4HKQ A;  2DVI A;  5G0R B;  1PIL A;  2J9E A;  4YY3 F;  1VC5 A;  3M8P A;  1AUD A;  1R8H A;  1UPP A;  5FDL B;  1H2T Z;  4DX7 A;  1ITP A;  5C42 B;  3UDV A;  2AX0 A;  2RVJ A;  1IBM J;  1B64 A;  5KFY A;  2V9W A;  1D9F A;  2ATC B;  3NBP B;  5HJY A;  3KUE A;  2RS8 A;  5A6P A;  2DHX A;  4DV0 J;  3BDP A;  4TYA A;  2PE8 A;  3MTK A;  3M2U A;  3TP2 A;  1R8C A;  4R5P B;  1HNW J;  1BMQ B;  4AXJ A;  1NND A;  2PI5 A;  4J91 A;  5B0D A;  5IC4 B;  4K2X A;  1GMW A;  2QGF B;  4J9V A;  2CPJ A;  3GU0 A;  2XMM A;  1S0N A;  4C3L A;  5CYM A;  2ZWP A;  3BO4 A;  4JI8 J;  2O5D A;  5J2Q B;  5CD4 H;  4QQB A;  3NNA A;  4ZIW A;  2R8K A;  4FN5 A;  3FGV A;  2AZ1 A;  1U0H B;  4IRC A;  3W2W B;  3NEK A;  3K7R A;  4B3T J;  2XZW A;  4QIG A;  1XNQ F;  1RT6 A;  1HD0 A;  1DFD A;  4ED3 A;  3JSM A;  3IGV A;  2NCK L;  5F0U A;  4MKA A;  8ATC B;  4QIE A;  3HSJ A;  4A8O A;  4I64 A;  4LRA A;  2BJ9 A;  1Q79 A;  2FB0 A;  5EX3 A;  4ED4 A;  4LF9 J;  1U09 A;  4WII A;  3Q89 A;  2D1C A;  1XEZ A;  2RDJ A;  2AU0 A;  3GZ7 A;  1WKJ A;  1WAC A;  3ELH A;  3KMQ A;  1X4H A;  3AJD A;  2RJZ A;  2UZA A;  3C19 A;  2V2K A;  2B9E A;  2BQU A;  1SC4 B;  1C1B B;  2UVU A;  2OMO A;  3N79 A;  1E6Y B;  3TR5 A;  3DRS A;  3DOM A;  1FWP A;  2CJY B;  1HI1 A;  1N5S A;  3KDO A;  1M0S A;  2CA9 A;  1NHV A;  4PG5 A;  1TV6 A;  3CCQ S;  5LM7 E;  7FDR A;  5DGA A;  2KJV A;  5ETS A;  3Q8P B;  2DHG A;  3SXL A;  4U8V A;  2LCW A;  3E01 A;  3FEY B;  1U1M A;  1U45 A;  3GB0 A;  5L1K A;  1FFS B;  1RWU A;  2R7S A;  3U1N A;  1H73 A;  2QLJ B;  4B3R J;  1IJF B;  4WP3 A;  2CVI A;  1HWU A;  3A8E A;  5U47 A;  4JI7 F;  4DR5 F;  4LJM A;  1F9H A;  4WK1 A;  2R8J A;  1IM4 A;  1OYE A;  4HR2 A;  2IYG A;  1PYT A;  3CIZ A;  1K0T A;  5K8P A;  5D0E A;  3ZZZ A;  4N41 A;  4EMD A;  3UO0 A;  3KNG A;  1GMU A;  1B4S A;  2DRB A;  5HI7 A;  1HHS A;  1ZM9 A;  3QAT A;  4DUY J;  2LDI A;  2MY8 A;  5C7P A;  4ECU A;  2HW3 A;  1UZH A;  2QG9 B;  4N77 A;  3J81 j;  3EJM A;  3I5B A;  4ZPT R;  2RU3 A;  1J27 A;  3PO5 A;  4B9U A;  4EBE A;  2DRA A;  2QMX A;  2YNI B;  1DY3 A;  4NLD A;  4FF4 A;  2FJD B;  3BO3 A;  3MM7 B;  4ZVE A;  4DWI A;  4ZVT B;  1J2V A;  2DD8 S;  5GAD I;  4MYT A;  4DUT A;  3VR1 A;  3HF5 A;  5EDW A;  2J6U A;  5KFJ A;  1BY9 A;  2WHO A;  5ETT A;  2D69 A;  4NLR A;  3OJU A;  2PFF B;  1S1V A;  1S77 D;  3ZZY A;  2CQC A;  2JDJ A;  5IV4 A;  1RWM B;  3BSA A;  4F02 A;  2VG5 B;  1N6Q B;  1FXL A;  1W7W A;  1Y4Z B;  3IR6 B;  3PYE A;  2QFJ A;  2MEW A;  1WG5 A;  4F4Y A;  3ETM A;  2MKI A;  1SI9 A;  1LWC A;  3CJK A;  4AQY F;  1Y7P A;  2XM3 A;  4GRS A;  5C24 A;  4DV1 J;  5KTQ A;  2UXD J;  1N0V C;  4NLX A;  2QO3 A;  4IQX A;  1AXQ A;  4PWU A;  1ZZN A;  5CYQ B;  3VAL A;  4ZIV A;  1TKX B;  3B4M A;  4I2Q B;  2BXJ A;  2JL9 A;  4MTP A;  5AXM A;  1G7C B;  1WTF A;  4X4N A;  1GH8 A;  1KHW A;  1Q1K A;  3MEE B;  5J1P A;  1VR6 A;  3LWL A;  5LJ3 Y;  2ZD1 A;  1QAI A;  3PEJ A;  5GAG I;  3SV3 A;  4D3G A;  2FLN A;  4P2S A;  2HWI A;  4HHJ A;  1F2H A;  4M5D A;  1MW7 A;  5HSP A;  5IV3 A;  2R7W A;  5IT4 A;  4FVM A;  2G2Y A;  3QLH A;  4QWB A;  1WEZ A;  4WZM A;  3I4H X;  4B02 A;  4OZ5 A;  4WTO B;  4C0B A;  3LP1 B;  5A8R A;  2FVS A;  1T9V A;  2YVS A;  4I6W A;  4C8O A;  3CNQ P;  3T9Z A;  3OVS A;  2OPP A;  1TL3 B;  1S9G B;  1HNI A;  2GAG C;  2YWF A;  3US5 A;  4OZJ A;  3FBF A;  3M8P B;  1DUR A;  5F3Z A;  5LL6 d;  4DX5 A;  3T5L A;  4OX6 A;  4M1K A;  1NUE A;  3CC2 S;  1RTH A;  1DAX A;  2LEC A;  3DLJ A;  4JOU A;  3BN7 A;  5B0C A;  3TA2 A;  3MR6 A;  4M5K A;  3KXD A;  4A8X A;  2PGC A;  2ZUA A;  1BWV A;  1BGX T;  2H4W B;  4JYA F;  2JFD A;  3SCJ E;  3B78 A;  1FRJ A;  2GNK A;  1T8E A;  1JLB A;  2YWK A;  4CDI A;  4JV1 A;  1K47 A;  2BM0 A;  2ZDP A;  4ZLJ A;  4ZPC A;  3PX0 A;  3MCS A;  4P2X A;  4DQR A;  4I4B A;  2RNE A;  5CYM B;  4ZHR A;  5E2Q A;  3FZ2 A;  2W9B A;  2EG1 A;  2CPD A;  5KFD A;  5MAO A;  4NI2 A;  3AHP A;  4NLS A;  3CJ3 A;  3JQK A;  4I68 A;  4OJH A;  2BQR A;  3I87 A;  3FC9 A;  3GIM A;  1RT6 B;  4IOB A;  1FNX H;  1IXK A;  1FK9 B;  3FQK A;  5HMX A;  2X1B A;  3JSM B;  4CRJ A;  2HQF A;  2YKA A;  3L7O A;  2WVC A;  2JH3 A;  1KFS A;  5CQG A;  2QMU B;  4JI6 J;  2H65 B;  4ZVH A;  1D0E A;  3GFZ A;  5D4O A;  2F40 A;  3KOA A;  5D3G A;  1XR7 A;  3ET6 A;  3A3O B;  4C3M A;  2MQP A;  4DF8 A;  1O8B A;  4XDD A;  2XNR A;  1UW4 A;  2JZ5 A;  2DB1 A;  4NLO A;  5GAH I;  1CUL A;  3WBZ A;  1Q8B A;  3FJ2 A;  3SYZ A;  2NR0 A;  1I1G A;  1ZPW X;  2CWX A;  5LSO A;  2C42 A;  2DGU A;  2VDI A;  3QWU A;  3UN3 A;  3JSY A;  3DRS B;  3DOM B;  2KB2 A;  2ZHA A;  3L9Z A;  2EK6 A;  1WJ9 A;  4ID5 A;  4MKY A;  3MEC A;  3T9N A;  2C2R A;  3N6M A;  5DDR C;  4N76 A;  3OBI A;  2IJF A;  4A8K A;  4O3O A;  3E01 B;  3GTY X;  1WD6 A;  2GMH A;  1GAO A;  4Q44 A;  2HFV A;  1D8Y A;  1K0V A;  3BRE A;  3R7B B;  4YHH F;  2X1G A;  2A6M A;  4G1Q A;  4OX9 J;  1PKU A;  3M8Q B;  1T9Y A;  4WF9 Q;  4GKK F;  1TR0 A;  1YJ9 S;  3KHL A;  1U49 A;  4TQR A;  3TZY A;  5L1J A;  2Q66 A;  2XZD B;  4F4A A;  2DKO B;  4RPF A;  3M9M B;  1UEV A;  1FJG J;  3KJV A;  4ZP7 A;  3D1H A;  2W7P A;  2YNG A;  3FEX B;  1N8R T;  3ZTO A;  5HQL A;  3VAG A; 
#chains in the Genus database with same CATH homology
 4O0N A;  1NSP A;  2B8P A;  2DYA A;  3DKD A;  3G2X A;  2B8Q A;  1B99 A;  1JXV A;  2DXD A;  3VGS A;  3EVM A;  5BXI A;  2DXE A;  4FKX A;  1F3F A;  2HVE A;  4DZ6 A;  3EMT A;  1LWX A;  3PRV A;  1BE4 A;  1XQI A;  2HVD A;  4DUT A;  4FKY A;  3EVW A;  2AZ1 A;  1WKK A;  3EE3 A;  3ENA A;  3NGT A;  4UOF A;  1K44 A;  4AND A;  3FCW A;  3VGT A;  5CAB A;  1NDP A;  1PAE X;  3B6B A;  2VU5 A;  3GPA A;  3PJ9 A;  1NDC A;  5IOL A;  1XIQ A;  2AZ3 A;  3EIC A;  4CP5 A;  2NCK L;  1VYA A;  4UOH A;  1W7W A;  3B54 A;  1WKL A;  3FC9 A;  1EHW A;  3FBC A;  3ZTP A;  4EK2 A;  4S0M A;  1PKU A;  3EM1 A;  1NB2 A;  1NCL A;  3FBB A;  3NGR A;  2BEF A;  2CWK A;  3BBB A;  3ETM A;  3MPD A;  3VGU A;  5CAA A;  4HR2 A;  1BUX A;  1NDK A;  3Q83 A;  2BX6 A;  1F6T A;  1S5Z A;  3BBF A;  3VVT A;  3GP9 A;  4ENO A;  1BHN A;  3DDI A;  1LEO A;  3NGS A;  3Q8U A;  3BH7 B;  3Q89 A;  3FBF A;  1NPK A;  1S59 A;  3L7U A;  3R9L A;  4DI6 A;  2DXF A;  1WKJ A;  3WX8 A;  1NDL A;  3BBC A;  3JS9 A;  1HIY A;  3ELH A;  2HUR A;  3NGU A;  3Q86 A;  1NHK L;  4ANC A;  1NSQ A;  3VVU A;  4ANE A;  1HHQ A;  2DY9 A;  4WBF A;  1B4S A;  4F4A A;  3BH6 B;  3EVO A;  3FKB A;  3Q8V A;  1NUE A;  3ZTR A;  4UOG A;  1NSK L;  3VGV A;  4C6A A;  4W98 A;  4F36 A;  1ZS6 A;  3ZTS A;  1U8W A;  5C7P A;  3Q8Y A;  3FBE A;  3ZTQ A;  4KPC A;  1MN7 A;  1KDN A;  1UCN A;  1S57 A;  3EJM A;  2ZUA A;  1NLK L;  1HLW A;  1MN9 A;  3ZTO A;  3FCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...